F490488
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1126 | 573 | 2252 | 294 |
Family's Representative Sequence
| Representative Sequence | 3300049571|Ga0501034_0032599|Ga0501034_0032599_2293_3291 |
| Length | 332 |
| Sequence | MSFIGYLKNDEKTQKILVMGGEDFAHQHKEKNMEIGFIGLGRMGANMVRRLLRDGHTVVAWNRTAAKTDEIVSEGAQGAYSIPELVEKLQTPRIVWIMVPSGQATDDMINEVTPLLSKGDIIIDGGNSNYHDSIRRSQELTAKGFQFMDAGTSGGIWGLKVGYCMMVGGEKATFEHVEPIIKSLAPPDGYLHCGPAGAGHFVKMVHNGIEYGMLQAYGEGFEILKAAKQYDLDLHAISHLWNQGSVVRSWLLELAELAFEHDADLSSIRGYVEDSGEGRWTVQQAIDTDVPAPVITLSLLERFRSRQDESFTAKVIAALRKEFGGHAVKSAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 6 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 10 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 11 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 14 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 36 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 40 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 43 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 51 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 52 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 53 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 54 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 57 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013045 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 81 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 88 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 102 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 141 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 143 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 144 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 145 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 148 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 149 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 150 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 151 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 156 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 157 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 163 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 164 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 165 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 166 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 167 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 169 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 170 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 171 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 172 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 173 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 174 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 175 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 176 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 177 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 178 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 179 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 180 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 181 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 182 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 183 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 184 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 185 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 186 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 187 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 188 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 189 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 274 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 275 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 276 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 277 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 286 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 287 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 288 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 289 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 290 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 291 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 292 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 334 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 345 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 346 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 354 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 357 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 359 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 360 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 361 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 362 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 363 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 364 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 366 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 367 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 368 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 369 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 370 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 371 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 372 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 373 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 374 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 375 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 376 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 377 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 378 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 379 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 380 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 384 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 385 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 386 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 387 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 388 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 389 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 390 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 391 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 392 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 393 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 394 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 395 | 2600255286 | Paenibacillus sp. NFR01 | Isolate | Rhizoplane |
| 396 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 397 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 398 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 399 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 400 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 401 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 402 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 403 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 404 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 405 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 406 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 407 | 2643221681 | Aeromicrobium sp. Root472D3 | Isolate | Unclassified |
| 408 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 409 | 2643221697 | Aeromicrobium sp. Root495 | Isolate | Unclassified |
| 410 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 411 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 412 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 413 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 414 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 415 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 416 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 417 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 418 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 419 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 420 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 421 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 422 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 423 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 424 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 425 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 426 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 427 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 428 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 429 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 430 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 431 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 432 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 433 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 434 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 435 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 436 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 437 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 438 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 439 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 440 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 441 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 442 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 443 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 444 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 445 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 446 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 447 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 448 | 2821111986 | Paenibacillus illinoisensis 582 | Isolate | Unclassified |
| 449 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 450 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 451 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 452 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 453 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 454 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 455 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 456 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 457 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 458 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 459 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 460 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 461 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 462 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 463 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 464 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 465 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 466 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 467 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 468 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 469 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 470 | 2885526491 | Paenibacillus sp. LK1 | Isolate | Rhizosphere |
| 471 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 472 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 473 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 474 | 2904162308 | Paenibacillus sp. AD87 | Isolate | Unclassified |
| 475 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 476 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 477 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 478 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 479 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 480 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 481 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 482 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 483 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 484 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 485 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 486 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 487 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 488 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 489 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 490 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 491 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 492 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 493 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 494 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 495 | 2939679117 | Paenibacillus sp. 4624 | Isolate | Rhizosphere |
| 496 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 497 | 2945991243 | Paenibacillus sp. B21a W2I17 | Isolate | Rhizosphere |
| 498 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 499 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 500 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 501 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 502 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 503 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 504 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 505 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 506 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 507 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 508 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 509 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 510 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 511 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 512 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 513 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 514 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 515 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 516 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 517 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 518 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 519 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 520 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 521 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 522 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 523 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 524 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 525 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 526 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 527 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 528 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 529 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 530 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 531 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 532 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 533 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 534 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 535 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 536 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 537 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 538 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 539 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 540 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 541 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 542 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 543 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 544 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 545 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 546 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 547 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 548 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 549 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 550 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 551 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 552 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 553 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 554 | 8022948649 | Bacillus endophyticus FH5 | Isolate | Rhizosphere |
| 555 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 556 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 557 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 558 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 559 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 560 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 561 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 562 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 563 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 564 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 565 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 566 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 567 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 568 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
| 569 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 570 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 571 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 572 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 573 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.27 |
| Metatranscriptomes | 4.53 |
| Isolates | 22.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 8.17 |
| Nodule | 0.53 |
| Rhizoplane | 3.73 |
| Rhizosphere | 70.43 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501034_0032599 | 3300049571 | Bacteria | 5290 |
| 2 | JGI24737J22298_10003012 | 3300001990 | Bacteria | 5973 |
| 3 | JGI24737J22298_10019642 | 3300001990 | Bacteria | 2160 |
| 4 | JGI24737J22298_10055047 | 3300001990 | Bacteria | 1203 |
| 5 | JGI24735J21928_10014360 | 3300002067 | Bacteria | 2481 |
| 6 | JGI24738J21930_10002471 | 3300002075 | Bacteria | 4829 |
| 7 | JGI24738J21930_10005279 | 3300002075 | Bacteria | 3113 |
| 8 | JGI25159J45721_1002931 | 3300002987 | Bacteria | 6218 |
| 9 | JGI25151J46595_10000677 | 3300003187 | Bacteria | 28790 |
| 10 | JGI25151J46595_10002436 | 3300003187 | Bacteria | 11202 |
| 11 | JGI25151J46595_10012375 | 3300003187 | Bacteria | 3884 |
| 12 | JGI25151J46595_10018506 | 3300003187 | Bacteria | 2988 |
| 13 | JGI25151J46595_10056874 | 3300003187 | Bacteria | 1279 |
| 14 | rootL2_10101561 | 3300003322 | Bacteria | 6556 |
| 15 | rootL2_10187682 | 3300003322 | Bacteria | 2610 |
| 16 | JGI25160J50197_1026048 | 3300003354 | Bacteria | 1620 |
| 17 | JGI25407J50210_10002819 | 3300003373 | Bacteria | 4137 |
| 18 | Ga0006562J51391_1003739 | 3300003578 | Bacteria | 3570 |
| 19 | Ga0006562J51391_1012963 | 3300003578 | Bacteria | 2301 |
| 20 | Ga0006562J51391_1030540 | 3300003578 | Bacteria | 1518 |
| 21 | Ga0006562J51391_1059892 | 3300003578 | Bacteria | 3240 |
| 22 | Ga0055532_1000299 | 3300003758 | Bacteria | 30597 |
| 23 | Ga0055532_1002253 | 3300003758 | Bacteria | 4207 |
| 24 | Ga0055532_1003874 | 3300003758 | Bacteria | 2408 |
| 25 | Ga0055528_1001788 | 3300003790 | Bacteria | 12329 |
| 26 | Ga0055541_1000172 | 3300003841 | Bacteria | 30235 |
| 27 | Ga0055541_1002886 | 3300003841 | Bacteria | 3324 |
| 28 | Ga0058863_10171726 | 3300004799 | Bacteria | 2081 |
| 29 | Ga0058862_10045293 | 3300004803 | Bacteria | 2421 |
| 30 | Ga0070670_100270830 | 3300005331 | Bacteria | 1482 |
| 31 | Ga0070670_100572786 | 3300005331 | Bacteria | 1009 |
| 32 | Ga0068869_100031387 | 3300005334 | Bacteria | 3737 |
| 33 | Ga0070682_100005588 | 3300005337 | Bacteria | 7007 |
| 34 | Ga0068868_100004322 | 3300005338 | Bacteria | 9954 |
| 35 | Ga0070689_100184113 | 3300005340 | Bacteria | 1698 |
| 36 | Ga0070675_100005088 | 3300005354 | Bacteria | 10030 |
| 37 | Ga0070675_100174667 | 3300005354 | Bacteria | 1854 |
| 38 | Ga0070659_100071107 | 3300005366 | Bacteria | 2766 |
| 39 | Ga0070713_100024496 | 3300005436 | Bacteria | 4702 |
| 40 | Ga0070700_100001935 | 3300005441 | Bacteria | 10483 |
| 41 | Ga0070700_100013018 | 3300005441 | Bacteria | 4666 |
| 42 | Ga0070663_100003212 | 3300005455 | Bacteria | 9390 |
| 43 | Ga0070678_100171437 | 3300005456 | Bacteria | 1768 |
| 44 | Ga0068867_100004619 | 3300005459 | Bacteria | 9689 |
| 45 | Ga0070679_100007936 | 3300005530 | Bacteria | 9963 |
| 46 | Ga0070684_100022768 | 3300005535 | Bacteria | 5231 |
| 47 | Ga0068853_100022563 | 3300005539 | Bacteria | 5258 |
| 48 | Ga0068853_100045234 | 3300005539 | Bacteria | 3770 |
| 49 | Ga0068853_100063647 | 3300005539 | Bacteria | 3195 |
| 50 | Ga0070672_100138686 | 3300005543 | Bacteria | 2004 |
| 51 | Ga0070696_100242147 | 3300005546 | Bacteria | 1361 |
| 52 | Ga0070664_100028469 | 3300005564 | Bacteria | 4647 |
| 53 | Ga0070664_100272784 | 3300005564 | Bacteria | 1524 |
| 54 | Ga0068857_100003449 | 3300005577 | Bacteria | 13186 |
| 55 | Ga0068857_100090466 | 3300005577 | Bacteria | 2739 |
| 56 | Ga0068856_100263614 | 3300005614 | Bacteria | 1739 |
| 57 | Ga0070702_100012209 | 3300005615 | Bacteria | 4297 |
| 58 | Ga0070702_100086946 | 3300005615 | Bacteria | 1887 |
| 59 | Ga0068852_100002664 | 3300005616 | Bacteria | 12345 |
| 60 | Ga0068859_100392252 | 3300005617 | Bacteria | 1484 |
| 61 | Ga0068861_100020787 | 3300005719 | Bacteria | 4707 |
| 62 | Ga0068861_100039601 | 3300005719 | Bacteria | 3519 |
| 63 | Ga0068870_10001343 | 3300005840 | Bacteria | 9920 |
| 64 | Ga0068858_100386323 | 3300005842 | Bacteria | 1344 |
| 65 | Ga0081455_10001942 | 3300005937 | Bacteria | 24845 |
| 66 | Ga0081455_10011475 | 3300005937 | Bacteria | 8902 |
| 67 | Ga0081455_10023202 | 3300005937 | Bacteria | 5778 |
| 68 | Ga0081538_10001831 | 3300005981 | Bacteria | 21425 |
| 69 | Ga0075365_10030881 | 3300006038 | Bacteria | 3435 |
| 70 | Ga0075365_10043595 | 3300006038 | Bacteria | 2937 |
| 71 | Ga0075368_10020319 | 3300006042 | Bacteria | 2514 |
| 72 | Ga0075363_100074953 | 3300006048 | Bacteria | 1843 |
| 73 | Ga0070715_10027329 | 3300006163 | Bacteria | 2279 |
| 74 | Ga0075367_10001303 | 3300006178 | Bacteria | 10576 |
| 75 | Ga0075370_10015300 | 3300006353 | Bacteria | 4104 |
| 76 | Ga0075428_100020122 | 3300006844 | Bacteria | 7390 |
| 77 | Ga0075428_100616939 | 3300006844 | Bacteria | 1158 |
| 78 | Ga0075430_100005085 | 3300006846 | Bacteria | 11074 |
| 79 | Ga0075431_100014862 | 3300006847 | Bacteria | 7881 |
| 80 | Ga0075433_10098527 | 3300006852 | Bacteria | 2588 |
| 81 | Ga0075429_100000903 | 3300006880 | Bacteria | 23469 |
| 82 | Ga0075429_100374255 | 3300006880 | Bacteria | 1247 |
| 83 | Ga0097620_100392294 | 3300006931 | Bacteria | 1484 |
| 84 | Ga0099826_10028077 | 3300006948 | Bacteria | 4124 |
| 85 | Ga0105251_10007962 | 3300009011 | Bacteria | 6434 |
| 86 | Ga0105251_10012044 | 3300009011 | Bacteria | 4908 |
| 87 | Ga0105251_10020194 | 3300009011 | Bacteria | 3504 |
| 88 | Ga0105251_10035894 | 3300009011 | Bacteria | 2443 |
| 89 | Ga0105251_10040437 | 3300009011 | Bacteria | 2273 |
| 90 | Ga0105244_10077792 | 3300009036 | Bacteria | 1645 |
| 91 | Ga0105250_10002799 | 3300009092 | Bacteria | 8556 |
| 92 | Ga0105250_10002980 | 3300009092 | Bacteria | 8221 |
| 93 | Ga0111539_10013281 | 3300009094 | Bacteria | 10292 |
| 94 | Ga0111539_10166515 | 3300009094 | Bacteria | 2577 |
| 95 | Ga0111539_10251718 | 3300009094 | Bacteria | 2057 |
| 96 | Ga0105245_10001147 | 3300009098 | Bacteria | 23949 |
| 97 | Ga0105245_10311999 | 3300009098 | Bacteria | 1547 |
| 98 | Ga0105247_10241994 | 3300009101 | Bacteria | 1230 |
| 99 | Ga0114129_10015252 | 3300009147 | Bacteria | 10936 |
| 100 | Ga0105243_10023928 | 3300009148 | Bacteria | 4654 |
| 101 | Ga0105243_10025967 | 3300009148 | Bacteria | 4482 |
| 102 | Ga0105243_10071900 | 3300009148 | Bacteria | 2798 |
| 103 | Ga0105243_10188957 | 3300009148 | Bacteria | 1798 |
| 104 | Ga0105242_10005109 | 3300009176 | Bacteria | 10121 |
| 105 | Ga0105248_10028922 | 3300009177 | Bacteria | 6178 |
| 106 | Ga0105238_10033334 | 3300009551 | Bacteria | 5243 |
| 107 | Ga0105238_10147446 | 3300009551 | Bacteria | 2329 |
| 108 | Ga0105249_10350571 | 3300009553 | Bacteria | 1495 |
| 109 | Ga0105249_10518614 | 3300009553 | Bacteria | 1239 |
| 110 | Ga0105239_10719844 | 3300010375 | Bacteria | 1142 |
| 111 | Ga0105246_10001109 | 3300011119 | Bacteria | 15648 |
| 112 | Ga0105246_10002420 | 3300011119 | Bacteria | 11263 |
| 113 | Ga0105246_10040795 | 3300011119 | Bacteria | 3135 |
| 114 | Ga0154016_135814 | 3300013045 | Bacteria | 2105 |
| 115 | Ga0157369_10030985 | 3300013105 | Bacteria | 5894 |
| 116 | Ga0157374_10163606 | 3300013296 | Bacteria | 2168 |
| 117 | Ga0157374_10191460 | 3300013296 | Bacteria | 2001 |
| 118 | Ga0157378_10022811 | 3300013297 | Bacteria | 5510 |
| 119 | Ga0157372_10044612 | 3300013307 | Bacteria | 4914 |
| 120 | Ga0157372_10319350 | 3300013307 | Bacteria | 1808 |
| 121 | Ga0157375_10133866 | 3300013308 | Bacteria | 2600 |
| 122 | Ga0157380_10018782 | 3300014326 | Bacteria | 5140 |
| 123 | Ga0182008_10000554 | 3300014497 | Bacteria | 27720 |
| 124 | Ga0182008_10002136 | 3300014497 | Bacteria | 12605 |
| 125 | Ga0157377_10005002 | 3300014745 | Bacteria | 6183 |
| 126 | Ga0182007_10000292 | 3300015262 | Bacteria | 32543 |
| 127 | Ga0182007_10001633 | 3300015262 | Bacteria | 11886 |
| 128 | Ga0182005_1023082 | 3300015265 | Bacteria | 1703 |
| 129 | Ga0182005_1032444 | 3300015265 | Bacteria | 1421 |
| 130 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 131 | Ga0183367_1008 | 3300015688 | Bacteria | 490626 |
| 132 | Ga0163161_10057586 | 3300017792 | Bacteria | 2823 |
| 133 | Ga0197907_10313398 | 3300020069 | Bacteria | 2437 |
| 134 | Ga0197907_10644589 | 3300020069 | Bacteria | 1810 |
| 135 | Ga0197907_10718981 | 3300020069 | Bacteria | 1630 |
| 136 | Ga0197907_10823686 | 3300020069 | Bacteria | 2127 |
| 137 | Ga0206356_11092319 | 3300020070 | Bacteria | 1777 |
| 138 | Ga0206356_11480975 | 3300020070 | Bacteria | 2121 |
| 139 | Ga0206349_1005955 | 3300020075 | Bacteria | 1877 |
| 140 | Ga0206349_1324702 | 3300020075 | Bacteria | 1877 |
| 141 | Ga0206349_1750765 | 3300020075 | Bacteria | 1594 |
| 142 | Ga0206355_1079660 | 3300020076 | Bacteria | 1377 |
| 143 | Ga0206355_1188050 | 3300020076 | Bacteria | 2667 |
| 144 | Ga0206355_1194676 | 3300020076 | Bacteria | 2607 |
| 145 | Ga0206355_1258842 | 3300020076 | Bacteria | 2169 |
| 146 | Ga0206351_10182587 | 3300020077 | Bacteria | 1141 |
| 147 | Ga0206351_10437743 | 3300020077 | Bacteria | 5150 |
| 148 | Ga0206352_10587434 | 3300020078 | Bacteria | 1129 |
| 149 | Ga0206350_10495155 | 3300020080 | Bacteria | 5705 |
| 150 | Ga0206350_10725204 | 3300020080 | Bacteria | 3185 |
| 151 | Ga0206350_10977944 | 3300020080 | Bacteria | 4278 |
| 152 | Ga0206350_11345746 | 3300020080 | Bacteria | 1150 |
| 153 | Ga0206354_10972849 | 3300020081 | Bacteria | 2929 |
| 154 | Ga0206354_11693194 | 3300020081 | Bacteria | 1457 |
| 155 | Ga0206353_10495354 | 3300020082 | Bacteria | 3823 |
| 156 | Ga0154015_1524369 | 3300020610 | Bacteria | 1104 |
| 157 | Ga0154015_1638209 | 3300020610 | Bacteria | 5110 |
| 158 | Ga0224712_10005887 | 3300022467 | Bacteria | 3455 |
| 159 | Ga0224712_10009437 | 3300022467 | Bacteria | 2941 |
| 160 | Ga0224712_10155751 | 3300022467 | Bacteria | 1016 |
| 161 | Ga0209566_100135 | 3300025225 | Bacteria | 91038 |
| 162 | Ga0209566_100335 | 3300025225 | Bacteria | 41595 |
| 163 | Ga0209566_101250 | 3300025225 | Bacteria | 8632 |
| 164 | Ga0209147_100082 | 3300025229 | Bacteria | 194153 |
| 165 | Ga0209147_100185 | 3300025229 | Bacteria | 74400 |
| 166 | Ga0209147_101758 | 3300025229 | Bacteria | 6938 |
| 167 | Ga0209147_102078 | 3300025229 | Bacteria | 5644 |
| 168 | Ga0209147_102386 | 3300025229 | Bacteria | 4727 |
| 169 | Ga0209437_100632 | 3300025233 | Bacteria | 20772 |
| 170 | Ga0209258_102135 | 3300025242 | Bacteria | 5512 |
| 171 | Ga0209673_1010173 | 3300025273 | Bacteria | 3992 |
| 172 | Ga0209130_1000330 | 3300025284 | Bacteria | 54419 |
| 173 | Ga0209130_1001162 | 3300025284 | Bacteria | 19005 |
| 174 | Ga0209675_1025766 | 3300025291 | Bacteria | 1476 |
| 175 | Ga0209676_1001704 | 3300025292 | Bacteria | 19032 |
| 176 | Ga0209025_1000266 | 3300025294 | Bacteria | 122782 |
| 177 | Ga0209025_1000368 | 3300025294 | Bacteria | 95103 |
| 178 | Ga0209025_1000989 | 3300025294 | Bacteria | 42204 |
| 179 | Ga0209025_1001769 | 3300025294 | Bacteria | 25768 |
| 180 | Ga0209025_1002363 | 3300025294 | Bacteria | 20227 |
| 181 | Ga0209025_1003354 | 3300025294 | Bacteria | 15352 |
| 182 | Ga0209025_1003422 | 3300025294 | Bacteria | 15054 |
| 183 | Ga0209025_1003732 | 3300025294 | Bacteria | 13972 |
| 184 | Ga0209025_1004361 | 3300025294 | Bacteria | 12337 |
| 185 | Ga0209025_1004544 | 3300025294 | Bacteria | 11960 |
| 186 | Ga0209025_1004948 | 3300025294 | Bacteria | 11182 |
| 187 | Ga0209025_1005588 | 3300025294 | Bacteria | 10173 |
| 188 | Ga0209025_1009588 | 3300025294 | Bacteria | 6718 |
| 189 | Ga0209025_1015545 | 3300025294 | Bacteria | 4577 |
| 190 | Ga0209025_1015768 | 3300025294 | Bacteria | 4522 |
| 191 | Ga0209025_1021819 | 3300025294 | Bacteria | 3425 |
| 192 | Ga0209025_1033461 | 3300025294 | Bacteria | 2374 |
| 193 | Ga0207426_1000938 | 3300025302 | Bacteria | 28962 |
| 194 | Ga0207426_1004261 | 3300025302 | Bacteria | 7096 |
| 195 | Ga0207426_1009876 | 3300025302 | Bacteria | 3741 |
| 196 | Ga0207426_1023854 | 3300025302 | Bacteria | 2083 |
| 197 | Ga0207697_10031484 | 3300025315 | Bacteria | 2170 |
| 198 | Ga0207696_1004024 | 3300025711 | Bacteria | 6454 |
| 199 | Ga0207696_1004115 | 3300025711 | Bacteria | 6365 |
| 200 | Ga0207696_1010827 | 3300025711 | Bacteria | 3323 |
| 201 | Ga0207696_1021441 | 3300025711 | Bacteria | 2069 |
| 202 | Ga0207655_1000138 | 3300025728 | Bacteria | 140079 |
| 203 | Ga0207655_1001364 | 3300025728 | Bacteria | 22904 |
| 204 | Ga0207655_1004835 | 3300025728 | Bacteria | 9363 |
| 205 | Ga0207655_1010450 | 3300025728 | Bacteria | 5627 |
| 206 | Ga0207655_1042427 | 3300025728 | Bacteria | 1937 |
| 207 | Ga0207713_1001636 | 3300025735 | Bacteria | 17463 |
| 208 | Ga0207713_1010356 | 3300025735 | Bacteria | 5166 |
| 209 | Ga0207713_1019937 | 3300025735 | Bacteria | 3265 |
| 210 | Ga0207688_10006923 | 3300025901 | Bacteria | 6173 |
| 211 | Ga0207647_10001942 | 3300025904 | Bacteria | 15807 |
| 212 | Ga0207647_10023263 | 3300025904 | Bacteria | 4101 |
| 213 | Ga0207643_10004307 | 3300025908 | Bacteria | 7651 |
| 214 | Ga0207652_10146862 | 3300025921 | Bacteria | 2111 |
| 215 | Ga0207646_10056443 | 3300025922 | Bacteria | 3510 |
| 216 | Ga0207694_10068579 | 3300025924 | Bacteria | 2770 |
| 217 | Ga0207659_10022419 | 3300025926 | Bacteria | 4204 |
| 218 | Ga0207659_10023494 | 3300025926 | Bacteria | 4116 |
| 219 | Ga0207687_10065145 | 3300025927 | Bacteria | 2587 |
| 220 | Ga0207687_10149983 | 3300025927 | Bacteria | 1778 |
| 221 | Ga0207687_10338172 | 3300025927 | Bacteria | 1223 |
| 222 | Ga0207686_10130382 | 3300025934 | Bacteria | 1724 |
| 223 | Ga0207686_10175698 | 3300025934 | Bacteria | 1514 |
| 224 | Ga0207709_10004627 | 3300025935 | Bacteria | 7914 |
| 225 | Ga0207709_10147163 | 3300025935 | Bacteria | 1627 |
| 226 | Ga0207670_10098116 | 3300025936 | Bacteria | 2087 |
| 227 | Ga0207669_10122529 | 3300025937 | Bacteria | 1768 |
| 228 | Ga0207691_10013682 | 3300025940 | Bacteria | 7753 |
| 229 | Ga0207689_10011605 | 3300025942 | Bacteria | 7548 |
| 230 | Ga0207661_10017497 | 3300025944 | Bacteria | 5307 |
| 231 | Ga0207679_10014257 | 3300025945 | Bacteria | 5221 |
| 232 | Ga0207679_10270343 | 3300025945 | Bacteria | 1453 |
| 233 | Ga0207677_10023520 | 3300026023 | Bacteria | 3809 |
| 234 | Ga0207677_10298055 | 3300026023 | Bacteria | 1331 |
| 235 | Ga0207639_10039392 | 3300026041 | Bacteria | 3521 |
| 236 | Ga0207639_10072727 | 3300026041 | Bacteria | 2693 |
| 237 | Ga0207639_10122799 | 3300026041 | Bacteria | 2136 |
| 238 | Ga0207678_10004167 | 3300026067 | Bacteria | 12978 |
| 239 | Ga0207708_10004420 | 3300026075 | Bacteria | 10361 |
| 240 | Ga0207708_10004454 | 3300026075 | Bacteria | 10324 |
| 241 | Ga0207702_10161097 | 3300026078 | Bacteria | 2049 |
| 242 | Ga0207648_10000921 | 3300026089 | Bacteria | 33155 |
| 243 | Ga0207674_10006994 | 3300026116 | Bacteria | 13196 |
| 244 | Ga0207674_10022466 | 3300026116 | Bacteria | 6772 |
| 245 | Ga0207675_100002005 | 3300026118 | Bacteria | 20311 |
| 246 | Ga0207675_100104548 | 3300026118 | Bacteria | 2669 |
| 247 | Ga0207683_10161594 | 3300026121 | Bacteria | 2025 |
| 248 | Ga0209371_1006068 | 3300027312 | Bacteria | 4591 |
| 249 | Ga0209371_1022153 | 3300027312 | Bacteria | 1524 |
| 250 | Ga0209813_10002419 | 3300027866 | Bacteria | 4272 |
| 251 | Ga0207428_10110983 | 3300027907 | Bacteria | 2111 |
| 252 | Ga0207428_10287618 | 3300027907 | Bacteria | 1219 |
| 253 | Ga0268265_10035867 | 3300028380 | Bacteria | 3628 |
| 254 | Ga0307517_10001714 | 3300028786 | Bacteria | 36146 |
| 255 | Ga0307517_10002640 | 3300028786 | Bacteria | 28593 |
| 256 | Ga0307517_10004854 | 3300028786 | Bacteria | 20493 |
| 257 | Ga0307515_10001593 | 3300028794 | Bacteria | 50590 |
| 258 | Ga0307515_10014250 | 3300028794 | Bacteria | 14769 |
| 259 | Ga0307515_10104883 | 3300028794 | Bacteria | 3371 |
| 260 | Ga0307515_10234061 | 3300028794 | Bacteria | 1622 |
| 261 | Ga0237817_10148 | 3300030083 | Bacteria | 20932 |
| 262 | Ga0237817_10756 | 3300030083 | Bacteria | 2560 |
| 263 | Ga0268256_1001844 | 3300030500 | Bacteria | 11807 |
| 264 | Ga0307511_10045016 | 3300030521 | Bacteria | 3654 |
| 265 | Ga0307511_10106400 | 3300030521 | Bacteria | 1811 |
| 266 | Ga0307511_10174564 | 3300030521 | Bacteria | 1172 |
| 267 | Ga0307512_10005962 | 3300030522 | Bacteria | 12518 |
| 268 | Ga0307512_10010108 | 3300030522 | Bacteria | 9026 |
| 269 | Ga0307512_10123438 | 3300030522 | Bacteria | 1653 |
| 270 | Ga0307513_10003857 | 3300031456 | Bacteria | 20172 |
| 271 | Ga0307513_10005869 | 3300031456 | Bacteria | 16132 |
| 272 | Ga0307513_10033495 | 3300031456 | Bacteria | 5773 |
| 273 | Ga0307513_10083573 | 3300031456 | Bacteria | 3283 |
| 274 | Ga0307509_10022042 | 3300031507 | Bacteria | 7191 |
| 275 | Ga0307509_10045336 | 3300031507 | Bacteria | 4742 |
| 276 | Ga0307509_10106819 | 3300031507 | Bacteria | 2817 |
| 277 | Ga0307509_10437587 | 3300031507 | Bacteria | 1004 |
| 278 | Ga0307408_100009560 | 3300031548 | Bacteria | 6397 |
| 279 | Ga0307408_100018205 | 3300031548 | Bacteria | 4715 |
| 280 | Ga0307408_100195600 | 3300031548 | Bacteria | 1633 |
| 281 | Ga0307508_10005641 | 3300031616 | Bacteria | 11862 |
| 282 | Ga0307508_10006245 | 3300031616 | Bacteria | 11227 |
| 283 | Ga0307508_10012163 | 3300031616 | Bacteria | 7871 |
| 284 | Ga0307508_10032071 | 3300031616 | Bacteria | 4747 |
| 285 | Ga0307508_10121325 | 3300031616 | Bacteria | 2216 |
| 286 | Ga0307508_10127784 | 3300031616 | Bacteria | 2144 |
| 287 | Ga0307508_10129037 | 3300031616 | Bacteria | 2132 |
| 288 | Ga0307508_10273692 | 3300031616 | Bacteria | 1282 |
| 289 | Ga0307514_10003791 | 3300031649 | Bacteria | 14236 |
| 290 | Ga0307514_10142272 | 3300031649 | Bacteria | 1628 |
| 291 | Ga0307514_10230784 | 3300031649 | Bacteria | 1122 |
| 292 | Ga0307516_10001611 | 3300031730 | Bacteria | 31098 |
| 293 | Ga0307516_10058354 | 3300031730 | Bacteria | 3757 |
| 294 | Ga0307516_10059986 | 3300031730 | Bacteria | 3697 |
| 295 | Ga0307516_10361540 | 3300031730 | Bacteria | 1116 |
| 296 | Ga0307518_10051884 | 3300031838 | Bacteria | 2980 |
| 297 | Ga0307518_10187482 | 3300031838 | Bacteria | 1390 |
| 298 | Ga0307410_10164666 | 3300031852 | Bacteria | 1665 |
| 299 | Ga0307410_10270147 | 3300031852 | Bacteria | 1330 |
| 300 | Ga0307409_100197492 | 3300031995 | Bacteria | 1797 |
| 301 | Ga0307409_100451200 | 3300031995 | Bacteria | 1241 |
| 302 | Ga0307416_100071306 | 3300032002 | Bacteria | 2886 |
| 303 | Ga0307415_100017436 | 3300032126 | Bacteria | 4306 |
| 304 | Ga0307415_100249711 | 3300032126 | Bacteria | 1441 |
| 305 | Ga0307507_10014438 | 3300033179 | Bacteria | 9417 |
| 306 | Ga0307510_10019153 | 3300033180 | Bacteria | 8030 |
| 307 | Ga0307510_10119186 | 3300033180 | Bacteria | 2350 |
| 308 | Ga0373960_0081824 | 3300035121 | Bacteria | 1018 |
| 309 | Ga0395900_0460686 | 3300037418 | Bacteria | 1226 |
| 310 | Ga0395900_0613614 | 3300037418 | Bacteria | 1027 |
| 311 | Ga0395898_0007697 | 3300037466 | Bacteria | 11437 |
| 312 | Ga0395898_0011065 | 3300037466 | Bacteria | 9397 |
| 313 | Ga0395898_0110460 | 3300037466 | Bacteria | 2635 |
| 314 | Ga0395898_0136081 | 3300037466 | Bacteria | 2352 |
| 315 | Ga0395898_0200666 | 3300037466 | Bacteria | 1904 |
| 316 | Ga0436364_1248121 | 3300037853 | Bacteria | 41642 |
| 317 | Ga0395901_0132397 | 3300038443 | Bacteria | 2620 |
| 318 | Ga0395901_0250517 | 3300038443 | Bacteria | 1845 |
| 319 | Ga0395901_0497764 | 3300038443 | Bacteria | 1241 |
| 320 | Ga0400489_59289 | 3300039093 | Bacteria | 40018 |
| 321 | Ga0436360_1314359 | 3300039438 | Bacteria | 1284 |
| 322 | Ga0439436_0052915 | 3300041404 | Bacteria | 1144 |
| 323 | Ga0439439_0014470 | 3300041406 | Bacteria | 1921 |
| 324 | Ga0439466_0051095 | 3300041411 | Bacteria | 1355 |
| 325 | Ga0451797_1337902 | 3300041453 | Bacteria | 1391 |
| 326 | Ga0439433_0009719 | 3300041999 | Bacteria | 2099 |
| 327 | Ga0439448_0016388 | 3300042005 | Bacteria | 2255 |
| 328 | Ga0439448_0017788 | 3300042005 | Bacteria | 2173 |
| 329 | Ga0439449_0012098 | 3300042007 | Bacteria | 3243 |
| 330 | Ga0439449_0026644 | 3300042007 | Bacteria | 2157 |
| 331 | Ga0439449_0078211 | 3300042007 | Bacteria | 1219 |
| 332 | Ga0439457_000375 | 3300042014 | Bacteria | 12586 |
| 333 | Ga0439457_001379 | 3300042014 | Bacteria | 7313 |
| 334 | Ga0439457_011112 | 3300042014 | Bacteria | 2055 |
| 335 | Ga0450894_000020 | 3300042131 | Bacteria | 23128 |
| 336 | Ga0450898_000073 | 3300042134 | Bacteria | 8918 |
| 337 | Ga0450900_007733 | 3300042136 | Bacteria | 1330 |
| 338 | Ga0450900_015460 | 3300042136 | Bacteria | 1026 |
| 339 | Ga0450903_000151 | 3300042138 | Bacteria | 15226 |
| 340 | Ga0450903_000206 | 3300042138 | Bacteria | 13047 |
| 341 | Ga0450906_000151 | 3300042145 | Bacteria | 12867 |
| 342 | Ga0439458_0000704 | 3300042157 | Bacteria | 8638 |
| 343 | Ga0439458_0001366 | 3300042157 | Bacteria | 6154 |
| 344 | Ga0439458_0032753 | 3300042157 | Bacteria | 1243 |
| 345 | Ga0450908_004319 | 3300042184 | Bacteria | 2740 |
| 346 | Ga0466969_0016237 | 3300044656 | Bacteria | 3900 |
| 347 | Ga0466969_0036448 | 3300044656 | Bacteria | 2484 |
| 348 | Ga0466969_0043174 | 3300044656 | Bacteria | 2247 |
| 349 | Ga0466972_0004374 | 3300044658 | Bacteria | 7063 |
| 350 | Ga0466972_0005245 | 3300044658 | Bacteria | 6487 |
| 351 | Ga0466972_0010871 | 3300044658 | Bacteria | 4567 |
| 352 | Ga0466972_0031906 | 3300044658 | Bacteria | 2589 |
| 353 | Ga0466972_0101062 | 3300044658 | Bacteria | 1364 |
| 354 | Ga0466965_0002794 | 3300044683 | Bacteria | 7511 |
| 355 | Ga0466965_0004242 | 3300044683 | Bacteria | 6374 |
| 356 | Ga0466965_0069963 | 3300044683 | Bacteria | 1764 |
| 357 | Ga0466966_0002002 | 3300044684 | Bacteria | 13213 |
| 358 | Ga0466966_0002447 | 3300044684 | Bacteria | 12138 |
| 359 | Ga0466966_0002519 | 3300044684 | Bacteria | 12007 |
| 360 | Ga0466966_0116088 | 3300044684 | Bacteria | 1647 |
| 361 | Ga0466966_0209760 | 3300044684 | Bacteria | 1177 |
| 362 | Ga0466961_0003345 | 3300044693 | Bacteria | 10007 |
| 363 | Ga0466961_0219231 | 3300044693 | Bacteria | 1173 |
| 364 | Ga0466961_0298154 | 3300044693 | Bacteria | 985 |
| 365 | Ga0466963_0001552 | 3300044694 | Bacteria | 12451 |
| 366 | Ga0466963_0002581 | 3300044694 | Bacteria | 10163 |
| 367 | Ga0466963_0004932 | 3300044694 | Bacteria | 7783 |
| 368 | Ga0466963_0016525 | 3300044694 | Bacteria | 4590 |
| 369 | Ga0466971_0000101 | 3300044719 | Bacteria | 31687 |
| 370 | Ga0466971_0001250 | 3300044719 | Bacteria | 10589 |
| 371 | Ga0466971_0051095 | 3300044719 | Bacteria | 1860 |
| 372 | Ga0466971_0061221 | 3300044719 | Bacteria | 1702 |
| 373 | Ga0466968_0133796 | 3300044735 | Bacteria | 1130 |
| 374 | Ga0466968_0171315 | 3300044735 | Bacteria | 1006 |
| 375 | Ga0466970_0002849 | 3300044765 | Bacteria | 8354 |
| 376 | Ga0466970_0017776 | 3300044765 | Bacteria | 3676 |
| 377 | Ga0466970_0021741 | 3300044765 | Bacteria | 3344 |
| 378 | Ga0466957_0000616 | 3300044842 | Bacteria | 17989 |
| 379 | Ga0466957_0000823 | 3300044842 | Bacteria | 15822 |
| 380 | Ga0466957_0098168 | 3300044842 | Bacteria | 1843 |
| 381 | Ga0466957_0121975 | 3300044842 | Bacteria | 1662 |
| 382 | Ga0466957_0152979 | 3300044842 | Bacteria | 1493 |
| 383 | Ga0466957_0192593 | 3300044842 | Bacteria | 1336 |
| 384 | Ga0466960_0045063 | 3300044901 | Bacteria | 2105 |
| 385 | Ga0466959_0000612 | 3300045049 | Bacteria | 20862 |
| 386 | Ga0466959_0000836 | 3300045049 | Bacteria | 18179 |
| 387 | Ga0466959_0001818 | 3300045049 | Bacteria | 13367 |
| 388 | Ga0466959_0073493 | 3300045049 | Bacteria | 2473 |
| 389 | Ga0466958_0007274 | 3300045836 | Bacteria | 6076 |
| 390 | Ga0466958_0011249 | 3300045836 | Bacteria | 5037 |
| 391 | Ga0466958_0093603 | 3300045836 | Bacteria | 1861 |
| 392 | Ga0466967_0007959 | 3300045976 | Bacteria | 7712 |
| 393 | Ga0466967_0016080 | 3300045976 | Bacteria | 5887 |
| 394 | Ga0466967_0050690 | 3300045976 | Bacteria | 3635 |
| 395 | Ga0466967_0051373 | 3300045976 | Bacteria | 3612 |
| 396 | Ga0466967_0197333 | 3300045976 | Bacteria | 1905 |
| 397 | Ga0466967_0204622 | 3300045976 | Bacteria | 1870 |
| 398 | Ga0466967_0229459 | 3300045976 | Bacteria | 1767 |
| 399 | Ga0466967_0281101 | 3300045976 | Bacteria | 1597 |
| 400 | Ga0466967_0314901 | 3300045976 | Bacteria | 1508 |
| 401 | Ga0495627_053532 | 3300046453 | Bacteria | 1208 |
| 402 | Ga0495592_0006424 | 3300046454 | Bacteria | 8750 |
| 403 | Ga0495592_0014672 | 3300046454 | Bacteria | 5948 |
| 404 | Ga0495592_0111791 | 3300046454 | Bacteria | 1932 |
| 405 | Ga0495603_0002262 | 3300046455 | Bacteria | 11309 |
| 406 | Ga0495603_0007947 | 3300046455 | Bacteria | 6401 |
| 407 | Ga0495603_0009906 | 3300046455 | Bacteria | 5769 |
| 408 | Ga0495603_0013328 | 3300046455 | Bacteria | 4972 |
| 409 | Ga0495603_0021338 | 3300046455 | Bacteria | 3922 |
| 410 | Ga0495603_0040284 | 3300046455 | Bacteria | 2796 |
| 411 | Ga0495603_0071419 | 3300046455 | Bacteria | 2040 |
| 412 | Ga0495603_0161324 | 3300046455 | Bacteria | 1300 |
| 413 | Ga0495603_0210903 | 3300046455 | Bacteria | 1121 |
| 414 | Ga0495590_0037724 | 3300046457 | Bacteria | 1685 |
| 415 | Ga0495591_052028 | 3300046458 | Bacteria | 1115 |
| 416 | Ga0495629_0003145 | 3300046459 | Bacteria | 12499 |
| 417 | Ga0495629_0008858 | 3300046459 | Bacteria | 7398 |
| 418 | Ga0495629_0010079 | 3300046459 | Bacteria | 6894 |
| 419 | Ga0495629_0016863 | 3300046459 | Bacteria | 5242 |
| 420 | Ga0495629_0018750 | 3300046459 | Bacteria | 4946 |
| 421 | Ga0495629_0020967 | 3300046459 | Bacteria | 4664 |
| 422 | Ga0495629_0022356 | 3300046459 | Bacteria | 4510 |
| 423 | Ga0495629_0022917 | 3300046459 | Bacteria | 4450 |
| 424 | Ga0495629_0030267 | 3300046459 | Bacteria | 3839 |
| 425 | Ga0495629_0031215 | 3300046459 | Bacteria | 3773 |
| 426 | Ga0495629_0041490 | 3300046459 | Bacteria | 3238 |
| 427 | Ga0495629_0070465 | 3300046459 | Bacteria | 2439 |
| 428 | Ga0495629_0199780 | 3300046459 | Bacteria | 1382 |
| 429 | Ga0495638_0038503 | 3300046460 | Bacteria | 3038 |
| 430 | Ga0495641_0071813 | 3300046461 | Bacteria | 1553 |
| 431 | Ga0495641_0086847 | 3300046461 | Bacteria | 1400 |
| 432 | Ga0495651_0005293 | 3300046462 | Bacteria | 9836 |
| 433 | Ga0495651_0290456 | 3300046462 | Bacteria | 1100 |
| 434 | Ga0495653_0001013 | 3300046463 | Bacteria | 21659 |
| 435 | Ga0495653_0019424 | 3300046463 | Bacteria | 5512 |
| 436 | Ga0495580_0003679 | 3300046472 | Bacteria | 13005 |
| 437 | Ga0495582_0079227 | 3300046473 | Bacteria | 1823 |
| 438 | Ga0495582_0086578 | 3300046473 | Bacteria | 1744 |
| 439 | Ga0495605_0062442 | 3300046474 | Bacteria | 1780 |
| 440 | Ga0495639_0015199 | 3300046475 | Bacteria | 3335 |
| 441 | Ga0495662_0000792 | 3300046476 | Bacteria | 15345 |
| 442 | Ga0495662_0001198 | 3300046476 | Bacteria | 12809 |
| 443 | Ga0495662_0001489 | 3300046476 | Bacteria | 11592 |
| 444 | Ga0495662_0001839 | 3300046476 | Bacteria | 10633 |
| 445 | Ga0495662_0054628 | 3300046476 | Bacteria | 1929 |
| 446 | Ga0495662_0065920 | 3300046476 | Bacteria | 1751 |
| 447 | Ga0495662_0090335 | 3300046476 | Bacteria | 1493 |
| 448 | Ga0495664_0000843 | 3300046477 | Bacteria | 15738 |
| 449 | Ga0495664_0001419 | 3300046477 | Bacteria | 12708 |
| 450 | Ga0495664_0020583 | 3300046477 | Bacteria | 3805 |
| 451 | Ga0495585_0009779 | 3300046492 | Bacteria | 5737 |
| 452 | Ga0495585_0026138 | 3300046492 | Bacteria | 3335 |
| 453 | Ga0495594_0001500 | 3300046499 | Bacteria | 12113 |
| 454 | Ga0495594_0014868 | 3300046499 | Bacteria | 4084 |
| 455 | Ga0495594_0015677 | 3300046499 | Bacteria | 3983 |
| 456 | Ga0495594_0017275 | 3300046499 | Bacteria | 3809 |
| 457 | Ga0495594_0022544 | 3300046499 | Bacteria | 3368 |
| 458 | Ga0495594_0058991 | 3300046499 | Bacteria | 2121 |
| 459 | Ga0495607_0012225 | 3300046501 | Bacteria | 5674 |
| 460 | Ga0495607_0132497 | 3300046501 | Bacteria | 1295 |
| 461 | Ga0495607_0182559 | 3300046501 | Bacteria | 1051 |
| 462 | Ga0495608_0000571 | 3300046511 | Bacteria | 25313 |
| 463 | Ga0495610_0022468 | 3300046512 | Bacteria | 3450 |
| 464 | Ga0495618_0023098 | 3300046514 | Bacteria | 3842 |
| 465 | Ga0495618_0081822 | 3300046514 | Bacteria | 2062 |
| 466 | Ga0495620_0059282 | 3300046515 | Bacteria | 1600 |
| 467 | Ga0495628_0004213 | 3300046516 | Bacteria | 12787 |
| 468 | Ga0495628_0034586 | 3300046516 | Bacteria | 4063 |
| 469 | Ga0495628_0200352 | 3300046516 | Bacteria | 1504 |
| 470 | Ga0495630_0011805 | 3300046517 | Bacteria | 6330 |
| 471 | Ga0495630_0016350 | 3300046517 | Bacteria | 5420 |
| 472 | Ga0495630_0024711 | 3300046517 | Bacteria | 4440 |
| 473 | Ga0495630_0078827 | 3300046517 | Bacteria | 2484 |
| 474 | Ga0495631_0002818 | 3300046518 | Bacteria | 9653 |
| 475 | Ga0495631_0050189 | 3300046518 | Bacteria | 1825 |
| 476 | Ga0495632_0067803 | 3300046519 | Bacteria | 1720 |
| 477 | Ga0495637_0042225 | 3300046520 | Bacteria | 1952 |
| 478 | Ga0495643_0001620 | 3300046522 | Bacteria | 19894 |
| 479 | Ga0495648_0071670 | 3300046524 | Bacteria | 2007 |
| 480 | Ga0495666_0000455 | 3300046526 | Bacteria | 18214 |
| 481 | Ga0495652_0039494 | 3300046529 | Bacteria | 4081 |
| 482 | Ga0495652_0046351 | 3300046529 | Bacteria | 3732 |
| 483 | Ga0495652_0057156 | 3300046529 | Bacteria | 3310 |
| 484 | Ga0495652_0115687 | 3300046529 | Bacteria | 2148 |
| 485 | Ga0495652_0314035 | 3300046529 | Bacteria | 1134 |
| 486 | Ga0495654_0004463 | 3300046530 | Bacteria | 8298 |
| 487 | Ga0495665_0001966 | 3300046531 | Bacteria | 11103 |
| 488 | Ga0495665_0063533 | 3300046531 | Bacteria | 1949 |
| 489 | Ga0495640_0004142 | 3300046533 | Bacteria | 11598 |
| 490 | Ga0495640_0011997 | 3300046533 | Bacteria | 6641 |
| 491 | Ga0495640_0033198 | 3300046533 | Bacteria | 3669 |
| 492 | Ga0495640_0059238 | 3300046533 | Bacteria | 2609 |
| 493 | Ga0495586_0014256 | 3300046535 | Bacteria | 4223 |
| 494 | Ga0495587_0001439 | 3300046536 | Bacteria | 15855 |
| 495 | Ga0495587_0002646 | 3300046536 | Bacteria | 11963 |
| 496 | Ga0495587_0008063 | 3300046536 | Bacteria | 6792 |
| 497 | Ga0495587_0029547 | 3300046536 | Bacteria | 3327 |
| 498 | Ga0495609_0006715 | 3300046538 | Bacteria | 5835 |
| 499 | Ga0495597_0023333 | 3300046542 | Bacteria | 2862 |
| 500 | Ga0495597_0024603 | 3300046542 | Bacteria | 2777 |
| 501 | Ga0495645_0003077 | 3300046543 | Bacteria | 11302 |
| 502 | Ga0495645_0011980 | 3300046543 | Bacteria | 6111 |
| 503 | Ga0495645_0021959 | 3300046543 | Bacteria | 4616 |
| 504 | Ga0495645_0033635 | 3300046543 | Bacteria | 3740 |
| 505 | Ga0495645_0098022 | 3300046543 | Bacteria | 2087 |
| 506 | Ga0495622_0008760 | 3300046557 | Bacteria | 4687 |
| 507 | Ga0495622_0011939 | 3300046557 | Bacteria | 4017 |
| 508 | Ga0495622_0030419 | 3300046557 | Bacteria | 2523 |
| 509 | Ga0495622_0032908 | 3300046557 | Bacteria | 2420 |
| 510 | Ga0495622_0035093 | 3300046557 | Bacteria | 2339 |
| 511 | Ga0495622_0075874 | 3300046557 | Bacteria | 1549 |
| 512 | Ga0495667_0352619 | 3300046559 | Bacteria | 929 |
| 513 | Ga0495668_0008893 | 3300046616 | Bacteria | 6213 |
| 514 | Ga0495668_0050515 | 3300046616 | Bacteria | 2304 |
| 515 | Ga0495668_0071903 | 3300046616 | Bacteria | 1901 |
| 516 | Ga0495634_0004858 | 3300046642 | Bacteria | 10419 |
| 517 | Ga0495634_0006160 | 3300046642 | Bacteria | 9132 |
| 518 | Ga0495634_0009383 | 3300046642 | Bacteria | 7217 |
| 519 | Ga0495634_0035246 | 3300046642 | Bacteria | 3428 |
| 520 | Ga0495634_0230740 | 3300046642 | Bacteria | 1139 |
| 521 | Ga0495611_0016020 | 3300046648 | Bacteria | 3205 |
| 522 | Ga0495611_0090163 | 3300046648 | Bacteria | 1416 |
| 523 | Ga0495625_0002746 | 3300046660 | Bacteria | 18634 |
| 524 | Ga0495625_0018911 | 3300046660 | Bacteria | 5362 |
| 525 | Ga0495625_0019263 | 3300046660 | Bacteria | 5299 |
| 526 | Ga0495625_0036591 | 3300046660 | Bacteria | 3607 |
| 527 | Ga0495625_0053301 | 3300046660 | Bacteria | 2893 |
| 528 | Ga0495635_0000520 | 3300046663 | Bacteria | 24388 |
| 529 | Ga0495635_0003307 | 3300046663 | Bacteria | 11139 |
| 530 | Ga0495635_0065915 | 3300046663 | Bacteria | 2484 |
| 531 | Ga0495635_0084600 | 3300046663 | Bacteria | 2170 |
| 532 | Ga0495588_0003010 | 3300046674 | Bacteria | 7288 |
| 533 | Ga0495588_0009429 | 3300046674 | Bacteria | 4511 |
| 534 | Ga0495588_0013421 | 3300046674 | Bacteria | 3904 |
| 535 | Ga0495588_0039663 | 3300046674 | Bacteria | 2400 |
| 536 | Ga0495588_0052923 | 3300046674 | Bacteria | 2093 |
| 537 | Ga0495657_0004158 | 3300046675 | Bacteria | 11592 |
| 538 | Ga0495657_0008170 | 3300046675 | Bacteria | 8019 |
| 539 | Ga0495657_0012641 | 3300046675 | Bacteria | 6262 |
| 540 | Ga0495657_0013809 | 3300046675 | Bacteria | 5945 |
| 541 | Ga0495657_0092574 | 3300046675 | Bacteria | 1936 |
| 542 | Ga0495599_0006802 | 3300046678 | Bacteria | 6909 |
| 543 | Ga0495599_0041151 | 3300046678 | Bacteria | 2902 |
| 544 | Ga0495646_0000451 | 3300046680 | Bacteria | 21719 |
| 545 | Ga0495646_0002442 | 3300046680 | Bacteria | 11409 |
| 546 | Ga0495646_0017723 | 3300046680 | Bacteria | 4514 |
| 547 | Ga0495646_0049442 | 3300046680 | Bacteria | 2552 |
| 548 | Ga0495658_0011969 | 3300046683 | Bacteria | 4379 |
| 549 | Ga0495658_0014079 | 3300046683 | Bacteria | 4078 |
| 550 | Ga0495658_0068909 | 3300046683 | Bacteria | 2049 |
| 551 | Ga0495613_0000812 | 3300046689 | Bacteria | 24196 |
| 552 | Ga0495613_0001310 | 3300046689 | Bacteria | 19012 |
| 553 | Ga0495613_0001531 | 3300046689 | Bacteria | 17600 |
| 554 | Ga0495613_0015394 | 3300046689 | Bacteria | 5687 |
| 555 | Ga0495613_0036809 | 3300046689 | Bacteria | 3629 |
| 556 | Ga0495613_0068763 | 3300046689 | Bacteria | 2582 |
| 557 | Ga0495613_0073622 | 3300046689 | Bacteria | 2488 |
| 558 | Ga0495613_0077192 | 3300046689 | Bacteria | 2423 |
| 559 | Ga0495613_0181730 | 3300046689 | Bacteria | 1489 |
| 560 | Ga0495613_0183627 | 3300046689 | Bacteria | 1480 |
| 561 | Ga0495613_0332808 | 3300046689 | Bacteria | 1046 |
| 562 | Ga0495624_0087360 | 3300046690 | Bacteria | 1925 |
| 563 | Ga0495670_0005368 | 3300046691 | Bacteria | 6302 |
| 564 | Ga0495670_0099235 | 3300046691 | Bacteria | 1498 |
| 565 | Ga0495670_0139686 | 3300046691 | Bacteria | 1266 |
| 566 | Ga0495671_0036705 | 3300046692 | Bacteria | 2482 |
| 567 | Ga0495671_0086916 | 3300046692 | Bacteria | 1531 |
| 568 | Ga0495671_0170705 | 3300046692 | Bacteria | 1057 |
| 569 | Ga0495649_0032193 | 3300046694 | Bacteria | 2889 |
| 570 | Ga0495649_0086300 | 3300046694 | Bacteria | 1675 |
| 571 | Ga0495589_0023920 | 3300046794 | Bacteria | 3107 |
| 572 | Ga0495589_0137453 | 3300046794 | Bacteria | 1171 |
| 573 | Ga0495600_0005973 | 3300046809 | Bacteria | 7369 |
| 574 | Ga0495600_0032942 | 3300046809 | Bacteria | 3362 |
| 575 | Ga0495600_0162236 | 3300046809 | Bacteria | 1445 |
| 576 | Ga0495660_0003391 | 3300046810 | Bacteria | 9864 |
| 577 | Ga0495660_0033793 | 3300046810 | Bacteria | 2864 |
| 578 | Ga0495660_0138250 | 3300046810 | Bacteria | 1215 |
| 579 | Ga0495581_0016497 | 3300047315 | Bacteria | 4292 |
| 580 | Ga0495581_0022853 | 3300047315 | Bacteria | 3622 |
| 581 | Ga0495581_0050050 | 3300047315 | Bacteria | 2413 |
| 582 | Ga0495604_0000418 | 3300047317 | Bacteria | 38255 |
| 583 | Ga0495604_0001157 | 3300047317 | Bacteria | 21810 |
| 584 | Ga0495604_0031795 | 3300047317 | Bacteria | 4185 |
| 585 | Ga0495636_0004330 | 3300047318 | Bacteria | 5569 |
| 586 | Ga0495636_0008615 | 3300047318 | Bacteria | 4024 |
| 587 | Ga0495636_0022969 | 3300047318 | Bacteria | 2523 |
| 588 | Ga0495636_0029060 | 3300047318 | Bacteria | 2256 |
| 589 | Ga0495636_0192588 | 3300047318 | Bacteria | 928 |
| 590 | Ga0495674_0003023 | 3300047319 | Bacteria | 16371 |
| 591 | Ga0495674_0063086 | 3300047319 | Bacteria | 3224 |
| 592 | Ga0495674_0269207 | 3300047319 | Bacteria | 1398 |
| 593 | Ga0495676_0003597 | 3300047321 | Bacteria | 14067 |
| 594 | Ga0495676_0009846 | 3300047321 | Bacteria | 8684 |
| 595 | Ga0495676_0011192 | 3300047321 | Bacteria | 8109 |
| 596 | Ga0495676_0022567 | 3300047321 | Bacteria | 5473 |
| 597 | Ga0495676_0024227 | 3300047321 | Bacteria | 5257 |
| 598 | Ga0495676_0041190 | 3300047321 | Bacteria | 3803 |
| 599 | Ga0495676_0046806 | 3300047321 | Bacteria | 3505 |
| 600 | Ga0495676_0087935 | 3300047321 | Bacteria | 2332 |
| 601 | Ga0495676_0120007 | 3300047321 | Bacteria | 1914 |
| 602 | Ga0495676_0138253 | 3300047321 | Bacteria | 1748 |
| 603 | Ga0495676_0147635 | 3300047321 | Bacteria | 1677 |
| 604 | Ga0495676_0390675 | 3300047321 | Bacteria | 924 |
| 605 | Ga0495680_0197309 | 3300047322 | Bacteria | 1445 |
| 606 | Ga0495683_0057576 | 3300047323 | Bacteria | 1931 |
| 607 | Ga0495683_0094183 | 3300047323 | Bacteria | 1447 |
| 608 | Ga0495683_0145396 | 3300047323 | Bacteria | 1108 |
| 609 | Ga0495687_003992 | 3300047443 | Bacteria | 10277 |
| 610 | Ga0495687_013049 | 3300047443 | Bacteria | 4355 |
| 611 | Ga0495687_016575 | 3300047443 | Bacteria | 3703 |
| 612 | Ga0495675_0011451 | 3300047444 | Bacteria | 5568 |
| 613 | Ga0495675_0017393 | 3300047444 | Bacteria | 4557 |
| 614 | Ga0495675_0045903 | 3300047444 | Bacteria | 2782 |
| 615 | Ga0495677_0015624 | 3300047445 | Bacteria | 2757 |
| 616 | Ga0495677_0037006 | 3300047445 | Bacteria | 1783 |
| 617 | Ga0495679_051356 | 3300047446 | Bacteria | 1236 |
| 618 | Ga0495685_000328 | 3300047447 | Bacteria | 15284 |
| 619 | Ga0495685_001867 | 3300047447 | Bacteria | 6509 |
| 620 | Ga0495685_005504 | 3300047447 | Bacteria | 4137 |
| 621 | Ga0495685_021077 | 3300047447 | Bacteria | 2241 |
| 622 | Ga0495681_0000384 | 3300047470 | Bacteria | 34515 |
| 623 | Ga0495681_0001688 | 3300047470 | Bacteria | 16353 |
| 624 | Ga0495681_0021703 | 3300047470 | Bacteria | 3452 |
| 625 | Ga0495681_0084747 | 3300047470 | Bacteria | 1408 |
| 626 | Ga0495681_0146461 | 3300047470 | Bacteria | 994 |
| 627 | Ga0495686_0011663 | 3300047472 | Bacteria | 6187 |
| 628 | Ga0495686_0048908 | 3300047472 | Bacteria | 2664 |
| 629 | Ga0495686_0125480 | 3300047472 | Bacteria | 1526 |
| 630 | Ga0495593_0000135 | 3300047673 | Bacteria | 35475 |
| 631 | Ga0495593_0003672 | 3300047673 | Bacteria | 9162 |
| 632 | Ga0495593_0032228 | 3300047673 | Bacteria | 2858 |
| 633 | Ga0495602_0034385 | 3300048088 | Bacteria | 4741 |
| 634 | Ga0495602_0251419 | 3300048088 | Bacteria | 1317 |
| 635 | Ga0495614_0000327 | 3300048089 | Bacteria | 18876 |
| 636 | Ga0495614_0002106 | 3300048089 | Bacteria | 8792 |
| 637 | Ga0495614_0009702 | 3300048089 | Bacteria | 4253 |
| 638 | Ga0495614_0052660 | 3300048089 | Bacteria | 1744 |
| 639 | Ga0495614_0180074 | 3300048089 | Bacteria | 950 |
| 640 | Ga0496100_0011953 | 3300048903 | Bacteria | 4959 |
| 641 | Ga0496100_0085504 | 3300048903 | Bacteria | 2140 |
| 642 | Ga0496101_0001378 | 3300048904 | Bacteria | 14556 |
| 643 | Ga0496101_0203172 | 3300048904 | Bacteria | 1532 |
| 644 | Ga0496102_0035885 | 3300048905 | Bacteria | 4465 |
| 645 | Ga0496102_0094963 | 3300048905 | Bacteria | 2763 |
| 646 | Ga0496102_0110642 | 3300048905 | Bacteria | 2560 |
| 647 | Ga0496103_0003726 | 3300048906 | Bacteria | 9269 |
| 648 | Ga0496103_0007158 | 3300048906 | Bacteria | 6653 |
| 649 | Ga0496104_0001068 | 3300048907 | Bacteria | 23391 |
| 650 | Ga0496104_0001635 | 3300048907 | Bacteria | 19341 |
| 651 | Ga0496105_0001522 | 3300048908 | Bacteria | 16387 |
| 652 | Ga0496105_0008146 | 3300048908 | Bacteria | 8147 |
| 653 | Ga0496106_0001739 | 3300048909 | Bacteria | 16260 |
| 654 | Ga0496106_0004604 | 3300048909 | Bacteria | 10231 |
| 655 | Ga0496106_0105671 | 3300048909 | Bacteria | 2188 |
| 656 | Ga0496106_0264257 | 3300048909 | Bacteria | 1377 |
| 657 | Ga0496107_0000946 | 3300048910 | Bacteria | 17189 |
| 658 | Ga0496107_0021381 | 3300048910 | Bacteria | 4572 |
| 659 | Ga0496108_0000834 | 3300048911 | Bacteria | 23974 |
| 660 | Ga0496108_0007659 | 3300048911 | Bacteria | 8742 |
| 661 | Ga0496108_0100339 | 3300048911 | Bacteria | 2469 |
| 662 | Ga0496109_0000669 | 3300048912 | Bacteria | 28378 |
| 663 | Ga0496109_0036283 | 3300048912 | Bacteria | 4449 |
| 664 | Ga0496109_0050477 | 3300048912 | Bacteria | 3789 |
| 665 | Ga0496110_0004219 | 3300048913 | Bacteria | 11119 |
| 666 | Ga0496110_0007682 | 3300048913 | Bacteria | 8628 |
| 667 | Ga0496110_0056695 | 3300048913 | Bacteria | 3448 |
| 668 | Ga0496110_0101778 | 3300048913 | Bacteria | 2576 |
| 669 | Ga0496110_0129762 | 3300048913 | Bacteria | 2275 |
| 670 | Ga0496111_0038089 | 3300048914 | Bacteria | 3443 |
| 671 | Ga0496111_0079030 | 3300048914 | Bacteria | 2399 |
| 672 | Ga0496111_0109019 | 3300048914 | Bacteria | 2038 |
| 673 | Ga0496112_0029246 | 3300048915 | Bacteria | 5327 |
| 674 | Ga0496112_0043129 | 3300048915 | Bacteria | 4415 |
| 675 | Ga0496113_0013252 | 3300048916 | Bacteria | 5577 |
| 676 | Ga0496113_0027469 | 3300048916 | Bacteria | 4080 |
| 677 | Ga0496114_0051562 | 3300048917 | Bacteria | 3426 |
| 678 | Ga0496116_0001212 | 3300048919 | Bacteria | 30077 |
| 679 | Ga0496116_0019680 | 3300048919 | Bacteria | 5160 |
| 680 | Ga0496116_0043757 | 3300048919 | Bacteria | 3047 |
| 681 | Ga0496116_0105204 | 3300048919 | Bacteria | 1675 |
| 682 | Ga0496117_0025194 | 3300048920 | Bacteria | 4682 |
| 683 | Ga0496117_0066485 | 3300048920 | Bacteria | 2445 |
| 684 | Ga0496118_0036460 | 3300048921 | Bacteria | 3975 |
| 685 | Ga0496118_0154867 | 3300048921 | Bacteria | 1428 |
| 686 | Ga0496119_0002031 | 3300048922 | Bacteria | 22903 |
| 687 | Ga0496119_0009286 | 3300048922 | Bacteria | 8467 |
| 688 | Ga0496119_0009488 | 3300048922 | Bacteria | 8344 |
| 689 | Ga0496120_0008195 | 3300048923 | Bacteria | 7657 |
| 690 | Ga0496121_0089982 | 3300048924 | Bacteria | 2401 |
| 691 | Ga0496121_0121580 | 3300048924 | Bacteria | 1971 |
| 692 | Ga0496122_0009809 | 3300048925 | Bacteria | 10000 |
| 693 | Ga0496122_0047054 | 3300048925 | Bacteria | 3333 |
| 694 | Ga0496122_0068114 | 3300048925 | Bacteria | 2558 |
| 695 | Ga0496122_0072979 | 3300048925 | Bacteria | 2436 |
| 696 | Ga0496122_0081119 | 3300048925 | Bacteria | 2259 |
| 697 | Ga0496123_0009353 | 3300048926 | Bacteria | 8836 |
| 698 | Ga0496123_0067864 | 3300048926 | Bacteria | 2250 |
| 699 | Ga0496124_0088559 | 3300048927 | Bacteria | 2530 |
| 700 | Ga0496124_0164588 | 3300048927 | Bacteria | 1725 |
| 701 | Ga0496124_0256365 | 3300048927 | Bacteria | 1290 |
| 702 | Ga0496125_0000883 | 3300048928 | Bacteria | 47568 |
| 703 | Ga0496125_0007698 | 3300048928 | Bacteria | 11415 |
| 704 | Ga0496125_0012620 | 3300048928 | Bacteria | 8367 |
| 705 | Ga0496125_0029195 | 3300048928 | Bacteria | 4961 |
| 706 | Ga0496126_0059399 | 3300048929 | Bacteria | 3444 |
| 707 | Ga0496126_0141044 | 3300048929 | Bacteria | 2074 |
| 708 | Ga0501341_00183 | 3300049131 | Bacteria | 2214 |
| 709 | Ga0501343_003627 | 3300049132 | Bacteria | 1141 |
| 710 | Ga0501305_000889 | 3300049161 | Bacteria | 2688 |
| 711 | Ga0501311_002822 | 3300049527 | Bacteria | 1706 |
| 712 | Ga0501312_000166 | 3300049528 | Bacteria | 4379 |
| 713 | Ga0501312_017741 | 3300049528 | Bacteria | 1030 |
| 714 | Ga0501313_000516 | 3300049529 | Bacteria | 2691 |
| 715 | Ga0501315_000363 | 3300049531 | Bacteria | 3008 |
| 716 | Ga0501316_007029 | 3300049532 | Bacteria | 1213 |
| 717 | Ga0501316_009787 | 3300049532 | Bacteria | 1082 |
| 718 | Ga0501318_001432 | 3300049534 | Bacteria | 1872 |
| 719 | Ga0501319_001212 | 3300049535 | Bacteria | 1446 |
| 720 | Ga0501320_001857 | 3300049536 | Bacteria | 1612 |
| 721 | Ga0501323_000523 | 3300049539 | Bacteria | 2886 |
| 722 | Ga0501323_003091 | 3300049539 | Bacteria | 1674 |
| 723 | Ga0501337_000660 | 3300049553 | Bacteria | 1784 |
| 724 | Ga0501031_0000840 | 3300049568 | Bacteria | 18484 |
| 725 | Ga0501032_0000748 | 3300049569 | Bacteria | 26429 |
| 726 | Ga0501032_0032844 | 3300049569 | Bacteria | 3556 |
| 727 | Ga0501032_0051218 | 3300049569 | Bacteria | 2784 |
| 728 | Ga0501032_0164230 | 3300049569 | Bacteria | 1457 |
| 729 | Ga0501033_0010390 | 3300049570 | Bacteria | 7140 |
| 730 | Ga0501033_0013379 | 3300049570 | Bacteria | 6249 |
| 731 | Ga0501033_0036119 | 3300049570 | Bacteria | 3703 |
| 732 | Ga0501033_0051938 | 3300049570 | Bacteria | 3038 |
| 733 | Ga0501033_0059171 | 3300049570 | Bacteria | 2829 |
| 734 | Ga0501033_0138642 | 3300049570 | Bacteria | 1759 |
| 735 | Ga0501033_0334775 | 3300049570 | Bacteria | 1062 |
| 736 | Ga0501034_0004958 | 3300049571 | Bacteria | 14654 |
| 737 | Ga0501034_0007581 | 3300049571 | Bacteria | 11548 |
| 738 | Ga0501034_0018512 | 3300049571 | Bacteria | 7140 |
| 739 | Ga0501034_0118030 | 3300049571 | Bacteria | 2640 |
| 740 | Ga0501036_0005087 | 3300049572 | Bacteria | 10642 |
| 741 | Ga0501036_0013563 | 3300049572 | Bacteria | 6774 |
| 742 | Ga0501036_0016480 | 3300049572 | Bacteria | 6172 |
| 743 | Ga0501036_0079441 | 3300049572 | Bacteria | 2774 |
| 744 | Ga0501036_0169761 | 3300049572 | Bacteria | 1838 |
| 745 | Ga0501037_0000768 | 3300049573 | Bacteria | 24111 |
| 746 | Ga0501037_0002566 | 3300049573 | Bacteria | 13117 |
| 747 | Ga0501037_0108275 | 3300049573 | Bacteria | 2002 |
| 748 | Ga0501037_0130703 | 3300049573 | Bacteria | 1800 |
| 749 | Ga0501037_0252703 | 3300049573 | Bacteria | 1233 |
| 750 | Ga0501037_0293042 | 3300049573 | Bacteria | 1131 |
| 751 | Ga0501038_0006044 | 3300049574 | Bacteria | 11206 |
| 752 | Ga0501038_0006433 | 3300049574 | Bacteria | 10873 |
| 753 | Ga0501038_0035652 | 3300049574 | Bacteria | 4367 |
| 754 | Ga0501038_0066734 | 3300049574 | Bacteria | 3063 |
| 755 | Ga0501038_0221279 | 3300049574 | Bacteria | 1510 |
| 756 | Ga0501038_0308841 | 3300049574 | Bacteria | 1239 |
| 757 | Ga0501039_0015133 | 3300049575 | Bacteria | 5902 |
| 758 | Ga0501039_0059229 | 3300049575 | Bacteria | 2966 |
| 759 | Ga0501039_0134066 | 3300049575 | Bacteria | 1944 |
| 760 | Ga0501039_0153830 | 3300049575 | Bacteria | 1807 |
| 761 | Ga0501040_0041612 | 3300049576 | Bacteria | 3129 |
| 762 | Ga0501041_0000393 | 3300049577 | Bacteria | 21984 |
| 763 | Ga0501042_0039170 | 3300049578 | Bacteria | 3367 |
| 764 | Ga0501042_0048549 | 3300049578 | Bacteria | 3027 |
| 765 | Ga0501042_0063155 | 3300049578 | Bacteria | 2647 |
| 766 | Ga0501043_0004334 | 3300049579 | Bacteria | 11548 |
| 767 | Ga0501043_0022486 | 3300049579 | Bacteria | 4943 |
| 768 | Ga0501043_0033449 | 3300049579 | Bacteria | 4045 |
| 769 | Ga0501043_0079231 | 3300049579 | Bacteria | 2581 |
| 770 | Ga0501043_0372938 | 3300049579 | Bacteria | 1081 |
| 771 | Ga0501046_0004955 | 3300049580 | Bacteria | 11957 |
| 772 | Ga0501047_0000075 | 3300049581 | Bacteria | 124995 |
| 773 | Ga0501047_0000280 | 3300049581 | Bacteria | 59132 |
| 774 | Ga0501047_0022980 | 3300049581 | Bacteria | 5986 |
| 775 | Ga0501047_0024459 | 3300049581 | Bacteria | 5795 |
| 776 | Ga0501047_0186223 | 3300049581 | Bacteria | 1941 |
| 777 | Ga0501047_0215868 | 3300049581 | Bacteria | 1775 |
| 778 | Ga0501048_0010472 | 3300049582 | Bacteria | 6921 |
| 779 | Ga0501048_0018005 | 3300049582 | Bacteria | 5198 |
| 780 | Ga0501048_0284391 | 3300049582 | Bacteria | 1176 |
| 781 | Ga0501067_0045893 | 3300049583 | Bacteria | 2425 |
| 782 | Ga0501067_0080874 | 3300049583 | Bacteria | 1801 |
| 783 | Ga0501068_0001340 | 3300049584 | Bacteria | 13053 |
| 784 | Ga0501068_0316558 | 3300049584 | Bacteria | 1000 |
| 785 | Ga0501069_0027195 | 3300049585 | Bacteria | 3134 |
| 786 | Ga0501069_0045538 | 3300049585 | Bacteria | 2431 |
| 787 | Ga0501070_0002096 | 3300049586 | Bacteria | 17499 |
| 788 | Ga0501070_0016982 | 3300049586 | Bacteria | 6105 |
| 789 | Ga0501070_0139993 | 3300049586 | Bacteria | 1998 |
| 790 | Ga0501070_0280271 | 3300049586 | Bacteria | 1360 |
| 791 | Ga0501071_0002524 | 3300049587 | Bacteria | 11139 |
| 792 | Ga0501072_0001531 | 3300049588 | Bacteria | 17282 |
| 793 | Ga0501073_0016631 | 3300049589 | Bacteria | 5328 |
| 794 | Ga0501074_0010666 | 3300049590 | Bacteria | 6670 |
| 795 | Ga0501074_0018178 | 3300049590 | Bacteria | 5106 |
| 796 | Ga0501076_0071675 | 3300049592 | Bacteria | 2772 |
| 797 | Ga0501077_0017475 | 3300049593 | Bacteria | 4528 |
| 798 | Ga0501217_012817 | 3300049661 | Bacteria | 1873 |
| 799 | Ga0501217_026130 | 3300049661 | Bacteria | 1409 |
| 800 | Ga0501224_013126 | 3300049664 | Bacteria | 1223 |
| 801 | Ga0501079_0010786 | 3300049741 | Bacteria | 6957 |
| 802 | Ga0501079_0049481 | 3300049741 | Bacteria | 3244 |
| 803 | Ga0501080_0026016 | 3300049742 | Bacteria | 5437 |
| 804 | Ga0501080_0098838 | 3300049742 | Bacteria | 2708 |
| 805 | Ga0501080_0321238 | 3300049742 | Bacteria | 1401 |
| 806 | Ga0501083_0088997 | 3300049744 | Bacteria | 2040 |
| 807 | Ga0501035_0000431 | 3300049822 | Bacteria | 47303 |
| 808 | Ga0501035_0000477 | 3300049822 | Bacteria | 44891 |
| 809 | Ga0501035_0002133 | 3300049822 | Bacteria | 19679 |
| 810 | Ga0501035_0034739 | 3300049822 | Bacteria | 4579 |
| 811 | Ga0501035_0079885 | 3300049822 | Bacteria | 2888 |
| 812 | Ga0501035_0089210 | 3300049822 | Bacteria | 2716 |
| 813 | Ga0501035_0121894 | 3300049822 | Bacteria | 2278 |
| 814 | Ga0501035_0147684 | 3300049822 | Bacteria | 2041 |
| 815 | Ga0501035_0212194 | 3300049822 | Bacteria | 1656 |
| 816 | Ga0501035_0280799 | 3300049822 | Bacteria | 1407 |
| 817 | Ga0501044_0001532 | 3300049823 | Bacteria | 27104 |
| 818 | Ga0501044_0003263 | 3300049823 | Bacteria | 18246 |
| 819 | Ga0501044_0003565 | 3300049823 | Bacteria | 17510 |
| 820 | Ga0501044_0202332 | 3300049823 | Bacteria | 1943 |
| 821 | Ga0501044_0340267 | 3300049823 | Bacteria | 1421 |
| 822 | Ga0501045_0060587 | 3300049824 | Bacteria | 2774 |
| 823 | nmdc:mga03n38_1658_c1 | 3300050490 | Bacteria | 6531 |
| 824 | nmdc:mga03n38_168172_c1 | 3300050490 | Bacteria | 1115 |
| 825 | nmdc:mga0yw44_24019_c1 | 3300050492 | Bacteria | 3443 |
| 826 | nmdc:mga06z11_1588_c1 | 3300050494 | Bacteria | 8469 |
| 827 | nmdc:mga06z11_3481_c1 | 3300050494 | Bacteria | 6096 |
| 828 | nmdc:mga04h51_2417_c1 | 3300050495 | Bacteria | 4428 |
| 829 | nmdc:mga07m45_66037_c1 | 3300050496 | Bacteria | 2055 |
| 830 | nmdc:mga07m45_71601_c1 | 3300050496 | Bacteria | 1972 |
| 831 | nmdc:mga05p37_12880_c1 | 3300050507 | Bacteria | 10000 |
| 832 | nmdc:mga05p37_8911_c1 | 3300050507 | Bacteria | 11859 |
| 833 | nmdc:mga09592_2470_c1 | 3300050508 | Bacteria | 14923 |
| 834 | nmdc:mga0qj67_69908_c1 | 3300050509 | Bacteria | 2800 |
| 835 | nmdc:mga06r32_996_c1 | 3300050510 | Bacteria | 25413 |
| 836 | nmdc:mga08y16_33570_c1 | 3300050511 | Bacteria | 5389 |
| 837 | nmdc:mga08y16_8676_c1 | 3300050511 | Bacteria | 10661 |
| 838 | nmdc:mga0a205_113381_c1 | 3300050515 | Bacteria | 2610 |
| 839 | Ga0495601_0003396 | 3300053077 | Bacteria | 9126 |
| 840 | Ga0500610_0124137 | 3300053079 | Bacteria | 1318 |
| 841 | Ga0495655_0011007 | 3300053083 | Bacteria | 1804 |
| 842 | Ga0495655_0018106 | 3300053083 | Bacteria | 1544 |
| 843 | Ga0495619_0001857 | 3300053085 | Bacteria | 14059 |
| 844 | Ga0500578_0004537 | 3300053086 | Bacteria | 9721 |
| 845 | Ga0500578_0200286 | 3300053086 | Bacteria | 1222 |
| 846 | Ga0500644_0022930 | 3300053088 | Bacteria | 1889 |
| 847 | Ga0500641_0028087 | 3300053096 | Bacteria | 2195 |
| 848 | Ga0500650_0077208 | 3300053098 | Bacteria | 1556 |
| 849 | Ga0500654_031980 | 3300053099 | Bacteria | 3147 |
| 850 | Ga0500553_027252 | 3300053101 | Bacteria | 2871 |
| 851 | Ga0500560_004068 | 3300053107 | Bacteria | 3057 |
| 852 | Ga0500569_000539 | 3300053109 | Bacteria | 6326 |
| 853 | Ga0500572_008164 | 3300053111 | Bacteria | 2440 |
| 854 | Ga0500594_0073396 | 3300053118 | Bacteria | 1010 |
| 855 | Ga0500621_021663 | 3300053126 | Bacteria | 2468 |
| 856 | Ga0500628_001087 | 3300053129 | Bacteria | 4747 |
| 857 | Ga0500652_000846 | 3300053131 | Bacteria | 10103 |
| 858 | Ga0500658_0001364 | 3300053134 | Bacteria | 9879 |
| 859 | Ga0500561_0000683 | 3300053137 | Bacteria | 5381 |
| 860 | Ga0500573_0022463 | 3300053140 | Bacteria | 3621 |
| 861 | Ga0500573_0039369 | 3300053140 | Bacteria | 2731 |
| 862 | Ga0500573_0060456 | 3300053140 | Bacteria | 2170 |
| 863 | Ga0500579_088304 | 3300053143 | Bacteria | 1690 |
| 864 | Ga0500588_0009549 | 3300053146 | Bacteria | 2310 |
| 865 | Ga0500600_0065965 | 3300053149 | Bacteria | 2001 |
| 866 | Ga0500616_0034973 | 3300053153 | Bacteria | 2733 |
| 867 | Ga0500633_0000167 | 3300053160 | Bacteria | 8877 |
| 868 | Ga0500634_0000375 | 3300053161 | Bacteria | 14256 |
| 869 | Ga0500656_000274 | 3300053732 | Bacteria | 3544 |
| 870 | Ga0500587_002910 | 3300053739 | Bacteria | 2422 |
| 871 | Ga0501084_0013243 | 3300054114 | Bacteria | 6825 |
| 872 | Ga0501082_0001798 | 3300060353 | Bacteria | 18878 |
| 873 | Ga0466962_0001332 | 3300061719 | Bacteria | 11408 |
| 874 | Ga0466962_0016364 | 3300061719 | Bacteria | 3575 |
| 875 | Ga0466962_0043597 | 3300061719 | Bacteria | 2146 |
| 876 | Ga0530510_0092986 | 3300061734 | Bacteria | 2201 |
| 877 | 2540607507 | 2540341094 | Bacteria | 4061186 |
| 878 | 2547406121 | 2547132111 | Bacteria | 8013147 |
| 879 | 2547412521 | 2547132111 | Bacteria | 8013147 |
| 880 | 2550901955 | 2548877040 | Bacteria | 7507281 |
| 881 | 2553394672 | 2551306519 | Bacteria | 5465154 |
| 882 | 2554257491 | 2554235005 | Bacteria | 6457341 |
| 883 | 2556064322 | 2554235469 | Bacteria | 3590176 |
| 884 | 2571531913 | 2571042143 | Bacteria | 6986194 |
| 885 | 2585298432 | 2582581312 | Bacteria | 7308206 |
| 886 | 2585305738 | 2582581313 | Bacteria | 10042643 |
| 887 | 2585311212 | 2582581313 | Bacteria | 10042643 |
| 888 | 2585311857 | 2582581314 | Bacteria | 11452267 |
| 889 | 2585314586 | 2582581314 | Bacteria | 11452267 |
| 890 | 2595087999 | 2593339131 | Bacteria | 5116855 |
| 891 | 2601638417 | 2600255286 | Bacteria | 5390125 |
| 892 | 2616693492 | 2616644814 | Bacteria | 11555299 |
| 893 | 2616904167 | 2616644941 | Bacteria | 8510691 |
| 894 | 2643740857 | 2643221543 | Bacteria | 6628015 |
| 895 | 2643763172 | 2643221548 | Bacteria | 8053412 |
| 896 | 2643900186 | 2643221578 | Bacteria | 9213798 |
| 897 | 2643947940 | 2643221587 | Bacteria | 7586415 |
| 898 | 2644262849 | 2643221647 | Bacteria | 10741251 |
| 899 | 2644266452 | 2643221647 | Bacteria | 10741251 |
| 900 | 2644390623 | 2643221670 | Bacteria | 6497041 |
| 901 | 2644405590 | 2643221673 | Bacteria | 9196637 |
| 902 | 2644433806 | 2643221677 | Bacteria | 7584031 |
| 903 | 2644438020 | 2643221678 | Bacteria | 9540101 |
| 904 | 2644443053 | 2643221678 | Bacteria | 9540101 |
| 905 | 2644455183 | 2643221681 | Bacteria | 3707866 |
| 906 | 2644463958 | 2643221682 | Bacteria | 6743283 |
| 907 | 2644539364 | 2643221697 | Bacteria | 3575694 |
| 908 | 2644631126 | 2643221714 | Bacteria | 9015452 |
| 909 | 2644701696 | 2643221729 | Bacteria | 6621700 |
| 910 | 2644710613 | 2643221730 | Bacteria | 6523787 |
| 911 | 2644717018 | 2643221731 | Bacteria | 5623886 |
| 912 | 2644721520 | 2643221732 | Bacteria | 5756404 |
| 913 | 2685151353 | 2684622632 | Bacteria | 5380049 |
| 914 | 2698321906 | 2695420987 | Bacteria | 6152737 |
| 915 | 2712199301 | 2711768088 | Bacteria | 3195027 |
| 916 | 2721506518 | 2718218445 | Bacteria | 5113413 |
| 917 | 2723603661 | 2721755693 | Bacteria | 6126117 |
| 918 | 2728529980 | 2728368933 | Bacteria | 7044283 |
| 919 | 2730139656 | 2728369359 | Bacteria | 5621728 |
| 920 | 2738816914 | 2738541295 | Bacteria | 5730091 |
| 921 | 2739231029 | 2738543010 | Bacteria | 5583595 |
| 922 | 2739231706 | 2738543010 | Bacteria | 5583595 |
| 923 | 2739267953 | 2738543017 | Bacteria | 4271950 |
| 924 | 2753269747 | 2751185782 | Bacteria | 11227053 |
| 925 | 2753808049 | 2751185905 | Bacteria | 6142767 |
| 926 | 2757565981 | 2757320391 | Bacteria | 4746095 |
| 927 | 2777762246 | 2775507177 | Bacteria | 4384303 |
| 928 | 2777836027 | 2775507192 | Bacteria | 4622234 |
| 929 | 2777838119 | 2775507192 | Bacteria | 4622234 |
| 930 | 2784589058 | 2784132148 | Bacteria | 8627943 |
| 931 | 2784591817 | 2784132148 | Bacteria | 8627943 |
| 932 | 2785339909 | 2784746763 | Bacteria | 9783172 |
| 933 | 2785342789 | 2784746763 | Bacteria | 9783172 |
| 934 | 2785370013 | 2784746768 | Bacteria | 10036182 |
| 935 | 2786671084 | 2786546132 | Bacteria | 10419719 |
| 936 | 2786675170 | 2786546132 | Bacteria | 10419719 |
| 937 | 2793980516 | 2791355406 | Bacteria | 11364898 |
| 938 | 2802435839 | 2802428803 | Bacteria | 5806948 |
| 939 | 2804846315 | 2802429296 | Bacteria | 7227771 |
| 940 | 2808842509 | 2808606359 | Bacteria | 9866990 |
| 941 | 2808845164 | 2808606359 | Bacteria | 9866990 |
| 942 | 2808914759 | 2808606375 | Bacteria | 9466072 |
| 943 | 2808921014 | 2808606375 | Bacteria | 9466072 |
| 944 | 2809055804 | 2808606399 | Bacteria | 4021018 |
| 945 | 2809232661 | 2808606448 | Bacteria | 8656184 |
| 946 | 2809235437 | 2808606448 | Bacteria | 8656184 |
| 947 | 2811845715 | 2808606982 | Bacteria | 7791042 |
| 948 | 2812354538 | 2811994879 | Bacteria | 9313447 |
| 949 | 2812357591 | 2811994879 | Bacteria | 9313447 |
| 950 | 2812477479 | 2811994917 | Bacteria | 7761064 |
| 951 | 2812480112 | 2811994917 | Bacteria | 7761064 |
| 952 | 2819580383 | 2818991443 | Bacteria | 6598732 |
| 953 | 2819697340 | 2818991463 | Bacteria | 7948711 |
| 954 | 2819708757 | 2818991465 | Bacteria | 5388835 |
| 955 | 2819741571 | 2818991472 | Bacteria | 10089953 |
| 956 | 2821117426 | 2821111986 | Bacteria | 6894338 |
| 957 | 2842883527 | 2842882022 | Bacteria | 6158489 |
| 958 | 2842886007 | 2842882022 | Bacteria | 6158489 |
| 959 | 2852636159 | 2852635781 | Bacteria | 8251373 |
| 960 | 2852637330 | 2852635781 | Bacteria | 8251373 |
| 961 | 2857478250 | 2857472729 | Bacteria | 6568124 |
| 962 | 2857587156 | 2857586860 | Bacteria | 4354574 |
| 963 | 2857605541 | 2857604169 | Bacteria | 5111450 |
| 964 | 2857608980 | 2857604169 | Bacteria | 5111450 |
| 965 | 2860840203 | 2860837431 | Bacteria | 4202080 |
| 966 | 2862178913 | 2862178590 | Bacteria | 8583590 |
| 967 | 2862283220 | 2862281513 | Bacteria | 9621493 |
| 968 | 2862286115 | 2862281513 | Bacteria | 9621493 |
| 969 | 2862295634 | 2862290372 | Bacteria | 7471434 |
| 970 | 2862384222 | 2862382967 | Bacteria | 10317375 |
| 971 | 2862388921 | 2862382967 | Bacteria | 10317375 |
| 972 | 2862508169 | 2862507626 | Bacteria | 9425308 |
| 973 | 2862512187 | 2862507626 | Bacteria | 9425308 |
| 974 | 2862578802 | 2862574272 | Bacteria | 10567477 |
| 975 | 2862583502 | 2862574272 | Bacteria | 10567477 |
| 976 | 2863410092 | 2863404153 | Bacteria | 9672205 |
| 977 | 2864735674 | 2864733723 | Bacteria | 6770668 |
| 978 | 2865000275 | 2864997549 | Bacteria | 5139696 |
| 979 | 2867372437 | 2867369537 | Bacteria | 6501581 |
| 980 | 2867428730 | 2867428634 | Bacteria | 9590268 |
| 981 | 2867431351 | 2867428634 | Bacteria | 9590268 |
| 982 | 2867480465 | 2867475112 | Bacteria | 6909112 |
| 983 | 2873155291 | 2873151551 | Bacteria | 8625867 |
| 984 | 2875395144 | 2875391855 | Bacteria | 7600475 |
| 985 | 2877680611 | 2877676314 | Bacteria | 9512378 |
| 986 | 2885532960 | 2885526491 | Bacteria | 7164189 |
| 987 | 2889047697 | 2889042446 | Bacteria | 7618936 |
| 988 | 2889279591 | 2889276214 | Bacteria | 5979355 |
| 989 | 2889298134 | 2889295896 | Bacteria | 4704906 |
| 990 | 2904162361 | 2904162308 | Bacteria | 7086713 |
| 991 | 2904495511 | 2904490793 | Bacteria | 7046938 |
| 992 | 2904525800 | 2904524088 | Bacteria | 5887454 |
| 993 | 2904528424 | 2904524088 | Bacteria | 5887454 |
| 994 | 2904596916 | 2904595352 | Bacteria | 6124848 |
| 995 | 2907206685 | 2907202186 | Bacteria | 6632024 |
| 996 | 2912716145 | 2912715099 | Bacteria | 9460473 |
| 997 | 2912719327 | 2912715099 | Bacteria | 9460473 |
| 998 | 2912723981 | 2912723979 | Bacteria | 8557534 |
| 999 | 2912729060 | 2912723979 | Bacteria | 8557534 |
| 1000 | 2912731548 | 2912723979 | Bacteria | 8557534 |
| 1001 | 2912761343 | 2912757875 | Bacteria | 7940295 |
| 1002 | 2918505117 | 2918501144 | Bacteria | 8668083 |
| 1003 | 2919145608 | 2919143609 | Bacteria | 6219228 |
| 1004 | 2919147486 | 2919143609 | Bacteria | 6219228 |
| 1005 | 2919164606 | 2919160200 | Bacteria | 6929020 |
| 1006 | 2919471026 | 2919468124 | Bacteria | 9133025 |
| 1007 | 2919471828 | 2919468124 | Bacteria | 9133025 |
| 1008 | 2919517549 | 2919517244 | Bacteria | 5858162 |
| 1009 | 2919521545 | 2919517244 | Bacteria | 5858162 |
| 1010 | 2919721924 | 2919720352 | Bacteria | 5986006 |
| 1011 | 2919723739 | 2919720352 | Bacteria | 5986006 |
| 1012 | 2919725421 | 2919720352 | Bacteria | 5986006 |
| 1013 | 2928094311 | 2928093941 | Bacteria | 5965005 |
| 1014 | 2928098632 | 2928093941 | Bacteria | 5965005 |
| 1015 | 2929005403 | 2929004312 | Bacteria | 5678476 |
| 1016 | 2929007154 | 2929004312 | Bacteria | 5678476 |
| 1017 | 2929237025 | 2929233124 | Bacteria | 5948380 |
| 1018 | 2931384747 | 2931384279 | Bacteria | 7299545 |
| 1019 | 2935390768 | 2935390628 | Bacteria | 7043367 |
| 1020 | 2936341846 | 2936340661 | Bacteria | 5139038 |
| 1021 | 2938921207 | 2938917290 | Bacteria | 5914775 |
| 1022 | 2939684018 | 2939679117 | Bacteria | 6921672 |
| 1023 | 2939703643 | 2939702853 | Bacteria | 5139229 |
| 1024 | 2945996595 | 2945991243 | Bacteria | 7008369 |
| 1025 | 2946049446 | 2946045630 | Bacteria | 8527308 |
| 1026 | 2946059274 | 2946053406 | Bacteria | 6978655 |
| 1027 | 2946068263 | 2946064051 | Bacteria | 8957905 |
| 1028 | 2946071129 | 2946064051 | Bacteria | 8957905 |
| 1029 | 2946076399 | 2946072368 | Bacteria | 8999607 |
| 1030 | 2946079030 | 2946072368 | Bacteria | 8999607 |
| 1031 | 2947225603 | 2947224130 | Bacteria | 9938529 |
| 1032 | 2947228659 | 2947224130 | Bacteria | 9938529 |
| 1033 | 2947430062 | 2947426588 | Bacteria | 5357194 |
| 1034 | 2954006867 | 2954002825 | Bacteria | 9173742 |
| 1035 | 2954009777 | 2954002825 | Bacteria | 9173742 |
| 1036 | 2954382677 | 2954380949 | Bacteria | 10050426 |
| 1037 | 2954385740 | 2954380949 | Bacteria | 10050426 |
| 1038 | 2954677414 | 2954673503 | Bacteria | 9685905 |
| 1039 | 2954680205 | 2954673503 | Bacteria | 9685905 |
| 1040 | 2954683946 | 2954682443 | Bacteria | 9862841 |
| 1041 | 2954686739 | 2954682443 | Bacteria | 9862841 |
| 1042 | 2954693500 | 2954691527 | Bacteria | 10720516 |
| 1043 | 2954696386 | 2954691527 | Bacteria | 10720516 |
| 1044 | 2954705890 | 2954701450 | Bacteria | 10834262 |
| 1045 | 2954708594 | 2954701450 | Bacteria | 10834262 |
| 1046 | 2954713163 | 2954711539 | Bacteria | 10867210 |
| 1047 | 2954715743 | 2954711539 | Bacteria | 10867210 |
| 1048 | 2954723123 | 2954721474 | Bacteria | 10456478 |
| 1049 | 2954725681 | 2954721474 | Bacteria | 10456478 |
| 1050 | 2954736119 | 2954731030 | Bacteria | 10243860 |
| 1051 | 2954738706 | 2954731030 | Bacteria | 10243860 |
| 1052 | 2954742030 | 2954740390 | Bacteria | 10229294 |
| 1053 | 2954744635 | 2954740390 | Bacteria | 10229294 |
| 1054 | 2954754979 | 2954749733 | Bacteria | 10366972 |
| 1055 | 2954757564 | 2954749733 | Bacteria | 10366972 |
| 1056 | 2954761008 | 2954759201 | Bacteria | 9358192 |
| 1057 | 2954763602 | 2954759201 | Bacteria | 9358192 |
| 1058 | 2960321096 | 2960319331 | Bacteria | 5502575 |
| 1059 | 2960321893 | 2960319331 | Bacteria | 5502575 |
| 1060 | 2960377014 | 2960375949 | Bacteria | 5361395 |
| 1061 | 2960380063 | 2960375949 | Bacteria | 5361395 |
| 1062 | 2962293481 | 2962290636 | Bacteria | 4072939 |
| 1063 | 2965764616 | 2965761152 | Bacteria | 5806513 |
| 1064 | 2966602140 | 2966598605 | Bacteria | 7676064 |
| 1065 | 2969139489 | 2969136845 | Bacteria | 3923176 |
| 1066 | 2969767458 | 2969765954 | Bacteria | 4216713 |
| 1067 | 2969773229 | 2969770375 | Bacteria | 4271280 |
| 1068 | 2971409407 | 2971403814 | Bacteria | 7370929 |
| 1069 | 2979086971 | 2979083700 | Bacteria | 5894929 |
| 1070 | 2980126675 | 2980125574 | Bacteria | 5567337 |
| 1071 | 2980495244 | 2980492589 | Bacteria | 4072961 |
| 1072 | 2981286617 | 2981284811 | Bacteria | 4641497 |
| 1073 | 2981291568 | 2981289755 | Bacteria | 4641509 |
| 1074 | 2981982259 | 2981980479 | Bacteria | 4641628 |
| 1075 | 2981987161 | 2981985349 | Bacteria | 4641497 |
| 1076 | 2984532393 | 2984527788 | Bacteria | 5288478 |
| 1077 | 2984533653 | 2984532647 | Bacteria | 5288506 |
| 1078 | 2984593101 | 2984592036 | Bacteria | 3670284 |
| 1079 | 2990061591 | 2990059506 | Bacteria | 9321252 |
| 1080 | 2990065442 | 2990059506 | Bacteria | 9321252 |
| 1081 | 2990091936 | 2990088156 | Bacteria | 6657676 |
| 1082 | 2995468773 | 2995463766 | Bacteria | 8577691 |
| 1083 | 2996709134 | 2996706504 | Bacteria | 5757485 |
| 1084 | 2997459000 | 2997451912 | Bacteria | 8492419 |
| 1085 | 2997604637 | 2997600082 | Bacteria | 9896405 |
| 1086 | 3001893426 | 3001892409 | Bacteria | 6328293 |
| 1087 | 3006325762 | 3006321560 | Bacteria | 8247479 |
| 1088 | 3006425778 | 3006425503 | Bacteria | 6491253 |
| 1089 | 3006488507 | 3006486233 | Bacteria | 8157040 |
| 1090 | 3006496936 | 3006493962 | Bacteria | 8825450 |
| 1091 | 3006499440 | 3006493962 | Bacteria | 8825450 |
| 1092 | 3006976702 | 3006973921 | Bacteria | 4423788 |
| 1093 | 648169955 | 648028048 | Bacteria | 5394884 |
| 1094 | 8008564111 | 8008558824 | Bacteria | 10610750 |
| 1095 | 8008575975 | 8008574985 | Bacteria | 7815457 |
| 1096 | 8008578476 | 8008574985 | Bacteria | 7815457 |
| 1097 | 8022623118 | 8022621104 | Bacteria | 5241040 |
| 1098 | 8022654371 | 8022653035 | Bacteria | 4035078 |
| 1099 | 8022895186 | 8022893055 | Bacteria | 5300455 |
| 1100 | 8022898673 | 8022893055 | Bacteria | 5300455 |
| 1101 | 8022916026 | 8022914991 | Bacteria | 5584517 |
| 1102 | 8022918803 | 8022914991 | Bacteria | 5584517 |
| 1103 | 8022920587 | 8022914991 | Bacteria | 5584517 |
| 1104 | 8022952631 | 8022948649 | Bacteria | 5366783 |
| 1105 | 8023440128 | 8023438354 | Bacteria | 5779374 |
| 1106 | 8023447019 | 8023444577 | Bacteria | 5661597 |
| 1107 | 8023630548 | 8023623736 | Bacteria | 8593882 |
| 1108 | 8023631577 | 8023623736 | Bacteria | 8593882 |
| 1109 | 8025419924 | 8025413630 | Bacteria | 7014048 |
| 1110 | 8025485550 | 8025478263 | Bacteria | 8209203 |
| 1111 | 8033688264 | 8033684223 | Bacteria | 6906479 |
| 1112 | 8047897551 | 8047893842 | Bacteria | 11723082 |
| 1113 | 8048127861 | 8048127548 | Bacteria | 11053136 |
| 1114 | 8048361319 | 8048356638 | Bacteria | 11044339 |
| 1115 | 8048374538 | 8048369669 | Bacteria | 11666822 |
| 1116 | 8048383684 | 8048379754 | Bacteria | 11877923 |
| 1117 | 8048410260 | 8048406513 | Bacteria | 8936924 |
| 1118 | 8048410872 | 8048406513 | Bacteria | 8936924 |
| 1119 | 8054167477 | 8054160619 | Bacteria | 7783213 |
| 1120 | 8054284149 | 8054280661 | Bacteria | 4232245 |
| 1121 | 8054468971 | 8054465665 | Bacteria | 7323556 |
| 1122 | 8056452931 | 8056447290 | Bacteria | 7680491 |
| 1123 | 8056671945 | 8056667051 | Bacteria | 6953971 |
| 1124 | 8056834271 | 8056829672 | Bacteria | 9045328 |
| 1125 | 8056838010 | 8056829672 | Bacteria | 9045328 |
| 1126 | 8057739219 | 8057733483 | Bacteria | 6578323 |
| 1127 | Ga0501034_0032599 | |||
| 1128 | JGI24737J22298_10003012 | |||
| 1129 | JGI24737J22298_10019642 | |||
| 1130 | JGI24737J22298_10055047 | |||
| 1131 | JGI24735J21928_10014360 | |||
| 1132 | JGI24738J21930_10002471 | |||
| 1133 | JGI24738J21930_10005279 | |||
| 1134 | JGI25159J45721_1002931 | |||
| 1135 | JGI25151J46595_10000677 | |||
| 1136 | JGI25151J46595_10002436 | |||
| 1137 | JGI25151J46595_10012375 | |||
| 1138 | JGI25151J46595_10018506 | |||
| 1139 | JGI25151J46595_10056874 | |||
| 1140 | rootL2_10101561 | |||
| 1141 | rootL2_10187682 | |||
| 1142 | JGI25160J50197_1026048 | |||
| 1143 | JGI25407J50210_10002819 | |||
| 1144 | Ga0006562J51391_1003739 | |||
| 1145 | Ga0006562J51391_1012963 | |||
| 1146 | Ga0006562J51391_1030540 | |||
| 1147 | Ga0006562J51391_1059892 | |||
| 1148 | Ga0055532_1000299 | |||
| 1149 | Ga0055532_1002253 | |||
| 1150 | Ga0055532_1003874 | |||
| 1151 | Ga0055528_1001788 | |||
| 1152 | Ga0055541_1000172 | |||
| 1153 | Ga0055541_1002886 | |||
| 1154 | Ga0058863_10171726 | |||
| 1155 | Ga0058862_10045293 | |||
| 1156 | Ga0070670_100270830 | |||
| 1157 | Ga0070670_100572786 | |||
| 1158 | Ga0068869_100031387 | |||
| 1159 | Ga0070682_100005588 | |||
| 1160 | Ga0068868_100004322 | |||
| 1161 | Ga0070689_100184113 | |||
| 1162 | Ga0070675_100005088 | |||
| 1163 | Ga0070675_100174667 | |||
| 1164 | Ga0070659_100071107 | |||
| 1165 | Ga0070713_100024496 | |||
| 1166 | Ga0070700_100001935 | |||
| 1167 | Ga0070700_100013018 | |||
| 1168 | Ga0070663_100003212 | |||
| 1169 | Ga0070678_100171437 | |||
| 1170 | Ga0068867_100004619 | |||
| 1171 | Ga0070679_100007936 | |||
| 1172 | Ga0070684_100022768 | |||
| 1173 | Ga0068853_100022563 | |||
| 1174 | Ga0068853_100045234 | |||
| 1175 | Ga0068853_100063647 | |||
| 1176 | Ga0070672_100138686 | |||
| 1177 | Ga0070696_100242147 | |||
| 1178 | Ga0070664_100028469 | |||
| 1179 | Ga0070664_100272784 | |||
| 1180 | Ga0068857_100003449 | |||
| 1181 | Ga0068857_100090466 | |||
| 1182 | Ga0068856_100263614 | |||
| 1183 | Ga0070702_100012209 | |||
| 1184 | Ga0070702_100086946 | |||
| 1185 | Ga0068852_100002664 | |||
| 1186 | Ga0068859_100392252 | |||
| 1187 | Ga0068861_100020787 | |||
| 1188 | Ga0068861_100039601 | |||
| 1189 | Ga0068870_10001343 | |||
| 1190 | Ga0068858_100386323 | |||
| 1191 | Ga0081455_10001942 | |||
| 1192 | Ga0081455_10011475 | |||
| 1193 | Ga0081455_10023202 | |||
| 1194 | Ga0081538_10001831 | |||
| 1195 | Ga0075365_10030881 | |||
| 1196 | Ga0075365_10043595 | |||
| 1197 | Ga0075368_10020319 | |||
| 1198 | Ga0075363_100074953 | |||
| 1199 | Ga0070715_10027329 | |||
| 1200 | Ga0075367_10001303 | |||
| 1201 | Ga0075370_10015300 | |||
| 1202 | Ga0075428_100020122 | |||
| 1203 | Ga0075428_100616939 | |||
| 1204 | Ga0075430_100005085 | |||
| 1205 | Ga0075431_100014862 | |||
| 1206 | Ga0075433_10098527 | |||
| 1207 | Ga0075429_100000903 | |||
| 1208 | Ga0075429_100374255 | |||
| 1209 | Ga0097620_100392294 | |||
| 1210 | Ga0099826_10028077 | |||
| 1211 | Ga0105251_10007962 | |||
| 1212 | Ga0105251_10012044 | |||
| 1213 | Ga0105251_10020194 | |||
| 1214 | Ga0105251_10035894 | |||
| 1215 | Ga0105251_10040437 | |||
| 1216 | Ga0105244_10077792 | |||
| 1217 | Ga0105250_10002799 | |||
| 1218 | Ga0105250_10002980 | |||
| 1219 | Ga0111539_10013281 | |||
| 1220 | Ga0111539_10166515 | |||
| 1221 | Ga0111539_10251718 | |||
| 1222 | Ga0105245_10001147 | |||
| 1223 | Ga0105245_10311999 | |||
| 1224 | Ga0105247_10241994 | |||
| 1225 | Ga0114129_10015252 | |||
| 1226 | Ga0105243_10023928 | |||
| 1227 | Ga0105243_10025967 | |||
| 1228 | Ga0105243_10071900 | |||
| 1229 | Ga0105243_10188957 | |||
| 1230 | Ga0105242_10005109 | |||
| 1231 | Ga0105248_10028922 | |||
| 1232 | Ga0105238_10033334 | |||
| 1233 | Ga0105238_10147446 | |||
| 1234 | Ga0105249_10350571 | |||
| 1235 | Ga0105249_10518614 | |||
| 1236 | Ga0105239_10719844 | |||
| 1237 | Ga0105246_10001109 | |||
| 1238 | Ga0105246_10002420 | |||
| 1239 | Ga0105246_10040795 | |||
| 1240 | Ga0154016_135814 | |||
| 1241 | Ga0157369_10030985 | |||
| 1242 | Ga0157374_10163606 | |||
| 1243 | Ga0157374_10191460 | |||
| 1244 | Ga0157378_10022811 | |||
| 1245 | Ga0157372_10044612 | |||
| 1246 | Ga0157372_10319350 | |||
| 1247 | Ga0157375_10133866 | |||
| 1248 | Ga0157380_10018782 | |||
| 1249 | Ga0182008_10000554 | |||
| 1250 | Ga0182008_10002136 | |||
| 1251 | Ga0157377_10005002 | |||
| 1252 | Ga0182007_10000292 | |||
| 1253 | Ga0182007_10001633 | |||
| 1254 | Ga0182005_1023082 | |||
| 1255 | Ga0182005_1032444 | |||
| 1256 | Ga0183367_1001 | |||
| 1257 | Ga0183367_1008 | |||
| 1258 | Ga0163161_10057586 | |||
| 1259 | Ga0197907_10313398 | |||
| 1260 | Ga0197907_10644589 | |||
| 1261 | Ga0197907_10718981 | |||
| 1262 | Ga0197907_10823686 | |||
| 1263 | Ga0206356_11092319 | |||
| 1264 | Ga0206356_11480975 | |||
| 1265 | Ga0206349_1005955 | |||
| 1266 | Ga0206349_1324702 | |||
| 1267 | Ga0206349_1750765 | |||
| 1268 | Ga0206355_1079660 | |||
| 1269 | Ga0206355_1188050 | |||
| 1270 | Ga0206355_1194676 | |||
| 1271 | Ga0206355_1258842 | |||
| 1272 | Ga0206351_10182587 | |||
| 1273 | Ga0206351_10437743 | |||
| 1274 | Ga0206352_10587434 | |||
| 1275 | Ga0206350_10495155 | |||
| 1276 | Ga0206350_10725204 | |||
| 1277 | Ga0206350_10977944 | |||
| 1278 | Ga0206350_11345746 | |||
| 1279 | Ga0206354_10972849 | |||
| 1280 | Ga0206354_11693194 | |||
| 1281 | Ga0206353_10495354 | |||
| 1282 | Ga0154015_1524369 | |||
| 1283 | Ga0154015_1638209 | |||
| 1284 | Ga0224712_10005887 | |||
| 1285 | Ga0224712_10009437 | |||
| 1286 | Ga0224712_10155751 | |||
| 1287 | Ga0209566_100135 | |||
| 1288 | Ga0209566_100335 | |||
| 1289 | Ga0209566_101250 | |||
| 1290 | Ga0209147_100082 | |||
| 1291 | Ga0209147_100185 | |||
| 1292 | Ga0209147_101758 | |||
| 1293 | Ga0209147_102078 | |||
| 1294 | Ga0209147_102386 | |||
| 1295 | Ga0209437_100632 | |||
| 1296 | Ga0209258_102135 | |||
| 1297 | Ga0209673_1010173 | |||
| 1298 | Ga0209130_1000330 | |||
| 1299 | Ga0209130_1001162 | |||
| 1300 | Ga0209675_1025766 | |||
| 1301 | Ga0209676_1001704 | |||
| 1302 | Ga0209025_1000266 | |||
| 1303 | Ga0209025_1000368 | |||
| 1304 | Ga0209025_1000989 | |||
| 1305 | Ga0209025_1001769 | |||
| 1306 | Ga0209025_1002363 | |||
| 1307 | Ga0209025_1003354 | |||
| 1308 | Ga0209025_1003422 | |||
| 1309 | Ga0209025_1003732 | |||
| 1310 | Ga0209025_1004361 | |||
| 1311 | Ga0209025_1004544 | |||
| 1312 | Ga0209025_1004948 | |||
| 1313 | Ga0209025_1005588 | |||
| 1314 | Ga0209025_1009588 | |||
| 1315 | Ga0209025_1015545 | |||
| 1316 | Ga0209025_1015768 | |||
| 1317 | Ga0209025_1021819 | |||
| 1318 | Ga0209025_1033461 | |||
| 1319 | Ga0207426_1000938 | |||
| 1320 | Ga0207426_1004261 | |||
| 1321 | Ga0207426_1009876 | |||
| 1322 | Ga0207426_1023854 | |||
| 1323 | Ga0207697_10031484 | |||
| 1324 | Ga0207696_1004024 | |||
| 1325 | Ga0207696_1004115 | |||
| 1326 | Ga0207696_1010827 | |||
| 1327 | Ga0207696_1021441 | |||
| 1328 | Ga0207655_1000138 | |||
| 1329 | Ga0207655_1001364 | |||
| 1330 | Ga0207655_1004835 | |||
| 1331 | Ga0207655_1010450 | |||
| 1332 | Ga0207655_1042427 | |||
| 1333 | Ga0207713_1001636 | |||
| 1334 | Ga0207713_1010356 | |||
| 1335 | Ga0207713_1019937 | |||
| 1336 | Ga0207688_10006923 | |||
| 1337 | Ga0207647_10001942 | |||
| 1338 | Ga0207647_10023263 | |||
| 1339 | Ga0207643_10004307 | |||
| 1340 | Ga0207652_10146862 | |||
| 1341 | Ga0207646_10056443 | |||
| 1342 | Ga0207694_10068579 | |||
| 1343 | Ga0207659_10022419 | |||
| 1344 | Ga0207659_10023494 | |||
| 1345 | Ga0207687_10065145 | |||
| 1346 | Ga0207687_10149983 | |||
| 1347 | Ga0207687_10338172 | |||
| 1348 | Ga0207686_10130382 | |||
| 1349 | Ga0207686_10175698 | |||
| 1350 | Ga0207709_10004627 | |||
| 1351 | Ga0207709_10147163 | |||
| 1352 | Ga0207670_10098116 | |||
| 1353 | Ga0207669_10122529 | |||
| 1354 | Ga0207691_10013682 | |||
| 1355 | Ga0207689_10011605 | |||
| 1356 | Ga0207661_10017497 | |||
| 1357 | Ga0207679_10014257 | |||
| 1358 | Ga0207679_10270343 | |||
| 1359 | Ga0207677_10023520 | |||
| 1360 | Ga0207677_10298055 | |||
| 1361 | Ga0207639_10039392 | |||
| 1362 | Ga0207639_10072727 | |||
| 1363 | Ga0207639_10122799 | |||
| 1364 | Ga0207678_10004167 | |||
| 1365 | Ga0207708_10004420 | |||
| 1366 | Ga0207708_10004454 | |||
| 1367 | Ga0207702_10161097 | |||
| 1368 | Ga0207648_10000921 | |||
| 1369 | Ga0207674_10006994 | |||
| 1370 | Ga0207674_10022466 | |||
| 1371 | Ga0207675_100002005 | |||
| 1372 | Ga0207675_100104548 | |||
| 1373 | Ga0207683_10161594 | |||
| 1374 | Ga0209371_1006068 | |||
| 1375 | Ga0209371_1022153 | |||
| 1376 | Ga0209813_10002419 | |||
| 1377 | Ga0207428_10110983 | |||
| 1378 | Ga0207428_10287618 | |||
| 1379 | Ga0268265_10035867 | |||
| 1380 | Ga0307517_10001714 | |||
| 1381 | Ga0307517_10002640 | |||
| 1382 | Ga0307517_10004854 | |||
| 1383 | Ga0307515_10001593 | |||
| 1384 | Ga0307515_10014250 | |||
| 1385 | Ga0307515_10104883 | |||
| 1386 | Ga0307515_10234061 | |||
| 1387 | Ga0237817_10148 | |||
| 1388 | Ga0237817_10756 | |||
| 1389 | Ga0268256_1001844 | |||
| 1390 | Ga0307511_10045016 | |||
| 1391 | Ga0307511_10106400 | |||
| 1392 | Ga0307511_10174564 | |||
| 1393 | Ga0307512_10005962 | |||
| 1394 | Ga0307512_10010108 | |||
| 1395 | Ga0307512_10123438 | |||
| 1396 | Ga0307513_10003857 | |||
| 1397 | Ga0307513_10005869 | |||
| 1398 | Ga0307513_10033495 | |||
| 1399 | Ga0307513_10083573 | |||
| 1400 | Ga0307509_10022042 | |||
| 1401 | Ga0307509_10045336 | |||
| 1402 | Ga0307509_10106819 | |||
| 1403 | Ga0307509_10437587 | |||
| 1404 | Ga0307408_100009560 | |||
| 1405 | Ga0307408_100018205 | |||
| 1406 | Ga0307408_100195600 | |||
| 1407 | Ga0307508_10005641 | |||
| 1408 | Ga0307508_10006245 | |||
| 1409 | Ga0307508_10012163 | |||
| 1410 | Ga0307508_10032071 | |||
| 1411 | Ga0307508_10121325 | |||
| 1412 | Ga0307508_10127784 | |||
| 1413 | Ga0307508_10129037 | |||
| 1414 | Ga0307508_10273692 | |||
| 1415 | Ga0307514_10003791 | |||
| 1416 | Ga0307514_10142272 | |||
| 1417 | Ga0307514_10230784 | |||
| 1418 | Ga0307516_10001611 | |||
| 1419 | Ga0307516_10058354 | |||
| 1420 | Ga0307516_10059986 | |||
| 1421 | Ga0307516_10361540 | |||
| 1422 | Ga0307518_10051884 | |||
| 1423 | Ga0307518_10187482 | |||
| 1424 | Ga0307410_10164666 | |||
| 1425 | Ga0307410_10270147 | |||
| 1426 | Ga0307409_100197492 | |||
| 1427 | Ga0307409_100451200 | |||
| 1428 | Ga0307416_100071306 | |||
| 1429 | Ga0307415_100017436 | |||
| 1430 | Ga0307415_100249711 | |||
| 1431 | Ga0307507_10014438 | |||
| 1432 | Ga0307510_10019153 | |||
| 1433 | Ga0307510_10119186 | |||
| 1434 | Ga0373960_0081824 | |||
| 1435 | Ga0395900_0460686 | |||
| 1436 | Ga0395900_0613614 | |||
| 1437 | Ga0395898_0007697 | |||
| 1438 | Ga0395898_0011065 | |||
| 1439 | Ga0395898_0110460 | |||
| 1440 | Ga0395898_0136081 | |||
| 1441 | Ga0395898_0200666 | |||
| 1442 | Ga0436364_1248121 | |||
| 1443 | Ga0395901_0132397 | |||
| 1444 | Ga0395901_0250517 | |||
| 1445 | Ga0395901_0497764 | |||
| 1446 | Ga0400489_59289 | |||
| 1447 | Ga0436360_1314359 | |||
| 1448 | Ga0439436_0052915 | |||
| 1449 | Ga0439439_0014470 | |||
| 1450 | Ga0439466_0051095 | |||
| 1451 | Ga0451797_1337902 | |||
| 1452 | Ga0439433_0009719 | |||
| 1453 | Ga0439448_0016388 | |||
| 1454 | Ga0439448_0017788 | |||
| 1455 | Ga0439449_0012098 | |||
| 1456 | Ga0439449_0026644 | |||
| 1457 | Ga0439449_0078211 | |||
| 1458 | Ga0439457_000375 | |||
| 1459 | Ga0439457_001379 | |||
| 1460 | Ga0439457_011112 | |||
| 1461 | Ga0450894_000020 | |||
| 1462 | Ga0450898_000073 | |||
| 1463 | Ga0450900_007733 | |||
| 1464 | Ga0450900_015460 | |||
| 1465 | Ga0450903_000151 | |||
| 1466 | Ga0450903_000206 | |||
| 1467 | Ga0450906_000151 | |||
| 1468 | Ga0439458_0000704 | |||
| 1469 | Ga0439458_0001366 | |||
| 1470 | Ga0439458_0032753 | |||
| 1471 | Ga0450908_004319 | |||
| 1472 | Ga0466969_0016237 | |||
| 1473 | Ga0466969_0036448 | |||
| 1474 | Ga0466969_0043174 | |||
| 1475 | Ga0466972_0004374 | |||
| 1476 | Ga0466972_0005245 | |||
| 1477 | Ga0466972_0010871 | |||
| 1478 | Ga0466972_0031906 | |||
| 1479 | Ga0466972_0101062 | |||
| 1480 | Ga0466965_0002794 | |||
| 1481 | Ga0466965_0004242 | |||
| 1482 | Ga0466965_0069963 | |||
| 1483 | Ga0466966_0002002 | |||
| 1484 | Ga0466966_0002447 | |||
| 1485 | Ga0466966_0002519 | |||
| 1486 | Ga0466966_0116088 | |||
| 1487 | Ga0466966_0209760 | |||
| 1488 | Ga0466961_0003345 | |||
| 1489 | Ga0466961_0219231 | |||
| 1490 | Ga0466961_0298154 | |||
| 1491 | Ga0466963_0001552 | |||
| 1492 | Ga0466963_0002581 | |||
| 1493 | Ga0466963_0004932 | |||
| 1494 | Ga0466963_0016525 | |||
| 1495 | Ga0466971_0000101 | |||
| 1496 | Ga0466971_0001250 | |||
| 1497 | Ga0466971_0051095 | |||
| 1498 | Ga0466971_0061221 | |||
| 1499 | Ga0466968_0133796 | |||
| 1500 | Ga0466968_0171315 | |||
| 1501 | Ga0466970_0002849 | |||
| 1502 | Ga0466970_0017776 | |||
| 1503 | Ga0466970_0021741 | |||
| 1504 | Ga0466957_0000616 | |||
| 1505 | Ga0466957_0000823 | |||
| 1506 | Ga0466957_0098168 | |||
| 1507 | Ga0466957_0121975 | |||
| 1508 | Ga0466957_0152979 | |||
| 1509 | Ga0466957_0192593 | |||
| 1510 | Ga0466960_0045063 | |||
| 1511 | Ga0466959_0000612 | |||
| 1512 | Ga0466959_0000836 | |||
| 1513 | Ga0466959_0001818 | |||
| 1514 | Ga0466959_0073493 | |||
| 1515 | Ga0466958_0007274 | |||
| 1516 | Ga0466958_0011249 | |||
| 1517 | Ga0466958_0093603 | |||
| 1518 | Ga0466967_0007959 | |||
| 1519 | Ga0466967_0016080 | |||
| 1520 | Ga0466967_0050690 | |||
| 1521 | Ga0466967_0051373 | |||
| 1522 | Ga0466967_0197333 | |||
| 1523 | Ga0466967_0204622 | |||
| 1524 | Ga0466967_0229459 | |||
| 1525 | Ga0466967_0281101 | |||
| 1526 | Ga0466967_0314901 | |||
| 1527 | Ga0495627_053532 | |||
| 1528 | Ga0495592_0006424 | |||
| 1529 | Ga0495592_0014672 | |||
| 1530 | Ga0495592_0111791 | |||
| 1531 | Ga0495603_0002262 | |||
| 1532 | Ga0495603_0007947 | |||
| 1533 | Ga0495603_0009906 | |||
| 1534 | Ga0495603_0013328 | |||
| 1535 | Ga0495603_0021338 | |||
| 1536 | Ga0495603_0040284 | |||
| 1537 | Ga0495603_0071419 | |||
| 1538 | Ga0495603_0161324 | |||
| 1539 | Ga0495603_0210903 | |||
| 1540 | Ga0495590_0037724 | |||
| 1541 | Ga0495591_052028 | |||
| 1542 | Ga0495629_0003145 | |||
| 1543 | Ga0495629_0008858 | |||
| 1544 | Ga0495629_0010079 | |||
| 1545 | Ga0495629_0016863 | |||
| 1546 | Ga0495629_0018750 | |||
| 1547 | Ga0495629_0020967 | |||
| 1548 | Ga0495629_0022356 | |||
| 1549 | Ga0495629_0022917 | |||
| 1550 | Ga0495629_0030267 | |||
| 1551 | Ga0495629_0031215 | |||
| 1552 | Ga0495629_0041490 | |||
| 1553 | Ga0495629_0070465 | |||
| 1554 | Ga0495629_0199780 | |||
| 1555 | Ga0495638_0038503 | |||
| 1556 | Ga0495641_0071813 | |||
| 1557 | Ga0495641_0086847 | |||
| 1558 | Ga0495651_0005293 | |||
| 1559 | Ga0495651_0290456 | |||
| 1560 | Ga0495653_0001013 | |||
| 1561 | Ga0495653_0019424 | |||
| 1562 | Ga0495580_0003679 | |||
| 1563 | Ga0495582_0079227 | |||
| 1564 | Ga0495582_0086578 | |||
| 1565 | Ga0495605_0062442 | |||
| 1566 | Ga0495639_0015199 | |||
| 1567 | Ga0495662_0000792 | |||
| 1568 | Ga0495662_0001198 | |||
| 1569 | Ga0495662_0001489 | |||
| 1570 | Ga0495662_0001839 | |||
| 1571 | Ga0495662_0054628 | |||
| 1572 | Ga0495662_0065920 | |||
| 1573 | Ga0495662_0090335 | |||
| 1574 | Ga0495664_0000843 | |||
| 1575 | Ga0495664_0001419 | |||
| 1576 | Ga0495664_0020583 | |||
| 1577 | Ga0495585_0009779 | |||
| 1578 | Ga0495585_0026138 | |||
| 1579 | Ga0495594_0001500 | |||
| 1580 | Ga0495594_0014868 | |||
| 1581 | Ga0495594_0015677 | |||
| 1582 | Ga0495594_0017275 | |||
| 1583 | Ga0495594_0022544 | |||
| 1584 | Ga0495594_0058991 | |||
| 1585 | Ga0495607_0012225 | |||
| 1586 | Ga0495607_0132497 | |||
| 1587 | Ga0495607_0182559 | |||
| 1588 | Ga0495608_0000571 | |||
| 1589 | Ga0495610_0022468 | |||
| 1590 | Ga0495618_0023098 | |||
| 1591 | Ga0495618_0081822 | |||
| 1592 | Ga0495620_0059282 | |||
| 1593 | Ga0495628_0004213 | |||
| 1594 | Ga0495628_0034586 | |||
| 1595 | Ga0495628_0200352 | |||
| 1596 | Ga0495630_0011805 | |||
| 1597 | Ga0495630_0016350 | |||
| 1598 | Ga0495630_0024711 | |||
| 1599 | Ga0495630_0078827 | |||
| 1600 | Ga0495631_0002818 | |||
| 1601 | Ga0495631_0050189 | |||
| 1602 | Ga0495632_0067803 | |||
| 1603 | Ga0495637_0042225 | |||
| 1604 | Ga0495643_0001620 | |||
| 1605 | Ga0495648_0071670 | |||
| 1606 | Ga0495666_0000455 | |||
| 1607 | Ga0495652_0039494 | |||
| 1608 | Ga0495652_0046351 | |||
| 1609 | Ga0495652_0057156 | |||
| 1610 | Ga0495652_0115687 | |||
| 1611 | Ga0495652_0314035 | |||
| 1612 | Ga0495654_0004463 | |||
| 1613 | Ga0495665_0001966 | |||
| 1614 | Ga0495665_0063533 | |||
| 1615 | Ga0495640_0004142 | |||
| 1616 | Ga0495640_0011997 | |||
| 1617 | Ga0495640_0033198 | |||
| 1618 | Ga0495640_0059238 | |||
| 1619 | Ga0495586_0014256 | |||
| 1620 | Ga0495587_0001439 | |||
| 1621 | Ga0495587_0002646 | |||
| 1622 | Ga0495587_0008063 | |||
| 1623 | Ga0495587_0029547 | |||
| 1624 | Ga0495609_0006715 | |||
| 1625 | Ga0495597_0023333 | |||
| 1626 | Ga0495597_0024603 | |||
| 1627 | Ga0495645_0003077 | |||
| 1628 | Ga0495645_0011980 | |||
| 1629 | Ga0495645_0021959 | |||
| 1630 | Ga0495645_0033635 | |||
| 1631 | Ga0495645_0098022 | |||
| 1632 | Ga0495622_0008760 | |||
| 1633 | Ga0495622_0011939 | |||
| 1634 | Ga0495622_0030419 | |||
| 1635 | Ga0495622_0032908 | |||
| 1636 | Ga0495622_0035093 | |||
| 1637 | Ga0495622_0075874 | |||
| 1638 | Ga0495667_0352619 | |||
| 1639 | Ga0495668_0008893 | |||
| 1640 | Ga0495668_0050515 | |||
| 1641 | Ga0495668_0071903 | |||
| 1642 | Ga0495634_0004858 | |||
| 1643 | Ga0495634_0006160 | |||
| 1644 | Ga0495634_0009383 | |||
| 1645 | Ga0495634_0035246 | |||
| 1646 | Ga0495634_0230740 | |||
| 1647 | Ga0495611_0016020 | |||
| 1648 | Ga0495611_0090163 | |||
| 1649 | Ga0495625_0002746 | |||
| 1650 | Ga0495625_0018911 | |||
| 1651 | Ga0495625_0019263 | |||
| 1652 | Ga0495625_0036591 | |||
| 1653 | Ga0495625_0053301 | |||
| 1654 | Ga0495635_0000520 | |||
| 1655 | Ga0495635_0003307 | |||
| 1656 | Ga0495635_0065915 | |||
| 1657 | Ga0495635_0084600 | |||
| 1658 | Ga0495588_0003010 | |||
| 1659 | Ga0495588_0009429 | |||
| 1660 | Ga0495588_0013421 | |||
| 1661 | Ga0495588_0039663 | |||
| 1662 | Ga0495588_0052923 | |||
| 1663 | Ga0495657_0004158 | |||
| 1664 | Ga0495657_0008170 | |||
| 1665 | Ga0495657_0012641 | |||
| 1666 | Ga0495657_0013809 | |||
| 1667 | Ga0495657_0092574 | |||
| 1668 | Ga0495599_0006802 | |||
| 1669 | Ga0495599_0041151 | |||
| 1670 | Ga0495646_0000451 | |||
| 1671 | Ga0495646_0002442 | |||
| 1672 | Ga0495646_0017723 | |||
| 1673 | Ga0495646_0049442 | |||
| 1674 | Ga0495658_0011969 | |||
| 1675 | Ga0495658_0014079 | |||
| 1676 | Ga0495658_0068909 | |||
| 1677 | Ga0495613_0000812 | |||
| 1678 | Ga0495613_0001310 | |||
| 1679 | Ga0495613_0001531 | |||
| 1680 | Ga0495613_0015394 | |||
| 1681 | Ga0495613_0036809 | |||
| 1682 | Ga0495613_0068763 | |||
| 1683 | Ga0495613_0073622 | |||
| 1684 | Ga0495613_0077192 | |||
| 1685 | Ga0495613_0181730 | |||
| 1686 | Ga0495613_0183627 | |||
| 1687 | Ga0495613_0332808 | |||
| 1688 | Ga0495624_0087360 | |||
| 1689 | Ga0495670_0005368 | |||
| 1690 | Ga0495670_0099235 | |||
| 1691 | Ga0495670_0139686 | |||
| 1692 | Ga0495671_0036705 | |||
| 1693 | Ga0495671_0086916 | |||
| 1694 | Ga0495671_0170705 | |||
| 1695 | Ga0495649_0032193 | |||
| 1696 | Ga0495649_0086300 | |||
| 1697 | Ga0495589_0023920 | |||
| 1698 | Ga0495589_0137453 | |||
| 1699 | Ga0495600_0005973 | |||
| 1700 | Ga0495600_0032942 | |||
| 1701 | Ga0495600_0162236 | |||
| 1702 | Ga0495660_0003391 | |||
| 1703 | Ga0495660_0033793 | |||
| 1704 | Ga0495660_0138250 | |||
| 1705 | Ga0495581_0016497 | |||
| 1706 | Ga0495581_0022853 | |||
| 1707 | Ga0495581_0050050 | |||
| 1708 | Ga0495604_0000418 | |||
| 1709 | Ga0495604_0001157 | |||
| 1710 | Ga0495604_0031795 | |||
| 1711 | Ga0495636_0004330 | |||
| 1712 | Ga0495636_0008615 | |||
| 1713 | Ga0495636_0022969 | |||
| 1714 | Ga0495636_0029060 | |||
| 1715 | Ga0495636_0192588 | |||
| 1716 | Ga0495674_0003023 | |||
| 1717 | Ga0495674_0063086 | |||
| 1718 | Ga0495674_0269207 | |||
| 1719 | Ga0495676_0003597 | |||
| 1720 | Ga0495676_0009846 | |||
| 1721 | Ga0495676_0011192 | |||
| 1722 | Ga0495676_0022567 | |||
| 1723 | Ga0495676_0024227 | |||
| 1724 | Ga0495676_0041190 | |||
| 1725 | Ga0495676_0046806 | |||
| 1726 | Ga0495676_0087935 | |||
| 1727 | Ga0495676_0120007 | |||
| 1728 | Ga0495676_0138253 | |||
| 1729 | Ga0495676_0147635 | |||
| 1730 | Ga0495676_0390675 | |||
| 1731 | Ga0495680_0197309 | |||
| 1732 | Ga0495683_0057576 | |||
| 1733 | Ga0495683_0094183 | |||
| 1734 | Ga0495683_0145396 | |||
| 1735 | Ga0495687_003992 | |||
| 1736 | Ga0495687_013049 | |||
| 1737 | Ga0495687_016575 | |||
| 1738 | Ga0495675_0011451 | |||
| 1739 | Ga0495675_0017393 | |||
| 1740 | Ga0495675_0045903 | |||
| 1741 | Ga0495677_0015624 | |||
| 1742 | Ga0495677_0037006 | |||
| 1743 | Ga0495679_051356 | |||
| 1744 | Ga0495685_000328 | |||
| 1745 | Ga0495685_001867 | |||
| 1746 | Ga0495685_005504 | |||
| 1747 | Ga0495685_021077 | |||
| 1748 | Ga0495681_0000384 | |||
| 1749 | Ga0495681_0001688 | |||
| 1750 | Ga0495681_0021703 | |||
| 1751 | Ga0495681_0084747 | |||
| 1752 | Ga0495681_0146461 | |||
| 1753 | Ga0495686_0011663 | |||
| 1754 | Ga0495686_0048908 | |||
| 1755 | Ga0495686_0125480 | |||
| 1756 | Ga0495593_0000135 | |||
| 1757 | Ga0495593_0003672 | |||
| 1758 | Ga0495593_0032228 | |||
| 1759 | Ga0495602_0034385 | |||
| 1760 | Ga0495602_0251419 | |||
| 1761 | Ga0495614_0000327 | |||
| 1762 | Ga0495614_0002106 | |||
| 1763 | Ga0495614_0009702 | |||
| 1764 | Ga0495614_0052660 | |||
| 1765 | Ga0495614_0180074 | |||
| 1766 | Ga0496100_0011953 | |||
| 1767 | Ga0496100_0085504 | |||
| 1768 | Ga0496101_0001378 | |||
| 1769 | Ga0496101_0203172 | |||
| 1770 | Ga0496102_0035885 | |||
| 1771 | Ga0496102_0094963 | |||
| 1772 | Ga0496102_0110642 | |||
| 1773 | Ga0496103_0003726 | |||
| 1774 | Ga0496103_0007158 | |||
| 1775 | Ga0496104_0001068 | |||
| 1776 | Ga0496104_0001635 | |||
| 1777 | Ga0496105_0001522 | |||
| 1778 | Ga0496105_0008146 | |||
| 1779 | Ga0496106_0001739 | |||
| 1780 | Ga0496106_0004604 | |||
| 1781 | Ga0496106_0105671 | |||
| 1782 | Ga0496106_0264257 | |||
| 1783 | Ga0496107_0000946 | |||
| 1784 | Ga0496107_0021381 | |||
| 1785 | Ga0496108_0000834 | |||
| 1786 | Ga0496108_0007659 | |||
| 1787 | Ga0496108_0100339 | |||
| 1788 | Ga0496109_0000669 | |||
| 1789 | Ga0496109_0036283 | |||
| 1790 | Ga0496109_0050477 | |||
| 1791 | Ga0496110_0004219 | |||
| 1792 | Ga0496110_0007682 | |||
| 1793 | Ga0496110_0056695 | |||
| 1794 | Ga0496110_0101778 | |||
| 1795 | Ga0496110_0129762 | |||
| 1796 | Ga0496111_0038089 | |||
| 1797 | Ga0496111_0079030 | |||
| 1798 | Ga0496111_0109019 | |||
| 1799 | Ga0496112_0029246 | |||
| 1800 | Ga0496112_0043129 | |||
| 1801 | Ga0496113_0013252 | |||
| 1802 | Ga0496113_0027469 | |||
| 1803 | Ga0496114_0051562 | |||
| 1804 | Ga0496116_0001212 | |||
| 1805 | Ga0496116_0019680 | |||
| 1806 | Ga0496116_0043757 | |||
| 1807 | Ga0496116_0105204 | |||
| 1808 | Ga0496117_0025194 | |||
| 1809 | Ga0496117_0066485 | |||
| 1810 | Ga0496118_0036460 | |||
| 1811 | Ga0496118_0154867 | |||
| 1812 | Ga0496119_0002031 | |||
| 1813 | Ga0496119_0009286 | |||
| 1814 | Ga0496119_0009488 | |||
| 1815 | Ga0496120_0008195 | |||
| 1816 | Ga0496121_0089982 | |||
| 1817 | Ga0496121_0121580 | |||
| 1818 | Ga0496122_0009809 | |||
| 1819 | Ga0496122_0047054 | |||
| 1820 | Ga0496122_0068114 | |||
| 1821 | Ga0496122_0072979 | |||
| 1822 | Ga0496122_0081119 | |||
| 1823 | Ga0496123_0009353 | |||
| 1824 | Ga0496123_0067864 | |||
| 1825 | Ga0496124_0088559 | |||
| 1826 | Ga0496124_0164588 | |||
| 1827 | Ga0496124_0256365 | |||
| 1828 | Ga0496125_0000883 | |||
| 1829 | Ga0496125_0007698 | |||
| 1830 | Ga0496125_0012620 | |||
| 1831 | Ga0496125_0029195 | |||
| 1832 | Ga0496126_0059399 | |||
| 1833 | Ga0496126_0141044 | |||
| 1834 | Ga0501341_00183 | |||
| 1835 | Ga0501343_003627 | |||
| 1836 | Ga0501305_000889 | |||
| 1837 | Ga0501311_002822 | |||
| 1838 | Ga0501312_000166 | |||
| 1839 | Ga0501312_017741 | |||
| 1840 | Ga0501313_000516 | |||
| 1841 | Ga0501315_000363 | |||
| 1842 | Ga0501316_007029 | |||
| 1843 | Ga0501316_009787 | |||
| 1844 | Ga0501318_001432 | |||
| 1845 | Ga0501319_001212 | |||
| 1846 | Ga0501320_001857 | |||
| 1847 | Ga0501323_000523 | |||
| 1848 | Ga0501323_003091 | |||
| 1849 | Ga0501337_000660 | |||
| 1850 | Ga0501031_0000840 | |||
| 1851 | Ga0501032_0000748 | |||
| 1852 | Ga0501032_0032844 | |||
| 1853 | Ga0501032_0051218 | |||
| 1854 | Ga0501032_0164230 | |||
| 1855 | Ga0501033_0010390 | |||
| 1856 | Ga0501033_0013379 | |||
| 1857 | Ga0501033_0036119 | |||
| 1858 | Ga0501033_0051938 | |||
| 1859 | Ga0501033_0059171 | |||
| 1860 | Ga0501033_0138642 | |||
| 1861 | Ga0501033_0334775 | |||
| 1862 | Ga0501034_0004958 | |||
| 1863 | Ga0501034_0007581 | |||
| 1864 | Ga0501034_0018512 | |||
| 1865 | Ga0501034_0118030 | |||
| 1866 | Ga0501036_0005087 | |||
| 1867 | Ga0501036_0013563 | |||
| 1868 | Ga0501036_0016480 | |||
| 1869 | Ga0501036_0079441 | |||
| 1870 | Ga0501036_0169761 | |||
| 1871 | Ga0501037_0000768 | |||
| 1872 | Ga0501037_0002566 | |||
| 1873 | Ga0501037_0108275 | |||
| 1874 | Ga0501037_0130703 | |||
| 1875 | Ga0501037_0252703 | |||
| 1876 | Ga0501037_0293042 | |||
| 1877 | Ga0501038_0006044 | |||
| 1878 | Ga0501038_0006433 | |||
| 1879 | Ga0501038_0035652 | |||
| 1880 | Ga0501038_0066734 | |||
| 1881 | Ga0501038_0221279 | |||
| 1882 | Ga0501038_0308841 | |||
| 1883 | Ga0501039_0015133 | |||
| 1884 | Ga0501039_0059229 | |||
| 1885 | Ga0501039_0134066 | |||
| 1886 | Ga0501039_0153830 | |||
| 1887 | Ga0501040_0041612 | |||
| 1888 | Ga0501041_0000393 | |||
| 1889 | Ga0501042_0039170 | |||
| 1890 | Ga0501042_0048549 | |||
| 1891 | Ga0501042_0063155 | |||
| 1892 | Ga0501043_0004334 | |||
| 1893 | Ga0501043_0022486 | |||
| 1894 | Ga0501043_0033449 | |||
| 1895 | Ga0501043_0079231 | |||
| 1896 | Ga0501043_0372938 | |||
| 1897 | Ga0501046_0004955 | |||
| 1898 | Ga0501047_0000075 | |||
| 1899 | Ga0501047_0000280 | |||
| 1900 | Ga0501047_0022980 | |||
| 1901 | Ga0501047_0024459 | |||
| 1902 | Ga0501047_0186223 | |||
| 1903 | Ga0501047_0215868 | |||
| 1904 | Ga0501048_0010472 | |||
| 1905 | Ga0501048_0018005 | |||
| 1906 | Ga0501048_0284391 | |||
| 1907 | Ga0501067_0045893 | |||
| 1908 | Ga0501067_0080874 | |||
| 1909 | Ga0501068_0001340 | |||
| 1910 | Ga0501068_0316558 | |||
| 1911 | Ga0501069_0027195 | |||
| 1912 | Ga0501069_0045538 | |||
| 1913 | Ga0501070_0002096 | |||
| 1914 | Ga0501070_0016982 | |||
| 1915 | Ga0501070_0139993 | |||
| 1916 | Ga0501070_0280271 | |||
| 1917 | Ga0501071_0002524 | |||
| 1918 | Ga0501072_0001531 | |||
| 1919 | Ga0501073_0016631 | |||
| 1920 | Ga0501074_0010666 | |||
| 1921 | Ga0501074_0018178 | |||
| 1922 | Ga0501076_0071675 | |||
| 1923 | Ga0501077_0017475 | |||
| 1924 | Ga0501217_012817 | |||
| 1925 | Ga0501217_026130 | |||
| 1926 | Ga0501224_013126 | |||
| 1927 | Ga0501079_0010786 | |||
| 1928 | Ga0501079_0049481 | |||
| 1929 | Ga0501080_0026016 | |||
| 1930 | Ga0501080_0098838 | |||
| 1931 | Ga0501080_0321238 | |||
| 1932 | Ga0501083_0088997 | |||
| 1933 | Ga0501035_0000431 | |||
| 1934 | Ga0501035_0000477 | |||
| 1935 | Ga0501035_0002133 | |||
| 1936 | Ga0501035_0034739 | |||
| 1937 | Ga0501035_0079885 | |||
| 1938 | Ga0501035_0089210 | |||
| 1939 | Ga0501035_0121894 | |||
| 1940 | Ga0501035_0147684 | |||
| 1941 | Ga0501035_0212194 | |||
| 1942 | Ga0501035_0280799 | |||
| 1943 | Ga0501044_0001532 | |||
| 1944 | Ga0501044_0003263 | |||
| 1945 | Ga0501044_0003565 | |||
| 1946 | Ga0501044_0202332 | |||
| 1947 | Ga0501044_0340267 | |||
| 1948 | Ga0501045_0060587 | |||
| 1949 | nmdc:mga03n38_1658_c1 | |||
| 1950 | nmdc:mga03n38_168172_c1 | |||
| 1951 | nmdc:mga0yw44_24019_c1 | |||
| 1952 | nmdc:mga06z11_1588_c1 | |||
| 1953 | nmdc:mga06z11_3481_c1 | |||
| 1954 | nmdc:mga04h51_2417_c1 | |||
| 1955 | nmdc:mga07m45_66037_c1 | |||
| 1956 | nmdc:mga07m45_71601_c1 | |||
| 1957 | nmdc:mga05p37_12880_c1 | |||
| 1958 | nmdc:mga05p37_8911_c1 | |||
| 1959 | nmdc:mga09592_2470_c1 | |||
| 1960 | nmdc:mga0qj67_69908_c1 | |||
| 1961 | nmdc:mga06r32_996_c1 | |||
| 1962 | nmdc:mga08y16_33570_c1 | |||
| 1963 | nmdc:mga08y16_8676_c1 | |||
| 1964 | nmdc:mga0a205_113381_c1 | |||
| 1965 | Ga0495601_0003396 | |||
| 1966 | Ga0500610_0124137 | |||
| 1967 | Ga0495655_0011007 | |||
| 1968 | Ga0495655_0018106 | |||
| 1969 | Ga0495619_0001857 | |||
| 1970 | Ga0500578_0004537 | |||
| 1971 | Ga0500578_0200286 | |||
| 1972 | Ga0500644_0022930 | |||
| 1973 | Ga0500641_0028087 | |||
| 1974 | Ga0500650_0077208 | |||
| 1975 | Ga0500654_031980 | |||
| 1976 | Ga0500553_027252 | |||
| 1977 | Ga0500560_004068 | |||
| 1978 | Ga0500569_000539 | |||
| 1979 | Ga0500572_008164 | |||
| 1980 | Ga0500594_0073396 | |||
| 1981 | Ga0500621_021663 | |||
| 1982 | Ga0500628_001087 | |||
| 1983 | Ga0500652_000846 | |||
| 1984 | Ga0500658_0001364 | |||
| 1985 | Ga0500561_0000683 | |||
| 1986 | Ga0500573_0022463 | |||
| 1987 | Ga0500573_0039369 | |||
| 1988 | Ga0500573_0060456 | |||
| 1989 | Ga0500579_088304 | |||
| 1990 | Ga0500588_0009549 | |||
| 1991 | Ga0500600_0065965 | |||
| 1992 | Ga0500616_0034973 | |||
| 1993 | Ga0500633_0000167 | |||
| 1994 | Ga0500634_0000375 | |||
| 1995 | Ga0500656_000274 | |||
| 1996 | Ga0500587_002910 | |||
| 1997 | Ga0501084_0013243 | |||
| 1998 | Ga0501082_0001798 | |||
| 1999 | Ga0466962_0001332 | |||
| 2000 | Ga0466962_0016364 | |||
| 2001 | Ga0466962_0043597 | |||
| 2002 | Ga0530510_0092986 | |||
| 2003 | 2540607507 | |||
| 2004 | 2547406121 | |||
| 2005 | 2547412521 | |||
| 2006 | 2550901955 | |||
| 2007 | 2553394672 | |||
| 2008 | 2554257491 | |||
| 2009 | 2556064322 | |||
| 2010 | 2571531913 | |||
| 2011 | 2585298432 | |||
| 2012 | 2585305738 | |||
| 2013 | 2585311212 | |||
| 2014 | 2585311857 | |||
| 2015 | 2585314586 | |||
| 2016 | 2595087999 | |||
| 2017 | 2601638417 | |||
| 2018 | 2616693492 | |||
| 2019 | 2616904167 | |||
| 2020 | 2643740857 | |||
| 2021 | 2643763172 | |||
| 2022 | 2643900186 | |||
| 2023 | 2643947940 | |||
| 2024 | 2644262849 | |||
| 2025 | 2644266452 | |||
| 2026 | 2644390623 | |||
| 2027 | 2644405590 | |||
| 2028 | 2644433806 | |||
| 2029 | 2644438020 | |||
| 2030 | 2644443053 | |||
| 2031 | 2644455183 | |||
| 2032 | 2644463958 | |||
| 2033 | 2644539364 | |||
| 2034 | 2644631126 | |||
| 2035 | 2644701696 | |||
| 2036 | 2644710613 | |||
| 2037 | 2644717018 | |||
| 2038 | 2644721520 | |||
| 2039 | 2685151353 | |||
| 2040 | 2698321906 | |||
| 2041 | 2712199301 | |||
| 2042 | 2721506518 | |||
| 2043 | 2723603661 | |||
| 2044 | 2728529980 | |||
| 2045 | 2730139656 | |||
| 2046 | 2738816914 | |||
| 2047 | 2739231029 | |||
| 2048 | 2739231706 | |||
| 2049 | 2739267953 | |||
| 2050 | 2753269747 | |||
| 2051 | 2753808049 | |||
| 2052 | 2757565981 | |||
| 2053 | 2777762246 | |||
| 2054 | 2777836027 | |||
| 2055 | 2777838119 | |||
| 2056 | 2784589058 | |||
| 2057 | 2784591817 | |||
| 2058 | 2785339909 | |||
| 2059 | 2785342789 | |||
| 2060 | 2785370013 | |||
| 2061 | 2786671084 | |||
| 2062 | 2786675170 | |||
| 2063 | 2793980516 | |||
| 2064 | 2802435839 | |||
| 2065 | 2804846315 | |||
| 2066 | 2808842509 | |||
| 2067 | 2808845164 | |||
| 2068 | 2808914759 | |||
| 2069 | 2808921014 | |||
| 2070 | 2809055804 | |||
| 2071 | 2809232661 | |||
| 2072 | 2809235437 | |||
| 2073 | 2811845715 | |||
| 2074 | 2812354538 | |||
| 2075 | 2812357591 | |||
| 2076 | 2812477479 | |||
| 2077 | 2812480112 | |||
| 2078 | 2819580383 | |||
| 2079 | 2819697340 | |||
| 2080 | 2819708757 | |||
| 2081 | 2819741571 | |||
| 2082 | 2821117426 | |||
| 2083 | 2842883527 | |||
| 2084 | 2842886007 | |||
| 2085 | 2852636159 | |||
| 2086 | 2852637330 | |||
| 2087 | 2857478250 | |||
| 2088 | 2857587156 | |||
| 2089 | 2857605541 | |||
| 2090 | 2857608980 | |||
| 2091 | 2860840203 | |||
| 2092 | 2862178913 | |||
| 2093 | 2862283220 | |||
| 2094 | 2862286115 | |||
| 2095 | 2862295634 | |||
| 2096 | 2862384222 | |||
| 2097 | 2862388921 | |||
| 2098 | 2862508169 | |||
| 2099 | 2862512187 | |||
| 2100 | 2862578802 | |||
| 2101 | 2862583502 | |||
| 2102 | 2863410092 | |||
| 2103 | 2864735674 | |||
| 2104 | 2865000275 | |||
| 2105 | 2867372437 | |||
| 2106 | 2867428730 | |||
| 2107 | 2867431351 | |||
| 2108 | 2867480465 | |||
| 2109 | 2873155291 | |||
| 2110 | 2875395144 | |||
| 2111 | 2877680611 | |||
| 2112 | 2885532960 | |||
| 2113 | 2889047697 | |||
| 2114 | 2889279591 | |||
| 2115 | 2889298134 | |||
| 2116 | 2904162361 | |||
| 2117 | 2904495511 | |||
| 2118 | 2904525800 | |||
| 2119 | 2904528424 | |||
| 2120 | 2904596916 | |||
| 2121 | 2907206685 | |||
| 2122 | 2912716145 | |||
| 2123 | 2912719327 | |||
| 2124 | 2912723981 | |||
| 2125 | 2912729060 | |||
| 2126 | 2912731548 | |||
| 2127 | 2912761343 | |||
| 2128 | 2918505117 | |||
| 2129 | 2919145608 | |||
| 2130 | 2919147486 | |||
| 2131 | 2919164606 | |||
| 2132 | 2919471026 | |||
| 2133 | 2919471828 | |||
| 2134 | 2919517549 | |||
| 2135 | 2919521545 | |||
| 2136 | 2919721924 | |||
| 2137 | 2919723739 | |||
| 2138 | 2919725421 | |||
| 2139 | 2928094311 | |||
| 2140 | 2928098632 | |||
| 2141 | 2929005403 | |||
| 2142 | 2929007154 | |||
| 2143 | 2929237025 | |||
| 2144 | 2931384747 | |||
| 2145 | 2935390768 | |||
| 2146 | 2936341846 | |||
| 2147 | 2938921207 | |||
| 2148 | 2939684018 | |||
| 2149 | 2939703643 | |||
| 2150 | 2945996595 | |||
| 2151 | 2946049446 | |||
| 2152 | 2946059274 | |||
| 2153 | 2946068263 | |||
| 2154 | 2946071129 | |||
| 2155 | 2946076399 | |||
| 2156 | 2946079030 | |||
| 2157 | 2947225603 | |||
| 2158 | 2947228659 | |||
| 2159 | 2947430062 | |||
| 2160 | 2954006867 | |||
| 2161 | 2954009777 | |||
| 2162 | 2954382677 | |||
| 2163 | 2954385740 | |||
| 2164 | 2954677414 | |||
| 2165 | 2954680205 | |||
| 2166 | 2954683946 | |||
| 2167 | 2954686739 | |||
| 2168 | 2954693500 | |||
| 2169 | 2954696386 | |||
| 2170 | 2954705890 | |||
| 2171 | 2954708594 | |||
| 2172 | 2954713163 | |||
| 2173 | 2954715743 | |||
| 2174 | 2954723123 | |||
| 2175 | 2954725681 | |||
| 2176 | 2954736119 | |||
| 2177 | 2954738706 | |||
| 2178 | 2954742030 | |||
| 2179 | 2954744635 | |||
| 2180 | 2954754979 | |||
| 2181 | 2954757564 | |||
| 2182 | 2954761008 | |||
| 2183 | 2954763602 | |||
| 2184 | 2960321096 | |||
| 2185 | 2960321893 | |||
| 2186 | 2960377014 | |||
| 2187 | 2960380063 | |||
| 2188 | 2962293481 | |||
| 2189 | 2965764616 | |||
| 2190 | 2966602140 | |||
| 2191 | 2969139489 | |||
| 2192 | 2969767458 | |||
| 2193 | 2969773229 | |||
| 2194 | 2971409407 | |||
| 2195 | 2979086971 | |||
| 2196 | 2980126675 | |||
| 2197 | 2980495244 | |||
| 2198 | 2981286617 | |||
| 2199 | 2981291568 | |||
| 2200 | 2981982259 | |||
| 2201 | 2981987161 | |||
| 2202 | 2984532393 | |||
| 2203 | 2984533653 | |||
| 2204 | 2984593101 | |||
| 2205 | 2990061591 | |||
| 2206 | 2990065442 | |||
| 2207 | 2990091936 | |||
| 2208 | 2995468773 | |||
| 2209 | 2996709134 | |||
| 2210 | 2997459000 | |||
| 2211 | 2997604637 | |||
| 2212 | 3001893426 | |||
| 2213 | 3006325762 | |||
| 2214 | 3006425778 | |||
| 2215 | 3006488507 | |||
| 2216 | 3006496936 | |||
| 2217 | 3006499440 | |||
| 2218 | 3006976702 | |||
| 2219 | 648169955 | |||
| 2220 | 8008564111 | |||
| 2221 | 8008575975 | |||
| 2222 | 8008578476 | |||
| 2223 | 8022623118 | |||
| 2224 | 8022654371 | |||
| 2225 | 8022895186 | |||
| 2226 | 8022898673 | |||
| 2227 | 8022916026 | |||
| 2228 | 8022918803 | |||
| 2229 | 8022920587 | |||
| 2230 | 8022952631 | |||
| 2231 | 8023440128 | |||
| 2232 | 8023447019 | |||
| 2233 | 8023630548 | |||
| 2234 | 8023631577 | |||
| 2235 | 8025419924 | |||
| 2236 | 8025485550 | |||
| 2237 | 8033688264 | |||
| 2238 | 8047897551 | |||
| 2239 | 8048127861 | |||
| 2240 | 8048361319 | |||
| 2241 | 8048374538 | |||
| 2242 | 8048383684 | |||
| 2243 | 8048410260 | |||
| 2244 | 8048410872 | |||
| 2245 | 8054167477 | |||
| 2246 | 8054284149 | |||
| 2247 | 8054468971 | |||
| 2248 | 8056452931 | |||
| 2249 | 8056671945 | |||
| 2250 | 8056834271 | |||
| 2251 | 8056838010 | |||
| 2252 | 8057739219 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7exs-assembly1.cif.gz_A | thermomicrobium roseum sarcosine oxidase mutant - s320r | 0.9549 | 1 | 31 |
| 2bra-assembly1.cif.gz_A | structure of n-terminal fad binding motif of mouse mical | 0.9541 | 2 | 31 |
| 6ici-assembly1.cif.gz_A | crystal structure of human mical3 | 0.9442 | 2 | 31 |
| 1reo-assembly1.cif.gz_A | l-amino acid oxidase from agkistrodon halys pallas | 0.9424 | 2 | 30 |
| 3rp7-assembly1.cif.gz_A | crystal structure of klebsiella pneumoniae hpxo complexed with fad and uric acid | 0.9378 | 1 | 30 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6fqxH01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9538 | 2 | 160 | 3.40.50.720 |
| 2w8zA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9524 | 2 | 161 | 3.40.50.720 |
| af_Q4DU92_1_145_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9515 | 1 | 128 | 3.40.50.720 |
| 3i3lA01 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9381 | 2 | 31 | 3.50.50.60 |
| af_A0A1D6E7M3_47_537_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9361 | 3 | 30 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z0Q390-F1-model_v4 | 6-phosphogluconate dehydrogenase | 1.007 | 1 | 76 |
GO:0004616
GO:0050661 |
| AF-A0A6G2PXG9-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9959 | 83 | 176 |
GO:0004616
GO:0016054 GO:0050661 |
| AF-A0A7Z0Q390-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9939 | 1 | 76 |
GO:0004616
GO:0050661 |
| AF-A0A6B1KQ78-F1-model_v4 | 6-phosphogluconate dehydrogenase | 0.9934 | 1 | 178 |
GO:0004616
GO:0006098 GO:0016054 GO:0019521 GO:0050661 |
| AF-A0A4Q5YXB7-F1-model_v4 | deleted | 0.9932 | 1 | 125 |
|