F490488

General Info

Members Datasets Scaffolds Average Seq Length
1126 573 2252 294

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0032599|Ga0501034_0032599_2293_3291
Length 332
Sequence MSFIGYLKNDEKTQKILVMGGEDFAHQHKEKNMEIGFIGLGRMGANMVRRLLRDGHTVVAWNRTAAKTDEIVSEGAQGAYSIPELVEKLQTPRIVWIMVPSGQATDDMINEVTPLLSKGDIIIDGGNSNYHDSIRRSQELTAKGFQFMDAGTSGGIWGLKVGYCMMVGGEKATFEHVEPIIKSLAPPDGYLHCGPAGAGHFVKMVHNGIEYGMLQAYGEGFEILKAAKQYDLDLHAISHLWNQGSVVRSWLLELAELAFEHDADLSSIRGYVEDSGEGRWTVQQAIDTDVPAPVITLSLLERFRSRQDESFTAKVIAALRKEFGGHAVKSAE

Samples

Sample ID Description Type Environment
1 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
57 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013045 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
88 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
141 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
163 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
168 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
169 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
173 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
174 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
175 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
176 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
186 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
187 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
197 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
200 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
220 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
229 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
230 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
239 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
246 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
247 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
248 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
249 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
260 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
261 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
296 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
334 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
335 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
336 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
354 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
359 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
360 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
361 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
362 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
363 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
364 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
365 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
366 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
367 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
368 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
369 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
370 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
371 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
372 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
373 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
374 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
375 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
376 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
377 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
378 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
379 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
380 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
384 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
385 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
386 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
387 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
388 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
389 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
390 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
391 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
392 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
393 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
394 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
395 2600255286 Paenibacillus sp. NFR01 Isolate Rhizoplane
396 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
397 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
398 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
399 2643221548 Streptomyces sp. Root55 Isolate Unclassified
400 2643221578 Streptomyces sp. Root63 Isolate Unclassified
401 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
402 2643221647 Streptomyces sp. Root369 Isolate Unclassified
403 2643221670 Streptomyces sp. Root431 Isolate Unclassified
404 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
405 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
406 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
407 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
408 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
409 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
410 2643221714 Streptomyces sp. Root264 Isolate Unclassified
411 2643221729 Bacillus sp. Root11 Isolate Unclassified
412 2643221730 Bacillus sp. Root131 Isolate Unclassified
413 2643221731 Bacillus sp. Root147 Isolate Unclassified
414 2643221732 Bacillus sp. Root239 Isolate Unclassified
415 2684622632 Bacillus cereus 905 Isolate Unclassified
416 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
417 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
418 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
419 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
420 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
421 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
422 2738541295 Bacillus sp. OK085 Isolate Unclassified
423 2738543010 Bacillus sp. YR335 Isolate Unclassified
424 2738543017 Bacillus sp. OV186 Isolate Unclassified
425 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
426 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
427 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
428 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
429 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
430 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
431 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
432 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
433 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
434 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
435 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
436 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
437 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
438 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
439 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
440 2808606448 Streptomyces sp. 193411 Isolate Unclassified
441 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
442 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
443 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
444 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
445 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
446 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
447 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
448 2821111986 Paenibacillus illinoisensis 582 Isolate Unclassified
449 2842882022 Bacillus sp. R-71893 Isolate Unclassified
450 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
451 2857472729 Cohnella sp. R-74144 Isolate Unclassified
452 2857586860 Bacillus sp. R-71935 Isolate Unclassified
453 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
454 2860837431 Bacillus sp. WR11 Isolate Unclassified
455 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
456 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
457 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
458 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
459 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
460 2862574272 Streptomyces sp. AcE210 Isolate Nodule
461 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
462 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
463 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
464 2867369537 Streptomyces sp. Z26 Isolate Unclassified
465 2867428634 Streptomyces sp. RP5T Isolate Unclassified
466 2867475112 Streptomyces sp. TM32 Isolate Unclassified
467 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
468 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
469 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
470 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
471 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
472 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
473 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
474 2904162308 Paenibacillus sp. AD87 Isolate Unclassified
475 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
476 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
477 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
478 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
479 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
480 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
481 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
482 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
483 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
484 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
485 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
486 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
487 2919720352 Priestia megaterium 4340 Isolate Unclassified
488 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
489 2929004312 Priestia megaterium 1104 Isolate Unclassified
490 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
491 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
492 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
493 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
494 2938917290 Bacillus sp. CR71 Isolate Unclassified
495 2939679117 Paenibacillus sp. 4624 Isolate Rhizosphere
496 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
497 2945991243 Paenibacillus sp. B21a W2I17 Isolate Rhizosphere
498 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
499 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
500 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
501 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
502 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
503 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
504 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
505 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
506 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
507 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
508 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
509 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
510 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
511 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
512 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
513 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
514 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
515 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
516 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
517 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
518 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
519 2965761152 Bacillus sp. COPE52 Isolate Unclassified
520 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
521 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
522 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
523 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
524 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
525 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
526 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
527 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
528 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
529 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
530 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
531 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
532 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
533 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
534 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
535 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
536 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
537 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
538 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
539 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
540 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
541 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
542 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
543 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
544 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
545 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
546 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
547 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
548 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
549 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
550 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
551 8022653035 Bacillus sp. Rc4 Isolate Unclassified
552 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
553 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
554 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
555 8023438354 Bacillus sp. BH2 Isolate Unclassified
556 8023444577 Bacillus sp. BH32 Isolate Unclassified
557 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
558 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
559 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
560 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
561 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
562 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
563 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
564 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
565 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
566 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
567 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
568 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
569 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
570 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
571 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
572 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
573 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.27
Metatranscriptomes 4.53
Isolates 22.2

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 8.17
Nodule 0.53
Rhizoplane 3.73
Rhizosphere 70.43
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501034_0032599 3300049571 Bacteria 5290
2 JGI24737J22298_10003012 3300001990 Bacteria 5973
3 JGI24737J22298_10019642 3300001990 Bacteria 2160
4 JGI24737J22298_10055047 3300001990 Bacteria 1203
5 JGI24735J21928_10014360 3300002067 Bacteria 2481
6 JGI24738J21930_10002471 3300002075 Bacteria 4829
7 JGI24738J21930_10005279 3300002075 Bacteria 3113
8 JGI25159J45721_1002931 3300002987 Bacteria 6218
9 JGI25151J46595_10000677 3300003187 Bacteria 28790
10 JGI25151J46595_10002436 3300003187 Bacteria 11202
11 JGI25151J46595_10012375 3300003187 Bacteria 3884
12 JGI25151J46595_10018506 3300003187 Bacteria 2988
13 JGI25151J46595_10056874 3300003187 Bacteria 1279
14 rootL2_10101561 3300003322 Bacteria 6556
15 rootL2_10187682 3300003322 Bacteria 2610
16 JGI25160J50197_1026048 3300003354 Bacteria 1620
17 JGI25407J50210_10002819 3300003373 Bacteria 4137
18 Ga0006562J51391_1003739 3300003578 Bacteria 3570
19 Ga0006562J51391_1012963 3300003578 Bacteria 2301
20 Ga0006562J51391_1030540 3300003578 Bacteria 1518
21 Ga0006562J51391_1059892 3300003578 Bacteria 3240
22 Ga0055532_1000299 3300003758 Bacteria 30597
23 Ga0055532_1002253 3300003758 Bacteria 4207
24 Ga0055532_1003874 3300003758 Bacteria 2408
25 Ga0055528_1001788 3300003790 Bacteria 12329
26 Ga0055541_1000172 3300003841 Bacteria 30235
27 Ga0055541_1002886 3300003841 Bacteria 3324
28 Ga0058863_10171726 3300004799 Bacteria 2081
29 Ga0058862_10045293 3300004803 Bacteria 2421
30 Ga0070670_100270830 3300005331 Bacteria 1482
31 Ga0070670_100572786 3300005331 Bacteria 1009
32 Ga0068869_100031387 3300005334 Bacteria 3737
33 Ga0070682_100005588 3300005337 Bacteria 7007
34 Ga0068868_100004322 3300005338 Bacteria 9954
35 Ga0070689_100184113 3300005340 Bacteria 1698
36 Ga0070675_100005088 3300005354 Bacteria 10030
37 Ga0070675_100174667 3300005354 Bacteria 1854
38 Ga0070659_100071107 3300005366 Bacteria 2766
39 Ga0070713_100024496 3300005436 Bacteria 4702
40 Ga0070700_100001935 3300005441 Bacteria 10483
41 Ga0070700_100013018 3300005441 Bacteria 4666
42 Ga0070663_100003212 3300005455 Bacteria 9390
43 Ga0070678_100171437 3300005456 Bacteria 1768
44 Ga0068867_100004619 3300005459 Bacteria 9689
45 Ga0070679_100007936 3300005530 Bacteria 9963
46 Ga0070684_100022768 3300005535 Bacteria 5231
47 Ga0068853_100022563 3300005539 Bacteria 5258
48 Ga0068853_100045234 3300005539 Bacteria 3770
49 Ga0068853_100063647 3300005539 Bacteria 3195
50 Ga0070672_100138686 3300005543 Bacteria 2004
51 Ga0070696_100242147 3300005546 Bacteria 1361
52 Ga0070664_100028469 3300005564 Bacteria 4647
53 Ga0070664_100272784 3300005564 Bacteria 1524
54 Ga0068857_100003449 3300005577 Bacteria 13186
55 Ga0068857_100090466 3300005577 Bacteria 2739
56 Ga0068856_100263614 3300005614 Bacteria 1739
57 Ga0070702_100012209 3300005615 Bacteria 4297
58 Ga0070702_100086946 3300005615 Bacteria 1887
59 Ga0068852_100002664 3300005616 Bacteria 12345
60 Ga0068859_100392252 3300005617 Bacteria 1484
61 Ga0068861_100020787 3300005719 Bacteria 4707
62 Ga0068861_100039601 3300005719 Bacteria 3519
63 Ga0068870_10001343 3300005840 Bacteria 9920
64 Ga0068858_100386323 3300005842 Bacteria 1344
65 Ga0081455_10001942 3300005937 Bacteria 24845
66 Ga0081455_10011475 3300005937 Bacteria 8902
67 Ga0081455_10023202 3300005937 Bacteria 5778
68 Ga0081538_10001831 3300005981 Bacteria 21425
69 Ga0075365_10030881 3300006038 Bacteria 3435
70 Ga0075365_10043595 3300006038 Bacteria 2937
71 Ga0075368_10020319 3300006042 Bacteria 2514
72 Ga0075363_100074953 3300006048 Bacteria 1843
73 Ga0070715_10027329 3300006163 Bacteria 2279
74 Ga0075367_10001303 3300006178 Bacteria 10576
75 Ga0075370_10015300 3300006353 Bacteria 4104
76 Ga0075428_100020122 3300006844 Bacteria 7390
77 Ga0075428_100616939 3300006844 Bacteria 1158
78 Ga0075430_100005085 3300006846 Bacteria 11074
79 Ga0075431_100014862 3300006847 Bacteria 7881
80 Ga0075433_10098527 3300006852 Bacteria 2588
81 Ga0075429_100000903 3300006880 Bacteria 23469
82 Ga0075429_100374255 3300006880 Bacteria 1247
83 Ga0097620_100392294 3300006931 Bacteria 1484
84 Ga0099826_10028077 3300006948 Bacteria 4124
85 Ga0105251_10007962 3300009011 Bacteria 6434
86 Ga0105251_10012044 3300009011 Bacteria 4908
87 Ga0105251_10020194 3300009011 Bacteria 3504
88 Ga0105251_10035894 3300009011 Bacteria 2443
89 Ga0105251_10040437 3300009011 Bacteria 2273
90 Ga0105244_10077792 3300009036 Bacteria 1645
91 Ga0105250_10002799 3300009092 Bacteria 8556
92 Ga0105250_10002980 3300009092 Bacteria 8221
93 Ga0111539_10013281 3300009094 Bacteria 10292
94 Ga0111539_10166515 3300009094 Bacteria 2577
95 Ga0111539_10251718 3300009094 Bacteria 2057
96 Ga0105245_10001147 3300009098 Bacteria 23949
97 Ga0105245_10311999 3300009098 Bacteria 1547
98 Ga0105247_10241994 3300009101 Bacteria 1230
99 Ga0114129_10015252 3300009147 Bacteria 10936
100 Ga0105243_10023928 3300009148 Bacteria 4654
101 Ga0105243_10025967 3300009148 Bacteria 4482
102 Ga0105243_10071900 3300009148 Bacteria 2798
103 Ga0105243_10188957 3300009148 Bacteria 1798
104 Ga0105242_10005109 3300009176 Bacteria 10121
105 Ga0105248_10028922 3300009177 Bacteria 6178
106 Ga0105238_10033334 3300009551 Bacteria 5243
107 Ga0105238_10147446 3300009551 Bacteria 2329
108 Ga0105249_10350571 3300009553 Bacteria 1495
109 Ga0105249_10518614 3300009553 Bacteria 1239
110 Ga0105239_10719844 3300010375 Bacteria 1142
111 Ga0105246_10001109 3300011119 Bacteria 15648
112 Ga0105246_10002420 3300011119 Bacteria 11263
113 Ga0105246_10040795 3300011119 Bacteria 3135
114 Ga0154016_135814 3300013045 Bacteria 2105
115 Ga0157369_10030985 3300013105 Bacteria 5894
116 Ga0157374_10163606 3300013296 Bacteria 2168
117 Ga0157374_10191460 3300013296 Bacteria 2001
118 Ga0157378_10022811 3300013297 Bacteria 5510
119 Ga0157372_10044612 3300013307 Bacteria 4914
120 Ga0157372_10319350 3300013307 Bacteria 1808
121 Ga0157375_10133866 3300013308 Bacteria 2600
122 Ga0157380_10018782 3300014326 Bacteria 5140
123 Ga0182008_10000554 3300014497 Bacteria 27720
124 Ga0182008_10002136 3300014497 Bacteria 12605
125 Ga0157377_10005002 3300014745 Bacteria 6183
126 Ga0182007_10000292 3300015262 Bacteria 32543
127 Ga0182007_10001633 3300015262 Bacteria 11886
128 Ga0182005_1023082 3300015265 Bacteria 1703
129 Ga0182005_1032444 3300015265 Bacteria 1421
130 Ga0183367_1001 3300015688 Bacteria 1225545
131 Ga0183367_1008 3300015688 Bacteria 490626
132 Ga0163161_10057586 3300017792 Bacteria 2823
133 Ga0197907_10313398 3300020069 Bacteria 2437
134 Ga0197907_10644589 3300020069 Bacteria 1810
135 Ga0197907_10718981 3300020069 Bacteria 1630
136 Ga0197907_10823686 3300020069 Bacteria 2127
137 Ga0206356_11092319 3300020070 Bacteria 1777
138 Ga0206356_11480975 3300020070 Bacteria 2121
139 Ga0206349_1005955 3300020075 Bacteria 1877
140 Ga0206349_1324702 3300020075 Bacteria 1877
141 Ga0206349_1750765 3300020075 Bacteria 1594
142 Ga0206355_1079660 3300020076 Bacteria 1377
143 Ga0206355_1188050 3300020076 Bacteria 2667
144 Ga0206355_1194676 3300020076 Bacteria 2607
145 Ga0206355_1258842 3300020076 Bacteria 2169
146 Ga0206351_10182587 3300020077 Bacteria 1141
147 Ga0206351_10437743 3300020077 Bacteria 5150
148 Ga0206352_10587434 3300020078 Bacteria 1129
149 Ga0206350_10495155 3300020080 Bacteria 5705
150 Ga0206350_10725204 3300020080 Bacteria 3185
151 Ga0206350_10977944 3300020080 Bacteria 4278
152 Ga0206350_11345746 3300020080 Bacteria 1150
153 Ga0206354_10972849 3300020081 Bacteria 2929
154 Ga0206354_11693194 3300020081 Bacteria 1457
155 Ga0206353_10495354 3300020082 Bacteria 3823
156 Ga0154015_1524369 3300020610 Bacteria 1104
157 Ga0154015_1638209 3300020610 Bacteria 5110
158 Ga0224712_10005887 3300022467 Bacteria 3455
159 Ga0224712_10009437 3300022467 Bacteria 2941
160 Ga0224712_10155751 3300022467 Bacteria 1016
161 Ga0209566_100135 3300025225 Bacteria 91038
162 Ga0209566_100335 3300025225 Bacteria 41595
163 Ga0209566_101250 3300025225 Bacteria 8632
164 Ga0209147_100082 3300025229 Bacteria 194153
165 Ga0209147_100185 3300025229 Bacteria 74400
166 Ga0209147_101758 3300025229 Bacteria 6938
167 Ga0209147_102078 3300025229 Bacteria 5644
168 Ga0209147_102386 3300025229 Bacteria 4727
169 Ga0209437_100632 3300025233 Bacteria 20772
170 Ga0209258_102135 3300025242 Bacteria 5512
171 Ga0209673_1010173 3300025273 Bacteria 3992
172 Ga0209130_1000330 3300025284 Bacteria 54419
173 Ga0209130_1001162 3300025284 Bacteria 19005
174 Ga0209675_1025766 3300025291 Bacteria 1476
175 Ga0209676_1001704 3300025292 Bacteria 19032
176 Ga0209025_1000266 3300025294 Bacteria 122782
177 Ga0209025_1000368 3300025294 Bacteria 95103
178 Ga0209025_1000989 3300025294 Bacteria 42204
179 Ga0209025_1001769 3300025294 Bacteria 25768
180 Ga0209025_1002363 3300025294 Bacteria 20227
181 Ga0209025_1003354 3300025294 Bacteria 15352
182 Ga0209025_1003422 3300025294 Bacteria 15054
183 Ga0209025_1003732 3300025294 Bacteria 13972
184 Ga0209025_1004361 3300025294 Bacteria 12337
185 Ga0209025_1004544 3300025294 Bacteria 11960
186 Ga0209025_1004948 3300025294 Bacteria 11182
187 Ga0209025_1005588 3300025294 Bacteria 10173
188 Ga0209025_1009588 3300025294 Bacteria 6718
189 Ga0209025_1015545 3300025294 Bacteria 4577
190 Ga0209025_1015768 3300025294 Bacteria 4522
191 Ga0209025_1021819 3300025294 Bacteria 3425
192 Ga0209025_1033461 3300025294 Bacteria 2374
193 Ga0207426_1000938 3300025302 Bacteria 28962
194 Ga0207426_1004261 3300025302 Bacteria 7096
195 Ga0207426_1009876 3300025302 Bacteria 3741
196 Ga0207426_1023854 3300025302 Bacteria 2083
197 Ga0207697_10031484 3300025315 Bacteria 2170
198 Ga0207696_1004024 3300025711 Bacteria 6454
199 Ga0207696_1004115 3300025711 Bacteria 6365
200 Ga0207696_1010827 3300025711 Bacteria 3323
201 Ga0207696_1021441 3300025711 Bacteria 2069
202 Ga0207655_1000138 3300025728 Bacteria 140079
203 Ga0207655_1001364 3300025728 Bacteria 22904
204 Ga0207655_1004835 3300025728 Bacteria 9363
205 Ga0207655_1010450 3300025728 Bacteria 5627
206 Ga0207655_1042427 3300025728 Bacteria 1937
207 Ga0207713_1001636 3300025735 Bacteria 17463
208 Ga0207713_1010356 3300025735 Bacteria 5166
209 Ga0207713_1019937 3300025735 Bacteria 3265
210 Ga0207688_10006923 3300025901 Bacteria 6173
211 Ga0207647_10001942 3300025904 Bacteria 15807
212 Ga0207647_10023263 3300025904 Bacteria 4101
213 Ga0207643_10004307 3300025908 Bacteria 7651
214 Ga0207652_10146862 3300025921 Bacteria 2111
215 Ga0207646_10056443 3300025922 Bacteria 3510
216 Ga0207694_10068579 3300025924 Bacteria 2770
217 Ga0207659_10022419 3300025926 Bacteria 4204
218 Ga0207659_10023494 3300025926 Bacteria 4116
219 Ga0207687_10065145 3300025927 Bacteria 2587
220 Ga0207687_10149983 3300025927 Bacteria 1778
221 Ga0207687_10338172 3300025927 Bacteria 1223
222 Ga0207686_10130382 3300025934 Bacteria 1724
223 Ga0207686_10175698 3300025934 Bacteria 1514
224 Ga0207709_10004627 3300025935 Bacteria 7914
225 Ga0207709_10147163 3300025935 Bacteria 1627
226 Ga0207670_10098116 3300025936 Bacteria 2087
227 Ga0207669_10122529 3300025937 Bacteria 1768
228 Ga0207691_10013682 3300025940 Bacteria 7753
229 Ga0207689_10011605 3300025942 Bacteria 7548
230 Ga0207661_10017497 3300025944 Bacteria 5307
231 Ga0207679_10014257 3300025945 Bacteria 5221
232 Ga0207679_10270343 3300025945 Bacteria 1453
233 Ga0207677_10023520 3300026023 Bacteria 3809
234 Ga0207677_10298055 3300026023 Bacteria 1331
235 Ga0207639_10039392 3300026041 Bacteria 3521
236 Ga0207639_10072727 3300026041 Bacteria 2693
237 Ga0207639_10122799 3300026041 Bacteria 2136
238 Ga0207678_10004167 3300026067 Bacteria 12978
239 Ga0207708_10004420 3300026075 Bacteria 10361
240 Ga0207708_10004454 3300026075 Bacteria 10324
241 Ga0207702_10161097 3300026078 Bacteria 2049
242 Ga0207648_10000921 3300026089 Bacteria 33155
243 Ga0207674_10006994 3300026116 Bacteria 13196
244 Ga0207674_10022466 3300026116 Bacteria 6772
245 Ga0207675_100002005 3300026118 Bacteria 20311
246 Ga0207675_100104548 3300026118 Bacteria 2669
247 Ga0207683_10161594 3300026121 Bacteria 2025
248 Ga0209371_1006068 3300027312 Bacteria 4591
249 Ga0209371_1022153 3300027312 Bacteria 1524
250 Ga0209813_10002419 3300027866 Bacteria 4272
251 Ga0207428_10110983 3300027907 Bacteria 2111
252 Ga0207428_10287618 3300027907 Bacteria 1219
253 Ga0268265_10035867 3300028380 Bacteria 3628
254 Ga0307517_10001714 3300028786 Bacteria 36146
255 Ga0307517_10002640 3300028786 Bacteria 28593
256 Ga0307517_10004854 3300028786 Bacteria 20493
257 Ga0307515_10001593 3300028794 Bacteria 50590
258 Ga0307515_10014250 3300028794 Bacteria 14769
259 Ga0307515_10104883 3300028794 Bacteria 3371
260 Ga0307515_10234061 3300028794 Bacteria 1622
261 Ga0237817_10148 3300030083 Bacteria 20932
262 Ga0237817_10756 3300030083 Bacteria 2560
263 Ga0268256_1001844 3300030500 Bacteria 11807
264 Ga0307511_10045016 3300030521 Bacteria 3654
265 Ga0307511_10106400 3300030521 Bacteria 1811
266 Ga0307511_10174564 3300030521 Bacteria 1172
267 Ga0307512_10005962 3300030522 Bacteria 12518
268 Ga0307512_10010108 3300030522 Bacteria 9026
269 Ga0307512_10123438 3300030522 Bacteria 1653
270 Ga0307513_10003857 3300031456 Bacteria 20172
271 Ga0307513_10005869 3300031456 Bacteria 16132
272 Ga0307513_10033495 3300031456 Bacteria 5773
273 Ga0307513_10083573 3300031456 Bacteria 3283
274 Ga0307509_10022042 3300031507 Bacteria 7191
275 Ga0307509_10045336 3300031507 Bacteria 4742
276 Ga0307509_10106819 3300031507 Bacteria 2817
277 Ga0307509_10437587 3300031507 Bacteria 1004
278 Ga0307408_100009560 3300031548 Bacteria 6397
279 Ga0307408_100018205 3300031548 Bacteria 4715
280 Ga0307408_100195600 3300031548 Bacteria 1633
281 Ga0307508_10005641 3300031616 Bacteria 11862
282 Ga0307508_10006245 3300031616 Bacteria 11227
283 Ga0307508_10012163 3300031616 Bacteria 7871
284 Ga0307508_10032071 3300031616 Bacteria 4747
285 Ga0307508_10121325 3300031616 Bacteria 2216
286 Ga0307508_10127784 3300031616 Bacteria 2144
287 Ga0307508_10129037 3300031616 Bacteria 2132
288 Ga0307508_10273692 3300031616 Bacteria 1282
289 Ga0307514_10003791 3300031649 Bacteria 14236
290 Ga0307514_10142272 3300031649 Bacteria 1628
291 Ga0307514_10230784 3300031649 Bacteria 1122
292 Ga0307516_10001611 3300031730 Bacteria 31098
293 Ga0307516_10058354 3300031730 Bacteria 3757
294 Ga0307516_10059986 3300031730 Bacteria 3697
295 Ga0307516_10361540 3300031730 Bacteria 1116
296 Ga0307518_10051884 3300031838 Bacteria 2980
297 Ga0307518_10187482 3300031838 Bacteria 1390
298 Ga0307410_10164666 3300031852 Bacteria 1665
299 Ga0307410_10270147 3300031852 Bacteria 1330
300 Ga0307409_100197492 3300031995 Bacteria 1797
301 Ga0307409_100451200 3300031995 Bacteria 1241
302 Ga0307416_100071306 3300032002 Bacteria 2886
303 Ga0307415_100017436 3300032126 Bacteria 4306
304 Ga0307415_100249711 3300032126 Bacteria 1441
305 Ga0307507_10014438 3300033179 Bacteria 9417
306 Ga0307510_10019153 3300033180 Bacteria 8030
307 Ga0307510_10119186 3300033180 Bacteria 2350
308 Ga0373960_0081824 3300035121 Bacteria 1018
309 Ga0395900_0460686 3300037418 Bacteria 1226
310 Ga0395900_0613614 3300037418 Bacteria 1027
311 Ga0395898_0007697 3300037466 Bacteria 11437
312 Ga0395898_0011065 3300037466 Bacteria 9397
313 Ga0395898_0110460 3300037466 Bacteria 2635
314 Ga0395898_0136081 3300037466 Bacteria 2352
315 Ga0395898_0200666 3300037466 Bacteria 1904
316 Ga0436364_1248121 3300037853 Bacteria 41642
317 Ga0395901_0132397 3300038443 Bacteria 2620
318 Ga0395901_0250517 3300038443 Bacteria 1845
319 Ga0395901_0497764 3300038443 Bacteria 1241
320 Ga0400489_59289 3300039093 Bacteria 40018
321 Ga0436360_1314359 3300039438 Bacteria 1284
322 Ga0439436_0052915 3300041404 Bacteria 1144
323 Ga0439439_0014470 3300041406 Bacteria 1921
324 Ga0439466_0051095 3300041411 Bacteria 1355
325 Ga0451797_1337902 3300041453 Bacteria 1391
326 Ga0439433_0009719 3300041999 Bacteria 2099
327 Ga0439448_0016388 3300042005 Bacteria 2255
328 Ga0439448_0017788 3300042005 Bacteria 2173
329 Ga0439449_0012098 3300042007 Bacteria 3243
330 Ga0439449_0026644 3300042007 Bacteria 2157
331 Ga0439449_0078211 3300042007 Bacteria 1219
332 Ga0439457_000375 3300042014 Bacteria 12586
333 Ga0439457_001379 3300042014 Bacteria 7313
334 Ga0439457_011112 3300042014 Bacteria 2055
335 Ga0450894_000020 3300042131 Bacteria 23128
336 Ga0450898_000073 3300042134 Bacteria 8918
337 Ga0450900_007733 3300042136 Bacteria 1330
338 Ga0450900_015460 3300042136 Bacteria 1026
339 Ga0450903_000151 3300042138 Bacteria 15226
340 Ga0450903_000206 3300042138 Bacteria 13047
341 Ga0450906_000151 3300042145 Bacteria 12867
342 Ga0439458_0000704 3300042157 Bacteria 8638
343 Ga0439458_0001366 3300042157 Bacteria 6154
344 Ga0439458_0032753 3300042157 Bacteria 1243
345 Ga0450908_004319 3300042184 Bacteria 2740
346 Ga0466969_0016237 3300044656 Bacteria 3900
347 Ga0466969_0036448 3300044656 Bacteria 2484
348 Ga0466969_0043174 3300044656 Bacteria 2247
349 Ga0466972_0004374 3300044658 Bacteria 7063
350 Ga0466972_0005245 3300044658 Bacteria 6487
351 Ga0466972_0010871 3300044658 Bacteria 4567
352 Ga0466972_0031906 3300044658 Bacteria 2589
353 Ga0466972_0101062 3300044658 Bacteria 1364
354 Ga0466965_0002794 3300044683 Bacteria 7511
355 Ga0466965_0004242 3300044683 Bacteria 6374
356 Ga0466965_0069963 3300044683 Bacteria 1764
357 Ga0466966_0002002 3300044684 Bacteria 13213
358 Ga0466966_0002447 3300044684 Bacteria 12138
359 Ga0466966_0002519 3300044684 Bacteria 12007
360 Ga0466966_0116088 3300044684 Bacteria 1647
361 Ga0466966_0209760 3300044684 Bacteria 1177
362 Ga0466961_0003345 3300044693 Bacteria 10007
363 Ga0466961_0219231 3300044693 Bacteria 1173
364 Ga0466961_0298154 3300044693 Bacteria 985
365 Ga0466963_0001552 3300044694 Bacteria 12451
366 Ga0466963_0002581 3300044694 Bacteria 10163
367 Ga0466963_0004932 3300044694 Bacteria 7783
368 Ga0466963_0016525 3300044694 Bacteria 4590
369 Ga0466971_0000101 3300044719 Bacteria 31687
370 Ga0466971_0001250 3300044719 Bacteria 10589
371 Ga0466971_0051095 3300044719 Bacteria 1860
372 Ga0466971_0061221 3300044719 Bacteria 1702
373 Ga0466968_0133796 3300044735 Bacteria 1130
374 Ga0466968_0171315 3300044735 Bacteria 1006
375 Ga0466970_0002849 3300044765 Bacteria 8354
376 Ga0466970_0017776 3300044765 Bacteria 3676
377 Ga0466970_0021741 3300044765 Bacteria 3344
378 Ga0466957_0000616 3300044842 Bacteria 17989
379 Ga0466957_0000823 3300044842 Bacteria 15822
380 Ga0466957_0098168 3300044842 Bacteria 1843
381 Ga0466957_0121975 3300044842 Bacteria 1662
382 Ga0466957_0152979 3300044842 Bacteria 1493
383 Ga0466957_0192593 3300044842 Bacteria 1336
384 Ga0466960_0045063 3300044901 Bacteria 2105
385 Ga0466959_0000612 3300045049 Bacteria 20862
386 Ga0466959_0000836 3300045049 Bacteria 18179
387 Ga0466959_0001818 3300045049 Bacteria 13367
388 Ga0466959_0073493 3300045049 Bacteria 2473
389 Ga0466958_0007274 3300045836 Bacteria 6076
390 Ga0466958_0011249 3300045836 Bacteria 5037
391 Ga0466958_0093603 3300045836 Bacteria 1861
392 Ga0466967_0007959 3300045976 Bacteria 7712
393 Ga0466967_0016080 3300045976 Bacteria 5887
394 Ga0466967_0050690 3300045976 Bacteria 3635
395 Ga0466967_0051373 3300045976 Bacteria 3612
396 Ga0466967_0197333 3300045976 Bacteria 1905
397 Ga0466967_0204622 3300045976 Bacteria 1870
398 Ga0466967_0229459 3300045976 Bacteria 1767
399 Ga0466967_0281101 3300045976 Bacteria 1597
400 Ga0466967_0314901 3300045976 Bacteria 1508
401 Ga0495627_053532 3300046453 Bacteria 1208
402 Ga0495592_0006424 3300046454 Bacteria 8750
403 Ga0495592_0014672 3300046454 Bacteria 5948
404 Ga0495592_0111791 3300046454 Bacteria 1932
405 Ga0495603_0002262 3300046455 Bacteria 11309
406 Ga0495603_0007947 3300046455 Bacteria 6401
407 Ga0495603_0009906 3300046455 Bacteria 5769
408 Ga0495603_0013328 3300046455 Bacteria 4972
409 Ga0495603_0021338 3300046455 Bacteria 3922
410 Ga0495603_0040284 3300046455 Bacteria 2796
411 Ga0495603_0071419 3300046455 Bacteria 2040
412 Ga0495603_0161324 3300046455 Bacteria 1300
413 Ga0495603_0210903 3300046455 Bacteria 1121
414 Ga0495590_0037724 3300046457 Bacteria 1685
415 Ga0495591_052028 3300046458 Bacteria 1115
416 Ga0495629_0003145 3300046459 Bacteria 12499
417 Ga0495629_0008858 3300046459 Bacteria 7398
418 Ga0495629_0010079 3300046459 Bacteria 6894
419 Ga0495629_0016863 3300046459 Bacteria 5242
420 Ga0495629_0018750 3300046459 Bacteria 4946
421 Ga0495629_0020967 3300046459 Bacteria 4664
422 Ga0495629_0022356 3300046459 Bacteria 4510
423 Ga0495629_0022917 3300046459 Bacteria 4450
424 Ga0495629_0030267 3300046459 Bacteria 3839
425 Ga0495629_0031215 3300046459 Bacteria 3773
426 Ga0495629_0041490 3300046459 Bacteria 3238
427 Ga0495629_0070465 3300046459 Bacteria 2439
428 Ga0495629_0199780 3300046459 Bacteria 1382
429 Ga0495638_0038503 3300046460 Bacteria 3038
430 Ga0495641_0071813 3300046461 Bacteria 1553
431 Ga0495641_0086847 3300046461 Bacteria 1400
432 Ga0495651_0005293 3300046462 Bacteria 9836
433 Ga0495651_0290456 3300046462 Bacteria 1100
434 Ga0495653_0001013 3300046463 Bacteria 21659
435 Ga0495653_0019424 3300046463 Bacteria 5512
436 Ga0495580_0003679 3300046472 Bacteria 13005
437 Ga0495582_0079227 3300046473 Bacteria 1823
438 Ga0495582_0086578 3300046473 Bacteria 1744
439 Ga0495605_0062442 3300046474 Bacteria 1780
440 Ga0495639_0015199 3300046475 Bacteria 3335
441 Ga0495662_0000792 3300046476 Bacteria 15345
442 Ga0495662_0001198 3300046476 Bacteria 12809
443 Ga0495662_0001489 3300046476 Bacteria 11592
444 Ga0495662_0001839 3300046476 Bacteria 10633
445 Ga0495662_0054628 3300046476 Bacteria 1929
446 Ga0495662_0065920 3300046476 Bacteria 1751
447 Ga0495662_0090335 3300046476 Bacteria 1493
448 Ga0495664_0000843 3300046477 Bacteria 15738
449 Ga0495664_0001419 3300046477 Bacteria 12708
450 Ga0495664_0020583 3300046477 Bacteria 3805
451 Ga0495585_0009779 3300046492 Bacteria 5737
452 Ga0495585_0026138 3300046492 Bacteria 3335
453 Ga0495594_0001500 3300046499 Bacteria 12113
454 Ga0495594_0014868 3300046499 Bacteria 4084
455 Ga0495594_0015677 3300046499 Bacteria 3983
456 Ga0495594_0017275 3300046499 Bacteria 3809
457 Ga0495594_0022544 3300046499 Bacteria 3368
458 Ga0495594_0058991 3300046499 Bacteria 2121
459 Ga0495607_0012225 3300046501 Bacteria 5674
460 Ga0495607_0132497 3300046501 Bacteria 1295
461 Ga0495607_0182559 3300046501 Bacteria 1051
462 Ga0495608_0000571 3300046511 Bacteria 25313
463 Ga0495610_0022468 3300046512 Bacteria 3450
464 Ga0495618_0023098 3300046514 Bacteria 3842
465 Ga0495618_0081822 3300046514 Bacteria 2062
466 Ga0495620_0059282 3300046515 Bacteria 1600
467 Ga0495628_0004213 3300046516 Bacteria 12787
468 Ga0495628_0034586 3300046516 Bacteria 4063
469 Ga0495628_0200352 3300046516 Bacteria 1504
470 Ga0495630_0011805 3300046517 Bacteria 6330
471 Ga0495630_0016350 3300046517 Bacteria 5420
472 Ga0495630_0024711 3300046517 Bacteria 4440
473 Ga0495630_0078827 3300046517 Bacteria 2484
474 Ga0495631_0002818 3300046518 Bacteria 9653
475 Ga0495631_0050189 3300046518 Bacteria 1825
476 Ga0495632_0067803 3300046519 Bacteria 1720
477 Ga0495637_0042225 3300046520 Bacteria 1952
478 Ga0495643_0001620 3300046522 Bacteria 19894
479 Ga0495648_0071670 3300046524 Bacteria 2007
480 Ga0495666_0000455 3300046526 Bacteria 18214
481 Ga0495652_0039494 3300046529 Bacteria 4081
482 Ga0495652_0046351 3300046529 Bacteria 3732
483 Ga0495652_0057156 3300046529 Bacteria 3310
484 Ga0495652_0115687 3300046529 Bacteria 2148
485 Ga0495652_0314035 3300046529 Bacteria 1134
486 Ga0495654_0004463 3300046530 Bacteria 8298
487 Ga0495665_0001966 3300046531 Bacteria 11103
488 Ga0495665_0063533 3300046531 Bacteria 1949
489 Ga0495640_0004142 3300046533 Bacteria 11598
490 Ga0495640_0011997 3300046533 Bacteria 6641
491 Ga0495640_0033198 3300046533 Bacteria 3669
492 Ga0495640_0059238 3300046533 Bacteria 2609
493 Ga0495586_0014256 3300046535 Bacteria 4223
494 Ga0495587_0001439 3300046536 Bacteria 15855
495 Ga0495587_0002646 3300046536 Bacteria 11963
496 Ga0495587_0008063 3300046536 Bacteria 6792
497 Ga0495587_0029547 3300046536 Bacteria 3327
498 Ga0495609_0006715 3300046538 Bacteria 5835
499 Ga0495597_0023333 3300046542 Bacteria 2862
500 Ga0495597_0024603 3300046542 Bacteria 2777
501 Ga0495645_0003077 3300046543 Bacteria 11302
502 Ga0495645_0011980 3300046543 Bacteria 6111
503 Ga0495645_0021959 3300046543 Bacteria 4616
504 Ga0495645_0033635 3300046543 Bacteria 3740
505 Ga0495645_0098022 3300046543 Bacteria 2087
506 Ga0495622_0008760 3300046557 Bacteria 4687
507 Ga0495622_0011939 3300046557 Bacteria 4017
508 Ga0495622_0030419 3300046557 Bacteria 2523
509 Ga0495622_0032908 3300046557 Bacteria 2420
510 Ga0495622_0035093 3300046557 Bacteria 2339
511 Ga0495622_0075874 3300046557 Bacteria 1549
512 Ga0495667_0352619 3300046559 Bacteria 929
513 Ga0495668_0008893 3300046616 Bacteria 6213
514 Ga0495668_0050515 3300046616 Bacteria 2304
515 Ga0495668_0071903 3300046616 Bacteria 1901
516 Ga0495634_0004858 3300046642 Bacteria 10419
517 Ga0495634_0006160 3300046642 Bacteria 9132
518 Ga0495634_0009383 3300046642 Bacteria 7217
519 Ga0495634_0035246 3300046642 Bacteria 3428
520 Ga0495634_0230740 3300046642 Bacteria 1139
521 Ga0495611_0016020 3300046648 Bacteria 3205
522 Ga0495611_0090163 3300046648 Bacteria 1416
523 Ga0495625_0002746 3300046660 Bacteria 18634
524 Ga0495625_0018911 3300046660 Bacteria 5362
525 Ga0495625_0019263 3300046660 Bacteria 5299
526 Ga0495625_0036591 3300046660 Bacteria 3607
527 Ga0495625_0053301 3300046660 Bacteria 2893
528 Ga0495635_0000520 3300046663 Bacteria 24388
529 Ga0495635_0003307 3300046663 Bacteria 11139
530 Ga0495635_0065915 3300046663 Bacteria 2484
531 Ga0495635_0084600 3300046663 Bacteria 2170
532 Ga0495588_0003010 3300046674 Bacteria 7288
533 Ga0495588_0009429 3300046674 Bacteria 4511
534 Ga0495588_0013421 3300046674 Bacteria 3904
535 Ga0495588_0039663 3300046674 Bacteria 2400
536 Ga0495588_0052923 3300046674 Bacteria 2093
537 Ga0495657_0004158 3300046675 Bacteria 11592
538 Ga0495657_0008170 3300046675 Bacteria 8019
539 Ga0495657_0012641 3300046675 Bacteria 6262
540 Ga0495657_0013809 3300046675 Bacteria 5945
541 Ga0495657_0092574 3300046675 Bacteria 1936
542 Ga0495599_0006802 3300046678 Bacteria 6909
543 Ga0495599_0041151 3300046678 Bacteria 2902
544 Ga0495646_0000451 3300046680 Bacteria 21719
545 Ga0495646_0002442 3300046680 Bacteria 11409
546 Ga0495646_0017723 3300046680 Bacteria 4514
547 Ga0495646_0049442 3300046680 Bacteria 2552
548 Ga0495658_0011969 3300046683 Bacteria 4379
549 Ga0495658_0014079 3300046683 Bacteria 4078
550 Ga0495658_0068909 3300046683 Bacteria 2049
551 Ga0495613_0000812 3300046689 Bacteria 24196
552 Ga0495613_0001310 3300046689 Bacteria 19012
553 Ga0495613_0001531 3300046689 Bacteria 17600
554 Ga0495613_0015394 3300046689 Bacteria 5687
555 Ga0495613_0036809 3300046689 Bacteria 3629
556 Ga0495613_0068763 3300046689 Bacteria 2582
557 Ga0495613_0073622 3300046689 Bacteria 2488
558 Ga0495613_0077192 3300046689 Bacteria 2423
559 Ga0495613_0181730 3300046689 Bacteria 1489
560 Ga0495613_0183627 3300046689 Bacteria 1480
561 Ga0495613_0332808 3300046689 Bacteria 1046
562 Ga0495624_0087360 3300046690 Bacteria 1925
563 Ga0495670_0005368 3300046691 Bacteria 6302
564 Ga0495670_0099235 3300046691 Bacteria 1498
565 Ga0495670_0139686 3300046691 Bacteria 1266
566 Ga0495671_0036705 3300046692 Bacteria 2482
567 Ga0495671_0086916 3300046692 Bacteria 1531
568 Ga0495671_0170705 3300046692 Bacteria 1057
569 Ga0495649_0032193 3300046694 Bacteria 2889
570 Ga0495649_0086300 3300046694 Bacteria 1675
571 Ga0495589_0023920 3300046794 Bacteria 3107
572 Ga0495589_0137453 3300046794 Bacteria 1171
573 Ga0495600_0005973 3300046809 Bacteria 7369
574 Ga0495600_0032942 3300046809 Bacteria 3362
575 Ga0495600_0162236 3300046809 Bacteria 1445
576 Ga0495660_0003391 3300046810 Bacteria 9864
577 Ga0495660_0033793 3300046810 Bacteria 2864
578 Ga0495660_0138250 3300046810 Bacteria 1215
579 Ga0495581_0016497 3300047315 Bacteria 4292
580 Ga0495581_0022853 3300047315 Bacteria 3622
581 Ga0495581_0050050 3300047315 Bacteria 2413
582 Ga0495604_0000418 3300047317 Bacteria 38255
583 Ga0495604_0001157 3300047317 Bacteria 21810
584 Ga0495604_0031795 3300047317 Bacteria 4185
585 Ga0495636_0004330 3300047318 Bacteria 5569
586 Ga0495636_0008615 3300047318 Bacteria 4024
587 Ga0495636_0022969 3300047318 Bacteria 2523
588 Ga0495636_0029060 3300047318 Bacteria 2256
589 Ga0495636_0192588 3300047318 Bacteria 928
590 Ga0495674_0003023 3300047319 Bacteria 16371
591 Ga0495674_0063086 3300047319 Bacteria 3224
592 Ga0495674_0269207 3300047319 Bacteria 1398
593 Ga0495676_0003597 3300047321 Bacteria 14067
594 Ga0495676_0009846 3300047321 Bacteria 8684
595 Ga0495676_0011192 3300047321 Bacteria 8109
596 Ga0495676_0022567 3300047321 Bacteria 5473
597 Ga0495676_0024227 3300047321 Bacteria 5257
598 Ga0495676_0041190 3300047321 Bacteria 3803
599 Ga0495676_0046806 3300047321 Bacteria 3505
600 Ga0495676_0087935 3300047321 Bacteria 2332
601 Ga0495676_0120007 3300047321 Bacteria 1914
602 Ga0495676_0138253 3300047321 Bacteria 1748
603 Ga0495676_0147635 3300047321 Bacteria 1677
604 Ga0495676_0390675 3300047321 Bacteria 924
605 Ga0495680_0197309 3300047322 Bacteria 1445
606 Ga0495683_0057576 3300047323 Bacteria 1931
607 Ga0495683_0094183 3300047323 Bacteria 1447
608 Ga0495683_0145396 3300047323 Bacteria 1108
609 Ga0495687_003992 3300047443 Bacteria 10277
610 Ga0495687_013049 3300047443 Bacteria 4355
611 Ga0495687_016575 3300047443 Bacteria 3703
612 Ga0495675_0011451 3300047444 Bacteria 5568
613 Ga0495675_0017393 3300047444 Bacteria 4557
614 Ga0495675_0045903 3300047444 Bacteria 2782
615 Ga0495677_0015624 3300047445 Bacteria 2757
616 Ga0495677_0037006 3300047445 Bacteria 1783
617 Ga0495679_051356 3300047446 Bacteria 1236
618 Ga0495685_000328 3300047447 Bacteria 15284
619 Ga0495685_001867 3300047447 Bacteria 6509
620 Ga0495685_005504 3300047447 Bacteria 4137
621 Ga0495685_021077 3300047447 Bacteria 2241
622 Ga0495681_0000384 3300047470 Bacteria 34515
623 Ga0495681_0001688 3300047470 Bacteria 16353
624 Ga0495681_0021703 3300047470 Bacteria 3452
625 Ga0495681_0084747 3300047470 Bacteria 1408
626 Ga0495681_0146461 3300047470 Bacteria 994
627 Ga0495686_0011663 3300047472 Bacteria 6187
628 Ga0495686_0048908 3300047472 Bacteria 2664
629 Ga0495686_0125480 3300047472 Bacteria 1526
630 Ga0495593_0000135 3300047673 Bacteria 35475
631 Ga0495593_0003672 3300047673 Bacteria 9162
632 Ga0495593_0032228 3300047673 Bacteria 2858
633 Ga0495602_0034385 3300048088 Bacteria 4741
634 Ga0495602_0251419 3300048088 Bacteria 1317
635 Ga0495614_0000327 3300048089 Bacteria 18876
636 Ga0495614_0002106 3300048089 Bacteria 8792
637 Ga0495614_0009702 3300048089 Bacteria 4253
638 Ga0495614_0052660 3300048089 Bacteria 1744
639 Ga0495614_0180074 3300048089 Bacteria 950
640 Ga0496100_0011953 3300048903 Bacteria 4959
641 Ga0496100_0085504 3300048903 Bacteria 2140
642 Ga0496101_0001378 3300048904 Bacteria 14556
643 Ga0496101_0203172 3300048904 Bacteria 1532
644 Ga0496102_0035885 3300048905 Bacteria 4465
645 Ga0496102_0094963 3300048905 Bacteria 2763
646 Ga0496102_0110642 3300048905 Bacteria 2560
647 Ga0496103_0003726 3300048906 Bacteria 9269
648 Ga0496103_0007158 3300048906 Bacteria 6653
649 Ga0496104_0001068 3300048907 Bacteria 23391
650 Ga0496104_0001635 3300048907 Bacteria 19341
651 Ga0496105_0001522 3300048908 Bacteria 16387
652 Ga0496105_0008146 3300048908 Bacteria 8147
653 Ga0496106_0001739 3300048909 Bacteria 16260
654 Ga0496106_0004604 3300048909 Bacteria 10231
655 Ga0496106_0105671 3300048909 Bacteria 2188
656 Ga0496106_0264257 3300048909 Bacteria 1377
657 Ga0496107_0000946 3300048910 Bacteria 17189
658 Ga0496107_0021381 3300048910 Bacteria 4572
659 Ga0496108_0000834 3300048911 Bacteria 23974
660 Ga0496108_0007659 3300048911 Bacteria 8742
661 Ga0496108_0100339 3300048911 Bacteria 2469
662 Ga0496109_0000669 3300048912 Bacteria 28378
663 Ga0496109_0036283 3300048912 Bacteria 4449
664 Ga0496109_0050477 3300048912 Bacteria 3789
665 Ga0496110_0004219 3300048913 Bacteria 11119
666 Ga0496110_0007682 3300048913 Bacteria 8628
667 Ga0496110_0056695 3300048913 Bacteria 3448
668 Ga0496110_0101778 3300048913 Bacteria 2576
669 Ga0496110_0129762 3300048913 Bacteria 2275
670 Ga0496111_0038089 3300048914 Bacteria 3443
671 Ga0496111_0079030 3300048914 Bacteria 2399
672 Ga0496111_0109019 3300048914 Bacteria 2038
673 Ga0496112_0029246 3300048915 Bacteria 5327
674 Ga0496112_0043129 3300048915 Bacteria 4415
675 Ga0496113_0013252 3300048916 Bacteria 5577
676 Ga0496113_0027469 3300048916 Bacteria 4080
677 Ga0496114_0051562 3300048917 Bacteria 3426
678 Ga0496116_0001212 3300048919 Bacteria 30077
679 Ga0496116_0019680 3300048919 Bacteria 5160
680 Ga0496116_0043757 3300048919 Bacteria 3047
681 Ga0496116_0105204 3300048919 Bacteria 1675
682 Ga0496117_0025194 3300048920 Bacteria 4682
683 Ga0496117_0066485 3300048920 Bacteria 2445
684 Ga0496118_0036460 3300048921 Bacteria 3975
685 Ga0496118_0154867 3300048921 Bacteria 1428
686 Ga0496119_0002031 3300048922 Bacteria 22903
687 Ga0496119_0009286 3300048922 Bacteria 8467
688 Ga0496119_0009488 3300048922 Bacteria 8344
689 Ga0496120_0008195 3300048923 Bacteria 7657
690 Ga0496121_0089982 3300048924 Bacteria 2401
691 Ga0496121_0121580 3300048924 Bacteria 1971
692 Ga0496122_0009809 3300048925 Bacteria 10000
693 Ga0496122_0047054 3300048925 Bacteria 3333
694 Ga0496122_0068114 3300048925 Bacteria 2558
695 Ga0496122_0072979 3300048925 Bacteria 2436
696 Ga0496122_0081119 3300048925 Bacteria 2259
697 Ga0496123_0009353 3300048926 Bacteria 8836
698 Ga0496123_0067864 3300048926 Bacteria 2250
699 Ga0496124_0088559 3300048927 Bacteria 2530
700 Ga0496124_0164588 3300048927 Bacteria 1725
701 Ga0496124_0256365 3300048927 Bacteria 1290
702 Ga0496125_0000883 3300048928 Bacteria 47568
703 Ga0496125_0007698 3300048928 Bacteria 11415
704 Ga0496125_0012620 3300048928 Bacteria 8367
705 Ga0496125_0029195 3300048928 Bacteria 4961
706 Ga0496126_0059399 3300048929 Bacteria 3444
707 Ga0496126_0141044 3300048929 Bacteria 2074
708 Ga0501341_00183 3300049131 Bacteria 2214
709 Ga0501343_003627 3300049132 Bacteria 1141
710 Ga0501305_000889 3300049161 Bacteria 2688
711 Ga0501311_002822 3300049527 Bacteria 1706
712 Ga0501312_000166 3300049528 Bacteria 4379
713 Ga0501312_017741 3300049528 Bacteria 1030
714 Ga0501313_000516 3300049529 Bacteria 2691
715 Ga0501315_000363 3300049531 Bacteria 3008
716 Ga0501316_007029 3300049532 Bacteria 1213
717 Ga0501316_009787 3300049532 Bacteria 1082
718 Ga0501318_001432 3300049534 Bacteria 1872
719 Ga0501319_001212 3300049535 Bacteria 1446
720 Ga0501320_001857 3300049536 Bacteria 1612
721 Ga0501323_000523 3300049539 Bacteria 2886
722 Ga0501323_003091 3300049539 Bacteria 1674
723 Ga0501337_000660 3300049553 Bacteria 1784
724 Ga0501031_0000840 3300049568 Bacteria 18484
725 Ga0501032_0000748 3300049569 Bacteria 26429
726 Ga0501032_0032844 3300049569 Bacteria 3556
727 Ga0501032_0051218 3300049569 Bacteria 2784
728 Ga0501032_0164230 3300049569 Bacteria 1457
729 Ga0501033_0010390 3300049570 Bacteria 7140
730 Ga0501033_0013379 3300049570 Bacteria 6249
731 Ga0501033_0036119 3300049570 Bacteria 3703
732 Ga0501033_0051938 3300049570 Bacteria 3038
733 Ga0501033_0059171 3300049570 Bacteria 2829
734 Ga0501033_0138642 3300049570 Bacteria 1759
735 Ga0501033_0334775 3300049570 Bacteria 1062
736 Ga0501034_0004958 3300049571 Bacteria 14654
737 Ga0501034_0007581 3300049571 Bacteria 11548
738 Ga0501034_0018512 3300049571 Bacteria 7140
739 Ga0501034_0118030 3300049571 Bacteria 2640
740 Ga0501036_0005087 3300049572 Bacteria 10642
741 Ga0501036_0013563 3300049572 Bacteria 6774
742 Ga0501036_0016480 3300049572 Bacteria 6172
743 Ga0501036_0079441 3300049572 Bacteria 2774
744 Ga0501036_0169761 3300049572 Bacteria 1838
745 Ga0501037_0000768 3300049573 Bacteria 24111
746 Ga0501037_0002566 3300049573 Bacteria 13117
747 Ga0501037_0108275 3300049573 Bacteria 2002
748 Ga0501037_0130703 3300049573 Bacteria 1800
749 Ga0501037_0252703 3300049573 Bacteria 1233
750 Ga0501037_0293042 3300049573 Bacteria 1131
751 Ga0501038_0006044 3300049574 Bacteria 11206
752 Ga0501038_0006433 3300049574 Bacteria 10873
753 Ga0501038_0035652 3300049574 Bacteria 4367
754 Ga0501038_0066734 3300049574 Bacteria 3063
755 Ga0501038_0221279 3300049574 Bacteria 1510
756 Ga0501038_0308841 3300049574 Bacteria 1239
757 Ga0501039_0015133 3300049575 Bacteria 5902
758 Ga0501039_0059229 3300049575 Bacteria 2966
759 Ga0501039_0134066 3300049575 Bacteria 1944
760 Ga0501039_0153830 3300049575 Bacteria 1807
761 Ga0501040_0041612 3300049576 Bacteria 3129
762 Ga0501041_0000393 3300049577 Bacteria 21984
763 Ga0501042_0039170 3300049578 Bacteria 3367
764 Ga0501042_0048549 3300049578 Bacteria 3027
765 Ga0501042_0063155 3300049578 Bacteria 2647
766 Ga0501043_0004334 3300049579 Bacteria 11548
767 Ga0501043_0022486 3300049579 Bacteria 4943
768 Ga0501043_0033449 3300049579 Bacteria 4045
769 Ga0501043_0079231 3300049579 Bacteria 2581
770 Ga0501043_0372938 3300049579 Bacteria 1081
771 Ga0501046_0004955 3300049580 Bacteria 11957
772 Ga0501047_0000075 3300049581 Bacteria 124995
773 Ga0501047_0000280 3300049581 Bacteria 59132
774 Ga0501047_0022980 3300049581 Bacteria 5986
775 Ga0501047_0024459 3300049581 Bacteria 5795
776 Ga0501047_0186223 3300049581 Bacteria 1941
777 Ga0501047_0215868 3300049581 Bacteria 1775
778 Ga0501048_0010472 3300049582 Bacteria 6921
779 Ga0501048_0018005 3300049582 Bacteria 5198
780 Ga0501048_0284391 3300049582 Bacteria 1176
781 Ga0501067_0045893 3300049583 Bacteria 2425
782 Ga0501067_0080874 3300049583 Bacteria 1801
783 Ga0501068_0001340 3300049584 Bacteria 13053
784 Ga0501068_0316558 3300049584 Bacteria 1000
785 Ga0501069_0027195 3300049585 Bacteria 3134
786 Ga0501069_0045538 3300049585 Bacteria 2431
787 Ga0501070_0002096 3300049586 Bacteria 17499
788 Ga0501070_0016982 3300049586 Bacteria 6105
789 Ga0501070_0139993 3300049586 Bacteria 1998
790 Ga0501070_0280271 3300049586 Bacteria 1360
791 Ga0501071_0002524 3300049587 Bacteria 11139
792 Ga0501072_0001531 3300049588 Bacteria 17282
793 Ga0501073_0016631 3300049589 Bacteria 5328
794 Ga0501074_0010666 3300049590 Bacteria 6670
795 Ga0501074_0018178 3300049590 Bacteria 5106
796 Ga0501076_0071675 3300049592 Bacteria 2772
797 Ga0501077_0017475 3300049593 Bacteria 4528
798 Ga0501217_012817 3300049661 Bacteria 1873
799 Ga0501217_026130 3300049661 Bacteria 1409
800 Ga0501224_013126 3300049664 Bacteria 1223
801 Ga0501079_0010786 3300049741 Bacteria 6957
802 Ga0501079_0049481 3300049741 Bacteria 3244
803 Ga0501080_0026016 3300049742 Bacteria 5437
804 Ga0501080_0098838 3300049742 Bacteria 2708
805 Ga0501080_0321238 3300049742 Bacteria 1401
806 Ga0501083_0088997 3300049744 Bacteria 2040
807 Ga0501035_0000431 3300049822 Bacteria 47303
808 Ga0501035_0000477 3300049822 Bacteria 44891
809 Ga0501035_0002133 3300049822 Bacteria 19679
810 Ga0501035_0034739 3300049822 Bacteria 4579
811 Ga0501035_0079885 3300049822 Bacteria 2888
812 Ga0501035_0089210 3300049822 Bacteria 2716
813 Ga0501035_0121894 3300049822 Bacteria 2278
814 Ga0501035_0147684 3300049822 Bacteria 2041
815 Ga0501035_0212194 3300049822 Bacteria 1656
816 Ga0501035_0280799 3300049822 Bacteria 1407
817 Ga0501044_0001532 3300049823 Bacteria 27104
818 Ga0501044_0003263 3300049823 Bacteria 18246
819 Ga0501044_0003565 3300049823 Bacteria 17510
820 Ga0501044_0202332 3300049823 Bacteria 1943
821 Ga0501044_0340267 3300049823 Bacteria 1421
822 Ga0501045_0060587 3300049824 Bacteria 2774
823 nmdc:mga03n38_1658_c1 3300050490 Bacteria 6531
824 nmdc:mga03n38_168172_c1 3300050490 Bacteria 1115
825 nmdc:mga0yw44_24019_c1 3300050492 Bacteria 3443
826 nmdc:mga06z11_1588_c1 3300050494 Bacteria 8469
827 nmdc:mga06z11_3481_c1 3300050494 Bacteria 6096
828 nmdc:mga04h51_2417_c1 3300050495 Bacteria 4428
829 nmdc:mga07m45_66037_c1 3300050496 Bacteria 2055
830 nmdc:mga07m45_71601_c1 3300050496 Bacteria 1972
831 nmdc:mga05p37_12880_c1 3300050507 Bacteria 10000
832 nmdc:mga05p37_8911_c1 3300050507 Bacteria 11859
833 nmdc:mga09592_2470_c1 3300050508 Bacteria 14923
834 nmdc:mga0qj67_69908_c1 3300050509 Bacteria 2800
835 nmdc:mga06r32_996_c1 3300050510 Bacteria 25413
836 nmdc:mga08y16_33570_c1 3300050511 Bacteria 5389
837 nmdc:mga08y16_8676_c1 3300050511 Bacteria 10661
838 nmdc:mga0a205_113381_c1 3300050515 Bacteria 2610
839 Ga0495601_0003396 3300053077 Bacteria 9126
840 Ga0500610_0124137 3300053079 Bacteria 1318
841 Ga0495655_0011007 3300053083 Bacteria 1804
842 Ga0495655_0018106 3300053083 Bacteria 1544
843 Ga0495619_0001857 3300053085 Bacteria 14059
844 Ga0500578_0004537 3300053086 Bacteria 9721
845 Ga0500578_0200286 3300053086 Bacteria 1222
846 Ga0500644_0022930 3300053088 Bacteria 1889
847 Ga0500641_0028087 3300053096 Bacteria 2195
848 Ga0500650_0077208 3300053098 Bacteria 1556
849 Ga0500654_031980 3300053099 Bacteria 3147
850 Ga0500553_027252 3300053101 Bacteria 2871
851 Ga0500560_004068 3300053107 Bacteria 3057
852 Ga0500569_000539 3300053109 Bacteria 6326
853 Ga0500572_008164 3300053111 Bacteria 2440
854 Ga0500594_0073396 3300053118 Bacteria 1010
855 Ga0500621_021663 3300053126 Bacteria 2468
856 Ga0500628_001087 3300053129 Bacteria 4747
857 Ga0500652_000846 3300053131 Bacteria 10103
858 Ga0500658_0001364 3300053134 Bacteria 9879
859 Ga0500561_0000683 3300053137 Bacteria 5381
860 Ga0500573_0022463 3300053140 Bacteria 3621
861 Ga0500573_0039369 3300053140 Bacteria 2731
862 Ga0500573_0060456 3300053140 Bacteria 2170
863 Ga0500579_088304 3300053143 Bacteria 1690
864 Ga0500588_0009549 3300053146 Bacteria 2310
865 Ga0500600_0065965 3300053149 Bacteria 2001
866 Ga0500616_0034973 3300053153 Bacteria 2733
867 Ga0500633_0000167 3300053160 Bacteria 8877
868 Ga0500634_0000375 3300053161 Bacteria 14256
869 Ga0500656_000274 3300053732 Bacteria 3544
870 Ga0500587_002910 3300053739 Bacteria 2422
871 Ga0501084_0013243 3300054114 Bacteria 6825
872 Ga0501082_0001798 3300060353 Bacteria 18878
873 Ga0466962_0001332 3300061719 Bacteria 11408
874 Ga0466962_0016364 3300061719 Bacteria 3575
875 Ga0466962_0043597 3300061719 Bacteria 2146
876 Ga0530510_0092986 3300061734 Bacteria 2201
877 2540607507 2540341094 Bacteria 4061186
878 2547406121 2547132111 Bacteria 8013147
879 2547412521 2547132111 Bacteria 8013147
880 2550901955 2548877040 Bacteria 7507281
881 2553394672 2551306519 Bacteria 5465154
882 2554257491 2554235005 Bacteria 6457341
883 2556064322 2554235469 Bacteria 3590176
884 2571531913 2571042143 Bacteria 6986194
885 2585298432 2582581312 Bacteria 7308206
886 2585305738 2582581313 Bacteria 10042643
887 2585311212 2582581313 Bacteria 10042643
888 2585311857 2582581314 Bacteria 11452267
889 2585314586 2582581314 Bacteria 11452267
890 2595087999 2593339131 Bacteria 5116855
891 2601638417 2600255286 Bacteria 5390125
892 2616693492 2616644814 Bacteria 11555299
893 2616904167 2616644941 Bacteria 8510691
894 2643740857 2643221543 Bacteria 6628015
895 2643763172 2643221548 Bacteria 8053412
896 2643900186 2643221578 Bacteria 9213798
897 2643947940 2643221587 Bacteria 7586415
898 2644262849 2643221647 Bacteria 10741251
899 2644266452 2643221647 Bacteria 10741251
900 2644390623 2643221670 Bacteria 6497041
901 2644405590 2643221673 Bacteria 9196637
902 2644433806 2643221677 Bacteria 7584031
903 2644438020 2643221678 Bacteria 9540101
904 2644443053 2643221678 Bacteria 9540101
905 2644455183 2643221681 Bacteria 3707866
906 2644463958 2643221682 Bacteria 6743283
907 2644539364 2643221697 Bacteria 3575694
908 2644631126 2643221714 Bacteria 9015452
909 2644701696 2643221729 Bacteria 6621700
910 2644710613 2643221730 Bacteria 6523787
911 2644717018 2643221731 Bacteria 5623886
912 2644721520 2643221732 Bacteria 5756404
913 2685151353 2684622632 Bacteria 5380049
914 2698321906 2695420987 Bacteria 6152737
915 2712199301 2711768088 Bacteria 3195027
916 2721506518 2718218445 Bacteria 5113413
917 2723603661 2721755693 Bacteria 6126117
918 2728529980 2728368933 Bacteria 7044283
919 2730139656 2728369359 Bacteria 5621728
920 2738816914 2738541295 Bacteria 5730091
921 2739231029 2738543010 Bacteria 5583595
922 2739231706 2738543010 Bacteria 5583595
923 2739267953 2738543017 Bacteria 4271950
924 2753269747 2751185782 Bacteria 11227053
925 2753808049 2751185905 Bacteria 6142767
926 2757565981 2757320391 Bacteria 4746095
927 2777762246 2775507177 Bacteria 4384303
928 2777836027 2775507192 Bacteria 4622234
929 2777838119 2775507192 Bacteria 4622234
930 2784589058 2784132148 Bacteria 8627943
931 2784591817 2784132148 Bacteria 8627943
932 2785339909 2784746763 Bacteria 9783172
933 2785342789 2784746763 Bacteria 9783172
934 2785370013 2784746768 Bacteria 10036182
935 2786671084 2786546132 Bacteria 10419719
936 2786675170 2786546132 Bacteria 10419719
937 2793980516 2791355406 Bacteria 11364898
938 2802435839 2802428803 Bacteria 5806948
939 2804846315 2802429296 Bacteria 7227771
940 2808842509 2808606359 Bacteria 9866990
941 2808845164 2808606359 Bacteria 9866990
942 2808914759 2808606375 Bacteria 9466072
943 2808921014 2808606375 Bacteria 9466072
944 2809055804 2808606399 Bacteria 4021018
945 2809232661 2808606448 Bacteria 8656184
946 2809235437 2808606448 Bacteria 8656184
947 2811845715 2808606982 Bacteria 7791042
948 2812354538 2811994879 Bacteria 9313447
949 2812357591 2811994879 Bacteria 9313447
950 2812477479 2811994917 Bacteria 7761064
951 2812480112 2811994917 Bacteria 7761064
952 2819580383 2818991443 Bacteria 6598732
953 2819697340 2818991463 Bacteria 7948711
954 2819708757 2818991465 Bacteria 5388835
955 2819741571 2818991472 Bacteria 10089953
956 2821117426 2821111986 Bacteria 6894338
957 2842883527 2842882022 Bacteria 6158489
958 2842886007 2842882022 Bacteria 6158489
959 2852636159 2852635781 Bacteria 8251373
960 2852637330 2852635781 Bacteria 8251373
961 2857478250 2857472729 Bacteria 6568124
962 2857587156 2857586860 Bacteria 4354574
963 2857605541 2857604169 Bacteria 5111450
964 2857608980 2857604169 Bacteria 5111450
965 2860840203 2860837431 Bacteria 4202080
966 2862178913 2862178590 Bacteria 8583590
967 2862283220 2862281513 Bacteria 9621493
968 2862286115 2862281513 Bacteria 9621493
969 2862295634 2862290372 Bacteria 7471434
970 2862384222 2862382967 Bacteria 10317375
971 2862388921 2862382967 Bacteria 10317375
972 2862508169 2862507626 Bacteria 9425308
973 2862512187 2862507626 Bacteria 9425308
974 2862578802 2862574272 Bacteria 10567477
975 2862583502 2862574272 Bacteria 10567477
976 2863410092 2863404153 Bacteria 9672205
977 2864735674 2864733723 Bacteria 6770668
978 2865000275 2864997549 Bacteria 5139696
979 2867372437 2867369537 Bacteria 6501581
980 2867428730 2867428634 Bacteria 9590268
981 2867431351 2867428634 Bacteria 9590268
982 2867480465 2867475112 Bacteria 6909112
983 2873155291 2873151551 Bacteria 8625867
984 2875395144 2875391855 Bacteria 7600475
985 2877680611 2877676314 Bacteria 9512378
986 2885532960 2885526491 Bacteria 7164189
987 2889047697 2889042446 Bacteria 7618936
988 2889279591 2889276214 Bacteria 5979355
989 2889298134 2889295896 Bacteria 4704906
990 2904162361 2904162308 Bacteria 7086713
991 2904495511 2904490793 Bacteria 7046938
992 2904525800 2904524088 Bacteria 5887454
993 2904528424 2904524088 Bacteria 5887454
994 2904596916 2904595352 Bacteria 6124848
995 2907206685 2907202186 Bacteria 6632024
996 2912716145 2912715099 Bacteria 9460473
997 2912719327 2912715099 Bacteria 9460473
998 2912723981 2912723979 Bacteria 8557534
999 2912729060 2912723979 Bacteria 8557534
1000 2912731548 2912723979 Bacteria 8557534
1001 2912761343 2912757875 Bacteria 7940295
1002 2918505117 2918501144 Bacteria 8668083
1003 2919145608 2919143609 Bacteria 6219228
1004 2919147486 2919143609 Bacteria 6219228
1005 2919164606 2919160200 Bacteria 6929020
1006 2919471026 2919468124 Bacteria 9133025
1007 2919471828 2919468124 Bacteria 9133025
1008 2919517549 2919517244 Bacteria 5858162
1009 2919521545 2919517244 Bacteria 5858162
1010 2919721924 2919720352 Bacteria 5986006
1011 2919723739 2919720352 Bacteria 5986006
1012 2919725421 2919720352 Bacteria 5986006
1013 2928094311 2928093941 Bacteria 5965005
1014 2928098632 2928093941 Bacteria 5965005
1015 2929005403 2929004312 Bacteria 5678476
1016 2929007154 2929004312 Bacteria 5678476
1017 2929237025 2929233124 Bacteria 5948380
1018 2931384747 2931384279 Bacteria 7299545
1019 2935390768 2935390628 Bacteria 7043367
1020 2936341846 2936340661 Bacteria 5139038
1021 2938921207 2938917290 Bacteria 5914775
1022 2939684018 2939679117 Bacteria 6921672
1023 2939703643 2939702853 Bacteria 5139229
1024 2945996595 2945991243 Bacteria 7008369
1025 2946049446 2946045630 Bacteria 8527308
1026 2946059274 2946053406 Bacteria 6978655
1027 2946068263 2946064051 Bacteria 8957905
1028 2946071129 2946064051 Bacteria 8957905
1029 2946076399 2946072368 Bacteria 8999607
1030 2946079030 2946072368 Bacteria 8999607
1031 2947225603 2947224130 Bacteria 9938529
1032 2947228659 2947224130 Bacteria 9938529
1033 2947430062 2947426588 Bacteria 5357194
1034 2954006867 2954002825 Bacteria 9173742
1035 2954009777 2954002825 Bacteria 9173742
1036 2954382677 2954380949 Bacteria 10050426
1037 2954385740 2954380949 Bacteria 10050426
1038 2954677414 2954673503 Bacteria 9685905
1039 2954680205 2954673503 Bacteria 9685905
1040 2954683946 2954682443 Bacteria 9862841
1041 2954686739 2954682443 Bacteria 9862841
1042 2954693500 2954691527 Bacteria 10720516
1043 2954696386 2954691527 Bacteria 10720516
1044 2954705890 2954701450 Bacteria 10834262
1045 2954708594 2954701450 Bacteria 10834262
1046 2954713163 2954711539 Bacteria 10867210
1047 2954715743 2954711539 Bacteria 10867210
1048 2954723123 2954721474 Bacteria 10456478
1049 2954725681 2954721474 Bacteria 10456478
1050 2954736119 2954731030 Bacteria 10243860
1051 2954738706 2954731030 Bacteria 10243860
1052 2954742030 2954740390 Bacteria 10229294
1053 2954744635 2954740390 Bacteria 10229294
1054 2954754979 2954749733 Bacteria 10366972
1055 2954757564 2954749733 Bacteria 10366972
1056 2954761008 2954759201 Bacteria 9358192
1057 2954763602 2954759201 Bacteria 9358192
1058 2960321096 2960319331 Bacteria 5502575
1059 2960321893 2960319331 Bacteria 5502575
1060 2960377014 2960375949 Bacteria 5361395
1061 2960380063 2960375949 Bacteria 5361395
1062 2962293481 2962290636 Bacteria 4072939
1063 2965764616 2965761152 Bacteria 5806513
1064 2966602140 2966598605 Bacteria 7676064
1065 2969139489 2969136845 Bacteria 3923176
1066 2969767458 2969765954 Bacteria 4216713
1067 2969773229 2969770375 Bacteria 4271280
1068 2971409407 2971403814 Bacteria 7370929
1069 2979086971 2979083700 Bacteria 5894929
1070 2980126675 2980125574 Bacteria 5567337
1071 2980495244 2980492589 Bacteria 4072961
1072 2981286617 2981284811 Bacteria 4641497
1073 2981291568 2981289755 Bacteria 4641509
1074 2981982259 2981980479 Bacteria 4641628
1075 2981987161 2981985349 Bacteria 4641497
1076 2984532393 2984527788 Bacteria 5288478
1077 2984533653 2984532647 Bacteria 5288506
1078 2984593101 2984592036 Bacteria 3670284
1079 2990061591 2990059506 Bacteria 9321252
1080 2990065442 2990059506 Bacteria 9321252
1081 2990091936 2990088156 Bacteria 6657676
1082 2995468773 2995463766 Bacteria 8577691
1083 2996709134 2996706504 Bacteria 5757485
1084 2997459000 2997451912 Bacteria 8492419
1085 2997604637 2997600082 Bacteria 9896405
1086 3001893426 3001892409 Bacteria 6328293
1087 3006325762 3006321560 Bacteria 8247479
1088 3006425778 3006425503 Bacteria 6491253
1089 3006488507 3006486233 Bacteria 8157040
1090 3006496936 3006493962 Bacteria 8825450
1091 3006499440 3006493962 Bacteria 8825450
1092 3006976702 3006973921 Bacteria 4423788
1093 648169955 648028048 Bacteria 5394884
1094 8008564111 8008558824 Bacteria 10610750
1095 8008575975 8008574985 Bacteria 7815457
1096 8008578476 8008574985 Bacteria 7815457
1097 8022623118 8022621104 Bacteria 5241040
1098 8022654371 8022653035 Bacteria 4035078
1099 8022895186 8022893055 Bacteria 5300455
1100 8022898673 8022893055 Bacteria 5300455
1101 8022916026 8022914991 Bacteria 5584517
1102 8022918803 8022914991 Bacteria 5584517
1103 8022920587 8022914991 Bacteria 5584517
1104 8022952631 8022948649 Bacteria 5366783
1105 8023440128 8023438354 Bacteria 5779374
1106 8023447019 8023444577 Bacteria 5661597
1107 8023630548 8023623736 Bacteria 8593882
1108 8023631577 8023623736 Bacteria 8593882
1109 8025419924 8025413630 Bacteria 7014048
1110 8025485550 8025478263 Bacteria 8209203
1111 8033688264 8033684223 Bacteria 6906479
1112 8047897551 8047893842 Bacteria 11723082
1113 8048127861 8048127548 Bacteria 11053136
1114 8048361319 8048356638 Bacteria 11044339
1115 8048374538 8048369669 Bacteria 11666822
1116 8048383684 8048379754 Bacteria 11877923
1117 8048410260 8048406513 Bacteria 8936924
1118 8048410872 8048406513 Bacteria 8936924
1119 8054167477 8054160619 Bacteria 7783213
1120 8054284149 8054280661 Bacteria 4232245
1121 8054468971 8054465665 Bacteria 7323556
1122 8056452931 8056447290 Bacteria 7680491
1123 8056671945 8056667051 Bacteria 6953971
1124 8056834271 8056829672 Bacteria 9045328
1125 8056838010 8056829672 Bacteria 9045328
1126 8057739219 8057733483 Bacteria 6578323
1127 Ga0501034_0032599
1128 JGI24737J22298_10003012
1129 JGI24737J22298_10019642
1130 JGI24737J22298_10055047
1131 JGI24735J21928_10014360
1132 JGI24738J21930_10002471
1133 JGI24738J21930_10005279
1134 JGI25159J45721_1002931
1135 JGI25151J46595_10000677
1136 JGI25151J46595_10002436
1137 JGI25151J46595_10012375
1138 JGI25151J46595_10018506
1139 JGI25151J46595_10056874
1140 rootL2_10101561
1141 rootL2_10187682
1142 JGI25160J50197_1026048
1143 JGI25407J50210_10002819
1144 Ga0006562J51391_1003739
1145 Ga0006562J51391_1012963
1146 Ga0006562J51391_1030540
1147 Ga0006562J51391_1059892
1148 Ga0055532_1000299
1149 Ga0055532_1002253
1150 Ga0055532_1003874
1151 Ga0055528_1001788
1152 Ga0055541_1000172
1153 Ga0055541_1002886
1154 Ga0058863_10171726
1155 Ga0058862_10045293
1156 Ga0070670_100270830
1157 Ga0070670_100572786
1158 Ga0068869_100031387
1159 Ga0070682_100005588
1160 Ga0068868_100004322
1161 Ga0070689_100184113
1162 Ga0070675_100005088
1163 Ga0070675_100174667
1164 Ga0070659_100071107
1165 Ga0070713_100024496
1166 Ga0070700_100001935
1167 Ga0070700_100013018
1168 Ga0070663_100003212
1169 Ga0070678_100171437
1170 Ga0068867_100004619
1171 Ga0070679_100007936
1172 Ga0070684_100022768
1173 Ga0068853_100022563
1174 Ga0068853_100045234
1175 Ga0068853_100063647
1176 Ga0070672_100138686
1177 Ga0070696_100242147
1178 Ga0070664_100028469
1179 Ga0070664_100272784
1180 Ga0068857_100003449
1181 Ga0068857_100090466
1182 Ga0068856_100263614
1183 Ga0070702_100012209
1184 Ga0070702_100086946
1185 Ga0068852_100002664
1186 Ga0068859_100392252
1187 Ga0068861_100020787
1188 Ga0068861_100039601
1189 Ga0068870_10001343
1190 Ga0068858_100386323
1191 Ga0081455_10001942
1192 Ga0081455_10011475
1193 Ga0081455_10023202
1194 Ga0081538_10001831
1195 Ga0075365_10030881
1196 Ga0075365_10043595
1197 Ga0075368_10020319
1198 Ga0075363_100074953
1199 Ga0070715_10027329
1200 Ga0075367_10001303
1201 Ga0075370_10015300
1202 Ga0075428_100020122
1203 Ga0075428_100616939
1204 Ga0075430_100005085
1205 Ga0075431_100014862
1206 Ga0075433_10098527
1207 Ga0075429_100000903
1208 Ga0075429_100374255
1209 Ga0097620_100392294
1210 Ga0099826_10028077
1211 Ga0105251_10007962
1212 Ga0105251_10012044
1213 Ga0105251_10020194
1214 Ga0105251_10035894
1215 Ga0105251_10040437
1216 Ga0105244_10077792
1217 Ga0105250_10002799
1218 Ga0105250_10002980
1219 Ga0111539_10013281
1220 Ga0111539_10166515
1221 Ga0111539_10251718
1222 Ga0105245_10001147
1223 Ga0105245_10311999
1224 Ga0105247_10241994
1225 Ga0114129_10015252
1226 Ga0105243_10023928
1227 Ga0105243_10025967
1228 Ga0105243_10071900
1229 Ga0105243_10188957
1230 Ga0105242_10005109
1231 Ga0105248_10028922
1232 Ga0105238_10033334
1233 Ga0105238_10147446
1234 Ga0105249_10350571
1235 Ga0105249_10518614
1236 Ga0105239_10719844
1237 Ga0105246_10001109
1238 Ga0105246_10002420
1239 Ga0105246_10040795
1240 Ga0154016_135814
1241 Ga0157369_10030985
1242 Ga0157374_10163606
1243 Ga0157374_10191460
1244 Ga0157378_10022811
1245 Ga0157372_10044612
1246 Ga0157372_10319350
1247 Ga0157375_10133866
1248 Ga0157380_10018782
1249 Ga0182008_10000554
1250 Ga0182008_10002136
1251 Ga0157377_10005002
1252 Ga0182007_10000292
1253 Ga0182007_10001633
1254 Ga0182005_1023082
1255 Ga0182005_1032444
1256 Ga0183367_1001
1257 Ga0183367_1008
1258 Ga0163161_10057586
1259 Ga0197907_10313398
1260 Ga0197907_10644589
1261 Ga0197907_10718981
1262 Ga0197907_10823686
1263 Ga0206356_11092319
1264 Ga0206356_11480975
1265 Ga0206349_1005955
1266 Ga0206349_1324702
1267 Ga0206349_1750765
1268 Ga0206355_1079660
1269 Ga0206355_1188050
1270 Ga0206355_1194676
1271 Ga0206355_1258842
1272 Ga0206351_10182587
1273 Ga0206351_10437743
1274 Ga0206352_10587434
1275 Ga0206350_10495155
1276 Ga0206350_10725204
1277 Ga0206350_10977944
1278 Ga0206350_11345746
1279 Ga0206354_10972849
1280 Ga0206354_11693194
1281 Ga0206353_10495354
1282 Ga0154015_1524369
1283 Ga0154015_1638209
1284 Ga0224712_10005887
1285 Ga0224712_10009437
1286 Ga0224712_10155751
1287 Ga0209566_100135
1288 Ga0209566_100335
1289 Ga0209566_101250
1290 Ga0209147_100082
1291 Ga0209147_100185
1292 Ga0209147_101758
1293 Ga0209147_102078
1294 Ga0209147_102386
1295 Ga0209437_100632
1296 Ga0209258_102135
1297 Ga0209673_1010173
1298 Ga0209130_1000330
1299 Ga0209130_1001162
1300 Ga0209675_1025766
1301 Ga0209676_1001704
1302 Ga0209025_1000266
1303 Ga0209025_1000368
1304 Ga0209025_1000989
1305 Ga0209025_1001769
1306 Ga0209025_1002363
1307 Ga0209025_1003354
1308 Ga0209025_1003422
1309 Ga0209025_1003732
1310 Ga0209025_1004361
1311 Ga0209025_1004544
1312 Ga0209025_1004948
1313 Ga0209025_1005588
1314 Ga0209025_1009588
1315 Ga0209025_1015545
1316 Ga0209025_1015768
1317 Ga0209025_1021819
1318 Ga0209025_1033461
1319 Ga0207426_1000938
1320 Ga0207426_1004261
1321 Ga0207426_1009876
1322 Ga0207426_1023854
1323 Ga0207697_10031484
1324 Ga0207696_1004024
1325 Ga0207696_1004115
1326 Ga0207696_1010827
1327 Ga0207696_1021441
1328 Ga0207655_1000138
1329 Ga0207655_1001364
1330 Ga0207655_1004835
1331 Ga0207655_1010450
1332 Ga0207655_1042427
1333 Ga0207713_1001636
1334 Ga0207713_1010356
1335 Ga0207713_1019937
1336 Ga0207688_10006923
1337 Ga0207647_10001942
1338 Ga0207647_10023263
1339 Ga0207643_10004307
1340 Ga0207652_10146862
1341 Ga0207646_10056443
1342 Ga0207694_10068579
1343 Ga0207659_10022419
1344 Ga0207659_10023494
1345 Ga0207687_10065145
1346 Ga0207687_10149983
1347 Ga0207687_10338172
1348 Ga0207686_10130382
1349 Ga0207686_10175698
1350 Ga0207709_10004627
1351 Ga0207709_10147163
1352 Ga0207670_10098116
1353 Ga0207669_10122529
1354 Ga0207691_10013682
1355 Ga0207689_10011605
1356 Ga0207661_10017497
1357 Ga0207679_10014257
1358 Ga0207679_10270343
1359 Ga0207677_10023520
1360 Ga0207677_10298055
1361 Ga0207639_10039392
1362 Ga0207639_10072727
1363 Ga0207639_10122799
1364 Ga0207678_10004167
1365 Ga0207708_10004420
1366 Ga0207708_10004454
1367 Ga0207702_10161097
1368 Ga0207648_10000921
1369 Ga0207674_10006994
1370 Ga0207674_10022466
1371 Ga0207675_100002005
1372 Ga0207675_100104548
1373 Ga0207683_10161594
1374 Ga0209371_1006068
1375 Ga0209371_1022153
1376 Ga0209813_10002419
1377 Ga0207428_10110983
1378 Ga0207428_10287618
1379 Ga0268265_10035867
1380 Ga0307517_10001714
1381 Ga0307517_10002640
1382 Ga0307517_10004854
1383 Ga0307515_10001593
1384 Ga0307515_10014250
1385 Ga0307515_10104883
1386 Ga0307515_10234061
1387 Ga0237817_10148
1388 Ga0237817_10756
1389 Ga0268256_1001844
1390 Ga0307511_10045016
1391 Ga0307511_10106400
1392 Ga0307511_10174564
1393 Ga0307512_10005962
1394 Ga0307512_10010108
1395 Ga0307512_10123438
1396 Ga0307513_10003857
1397 Ga0307513_10005869
1398 Ga0307513_10033495
1399 Ga0307513_10083573
1400 Ga0307509_10022042
1401 Ga0307509_10045336
1402 Ga0307509_10106819
1403 Ga0307509_10437587
1404 Ga0307408_100009560
1405 Ga0307408_100018205
1406 Ga0307408_100195600
1407 Ga0307508_10005641
1408 Ga0307508_10006245
1409 Ga0307508_10012163
1410 Ga0307508_10032071
1411 Ga0307508_10121325
1412 Ga0307508_10127784
1413 Ga0307508_10129037
1414 Ga0307508_10273692
1415 Ga0307514_10003791
1416 Ga0307514_10142272
1417 Ga0307514_10230784
1418 Ga0307516_10001611
1419 Ga0307516_10058354
1420 Ga0307516_10059986
1421 Ga0307516_10361540
1422 Ga0307518_10051884
1423 Ga0307518_10187482
1424 Ga0307410_10164666
1425 Ga0307410_10270147
1426 Ga0307409_100197492
1427 Ga0307409_100451200
1428 Ga0307416_100071306
1429 Ga0307415_100017436
1430 Ga0307415_100249711
1431 Ga0307507_10014438
1432 Ga0307510_10019153
1433 Ga0307510_10119186
1434 Ga0373960_0081824
1435 Ga0395900_0460686
1436 Ga0395900_0613614
1437 Ga0395898_0007697
1438 Ga0395898_0011065
1439 Ga0395898_0110460
1440 Ga0395898_0136081
1441 Ga0395898_0200666
1442 Ga0436364_1248121
1443 Ga0395901_0132397
1444 Ga0395901_0250517
1445 Ga0395901_0497764
1446 Ga0400489_59289
1447 Ga0436360_1314359
1448 Ga0439436_0052915
1449 Ga0439439_0014470
1450 Ga0439466_0051095
1451 Ga0451797_1337902
1452 Ga0439433_0009719
1453 Ga0439448_0016388
1454 Ga0439448_0017788
1455 Ga0439449_0012098
1456 Ga0439449_0026644
1457 Ga0439449_0078211
1458 Ga0439457_000375
1459 Ga0439457_001379
1460 Ga0439457_011112
1461 Ga0450894_000020
1462 Ga0450898_000073
1463 Ga0450900_007733
1464 Ga0450900_015460
1465 Ga0450903_000151
1466 Ga0450903_000206
1467 Ga0450906_000151
1468 Ga0439458_0000704
1469 Ga0439458_0001366
1470 Ga0439458_0032753
1471 Ga0450908_004319
1472 Ga0466969_0016237
1473 Ga0466969_0036448
1474 Ga0466969_0043174
1475 Ga0466972_0004374
1476 Ga0466972_0005245
1477 Ga0466972_0010871
1478 Ga0466972_0031906
1479 Ga0466972_0101062
1480 Ga0466965_0002794
1481 Ga0466965_0004242
1482 Ga0466965_0069963
1483 Ga0466966_0002002
1484 Ga0466966_0002447
1485 Ga0466966_0002519
1486 Ga0466966_0116088
1487 Ga0466966_0209760
1488 Ga0466961_0003345
1489 Ga0466961_0219231
1490 Ga0466961_0298154
1491 Ga0466963_0001552
1492 Ga0466963_0002581
1493 Ga0466963_0004932
1494 Ga0466963_0016525
1495 Ga0466971_0000101
1496 Ga0466971_0001250
1497 Ga0466971_0051095
1498 Ga0466971_0061221
1499 Ga0466968_0133796
1500 Ga0466968_0171315
1501 Ga0466970_0002849
1502 Ga0466970_0017776
1503 Ga0466970_0021741
1504 Ga0466957_0000616
1505 Ga0466957_0000823
1506 Ga0466957_0098168
1507 Ga0466957_0121975
1508 Ga0466957_0152979
1509 Ga0466957_0192593
1510 Ga0466960_0045063
1511 Ga0466959_0000612
1512 Ga0466959_0000836
1513 Ga0466959_0001818
1514 Ga0466959_0073493
1515 Ga0466958_0007274
1516 Ga0466958_0011249
1517 Ga0466958_0093603
1518 Ga0466967_0007959
1519 Ga0466967_0016080
1520 Ga0466967_0050690
1521 Ga0466967_0051373
1522 Ga0466967_0197333
1523 Ga0466967_0204622
1524 Ga0466967_0229459
1525 Ga0466967_0281101
1526 Ga0466967_0314901
1527 Ga0495627_053532
1528 Ga0495592_0006424
1529 Ga0495592_0014672
1530 Ga0495592_0111791
1531 Ga0495603_0002262
1532 Ga0495603_0007947
1533 Ga0495603_0009906
1534 Ga0495603_0013328
1535 Ga0495603_0021338
1536 Ga0495603_0040284
1537 Ga0495603_0071419
1538 Ga0495603_0161324
1539 Ga0495603_0210903
1540 Ga0495590_0037724
1541 Ga0495591_052028
1542 Ga0495629_0003145
1543 Ga0495629_0008858
1544 Ga0495629_0010079
1545 Ga0495629_0016863
1546 Ga0495629_0018750
1547 Ga0495629_0020967
1548 Ga0495629_0022356
1549 Ga0495629_0022917
1550 Ga0495629_0030267
1551 Ga0495629_0031215
1552 Ga0495629_0041490
1553 Ga0495629_0070465
1554 Ga0495629_0199780
1555 Ga0495638_0038503
1556 Ga0495641_0071813
1557 Ga0495641_0086847
1558 Ga0495651_0005293
1559 Ga0495651_0290456
1560 Ga0495653_0001013
1561 Ga0495653_0019424
1562 Ga0495580_0003679
1563 Ga0495582_0079227
1564 Ga0495582_0086578
1565 Ga0495605_0062442
1566 Ga0495639_0015199
1567 Ga0495662_0000792
1568 Ga0495662_0001198
1569 Ga0495662_0001489
1570 Ga0495662_0001839
1571 Ga0495662_0054628
1572 Ga0495662_0065920
1573 Ga0495662_0090335
1574 Ga0495664_0000843
1575 Ga0495664_0001419
1576 Ga0495664_0020583
1577 Ga0495585_0009779
1578 Ga0495585_0026138
1579 Ga0495594_0001500
1580 Ga0495594_0014868
1581 Ga0495594_0015677
1582 Ga0495594_0017275
1583 Ga0495594_0022544
1584 Ga0495594_0058991
1585 Ga0495607_0012225
1586 Ga0495607_0132497
1587 Ga0495607_0182559
1588 Ga0495608_0000571
1589 Ga0495610_0022468
1590 Ga0495618_0023098
1591 Ga0495618_0081822
1592 Ga0495620_0059282
1593 Ga0495628_0004213
1594 Ga0495628_0034586
1595 Ga0495628_0200352
1596 Ga0495630_0011805
1597 Ga0495630_0016350
1598 Ga0495630_0024711
1599 Ga0495630_0078827
1600 Ga0495631_0002818
1601 Ga0495631_0050189
1602 Ga0495632_0067803
1603 Ga0495637_0042225
1604 Ga0495643_0001620
1605 Ga0495648_0071670
1606 Ga0495666_0000455
1607 Ga0495652_0039494
1608 Ga0495652_0046351
1609 Ga0495652_0057156
1610 Ga0495652_0115687
1611 Ga0495652_0314035
1612 Ga0495654_0004463
1613 Ga0495665_0001966
1614 Ga0495665_0063533
1615 Ga0495640_0004142
1616 Ga0495640_0011997
1617 Ga0495640_0033198
1618 Ga0495640_0059238
1619 Ga0495586_0014256
1620 Ga0495587_0001439
1621 Ga0495587_0002646
1622 Ga0495587_0008063
1623 Ga0495587_0029547
1624 Ga0495609_0006715
1625 Ga0495597_0023333
1626 Ga0495597_0024603
1627 Ga0495645_0003077
1628 Ga0495645_0011980
1629 Ga0495645_0021959
1630 Ga0495645_0033635
1631 Ga0495645_0098022
1632 Ga0495622_0008760
1633 Ga0495622_0011939
1634 Ga0495622_0030419
1635 Ga0495622_0032908
1636 Ga0495622_0035093
1637 Ga0495622_0075874
1638 Ga0495667_0352619
1639 Ga0495668_0008893
1640 Ga0495668_0050515
1641 Ga0495668_0071903
1642 Ga0495634_0004858
1643 Ga0495634_0006160
1644 Ga0495634_0009383
1645 Ga0495634_0035246
1646 Ga0495634_0230740
1647 Ga0495611_0016020
1648 Ga0495611_0090163
1649 Ga0495625_0002746
1650 Ga0495625_0018911
1651 Ga0495625_0019263
1652 Ga0495625_0036591
1653 Ga0495625_0053301
1654 Ga0495635_0000520
1655 Ga0495635_0003307
1656 Ga0495635_0065915
1657 Ga0495635_0084600
1658 Ga0495588_0003010
1659 Ga0495588_0009429
1660 Ga0495588_0013421
1661 Ga0495588_0039663
1662 Ga0495588_0052923
1663 Ga0495657_0004158
1664 Ga0495657_0008170
1665 Ga0495657_0012641
1666 Ga0495657_0013809
1667 Ga0495657_0092574
1668 Ga0495599_0006802
1669 Ga0495599_0041151
1670 Ga0495646_0000451
1671 Ga0495646_0002442
1672 Ga0495646_0017723
1673 Ga0495646_0049442
1674 Ga0495658_0011969
1675 Ga0495658_0014079
1676 Ga0495658_0068909
1677 Ga0495613_0000812
1678 Ga0495613_0001310
1679 Ga0495613_0001531
1680 Ga0495613_0015394
1681 Ga0495613_0036809
1682 Ga0495613_0068763
1683 Ga0495613_0073622
1684 Ga0495613_0077192
1685 Ga0495613_0181730
1686 Ga0495613_0183627
1687 Ga0495613_0332808
1688 Ga0495624_0087360
1689 Ga0495670_0005368
1690 Ga0495670_0099235
1691 Ga0495670_0139686
1692 Ga0495671_0036705
1693 Ga0495671_0086916
1694 Ga0495671_0170705
1695 Ga0495649_0032193
1696 Ga0495649_0086300
1697 Ga0495589_0023920
1698 Ga0495589_0137453
1699 Ga0495600_0005973
1700 Ga0495600_0032942
1701 Ga0495600_0162236
1702 Ga0495660_0003391
1703 Ga0495660_0033793
1704 Ga0495660_0138250
1705 Ga0495581_0016497
1706 Ga0495581_0022853
1707 Ga0495581_0050050
1708 Ga0495604_0000418
1709 Ga0495604_0001157
1710 Ga0495604_0031795
1711 Ga0495636_0004330
1712 Ga0495636_0008615
1713 Ga0495636_0022969
1714 Ga0495636_0029060
1715 Ga0495636_0192588
1716 Ga0495674_0003023
1717 Ga0495674_0063086
1718 Ga0495674_0269207
1719 Ga0495676_0003597
1720 Ga0495676_0009846
1721 Ga0495676_0011192
1722 Ga0495676_0022567
1723 Ga0495676_0024227
1724 Ga0495676_0041190
1725 Ga0495676_0046806
1726 Ga0495676_0087935
1727 Ga0495676_0120007
1728 Ga0495676_0138253
1729 Ga0495676_0147635
1730 Ga0495676_0390675
1731 Ga0495680_0197309
1732 Ga0495683_0057576
1733 Ga0495683_0094183
1734 Ga0495683_0145396
1735 Ga0495687_003992
1736 Ga0495687_013049
1737 Ga0495687_016575
1738 Ga0495675_0011451
1739 Ga0495675_0017393
1740 Ga0495675_0045903
1741 Ga0495677_0015624
1742 Ga0495677_0037006
1743 Ga0495679_051356
1744 Ga0495685_000328
1745 Ga0495685_001867
1746 Ga0495685_005504
1747 Ga0495685_021077
1748 Ga0495681_0000384
1749 Ga0495681_0001688
1750 Ga0495681_0021703
1751 Ga0495681_0084747
1752 Ga0495681_0146461
1753 Ga0495686_0011663
1754 Ga0495686_0048908
1755 Ga0495686_0125480
1756 Ga0495593_0000135
1757 Ga0495593_0003672
1758 Ga0495593_0032228
1759 Ga0495602_0034385
1760 Ga0495602_0251419
1761 Ga0495614_0000327
1762 Ga0495614_0002106
1763 Ga0495614_0009702
1764 Ga0495614_0052660
1765 Ga0495614_0180074
1766 Ga0496100_0011953
1767 Ga0496100_0085504
1768 Ga0496101_0001378
1769 Ga0496101_0203172
1770 Ga0496102_0035885
1771 Ga0496102_0094963
1772 Ga0496102_0110642
1773 Ga0496103_0003726
1774 Ga0496103_0007158
1775 Ga0496104_0001068
1776 Ga0496104_0001635
1777 Ga0496105_0001522
1778 Ga0496105_0008146
1779 Ga0496106_0001739
1780 Ga0496106_0004604
1781 Ga0496106_0105671
1782 Ga0496106_0264257
1783 Ga0496107_0000946
1784 Ga0496107_0021381
1785 Ga0496108_0000834
1786 Ga0496108_0007659
1787 Ga0496108_0100339
1788 Ga0496109_0000669
1789 Ga0496109_0036283
1790 Ga0496109_0050477
1791 Ga0496110_0004219
1792 Ga0496110_0007682
1793 Ga0496110_0056695
1794 Ga0496110_0101778
1795 Ga0496110_0129762
1796 Ga0496111_0038089
1797 Ga0496111_0079030
1798 Ga0496111_0109019
1799 Ga0496112_0029246
1800 Ga0496112_0043129
1801 Ga0496113_0013252
1802 Ga0496113_0027469
1803 Ga0496114_0051562
1804 Ga0496116_0001212
1805 Ga0496116_0019680
1806 Ga0496116_0043757
1807 Ga0496116_0105204
1808 Ga0496117_0025194
1809 Ga0496117_0066485
1810 Ga0496118_0036460
1811 Ga0496118_0154867
1812 Ga0496119_0002031
1813 Ga0496119_0009286
1814 Ga0496119_0009488
1815 Ga0496120_0008195
1816 Ga0496121_0089982
1817 Ga0496121_0121580
1818 Ga0496122_0009809
1819 Ga0496122_0047054
1820 Ga0496122_0068114
1821 Ga0496122_0072979
1822 Ga0496122_0081119
1823 Ga0496123_0009353
1824 Ga0496123_0067864
1825 Ga0496124_0088559
1826 Ga0496124_0164588
1827 Ga0496124_0256365
1828 Ga0496125_0000883
1829 Ga0496125_0007698
1830 Ga0496125_0012620
1831 Ga0496125_0029195
1832 Ga0496126_0059399
1833 Ga0496126_0141044
1834 Ga0501341_00183
1835 Ga0501343_003627
1836 Ga0501305_000889
1837 Ga0501311_002822
1838 Ga0501312_000166
1839 Ga0501312_017741
1840 Ga0501313_000516
1841 Ga0501315_000363
1842 Ga0501316_007029
1843 Ga0501316_009787
1844 Ga0501318_001432
1845 Ga0501319_001212
1846 Ga0501320_001857
1847 Ga0501323_000523
1848 Ga0501323_003091
1849 Ga0501337_000660
1850 Ga0501031_0000840
1851 Ga0501032_0000748
1852 Ga0501032_0032844
1853 Ga0501032_0051218
1854 Ga0501032_0164230
1855 Ga0501033_0010390
1856 Ga0501033_0013379
1857 Ga0501033_0036119
1858 Ga0501033_0051938
1859 Ga0501033_0059171
1860 Ga0501033_0138642
1861 Ga0501033_0334775
1862 Ga0501034_0004958
1863 Ga0501034_0007581
1864 Ga0501034_0018512
1865 Ga0501034_0118030
1866 Ga0501036_0005087
1867 Ga0501036_0013563
1868 Ga0501036_0016480
1869 Ga0501036_0079441
1870 Ga0501036_0169761
1871 Ga0501037_0000768
1872 Ga0501037_0002566
1873 Ga0501037_0108275
1874 Ga0501037_0130703
1875 Ga0501037_0252703
1876 Ga0501037_0293042
1877 Ga0501038_0006044
1878 Ga0501038_0006433
1879 Ga0501038_0035652
1880 Ga0501038_0066734
1881 Ga0501038_0221279
1882 Ga0501038_0308841
1883 Ga0501039_0015133
1884 Ga0501039_0059229
1885 Ga0501039_0134066
1886 Ga0501039_0153830
1887 Ga0501040_0041612
1888 Ga0501041_0000393
1889 Ga0501042_0039170
1890 Ga0501042_0048549
1891 Ga0501042_0063155
1892 Ga0501043_0004334
1893 Ga0501043_0022486
1894 Ga0501043_0033449
1895 Ga0501043_0079231
1896 Ga0501043_0372938
1897 Ga0501046_0004955
1898 Ga0501047_0000075
1899 Ga0501047_0000280
1900 Ga0501047_0022980
1901 Ga0501047_0024459
1902 Ga0501047_0186223
1903 Ga0501047_0215868
1904 Ga0501048_0010472
1905 Ga0501048_0018005
1906 Ga0501048_0284391
1907 Ga0501067_0045893
1908 Ga0501067_0080874
1909 Ga0501068_0001340
1910 Ga0501068_0316558
1911 Ga0501069_0027195
1912 Ga0501069_0045538
1913 Ga0501070_0002096
1914 Ga0501070_0016982
1915 Ga0501070_0139993
1916 Ga0501070_0280271
1917 Ga0501071_0002524
1918 Ga0501072_0001531
1919 Ga0501073_0016631
1920 Ga0501074_0010666
1921 Ga0501074_0018178
1922 Ga0501076_0071675
1923 Ga0501077_0017475
1924 Ga0501217_012817
1925 Ga0501217_026130
1926 Ga0501224_013126
1927 Ga0501079_0010786
1928 Ga0501079_0049481
1929 Ga0501080_0026016
1930 Ga0501080_0098838
1931 Ga0501080_0321238
1932 Ga0501083_0088997
1933 Ga0501035_0000431
1934 Ga0501035_0000477
1935 Ga0501035_0002133
1936 Ga0501035_0034739
1937 Ga0501035_0079885
1938 Ga0501035_0089210
1939 Ga0501035_0121894
1940 Ga0501035_0147684
1941 Ga0501035_0212194
1942 Ga0501035_0280799
1943 Ga0501044_0001532
1944 Ga0501044_0003263
1945 Ga0501044_0003565
1946 Ga0501044_0202332
1947 Ga0501044_0340267
1948 Ga0501045_0060587
1949 nmdc:mga03n38_1658_c1
1950 nmdc:mga03n38_168172_c1
1951 nmdc:mga0yw44_24019_c1
1952 nmdc:mga06z11_1588_c1
1953 nmdc:mga06z11_3481_c1
1954 nmdc:mga04h51_2417_c1
1955 nmdc:mga07m45_66037_c1
1956 nmdc:mga07m45_71601_c1
1957 nmdc:mga05p37_12880_c1
1958 nmdc:mga05p37_8911_c1
1959 nmdc:mga09592_2470_c1
1960 nmdc:mga0qj67_69908_c1
1961 nmdc:mga06r32_996_c1
1962 nmdc:mga08y16_33570_c1
1963 nmdc:mga08y16_8676_c1
1964 nmdc:mga0a205_113381_c1
1965 Ga0495601_0003396
1966 Ga0500610_0124137
1967 Ga0495655_0011007
1968 Ga0495655_0018106
1969 Ga0495619_0001857
1970 Ga0500578_0004537
1971 Ga0500578_0200286
1972 Ga0500644_0022930
1973 Ga0500641_0028087
1974 Ga0500650_0077208
1975 Ga0500654_031980
1976 Ga0500553_027252
1977 Ga0500560_004068
1978 Ga0500569_000539
1979 Ga0500572_008164
1980 Ga0500594_0073396
1981 Ga0500621_021663
1982 Ga0500628_001087
1983 Ga0500652_000846
1984 Ga0500658_0001364
1985 Ga0500561_0000683
1986 Ga0500573_0022463
1987 Ga0500573_0039369
1988 Ga0500573_0060456
1989 Ga0500579_088304
1990 Ga0500588_0009549
1991 Ga0500600_0065965
1992 Ga0500616_0034973
1993 Ga0500633_0000167
1994 Ga0500634_0000375
1995 Ga0500656_000274
1996 Ga0500587_002910
1997 Ga0501084_0013243
1998 Ga0501082_0001798
1999 Ga0466962_0001332
2000 Ga0466962_0016364
2001 Ga0466962_0043597
2002 Ga0530510_0092986
2003 2540607507
2004 2547406121
2005 2547412521
2006 2550901955
2007 2553394672
2008 2554257491
2009 2556064322
2010 2571531913
2011 2585298432
2012 2585305738
2013 2585311212
2014 2585311857
2015 2585314586
2016 2595087999
2017 2601638417
2018 2616693492
2019 2616904167
2020 2643740857
2021 2643763172
2022 2643900186
2023 2643947940
2024 2644262849
2025 2644266452
2026 2644390623
2027 2644405590
2028 2644433806
2029 2644438020
2030 2644443053
2031 2644455183
2032 2644463958
2033 2644539364
2034 2644631126
2035 2644701696
2036 2644710613
2037 2644717018
2038 2644721520
2039 2685151353
2040 2698321906
2041 2712199301
2042 2721506518
2043 2723603661
2044 2728529980
2045 2730139656
2046 2738816914
2047 2739231029
2048 2739231706
2049 2739267953
2050 2753269747
2051 2753808049
2052 2757565981
2053 2777762246
2054 2777836027
2055 2777838119
2056 2784589058
2057 2784591817
2058 2785339909
2059 2785342789
2060 2785370013
2061 2786671084
2062 2786675170
2063 2793980516
2064 2802435839
2065 2804846315
2066 2808842509
2067 2808845164
2068 2808914759
2069 2808921014
2070 2809055804
2071 2809232661
2072 2809235437
2073 2811845715
2074 2812354538
2075 2812357591
2076 2812477479
2077 2812480112
2078 2819580383
2079 2819697340
2080 2819708757
2081 2819741571
2082 2821117426
2083 2842883527
2084 2842886007
2085 2852636159
2086 2852637330
2087 2857478250
2088 2857587156
2089 2857605541
2090 2857608980
2091 2860840203
2092 2862178913
2093 2862283220
2094 2862286115
2095 2862295634
2096 2862384222
2097 2862388921
2098 2862508169
2099 2862512187
2100 2862578802
2101 2862583502
2102 2863410092
2103 2864735674
2104 2865000275
2105 2867372437
2106 2867428730
2107 2867431351
2108 2867480465
2109 2873155291
2110 2875395144
2111 2877680611
2112 2885532960
2113 2889047697
2114 2889279591
2115 2889298134
2116 2904162361
2117 2904495511
2118 2904525800
2119 2904528424
2120 2904596916
2121 2907206685
2122 2912716145
2123 2912719327
2124 2912723981
2125 2912729060
2126 2912731548
2127 2912761343
2128 2918505117
2129 2919145608
2130 2919147486
2131 2919164606
2132 2919471026
2133 2919471828
2134 2919517549
2135 2919521545
2136 2919721924
2137 2919723739
2138 2919725421
2139 2928094311
2140 2928098632
2141 2929005403
2142 2929007154
2143 2929237025
2144 2931384747
2145 2935390768
2146 2936341846
2147 2938921207
2148 2939684018
2149 2939703643
2150 2945996595
2151 2946049446
2152 2946059274
2153 2946068263
2154 2946071129
2155 2946076399
2156 2946079030
2157 2947225603
2158 2947228659
2159 2947430062
2160 2954006867
2161 2954009777
2162 2954382677
2163 2954385740
2164 2954677414
2165 2954680205
2166 2954683946
2167 2954686739
2168 2954693500
2169 2954696386
2170 2954705890
2171 2954708594
2172 2954713163
2173 2954715743
2174 2954723123
2175 2954725681
2176 2954736119
2177 2954738706
2178 2954742030
2179 2954744635
2180 2954754979
2181 2954757564
2182 2954761008
2183 2954763602
2184 2960321096
2185 2960321893
2186 2960377014
2187 2960380063
2188 2962293481
2189 2965764616
2190 2966602140
2191 2969139489
2192 2969767458
2193 2969773229
2194 2971409407
2195 2979086971
2196 2980126675
2197 2980495244
2198 2981286617
2199 2981291568
2200 2981982259
2201 2981987161
2202 2984532393
2203 2984533653
2204 2984593101
2205 2990061591
2206 2990065442
2207 2990091936
2208 2995468773
2209 2996709134
2210 2997459000
2211 2997604637
2212 3001893426
2213 3006325762
2214 3006425778
2215 3006488507
2216 3006496936
2217 3006499440
2218 3006976702
2219 648169955
2220 8008564111
2221 8008575975
2222 8008578476
2223 8022623118
2224 8022654371
2225 8022895186
2226 8022898673
2227 8022916026
2228 8022918803
2229 8022920587
2230 8022952631
2231 8023440128
2232 8023447019
2233 8023630548
2234 8023631577
2235 8025419924
2236 8025485550
2237 8033688264
2238 8047897551
2239 8048127861
2240 8048361319
2241 8048374538
2242 8048383684
2243 8048410260
2244 8048410872
2245 8054167477
2246 8054284149
2247 8054468971
2248 8056452931
2249 8056671945
2250 8056834271
2251 8056838010
2252 8057739219

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

34

194

0.98

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

199

331

0.89

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

34

128

0.83

PF02826

2-Hacid_dh_C

D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain

6

134

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7exs-assembly1.cif.gz_A thermomicrobium roseum sarcosine oxidase mutant - s320r 0.9549 1 31
2bra-assembly1.cif.gz_A structure of n-terminal fad binding motif of mouse mical 0.9541 2 31
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.9442 2 31
1reo-assembly1.cif.gz_A l-amino acid oxidase from agkistrodon halys pallas 0.9424 2 30
3rp7-assembly1.cif.gz_A crystal structure of klebsiella pneumoniae hpxo complexed with fad and uric acid 0.9378 1 30
ID Description Score Start End Superfamily
6fqxH01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9538 2 160 3.40.50.720
2w8zA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9524 2 161 3.40.50.720
af_Q4DU92_1_145_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9515 1 128 3.40.50.720
3i3lA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9381 2 31 3.50.50.60
af_A0A1D6E7M3_47_537_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9361 3 30 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7Z0Q390-F1-model_v4 6-phosphogluconate dehydrogenase 1.007 1 76 GO:0004616
GO:0050661
AF-A0A6G2PXG9-F1-model_v4 6-phosphogluconate dehydrogenase 0.9959 83 176 GO:0004616
GO:0016054
GO:0050661
AF-A0A7Z0Q390-F1-model_v4 6-phosphogluconate dehydrogenase 0.9939 1 76 GO:0004616
GO:0050661
AF-A0A6B1KQ78-F1-model_v4 6-phosphogluconate dehydrogenase 0.9934 1 178 GO:0004616
GO:0006098
GO:0016054
GO:0019521
GO:0050661
AF-A0A4Q5YXB7-F1-model_v4 deleted 0.9932 1 125

Map