F490337

General Info

Members Datasets Scaffolds Average Seq Length
1118 404 1072 197

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10936705|Ga0105241_109367051
Length 236
Sequence MNVVLVDAGGGTALDHPVVADADVEVVGVALQRAPERLVGLAAVLIDAGGANLGSVRYALERLGATVKLVRDAEGLAGAQRVILPGVGAAGPGMARLRELGLVELLRSLKQPVLGVCLGMQLLFDRSEEAGVDTLGLIPGVVRKLVPACGIRVPHMGWNLLSAKQAHPLLAGLGGDEQAYFVHSYAVPVGDWTLASSDYGEAFSAVIARDNYYGMQFHPERSAAVGAKLLKSFLEL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
5 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
6 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
7 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
8 2739367700 Dyella sp. YR388 Isolate Unclassified
9 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
10 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
11 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
12 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
13 2818991457 Xanthomonas translucens 569 Isolate Unclassified
14 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
15 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
16 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
17 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
18 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
19 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
20 2884411467 Dyella sp. AD56 Isolate Rhizosphere
21 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
22 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
23 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
24 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
25 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
26 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
27 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
28 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
29 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
30 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
31 2928963466 Dyella japonica 1073 Isolate Unclassified
32 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
33 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
34 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
35 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
36 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
37 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
38 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
39 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
40 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
41 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
42 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
43 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
44 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
45 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
46 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
47 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
48 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
49 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
50 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
51 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
52 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
53 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
54 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
55 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
56 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
57 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
58 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
59 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
60 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
61 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
62 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
63 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
64 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
65 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
66 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
67 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
68 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
69 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
70 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
71 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
72 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
75 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
76 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
77 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
78 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
79 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
80 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
85 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
86 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
87 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
90 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
91 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
92 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
93 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
94 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
95 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
96 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
97 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
98 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
99 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
100 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
101 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
102 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
103 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
104 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
105 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
106 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
107 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
108 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
111 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
112 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
113 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
117 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
118 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
119 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
120 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
121 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
122 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
124 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
125 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
126 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
127 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
128 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
130 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
131 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
132 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
133 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
134 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
135 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
136 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
163 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
164 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
165 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
168 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
169 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
170 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
173 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
174 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
176 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
177 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
178 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
181 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
182 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
183 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
187 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
188 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
190 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
192 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
250 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
251 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
252 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
253 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
254 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
255 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
256 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
257 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
258 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
259 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
260 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
261 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
262 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
263 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
264 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
265 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
266 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
267 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
268 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
269 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
270 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
271 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
272 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
275 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
276 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
277 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
278 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
279 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
280 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
281 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
282 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
283 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
284 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
285 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
286 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
287 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
288 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
289 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
290 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
291 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
292 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
293 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
294 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
295 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
296 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
297 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
298 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
299 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
300 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
301 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
302 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
303 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
304 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
305 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
306 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
307 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
308 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
309 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
310 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
311 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
312 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
313 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
314 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
315 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
318 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
319 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
320 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
321 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
322 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
323 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
324 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
325 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
326 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
332 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
333 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
336 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
337 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
343 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
344 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
345 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
346 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
347 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
348 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
349 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
350 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
351 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
352 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
353 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
354 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
355 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
356 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
357 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
358 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
359 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
360 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
361 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
362 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
363 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
364 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
374 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
375 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
377 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
378 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
379 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
380 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
381 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
382 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
383 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
384 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
385 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
386 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
387 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
390 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
391 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
394 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
395 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
396 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
397 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
398 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
399 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
400 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
401 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
402 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
403 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
404 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.53
Metatranscriptomes 0.36
Isolates 4.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.68
Nodule 0.09
Rhizoplane 3.13
Rhizosphere 76.3
Stem 0
Stem Tuber 0
Unclassified 11.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2191643 2162886007 Bacteria 1273
2 SwRhRL2b_contig_3936045 2162886007 Bacteria 1173
3 JGI24736J21556_1000339 3300001904 Bacteria 8765
4 JGI24739J22299_10000040 3300001989 Bacteria 35361
5 JGI24739J22299_10056009 3300001989 Bacteria 1259
6 JGI24737J22298_10002132 3300001990 Bacteria 7051
7 JGI24737J22298_10002784 3300001990 Bacteria 6194
8 JGI25156J39149_1010714 3300002705 Bacteria 2134
9 JGI25162J39368_1000395 3300002737 Bacteria 36803
10 JGI25162J39368_1000684 3300002737 Bacteria 23728
11 JGI25162J39368_1002286 3300002737 Bacteria 7726
12 JGI25157J39369_1000081 3300002741 Bacteria 85798
13 JGI25157J39369_1000547 3300002741 Bacteria 22506
14 JGI25163J39215_1000313 3300002771 Bacteria 16376
15 JGI25164J39214_1000028 3300002772 Bacteria 150310
16 JGI25164J39214_1000338 3300002772 Bacteria 29675
17 JGI25164J39214_1000416 3300002772 Bacteria 24162
18 JGI25152J39213_1001386 3300002773 Bacteria 10503
19 JGI25150J39212_1000817 3300002774 Bacteria 10499
20 JGI25151J46595_10001867 3300003187 Bacteria 13477
21 JGI25165J46597_1000108 3300003214 Bacteria 150310
22 JGI25165J46597_1000513 3300003214 Bacteria 36803
23 JGI25165J46597_1003664 3300003214 Bacteria 3673
24 JGI25153J46596_10000167 3300003215 Bacteria 66040
25 JGI25153J46596_10003689 3300003215 Bacteria 8469
26 rootH1_10048199 3300003316 Bacteria 3478
27 rootH2_10026728 3300003320 Bacteria 23571
28 rootH1_10048164 3300003323 Bacteria 1855
29 rootH1_10103103 3300003323 Bacteria 1709
30 rootH1_10162681 3300003323 Bacteria 3348
31 Ga0006562J51391_1011160 3300003578 Bacteria 7470
32 Ga0006562J51391_1011163 3300003578 Bacteria 2930
33 Ga0055539_1001625 3300003752 Bacteria 4033
34 Ga0055535_1000771 3300003761 Bacteria 23731
35 Ga0055542_1000772 3300003762 Bacteria 24080
36 Ga0055542_1000787 3300003762 Bacteria 23728
37 Ga0055529_1000078 3300003763 Bacteria 150310
38 Ga0055526_1000268 3300003771 Bacteria 43933
39 Ga0055537_1000348 3300003773 Bacteria 31460
40 Ga0055536_1001728 3300003781 Bacteria 12918
41 Ga0055536_1008641 3300003781 Bacteria 4339
42 Ga0055534_1000043 3300003784 Bacteria 99338
43 Ga0055528_1000065 3300003790 Bacteria 85294
44 Ga0055530_10001974 3300003791 Bacteria 13958
45 Ga0055530_10002320 3300003791 Bacteria 12437
46 Ga0055540_1037333 3300003792 Bacteria 1072
47 Ga0055531_10010116 3300003794 Bacteria 4734
48 Ga0055531_10011251 3300003794 Bacteria 4342
49 Ga0055531_10011262 3300003794 Bacteria 4339
50 Ga0058692_1000031 3300003856 Bacteria 188488
51 Ga0058692_1000060 3300003856 Bacteria 98866
52 Ga0065704_10070367 3300005289 Bacteria 29287
53 Ga0065704_10134021 3300005289 Bacteria 1593
54 Ga0070658_10097525 3300005327 Bacteria 2427
55 Ga0070658_10212515 3300005327 Bacteria 1634
56 Ga0070658_10343262 3300005327 Bacteria 1277
57 Ga0070658_10371877 3300005327 Bacteria 1225
58 Ga0070658_10473418 3300005327 Bacteria 1080
59 Ga0070676_10257509 3300005328 Bacteria 1167
60 Ga0070683_100048684 3300005329 Bacteria 3919
61 Ga0070683_100814161 3300005329 Bacteria 895
62 Ga0070690_100175666 3300005330 Bacteria 1477
63 Ga0070670_100007794 3300005331 Bacteria 9111
64 Ga0070666_10000388 3300005335 Bacteria 27657
65 Ga0070666_10058900 3300005335 Bacteria 2597
66 Ga0070666_10254484 3300005335 Bacteria 1244
67 Ga0070682_100023945 3300005337 Bacteria 3629
68 Ga0070682_100179353 3300005337 Bacteria 1478
69 Ga0070660_100019590 3300005339 Bacteria 4960
70 Ga0070660_100061965 3300005339 Bacteria 2905
71 Ga0070660_100156685 3300005339 Bacteria 1833
72 Ga0070660_100865117 3300005339 Bacteria 761
73 Ga0070660_101054913 3300005339 Bacteria 687
74 Ga0070689_100010930 3300005340 Bacteria 6487
75 Ga0070691_10112024 3300005341 Bacteria 1366
76 Ga0070691_10196097 3300005341 Bacteria 1059
77 Ga0070661_100037021 3300005344 Bacteria 3549
78 Ga0070661_100038689 3300005344 Bacteria 3474
79 Ga0070661_100084639 3300005344 Bacteria 2343
80 Ga0070661_100139852 3300005344 Bacteria 1824
81 Ga0070661_100257471 3300005344 Bacteria 1348
82 Ga0070661_100384145 3300005344 Bacteria 1107
83 Ga0070661_100459547 3300005344 Bacteria 1014
84 Ga0070692_10044215 3300005345 Bacteria 2293
85 Ga0070692_10215947 3300005345 Bacteria 1131
86 Ga0070668_100112328 3300005347 Bacteria 2170
87 Ga0070669_100020435 3300005353 Bacteria 4729
88 Ga0070669_100224637 3300005353 Bacteria 1486
89 Ga0070675_100119317 3300005354 Bacteria 2240
90 Ga0070671_100013860 3300005355 Bacteria 6504
91 Ga0070671_100306657 3300005355 Bacteria 1352
92 Ga0070674_100031562 3300005356 Bacteria 3511
93 Ga0070674_100133202 3300005356 Bacteria 1856
94 Ga0070674_100300121 3300005356 Bacteria 1280
95 Ga0070673_100096136 3300005364 Bacteria 2430
96 Ga0070673_100506750 3300005364 Bacteria 1092
97 Ga0070673_100669910 3300005364 Bacteria 951
98 Ga0070688_100136001 3300005365 Bacteria 1664
99 Ga0070659_100005797 3300005366 Bacteria 8894
100 Ga0070659_100034565 3300005366 Bacteria 3932
101 Ga0070659_100058107 3300005366 Bacteria 3051
102 Ga0070659_100133964 3300005366 Bacteria 2014
103 Ga0070659_100161313 3300005366 Bacteria 1833
104 Ga0070659_100267417 3300005366 Bacteria 1420
105 Ga0070659_100362442 3300005366 Bacteria 1218
106 Ga0070667_100156091 3300005367 Bacteria 2007
107 Ga0070714_100104775 3300005435 Bacteria 2496
108 Ga0070714_100116833 3300005435 Bacteria 2368
109 Ga0070714_100164743 3300005435 Bacteria 2008
110 Ga0070714_100241691 3300005435 Bacteria 1667
111 Ga0070714_100304389 3300005435 Bacteria 1487
112 Ga0070713_100006097 3300005436 Bacteria 8314
113 Ga0070713_100014588 3300005436 Bacteria 5843
114 Ga0070701_10145876 3300005438 Bacteria 1358
115 Ga0070663_100093093 3300005455 Bacteria 2236
116 Ga0070663_100186336 3300005455 Bacteria 1613
117 Ga0070663_100252768 3300005455 Bacteria 1395
118 Ga0070663_100306505 3300005455 Bacteria 1273
119 Ga0070663_100312998 3300005455 Bacteria 1260
120 Ga0070663_100428567 3300005455 Bacteria 1086
121 Ga0070663_100638384 3300005455 Bacteria 899
122 Ga0070678_100568995 3300005456 Bacteria 1008
123 Ga0070662_100012504 3300005457 Bacteria 5629
124 Ga0070662_100127321 3300005457 Bacteria 1959
125 Ga0070662_100208443 3300005457 Bacteria 1554
126 Ga0070662_100655373 3300005457 Bacteria 886
127 Ga0070662_100771357 3300005457 Bacteria 816
128 Ga0070679_100019902 3300005530 Bacteria 6535
129 Ga0070684_100000098 3300005535 Bacteria 56167
130 Ga0070684_100208421 3300005535 Bacteria 1781
131 Ga0068853_100007676 3300005539 Bacteria 8648
132 Ga0068853_100050236 3300005539 Bacteria 3587
133 Ga0068853_100161588 3300005539 Bacteria 2022
134 Ga0068853_100200769 3300005539 Bacteria 1815
135 Ga0068853_100360905 3300005539 Bacteria 1353
136 Ga0068853_100361954 3300005539 Bacteria 1351
137 Ga0070696_100005210 3300005546 Bacteria 8690
138 Ga0070696_100052356 3300005546 Bacteria 2840
139 Ga0070693_100051465 3300005547 Bacteria 2359
140 Ga0070693_100065349 3300005547 Bacteria 2126
141 Ga0070665_100003847 3300005548 Bacteria 15889
142 Ga0070665_100022951 3300005548 Bacteria 6283
143 Ga0070665_100499008 3300005548 Bacteria 1228
144 Ga0068855_100002059 3300005563 Bacteria 24913
145 Ga0068855_100005690 3300005563 Bacteria 15228
146 Ga0068855_100020597 3300005563 Bacteria 7909
147 Ga0068855_100080776 3300005563 Bacteria 3770
148 Ga0068855_100082253 3300005563 Bacteria 3732
149 Ga0068855_100092531 3300005563 Bacteria 3487
150 Ga0068855_100107211 3300005563 Bacteria 3210
151 Ga0068855_100399958 3300005563 Bacteria 1505
152 Ga0068855_100624049 3300005563 Bacteria 1160
153 Ga0070664_100091821 3300005564 Bacteria 2628
154 Ga0068857_100000511 3300005577 Bacteria 27856
155 Ga0068857_100004075 3300005577 Bacteria 12305
156 Ga0068857_100004673 3300005577 Bacteria 11601
157 Ga0068857_100042446 3300005577 Bacteria 4035
158 Ga0068857_100059143 3300005577 Bacteria 3404
159 Ga0068857_100380365 3300005577 Bacteria 1311
160 Ga0068854_100001254 3300005578 Bacteria 15235
161 Ga0068854_100009920 3300005578 Bacteria 6161
162 Ga0068854_100027013 3300005578 Bacteria 3951
163 Ga0068854_100036209 3300005578 Bacteria 3459
164 Ga0068854_100063684 3300005578 Bacteria 2677
165 Ga0068854_100148510 3300005578 Bacteria 1805
166 Ga0068854_100231495 3300005578 Bacteria 1467
167 Ga0068856_100001449 3300005614 Bacteria 24884
168 Ga0068856_100008083 3300005614 Bacteria 10271
169 Ga0068856_100020139 3300005614 Bacteria 6480
170 Ga0068856_100217728 3300005614 Bacteria 1925
171 Ga0068856_100923512 3300005614 Bacteria 891
172 Ga0068852_100003835 3300005616 Bacteria 10557
173 Ga0068852_100037468 3300005616 Bacteria 4066
174 Ga0068852_100105743 3300005616 Bacteria 2550
175 Ga0068852_100243143 3300005616 Bacteria 1721
176 Ga0068852_100357589 3300005616 Bacteria 1427
177 Ga0068852_100453352 3300005616 Bacteria 1270
178 Ga0068852_100488648 3300005616 Bacteria 1224
179 Ga0068852_100505328 3300005616 Bacteria 1204
180 Ga0068859_100419067 3300005617 Bacteria 1435
181 Ga0068864_100028252 3300005618 Bacteria 4739
182 Ga0068864_100067635 3300005618 Bacteria 3102
183 Ga0068866_10183996 3300005718 Bacteria 1236
184 Ga0068863_100000991 3300005841 Bacteria 28498
185 Ga0068863_100001728 3300005841 Bacteria 21634
186 Ga0068863_100156943 3300005841 Bacteria 2178
187 Ga0068863_101395398 3300005841 Bacteria 708
188 Ga0068858_100013472 3300005842 Bacteria 7715
189 Ga0068860_100017406 3300005843 Bacteria 7002
190 Ga0068860_100043436 3300005843 Bacteria 4288
191 Ga0068860_100061662 3300005843 Bacteria 3563
192 Ga0068860_100522419 3300005843 Bacteria 1187
193 Ga0068862_100055198 3300005844 Bacteria 3403
194 Ga0068862_100057171 3300005844 Bacteria 3344
195 Ga0081539_10029649 3300005985 Bacteria 3413
196 Ga0075364_10000075 3300006051 Bacteria 38780
197 Ga0075364_10017738 3300006051 Bacteria 4452
198 Ga0075364_10033599 3300006051 Bacteria 3304
199 Ga0075364_10045173 3300006051 Bacteria 2867
200 Ga0075362_10034213 3300006177 Bacteria 2214
201 Ga0075367_10107375 3300006178 Bacteria 1711
202 Ga0075369_10031861 3300006186 Bacteria 2228
203 Ga0075366_10183309 3300006195 Bacteria 1272
204 Ga0075366_10204202 3300006195 Bacteria 1202
205 Ga0097621_100107133 3300006237 Bacteria 2358
206 Ga0097621_100411855 3300006237 Bacteria 1212
207 Ga0068871_100027620 3300006358 Bacteria 4440
208 Ga0075428_100534850 3300006844 Bacteria 1253
209 Ga0075428_100836136 3300006844 Bacteria 978
210 Ga0068865_100491865 3300006881 Bacteria 1021
211 Ga0097620_100419059 3300006931 Bacteria 1435
212 Ga0099794_10049341 3300007265 Bacteria 2023
213 Ga0105251_10000684 3300009011 Bacteria 31292
214 Ga0105251_10010358 3300009011 Bacteria 5416
215 Ga0105240_10003424 3300009093 Bacteria 24649
216 Ga0105240_10009039 3300009093 Bacteria 14150
217 Ga0105240_10014865 3300009093 Bacteria 10609
218 Ga0105240_10020015 3300009093 Bacteria 8934
219 Ga0105240_10030261 3300009093 Bacteria 7037
220 Ga0105240_10031164 3300009093 Bacteria 6919
221 Ga0105240_10164754 3300009093 Bacteria 2630
222 Ga0105240_10172954 3300009093 Bacteria 2556
223 Ga0105240_10239123 3300009093 Bacteria 2106
224 Ga0105240_10414486 3300009093 Bacteria 1515
225 Ga0105240_10575495 3300009093 Bacteria 1243
226 Ga0105240_10977755 3300009093 Bacteria 906
227 Ga0111539_10409346 3300009094 Bacteria 1580
228 Ga0111539_11273889 3300009094 Bacteria 853
229 Ga0105245_10543037 3300009098 Bacteria 1184
230 Ga0105245_11213042 3300009098 Bacteria 802
231 Ga0114129_10815943 3300009147 Bacteria 1189
232 Ga0105243_10012752 3300009148 Bacteria 6349
233 Ga0105243_10096358 3300009148 Bacteria 2447
234 Ga0105241_10083769 3300009174 Bacteria 2502
235 Ga0105241_10098806 3300009174 Bacteria 2317
236 Ga0105241_10879278 3300009174 Bacteria 831
237 Ga0105241_10936705 3300009174 Bacteria 806
238 Ga0105248_10084810 3300009177 Bacteria 3564
239 Ga0105248_10183860 3300009177 Bacteria 2355
240 Ga0105248_10686207 3300009177 Bacteria 1155
241 Ga0105237_10000023 3300009545 Bacteria 226144
242 Ga0105237_10000595 3300009545 Bacteria 50470
243 Ga0105237_10282236 3300009545 Bacteria 1663
244 Ga0105237_10363183 3300009545 Bacteria 1452
245 Ga0105237_10420762 3300009545 Bacteria 1341
246 Ga0105238_10005372 3300009551 Bacteria 12662
247 Ga0105238_10005720 3300009551 Bacteria 12290
248 Ga0105238_10104398 3300009551 Bacteria 2815
249 Ga0105238_10113419 3300009551 Bacteria 2690
250 Ga0105238_10747423 3300009551 Bacteria 992
251 Ga0105238_11270837 3300009551 Bacteria 762
252 Ga0105249_10064480 3300009553 Bacteria 3368
253 Ga0105032_109395 3300009979 Bacteria 799
254 Ga0105239_10000022 3300010375 Bacteria 257744
255 Ga0105239_10039292 3300010375 Bacteria 5184
256 Ga0105239_10049113 3300010375 Bacteria 4627
257 Ga0105239_10074918 3300010375 Bacteria 3721
258 Ga0105239_10078397 3300010375 Bacteria 3635
259 Ga0105239_10451297 3300010375 Bacteria 1459
260 Ga0105239_10625658 3300010375 Bacteria 1228
261 Ga0105239_10636726 3300010375 Bacteria 1217
262 Ga0105246_10004902 3300011119 Bacteria 8154
263 Ga0105246_10023433 3300011119 Bacteria 3994
264 Ga0157314_1000105 3300012500 Bacteria 8981
265 Ga0157373_10027400 3300013100 Bacteria 4110
266 Ga0157373_10044297 3300013100 Bacteria 3177
267 Ga0157373_10075101 3300013100 Bacteria 2385
268 Ga0157373_10115399 3300013100 Bacteria 1888
269 Ga0157373_10462764 3300013100 Bacteria 914
270 Ga0157371_10002070 3300013102 Bacteria 19660
271 Ga0157371_10002097 3300013102 Bacteria 19462
272 Ga0157371_10005020 3300013102 Bacteria 11339
273 Ga0157371_10005924 3300013102 Bacteria 10208
274 Ga0157371_10021458 3300013102 Bacteria 4742
275 Ga0157371_10024187 3300013102 Bacteria 4437
276 Ga0157371_10036564 3300013102 Bacteria 3516
277 Ga0157371_10049262 3300013102 Bacteria 2993
278 Ga0157371_10165528 3300013102 Bacteria 1579
279 Ga0157371_10741917 3300013102 Unclassified 737
280 Ga0157370_10000707 3300013104 Bacteria 41767
281 Ga0157370_10001239 3300013104 Bacteria 31925
282 Ga0157370_10009476 3300013104 Bacteria 10395
283 Ga0157370_10025187 3300013104 Bacteria 5890
284 Ga0157370_10045181 3300013104 Bacteria 4227
285 Ga0157370_10082267 3300013104 Bacteria 3029
286 Ga0157370_10104116 3300013104 Bacteria 2656
287 Ga0157370_10177749 3300013104 Bacteria 1978
288 Ga0157370_10187919 3300013104 Bacteria 1918
289 Ga0157370_10289114 3300013104 Bacteria 1514
290 Ga0157370_10471752 3300013104 Bacteria 1153
291 Ga0157369_10000239 3300013105 Bacteria 76144
292 Ga0157369_10005861 3300013105 Bacteria 14272
293 Ga0157369_10011860 3300013105 Bacteria 9898
294 Ga0157369_10026692 3300013105 Bacteria 6404
295 Ga0157369_10076617 3300013105 Bacteria 3585
296 Ga0157369_10087931 3300013105 Bacteria 3317
297 Ga0157369_10095626 3300013105 Bacteria 3169
298 Ga0157369_10128439 3300013105 Bacteria 2687
299 Ga0157369_10164684 3300013105 Bacteria 2339
300 Ga0157369_10297926 3300013105 Bacteria 1678
301 Ga0157369_10337263 3300013105 Bacteria 1566
302 Ga0157369_10690381 3300013105 Bacteria 1051
303 Ga0157374_10010711 3300013296 Bacteria 7898
304 Ga0157378_10272408 3300013297 Bacteria 1628
305 Ga0157378_10673704 3300013297 Bacteria 1052
306 Ga0157372_10008488 3300013307 Bacteria 10902
307 Ga0157372_10126760 3300013307 Bacteria 2936
308 Ga0157372_10151239 3300013307 Bacteria 2679
309 Ga0157372_10382008 3300013307 Bacteria 1641
310 Ga0157372_10455589 3300013307 Bacteria 1491
311 Ga0157372_11018677 3300013307 Bacteria 959
312 Ga0157372_11312997 3300013307 Bacteria 835
313 Ga0157375_11021767 3300013308 Bacteria 966
314 Ga0157375_11987819 3300013308 Bacteria 691
315 Ga0163163_10000597 3300014325 Bacteria 31566
316 Ga0163163_10000788 3300014325 Bacteria 26861
317 Ga0163163_10007998 3300014325 Bacteria 9357
318 Ga0163163_10840434 3300014325 Bacteria 982
319 Ga0182008_10000032 3300014497 Bacteria 162985
320 Ga0182008_10053209 3300014497 Bacteria 2005
321 Ga0182008_10111837 3300014497 Bacteria 1353
322 Ga0157377_10170118 3300014745 Bacteria 1362
323 Ga0157379_10003251 3300014968 Bacteria 13770
324 Ga0157376_10840628 3300014969 Bacteria 933
325 Ga0182006_1027840 3300015261 Bacteria 2304
326 Ga0182006_1034584 3300015261 Bacteria 2020
327 Ga0182006_1055039 3300015261 Bacteria 1520
328 Ga0182006_1078117 3300015261 Bacteria 1213
329 Ga0182006_1092595 3300015261 Bacteria 1085
330 Ga0182006_1155977 3300015261 Bacteria 771
331 Ga0182007_10000067 3300015262 Bacteria 82879
332 Ga0182007_10013574 3300015262 Bacteria 3101
333 Ga0182007_10059055 3300015262 Bacteria 1258
334 Ga0182005_1000487 3300015265 Bacteria 20470
335 Ga0182005_1003544 3300015265 Bacteria 5268
336 Ga0183368_1004 3300015687 Bacteria 1211761
337 Ga0163161_10000314 3300017792 Bacteria 41729
338 Ga0163161_10020581 3300017792 Bacteria 4632
339 Ga0163161_10022836 3300017792 Bacteria 4407
340 Ga0163161_10130017 3300017792 Bacteria 1898
341 Ga0206356_10015297 3300020070 Bacteria 2268
342 Ga0206353_10295629 3300020082 Bacteria 1190
343 Ga0209760_100676 3300025207 Bacteria 5407
344 Ga0209784_100047 3300025224 Bacteria 199596
345 Ga0209674_100053 3300025226 Bacteria 323159
346 Ga0207427_100023 3300025231 Bacteria 439725
347 Ga0207427_100115 3300025231 Bacteria 104282
348 Ga0207427_100130 3300025231 Bacteria 94510
349 Ga0207427_101434 3300025231 Bacteria 8642
350 Ga0209437_100015 3300025233 Bacteria 713457
351 Ga0209437_100020 3300025233 Bacteria 656374
352 Ga0209437_100079 3300025233 Bacteria 275948
353 Ga0209437_100276 3300025233 Bacteria 76094
354 Ga0209258_100043 3300025242 Bacteria 380685
355 Ga0209258_101362 3300025242 Bacteria 8861
356 Ga0207425_1000097 3300025245 Bacteria 84719
357 Ga0209646_1001086 3300025246 Bacteria 8118
358 Ga0209646_1001409 3300025246 Bacteria 6528
359 Ga0209646_1005518 3300025246 Bacteria 2199
360 Ga0209026_1000047 3300025250 Bacteria 261867
361 Ga0209026_1000105 3300025250 Bacteria 150738
362 Ga0209026_1000162 3300025250 Bacteria 102867
363 Ga0209026_1004849 3300025250 Bacteria 3822
364 Ga0209677_107553 3300025253 Bacteria 2281
365 Ga0209148_1000002 3300025254 Bacteria 2399500
366 Ga0209148_1000010 3300025254 Bacteria 1265567
367 Ga0209759_1000318 3300025256 Bacteria 63865
368 Ga0209129_1000189 3300025258 Bacteria 84712
369 Ga0209129_1002006 3300025258 Bacteria 10556
370 Ga0209233_1000009 3300025261 Bacteria 1265567
371 Ga0209233_1000020 3300025261 Bacteria 798224
372 Ga0209233_1000121 3300025261 Bacteria 233309
373 Ga0209233_1004374 3300025261 Bacteria 4818
374 Ga0209565_1000063 3300025263 Bacteria 183711
375 Ga0209455_1000020 3300025272 Bacteria 702259
376 Ga0209455_1000560 3300025272 Bacteria 25084
377 Ga0209673_1000065 3300025273 Bacteria 252799
378 Ga0209130_1022608 3300025284 Bacteria 1399
379 Ga0209675_1000011 3300025291 Bacteria 520597
380 Ga0209676_1000011 3300025292 Bacteria 860463
381 Ga0209676_1000068 3300025292 Bacteria 314068
382 Ga0209676_1000804 3300025292 Bacteria 41314
383 Ga0209025_1000054 3300025294 Bacteria 317002
384 Ga0209564_1000433 3300025295 Bacteria 72594
385 Ga0209758_1000062 3300025297 Bacteria 317002
386 Ga0209758_1000959 3300025297 Bacteria 38968
387 Ga0209050_1000239 3300025298 Bacteria 119530
388 Ga0209050_1000599 3300025298 Bacteria 57405
389 Ga0209050_1012752 3300025298 Bacteria 3817
390 Ga0209050_1022399 3300025298 Bacteria 2264
391 Ga0209256_1010810 3300025299 Bacteria 3756
392 Ga0209051_1003250 3300025303 Bacteria 10799
393 Ga0209257_1000014 3300025304 Bacteria 946850
394 Ga0209257_1005372 3300025304 Bacteria 9045
395 Ga0209257_1006688 3300025304 Bacteria 7302
396 Ga0207656_10029913 3300025321 Bacteria 2246
397 Ga0207713_1000806 3300025735 Bacteria 29049
398 Ga0207713_1012433 3300025735 Bacteria 4550
399 Ga0207680_10000227 3300025903 Bacteria 27167
400 Ga0207647_10001844 3300025904 Bacteria 16266
401 Ga0207647_10007732 3300025904 Bacteria 7739
402 Ga0207647_10010023 3300025904 Bacteria 6709
403 Ga0207647_10012011 3300025904 Bacteria 6044
404 Ga0207647_10018195 3300025904 Bacteria 4761
405 Ga0207647_10021257 3300025904 Bacteria 4334
406 Ga0207647_10037022 3300025904 Bacteria 3096
407 Ga0207647_10059981 3300025904 Bacteria 2326
408 Ga0207647_10110117 3300025904 Bacteria 1628
409 Ga0207705_10000003 3300025909 Bacteria 709270
410 Ga0207705_10038222 3300025909 Bacteria 3436
411 Ga0207705_10040692 3300025909 Bacteria 3334
412 Ga0207705_10105804 3300025909 Bacteria 2074
413 Ga0207705_10183601 3300025909 Bacteria 1579
414 Ga0207654_10168043 3300025911 Bacteria 1422
415 Ga0207654_10181440 3300025911 Bacteria 1374
416 Ga0207654_10335523 3300025911 Bacteria 1037
417 Ga0207654_10526933 3300025911 Bacteria 837
418 Ga0207707_10011138 3300025912 Bacteria 7822
419 Ga0207707_10137111 3300025912 Bacteria 2139
420 Ga0207695_10000261 3300025913 Bacteria 133038
421 Ga0207695_10000654 3300025913 Bacteria 68735
422 Ga0207695_10000907 3300025913 Bacteria 53347
423 Ga0207695_10008059 3300025913 Bacteria 13262
424 Ga0207695_10010391 3300025913 Bacteria 11391
425 Ga0207695_10043582 3300025913 Bacteria 4782
426 Ga0207695_10046136 3300025913 Bacteria 4620
427 Ga0207695_10047480 3300025913 Bacteria 4544
428 Ga0207695_10048652 3300025913 Bacteria 4476
429 Ga0207695_10111216 3300025913 Bacteria 2718
430 Ga0207695_10266207 3300025913 Bacteria 1610
431 Ga0207695_10766180 3300025913 Bacteria 845
432 Ga0207671_10000020 3300025914 Bacteria 309636
433 Ga0207671_10000033 3300025914 Bacteria 245869
434 Ga0207671_10000726 3300025914 Bacteria 41902
435 Ga0207671_10010073 3300025914 Bacteria 7836
436 Ga0207662_10255148 3300025918 Bacteria 1152
437 Ga0207657_10031993 3300025919 Bacteria 4758
438 Ga0207657_10082222 3300025919 Bacteria 2703
439 Ga0207657_10207414 3300025919 Bacteria 1574
440 Ga0207657_10689750 3300025919 Bacteria 794
441 Ga0207649_10001485 3300025920 Bacteria 13767
442 Ga0207649_10017022 3300025920 Bacteria 4114
443 Ga0207649_10079824 3300025920 Bacteria 2115
444 Ga0207649_10124865 3300025920 Bacteria 1740
445 Ga0207649_10214274 3300025920 Bacteria 1368
446 Ga0207649_10354522 3300025920 Bacteria 1087
447 Ga0207649_10398768 3300025920 Bacteria 1029
448 Ga0207649_10610356 3300025920 Unclassified 840
449 Ga0207652_10166505 3300025921 Bacteria 1977
450 Ga0207681_10114151 3300025923 Bacteria 1970
451 Ga0207681_10239811 3300025923 Bacteria 1411
452 Ga0207694_10006130 3300025924 Bacteria 9187
453 Ga0207694_10017824 3300025924 Bacteria 5367
454 Ga0207694_10271084 3300025924 Bacteria 1392
455 Ga0207694_10362700 3300025924 Bacteria 1201
456 Ga0207650_10020651 3300025925 Bacteria 4647
457 Ga0207650_10352869 3300025925 Bacteria 1210
458 Ga0207700_10003865 3300025928 Bacteria 8752
459 Ga0207700_10024335 3300025928 Bacteria 4190
460 Ga0207664_10000419 3300025929 Bacteria 30364
461 Ga0207664_10022981 3300025929 Bacteria 4666
462 Ga0207664_10138967 3300025929 Bacteria 2052
463 Ga0207664_10822840 3300025929 Bacteria 835
464 Ga0207644_10000833 3300025931 Bacteria 19607
465 Ga0207644_10002832 3300025931 Bacteria 11181
466 Ga0207690_10000314 3300025932 Bacteria 32801
467 Ga0207690_10000797 3300025932 Bacteria 20327
468 Ga0207690_10008204 3300025932 Bacteria 6196
469 Ga0207690_10034749 3300025932 Bacteria 3250
470 Ga0207690_10043020 3300025932 Bacteria 2970
471 Ga0207690_10119941 3300025932 Bacteria 1909
472 Ga0207690_10155955 3300025932 Bacteria 1697
473 Ga0207690_10215986 3300025932 Bacteria 1465
474 Ga0207690_10255072 3300025932 Bacteria 1357
475 Ga0207690_10447939 3300025932 Bacteria 1037
476 Ga0207706_10006757 3300025933 Bacteria 10606
477 Ga0207706_10064116 3300025933 Bacteria 3235
478 Ga0207706_10083461 3300025933 Bacteria 2809
479 Ga0207706_10254836 3300025933 Bacteria 1532
480 Ga0207709_10001731 3300025935 Bacteria 14693
481 Ga0207709_10006989 3300025935 Bacteria 6307
482 Ga0207670_10006401 3300025936 Bacteria 6526
483 Ga0207669_10044209 3300025937 Bacteria 2615
484 Ga0207669_10678038 3300025937 Bacteria 845
485 Ga0207704_10128325 3300025938 Bacteria 1751
486 Ga0207711_10070123 3300025941 Bacteria 3039
487 Ga0207711_10135700 3300025941 Bacteria 2210
488 Ga0207711_10636030 3300025941 Bacteria 995
489 Ga0207689_10150058 3300025942 Bacteria 1921
490 Ga0207689_10513710 3300025942 Bacteria 1004
491 Ga0207661_10001403 3300025944 Bacteria 16228
492 Ga0207667_10000130 3300025949 Bacteria 115321
493 Ga0207667_10000169 3300025949 Bacteria 95977
494 Ga0207667_10006239 3300025949 Bacteria 14468
495 Ga0207667_10013015 3300025949 Bacteria 9550
496 Ga0207667_10015306 3300025949 Bacteria 8721
497 Ga0207667_10064596 3300025949 Bacteria 3820
498 Ga0207667_10131954 3300025949 Bacteria 2573
499 Ga0207667_10132801 3300025949 Bacteria 2564
500 Ga0207667_10264973 3300025949 Bacteria 1757
501 Ga0207667_10426315 3300025949 Bacteria 1349
502 Ga0207651_10287750 3300025960 Bacteria 1361
503 Ga0207651_10432056 3300025960 Bacteria 1126
504 Ga0207712_10123710 3300025961 Bacteria 1961
505 Ga0207668_10126656 3300025972 Bacteria 1943
506 Ga0207668_10612466 3300025972 Bacteria 950
507 Ga0207640_10000838 3300025981 Bacteria 17511
508 Ga0207640_10000908 3300025981 Bacteria 16632
509 Ga0207640_10001060 3300025981 Bacteria 15224
510 Ga0207640_10104123 3300025981 Bacteria 1997
511 Ga0207640_10237128 3300025981 Bacteria 1407
512 Ga0207677_10062497 3300026023 Bacteria 2583
513 Ga0207677_10354174 3300026023 Bacteria 1231
514 Ga0207677_10371122 3300026023 Bacteria 1205
515 Ga0207703_10076370 3300026035 Bacteria 2778
516 Ga0207639_10001886 3300026041 Bacteria 14081
517 Ga0207639_10033345 3300026041 Bacteria 3798
518 Ga0207639_10118496 3300026041 Bacteria 2171
519 Ga0207639_10306901 3300026041 Bacteria 1405
520 Ga0207639_10316142 3300026041 Bacteria 1385
521 Ga0207678_10004283 3300026067 Bacteria 12797
522 Ga0207678_10009382 3300026067 Bacteria 8612
523 Ga0207678_10012591 3300026067 Bacteria 7432
524 Ga0207678_10071671 3300026067 Bacteria 2971
525 Ga0207678_10077801 3300026067 Bacteria 2841
526 Ga0207678_10246941 3300026067 Bacteria 1528
527 Ga0207678_10250517 3300026067 Bacteria 1517
528 Ga0207678_10261620 3300026067 Bacteria 1483
529 Ga0207678_10467075 3300026067 Bacteria 1098
530 Ga0207678_10608017 3300026067 Bacteria 959
531 Ga0207702_10000456 3300026078 Bacteria 46149
532 Ga0207702_10001809 3300026078 Bacteria 21033
533 Ga0207702_10016985 3300026078 Bacteria 6022
534 Ga0207702_10043331 3300026078 Bacteria 3778
535 Ga0207702_10053697 3300026078 Bacteria 3412
536 Ga0207702_10548603 3300026078 Bacteria 1130
537 Ga0207641_10031254 3300026088 Bacteria 4416
538 Ga0207641_10057113 3300026088 Bacteria 3319
539 Ga0207641_10097631 3300026088 Bacteria 2582
540 Ga0207641_11154779 3300026088 Bacteria 774
541 Ga0207648_10407013 3300026089 Bacteria 1233
542 Ga0207648_11017111 3300026089 Bacteria 776
543 Ga0207676_10018047 3300026095 Bacteria 5122
544 Ga0207676_10747026 3300026095 Bacteria 951
545 Ga0207674_10000132 3300026116 Bacteria 87692
546 Ga0207674_10000971 3300026116 Bacteria 37506
547 Ga0207674_10021327 3300026116 Bacteria 6980
548 Ga0207674_10039041 3300026116 Bacteria 4924
549 Ga0207674_10047238 3300026116 Bacteria 4415
550 Ga0207674_10264604 3300026116 Bacteria 1667
551 Ga0207674_10605584 3300026116 Bacteria 1058
552 Ga0207683_10677450 3300026121 Bacteria 956
553 Ga0207698_10013331 3300026142 Bacteria 5418
554 Ga0207698_10015885 3300026142 Bacteria 5059
555 Ga0207698_10016173 3300026142 Bacteria 5020
556 Ga0207698_10045800 3300026142 Bacteria 3298
557 Ga0207698_10151618 3300026142 Bacteria 2013
558 Ga0207698_10556360 3300026142 Bacteria 1125
559 Ga0209973_1019921 3300027252 Bacteria 883
560 Ga0209371_1000004 3300027312 Bacteria 1098197
561 Ga0209371_1000139 3300027312 Bacteria 120350
562 Ga0209999_1008881 3300027543 Bacteria 1818
563 Ga0209970_1011151 3300027614 Bacteria 1476
564 Ga0209983_1005635 3300027665 Bacteria 2583
565 Ga0209974_10010051 3300027876 Bacteria 3198
566 Ga0268266_10000514 3300028379 Bacteria 54510
567 Ga0268266_10774463 3300028379 Bacteria 926
568 Ga0268265_10175325 3300028380 Bacteria 1837
569 Ga0268265_10271456 3300028380 Bacteria 1513
570 Ga0268265_11381258 3300028380 Bacteria 706
571 Ga0268264_10032658 3300028381 Bacteria 4271
572 Ga0268264_10046584 3300028381 Bacteria 3602
573 Ga0268264_10180457 3300028381 Bacteria 1917
574 Ga0268256_1000005 3300030500 Bacteria 1082342
575 Ga0268256_1000109 3300030500 Bacteria 120350
576 Ga0316176_1166069 3300030732 Bacteria 962
577 Ga0314311_1025340 3300030733 Bacteria 9144
578 Ga0316178_1066114 3300030735 Bacteria 1651
579 Ga0316183_1086976 3300030742 Bacteria 6685
580 Ga0316181_1180556 3300030744 Bacteria 2478
581 Ga0307408_100001207 3300031548 Bacteria 19481
582 Ga0307408_100056195 3300031548 Bacteria 2854
583 Ga0307408_100089274 3300031548 Bacteria 2323
584 Ga0307408_100136374 3300031548 Bacteria 1921
585 Ga0307408_100196370 3300031548 Bacteria 1630
586 Ga0316579_10040992 3300031691 Bacteria 2149
587 Ga0316576_10007734 3300031727 Bacteria 6783
588 Ga0316576_10010970 3300031727 Bacteria 5909
589 Ga0316576_10036293 3300031727 Bacteria 3524
590 Ga0316576_10708104 3300031727 Bacteria 729
591 Ga0316578_10006565 3300031728 Bacteria 5757
592 Ga0307516_10162244 3300031730 Bacteria 1984
593 Ga0307405_10009341 3300031731 Bacteria 5022
594 Ga0307405_10036573 3300031731 Bacteria 2943
595 Ga0307405_10224636 3300031731 Bacteria 1380
596 Ga0316577_10105319 3300031733 Bacteria 1582
597 Ga0307413_10026248 3300031824 Bacteria 3207
598 Ga0307413_10044844 3300031824 Bacteria 2616
599 Ga0307413_10177855 3300031824 Bacteria 1513
600 Ga0307413_10503860 3300031824 Bacteria 973
601 Ga0307413_10733133 3300031824 Bacteria 824
602 Ga0307410_10002549 3300031852 Bacteria 8824
603 Ga0307410_10010008 3300031852 Bacteria 5351
604 Ga0307410_10026571 3300031852 Bacteria 3646
605 Ga0307410_10944271 3300031852 Bacteria 741
606 Ga0307406_10016843 3300031901 Bacteria 4252
607 Ga0307406_10138571 3300031901 Bacteria 1719
608 Ga0307406_10390814 3300031901 Bacteria 1100
609 Ga0307406_10512447 3300031901 Bacteria 975
610 Ga0307406_10524310 3300031901 Bacteria 965
611 Ga0307407_10000195 3300031903 Bacteria 18328
612 Ga0307407_10159425 3300031903 Bacteria 1475
613 Ga0307412_10000548 3300031911 Bacteria 22392
614 Ga0307412_10005980 3300031911 Bacteria 6853
615 Ga0307412_10240330 3300031911 Bacteria 1400
616 Ga0307412_10240820 3300031911 Bacteria 1399
617 Ga0307412_10307364 3300031911 Bacteria 1256
618 Ga0307409_100003317 3300031995 Bacteria 8701
619 Ga0307409_100018175 3300031995 Bacteria 4714
620 Ga0307409_100066180 3300031995 Bacteria 2848
621 Ga0307409_100537009 3300031995 Bacteria 1145
622 Ga0307409_100560622 3300031995 Bacteria 1123
623 Ga0307416_100001750 3300032002 Bacteria 12019
624 Ga0307416_100177034 3300032002 Bacteria 1994
625 Ga0307414_10001053 3300032004 Bacteria 14103
626 Ga0307414_10003789 3300032004 Bacteria 8126
627 Ga0307414_10023949 3300032004 Bacteria 3883
628 Ga0307414_10074267 3300032004 Bacteria 2463
629 Ga0307414_10160897 3300032004 Bacteria 1783
630 Ga0307414_10296325 3300032004 Bacteria 1366
631 Ga0307414_10307317 3300032004 Bacteria 1344
632 Ga0307414_10562854 3300032004 Bacteria 1017
633 Ga0307414_10566378 3300032004 Bacteria 1014
634 Ga0307414_10602496 3300032004 Bacteria 985
635 Ga0307414_10978216 3300032004 Bacteria 778
636 Ga0307411_10000206 3300032005 Bacteria 18997
637 Ga0307411_10002634 3300032005 Bacteria 8032
638 Ga0307411_10014544 3300032005 Bacteria 4384
639 Ga0307411_10016389 3300032005 Bacteria 4193
640 Ga0307411_10094833 3300032005 Bacteria 2093
641 Ga0307411_10232904 3300032005 Bacteria 1437
642 Ga0307411_10264160 3300032005 Bacteria 1361
643 Ga0307411_10502491 3300032005 Bacteria 1025
644 Ga0307411_10609503 3300032005 Bacteria 940
645 Ga0307411_10702476 3300032005 Bacteria 881
646 Ga0307415_100171924 3300032126 Bacteria 1691
647 Ga0307415_100574187 3300032126 Bacteria 999
648 Ga0307507_10000880 3300033179 Bacteria 66789
649 Ga0373943_0410418 3300035170 Bacteria 783
650 Ga0316574_0006768 3300035398 Bacteria 6227
651 Ga0316574_0013668 3300035398 Bacteria 4672
652 Ga0316574_0035290 3300035398 Bacteria 3055
653 Ga0316574_0040143 3300035398 Bacteria 2880
654 Ga0316574_0087546 3300035398 Bacteria 1983
655 Ga0316574_0114224 3300035398 Bacteria 1732
656 Ga0316574_0170516 3300035398 Bacteria 1401
657 Ga0316574_0227671 3300035398 Bacteria 1193
658 Ga0316574_0266986 3300035398 Bacteria 1092
659 Ga0316574_0526489 3300035398 Bacteria 735
660 Ga0316582_0108618 3300036647 Bacteria 1844
661 Ga0316582_0130962 3300036647 Bacteria 1685
662 Ga0316584_0391071 3300036712 Bacteria 992
663 Ga0395899_0000184 3300037312 Bacteria 91815
664 Ga0395899_0026186 3300037312 Bacteria 4401
665 Ga0395899_0026471 3300037312 Bacteria 4377
666 Ga0395899_0030102 3300037312 Bacteria 4084
667 Ga0395899_0041528 3300037312 Bacteria 3437
668 Ga0395899_0053971 3300037312 Bacteria 2975
669 Ga0395899_0089521 3300037312 Bacteria 2232
670 Ga0395899_0104800 3300037312 Bacteria 2038
671 Ga0395899_0108198 3300037312 Bacteria 2000
672 Ga0395899_0193216 3300037312 Bacteria 1423
673 Ga0395899_0245317 3300037312 Bacteria 1231
674 Ga0395899_0402416 3300037312 Bacteria 905
675 Ga0395900_0000723 3300037418 Bacteria 43948
676 Ga0395900_0003562 3300037418 Bacteria 16749
677 Ga0395900_0015111 3300037418 Bacteria 7869
678 Ga0395900_0015235 3300037418 Bacteria 7840
679 Ga0395900_0015753 3300037418 Bacteria 7707
680 Ga0395900_0016216 3300037418 Bacteria 7590
681 Ga0395900_0018901 3300037418 Bacteria 7028
682 Ga0395900_0023262 3300037418 Bacteria 6342
683 Ga0395900_0023486 3300037418 Bacteria 6311
684 Ga0395900_0032996 3300037418 Bacteria 5328
685 Ga0395900_0034194 3300037418 Bacteria 5233
686 Ga0395900_0034975 3300037418 Bacteria 5174
687 Ga0395900_0048973 3300037418 Bacteria 4352
688 Ga0395900_0116238 3300037418 Bacteria 2745
689 Ga0395900_0152977 3300037418 Bacteria 2356
690 Ga0395900_0180553 3300037418 Bacteria 2145
691 Ga0395900_0195738 3300037418 Bacteria 2048
692 Ga0395900_0225941 3300037418 Bacteria 1885
693 Ga0395900_0283099 3300037418 Bacteria 1649
694 Ga0395900_0367667 3300037418 Bacteria 1408
695 Ga0395900_0371655 3300037418 Bacteria 1399
696 Ga0395900_0394087 3300037418 Bacteria 1350
697 Ga0395900_0426287 3300037418 Bacteria 1286
698 Ga0395900_0510831 3300037418 Bacteria 1151
699 Ga0395900_0673295 3300037418 Unclassified 970
700 Ga0395898_0000087 3300037466 Bacteria 239211
701 Ga0395898_0003277 3300037466 Bacteria 18196
702 Ga0395898_0004020 3300037466 Bacteria 16164
703 Ga0395898_0009646 3300037466 Bacteria 10135
704 Ga0395898_0021149 3300037466 Bacteria 6599
705 Ga0395898_0021259 3300037466 Bacteria 6581
706 Ga0395898_0073821 3300037466 Bacteria 3295
707 Ga0395898_0076450 3300037466 Bacteria 3233
708 Ga0395898_0105564 3300037466 Bacteria 2701
709 Ga0395898_0211881 3300037466 Bacteria 1848
710 Ga0395898_0305517 3300037466 Bacteria 1517
711 Ga0395898_0689979 3300037466 Bacteria 963
712 Ga0395898_0730900 3300037466 Bacteria 931
713 Ga0395905_0000005 3300037471 Bacteria 557808
714 Ga0395905_0002000 3300037471 Bacteria 23293
715 Ga0395905_0002910 3300037471 Bacteria 18678
716 Ga0395905_0005131 3300037471 Bacteria 13445
717 Ga0395905_0006920 3300037471 Bacteria 11334
718 Ga0395905_0014364 3300037471 Bacteria 7565
719 Ga0395905_0014911 3300037471 Bacteria 7414
720 Ga0395905_0017740 3300037471 Bacteria 6758
721 Ga0395905_0019323 3300037471 Bacteria 6460
722 Ga0395905_0020118 3300037471 Bacteria 6324
723 Ga0395905_0038867 3300037471 Bacteria 4464
724 Ga0395905_0048848 3300037471 Bacteria 3964
725 Ga0395905_0092920 3300037471 Bacteria 2829
726 Ga0395905_0112028 3300037471 Bacteria 2562
727 Ga0395905_0155998 3300037471 Bacteria 2147
728 Ga0395905_0156703 3300037471 Bacteria 2142
729 Ga0395905_0368606 3300037471 Bacteria 1329
730 Ga0395901_0000280 3300038443 Bacteria 63153
731 Ga0395901_0001808 3300038443 Bacteria 22093
732 Ga0395901_0004038 3300038443 Bacteria 14781
733 Ga0395901_0011865 3300038443 Bacteria 8835
734 Ga0395901_0013263 3300038443 Bacteria 8369
735 Ga0395901_0015235 3300038443 Bacteria 7823
736 Ga0395901_0024583 3300038443 Bacteria 6185
737 Ga0395901_0036907 3300038443 Bacteria 5053
738 Ga0395901_0039387 3300038443 Bacteria 4890
739 Ga0395901_0041573 3300038443 Bacteria 4765
740 Ga0395901_0047175 3300038443 Bacteria 4473
741 Ga0395901_0056242 3300038443 Bacteria 4092
742 Ga0395901_0062101 3300038443 Bacteria 3888
743 Ga0395901_0090198 3300038443 Bacteria 3208
744 Ga0395901_0135655 3300038443 Bacteria 2587
745 Ga0395901_0145796 3300038443 Bacteria 2488
746 Ga0395901_0219532 3300038443 Bacteria 1987
747 Ga0395901_0325934 3300038443 Bacteria 1589
748 Ga0395901_0428574 3300038443 Bacteria 1355
749 Ga0395901_0455686 3300038443 Bacteria 1307
750 Ga0395901_0628422 3300038443 Bacteria 1080
751 Ga0237819_00169 3300038705 Bacteria 24069
752 Ga0436365_0505056 3300039437 Bacteria 7152
753 Ga0436363_1707670 3300039450 Bacteria 2046
754 Ga0439439_0130190 3300041406 Bacteria 706
755 Ga0439465_0001563 3300041413 Bacteria 7448
756 Ga0439465_0205265 3300041413 Bacteria 719
757 Ga0451800_0005888 3300041459 Bacteria 2818
758 Ga0451806_032754 3300041462 Bacteria 2478
759 Ga0451837_0033562 3300041494 Bacteria 1395
760 Ga0451837_0344179 3300041494 Bacteria 1634
761 Ga0439437_018934 3300042000 Bacteria 825
762 Ga0439445_0000014 3300042004 Bacteria 23823
763 Ga0439448_0018099 3300042005 Bacteria 2156
764 Ga0439448_0063189 3300042005 Bacteria 1226
765 Ga0439432_028035 3300042006 Bacteria 1836
766 Ga0439432_167382 3300042006 Bacteria 642
767 Ga0439449_0000069 3300042007 Bacteria 32108
768 Ga0439449_0003704 3300042007 Bacteria 5933
769 Ga0450912_000246 3300042116 Bacteria 2368
770 Ga0450920_009978 3300042122 Bacteria 1756
771 Ga0439458_0000243 3300042157 Bacteria 13137
772 Ga0439458_0007783 3300042157 Bacteria 2386
773 Ga0439459_0002997 3300042438 Bacteria 2649
774 Ga0466969_0000310 3300044656 Bacteria 26790
775 Ga0466969_0055225 3300044656 Bacteria 1943
776 Ga0466972_0008198 3300044658 Bacteria 5239
777 Ga0466972_0036255 3300044658 Bacteria 2413
778 Ga0466982_0000020 3300044672 Bacteria 99164
779 Ga0466965_0077533 3300044683 Bacteria 1678
780 Ga0466965_0078668 3300044683 Bacteria 1665
781 Ga0466966_0000039 3300044684 Bacteria 97202
782 Ga0466966_0000802 3300044684 Bacteria 19991
783 Ga0466966_0001010 3300044684 Bacteria 17949
784 Ga0466966_0008999 3300044684 Bacteria 6617
785 Ga0466966_0039427 3300044684 Bacteria 3042
786 Ga0466966_0045857 3300044684 Bacteria 2793
787 Ga0466966_0050544 3300044684 Bacteria 2644
788 Ga0466966_0368928 3300044684 Bacteria 862
789 Ga0466961_0000332 3300044693 Bacteria 31109
790 Ga0466961_0024458 3300044693 Bacteria 3885
791 Ga0466961_0052657 3300044693 Bacteria 2598
792 Ga0466961_0053178 3300044693 Bacteria 2584
793 Ga0466961_0296031 3300044693 Bacteria 989
794 Ga0466963_0450303 3300044694 Bacteria 908
795 Ga0466964_0002553 3300044706 Bacteria 6491
796 Ga0466964_0006390 3300044706 Bacteria 4393
797 Ga0466971_0001750 3300044719 Bacteria 9205
798 Ga0466971_0006606 3300044719 Bacteria 5042
799 Ga0466971_0006892 3300044719 Bacteria 4938
800 Ga0466971_0039618 3300044719 Bacteria 2114
801 Ga0466971_0102646 3300044719 Bacteria 1315
802 Ga0466968_0000227 3300044735 Bacteria 17595
803 Ga0466968_0016306 3300044735 Bacteria 2956
804 Ga0466968_0363235 3300044735 Bacteria 705
805 Ga0466970_0000410 3300044765 Bacteria 20927
806 Ga0466970_0000836 3300044765 Bacteria 14806
807 Ga0466970_0019102 3300044765 Bacteria 3552
808 Ga0466970_0020879 3300044765 Bacteria 3407
809 Ga0466970_0024226 3300044765 Bacteria 3173
810 Ga0466970_0060892 3300044765 Unclassified 2022
811 Ga0466970_0522763 3300044765 Bacteria 684
812 Ga0466970_0581900 3300044765 Bacteria 648
813 Ga0466957_0006130 3300044842 Bacteria 6786
814 Ga0466957_0088901 3300044842 Bacteria 1933
815 Ga0466957_0233213 3300044842 Bacteria 1219
816 Ga0466960_0034356 3300044901 Bacteria 2362
817 Ga0466959_0000334 3300045049 Bacteria 27826
818 Ga0466959_0008432 3300045049 Bacteria 7288
819 Ga0466959_0039700 3300045049 Bacteria 3479
820 Ga0466959_0042264 3300045049 Bacteria 3361
821 Ga0466959_0099272 3300045049 Bacteria 2085
822 Ga0466959_0172748 3300045049 Unclassified 1515
823 Ga0466959_0178635 3300045049 Unclassified 1486
824 Ga0466959_0493413 3300045049 Bacteria 828
825 Ga0466958_0004354 3300045836 Bacteria 7468
826 Ga0466958_0011059 3300045836 Bacteria 5073
827 Ga0466958_0016632 3300045836 Bacteria 4239
828 Ga0466958_0019140 3300045836 Bacteria 3982
829 Ga0466958_0208934 3300045836 Bacteria 1243
830 Ga0466958_0316658 3300045836 Bacteria 1002
831 Ga0466967_0077687 3300045976 Bacteria 2989
832 Ga0466967_0271783 3300045976 Bacteria 1624
833 Ga0466967_0271814 3300045976 Bacteria 1624
834 Ga0466967_0281394 3300045976 Bacteria 1596
835 Ga0466967_0460225 3300045976 Bacteria 1244
836 Ga0466967_0563575 3300045976 Bacteria 1122
837 Ga0495627_017920 3300046453 Bacteria 2398
838 Ga0495638_0000049 3300046460 Bacteria 206725
839 Ga0495638_0000202 3300046460 Bacteria 84492
840 Ga0495638_0000916 3300046460 Bacteria 30114
841 Ga0495638_0027546 3300046460 Bacteria 3677
842 Ga0495650_0001214 3300046471 Bacteria 27066
843 Ga0495606_0001000 3300046507 Bacteria 41217
844 Ga0495610_0049600 3300046512 Bacteria 2054
845 Ga0495631_0034299 3300046518 Bacteria 2275
846 Ga0495632_0130654 3300046519 Bacteria 1169
847 Ga0495643_0000919 3300046522 Bacteria 30964
848 Ga0495663_0002339 3300046525 Bacteria 5734
849 Ga0495663_0006455 3300046525 Bacteria 3241
850 Ga0495663_0013907 3300046525 Bacteria 2251
851 Ga0495663_0044739 3300046525 Bacteria 1356
852 Ga0495621_0000983 3300046539 Bacteria 7289
853 Ga0495621_0020509 3300046539 Bacteria 2170
854 Ga0495621_0065359 3300046539 Bacteria 1329
855 Ga0495622_0023430 3300046557 Bacteria 2878
856 Ga0495633_0011833 3300046558 Bacteria 4678
857 Ga0495633_0046333 3300046558 Bacteria 2057
858 Ga0495633_0174398 3300046558 Bacteria 990
859 Ga0495633_0209316 3300046558 Bacteria 894
860 Ga0495656_0002149 3300046615 Bacteria 6516
861 Ga0495668_0084960 3300046616 Bacteria 1736
862 Ga0495625_0048020 3300046660 Bacteria 3075
863 Ga0495625_0120402 3300046660 Bacteria 1786
864 Ga0495625_0125600 3300046660 Bacteria 1742
865 Ga0495670_0011668 3300046691 Bacteria 4324
866 Ga0495649_0000823 3300046694 Bacteria 24933
867 Ga0495660_0106768 3300046810 Bacteria 1434
868 Ga0495636_0006533 3300047318 Bacteria 4585
869 Ga0495672_0000105 3300047320 Bacteria 133882
870 Ga0495672_0158322 3300047320 Bacteria 1167
871 Ga0495686_0008426 3300047472 Bacteria 7563
872 Ga0495686_0015670 3300047472 Bacteria 5167
873 Ga0496100_0167599 3300048903 Bacteria 1579
874 Ga0496100_0229956 3300048903 Bacteria 1364
875 Ga0496101_0048090 3300048904 Bacteria 3064
876 Ga0496101_0177997 3300048904 Bacteria 1637
877 Ga0496102_0034842 3300048905 Bacteria 4531
878 Ga0496102_0859362 3300048905 Bacteria 829
879 Ga0496103_0101135 3300048906 Bacteria 1824
880 Ga0496104_0055648 3300048907 Bacteria 3741
881 Ga0496104_0091848 3300048907 Bacteria 2902
882 Ga0496104_0268192 3300048907 Bacteria 1619
883 Ga0496104_0346063 3300048907 Bacteria 1399
884 Ga0496105_0001964 3300048908 Bacteria 14781
885 Ga0496105_0172208 3300048908 Bacteria 1774
886 Ga0496106_0046723 3300048909 Bacteria 3256
887 Ga0496107_0234325 3300048910 Bacteria 1366
888 Ga0496107_0361177 3300048910 Bacteria 1080
889 Ga0496107_0786771 3300048910 Bacteria 697
890 Ga0496108_0148092 3300048911 Bacteria 2025
891 Ga0496109_0136187 3300048912 Bacteria 2295
892 Ga0496109_0267515 3300048912 Bacteria 1610
893 Ga0496110_0188119 3300048913 Bacteria 1875
894 Ga0496110_1025254 3300048913 Bacteria 733
895 Ga0496111_0118009 3300048914 Bacteria 1958
896 Ga0496111_0213700 3300048914 Bacteria 1433
897 Ga0496113_0030099 3300048916 Bacteria 3927
898 Ga0496113_0115447 3300048916 Bacteria 2094
899 Ga0496114_0000594 3300048917 Bacteria 26726
900 Ga0496114_0937283 3300048917 Bacteria 748
901 Ga0496115_0000024 3300048918 Bacteria 154488
902 Ga0496115_0000103 3300048918 Bacteria 80518
903 Ga0496115_0002161 3300048918 Bacteria 14061
904 Ga0496115_0002922 3300048918 Bacteria 12322
905 Ga0496115_0011553 3300048918 Bacteria 6620
906 Ga0496116_0000218 3300048919 Bacteria 107445
907 Ga0496116_0013717 3300048919 Bacteria 6515
908 Ga0496116_0032122 3300048919 Bacteria 3746
909 Ga0496116_0076650 3300048919 Bacteria 2093
910 Ga0496116_0113902 3300048919 Bacteria 1581
911 Ga0496116_0213622 3300048919 Bacteria 997
912 Ga0496117_0000314 3300048920 Bacteria 84712
913 Ga0496117_0001191 3300048920 Bacteria 39121
914 Ga0496117_0003149 3300048920 Bacteria 19675
915 Ga0496117_0004544 3300048920 Bacteria 15213
916 Ga0496117_0009737 3300048920 Bacteria 8868
917 Ga0496117_0083137 3300048920 Bacteria 2094
918 Ga0496117_0086255 3300048920 Bacteria 2040
919 Ga0496117_0117784 3300048920 Bacteria 1638
920 Ga0496117_0276306 3300048920 Bacteria 902
921 Ga0496118_0000371 3300048921 Bacteria 75491
922 Ga0496118_0002136 3300048921 Bacteria 27584
923 Ga0496118_0002547 3300048921 Bacteria 24411
924 Ga0496118_0006150 3300048921 Bacteria 13317
925 Ga0496118_0006935 3300048921 Bacteria 12250
926 Ga0496118_0012624 3300048921 Bacteria 8083
927 Ga0496118_0021905 3300048921 Bacteria 5605
928 Ga0496118_0033714 3300048921 Bacteria 4194
929 Ga0496118_0117972 3300048921 Bacteria 1739
930 Ga0496118_0127254 3300048921 Bacteria 1644
931 Ga0496119_0000239 3300048922 Bacteria 77503
932 Ga0496119_0001743 3300048922 Bacteria 25359
933 Ga0496119_0002432 3300048922 Bacteria 20445
934 Ga0496119_0002973 3300048922 Bacteria 18010
935 Ga0496119_0054521 3300048922 Bacteria 2433
936 Ga0496120_0000167 3300048923 Bacteria 110734
937 Ga0496120_0000181 3300048923 Bacteria 107114
938 Ga0496120_0000676 3300048923 Bacteria 50058
939 Ga0496120_0000868 3300048923 Bacteria 42806
940 Ga0496121_0000532 3300048924 Bacteria 72417
941 Ga0496121_0004104 3300048924 Bacteria 19979
942 Ga0496121_0016876 3300048924 Bacteria 7508
943 Ga0496121_0028676 3300048924 Bacteria 5176
944 Ga0496121_0039123 3300048924 Bacteria 4186
945 Ga0496121_0042063 3300048924 Bacteria 3982
946 Ga0496121_0046716 3300048924 Bacteria 3702
947 Ga0496121_0175446 3300048924 Bacteria 1552
948 Ga0496121_0209945 3300048924 Bacteria 1380
949 Ga0496122_0000901 3300048925 Bacteria 54955
950 Ga0496122_0001122 3300048925 Bacteria 46123
951 Ga0496122_0012066 3300048925 Bacteria 8660
952 Ga0496122_0021920 3300048925 Bacteria 5696
953 Ga0496122_0102293 3300048925 Bacteria 1910
954 Ga0496122_0185702 3300048925 Bacteria 1233
955 Ga0496122_0262235 3300048925 Bacteria 958
956 Ga0496123_0000727 3300048926 Bacteria 53518
957 Ga0496123_0000920 3300048926 Bacteria 46126
958 Ga0496123_0002564 3300048926 Bacteria 22119
959 Ga0496123_0005759 3300048926 Bacteria 12328
960 Ga0496123_0010634 3300048926 Bacteria 8097
961 Ga0496123_0042551 3300048926 Bacteria 3133
962 Ga0496123_0046388 3300048926 Bacteria 2948
963 Ga0496123_0318995 3300048926 Bacteria 734
964 Ga0496124_0001061 3300048927 Bacteria 43394
965 Ga0496124_0001652 3300048927 Bacteria 31905
966 Ga0496124_0005126 3300048927 Bacteria 14915
967 Ga0496124_0006193 3300048927 Bacteria 13112
968 Ga0496124_0009321 3300048927 Bacteria 10115
969 Ga0496124_0019095 3300048927 Bacteria 6397
970 Ga0496124_0021047 3300048927 Bacteria 6015
971 Ga0496124_0058646 3300048927 Bacteria 3236
972 Ga0496124_0239956 3300048927 Bacteria 1348
973 Ga0496124_0335034 3300048927 Bacteria 1077
974 Ga0496125_0000320 3300048928 Bacteria 93682
975 Ga0496125_0000344 3300048928 Bacteria 88380
976 Ga0496125_0005964 3300048928 Bacteria 13336
977 Ga0496125_0025180 3300048928 Bacteria 5455
978 Ga0496125_0121582 3300048928 Bacteria 1861
979 Ga0496125_0131233 3300048928 Bacteria 1763
980 Ga0496125_0268578 3300048928 Bacteria 1064
981 Ga0496126_0000581 3300048929 Bacteria 69541
982 Ga0496126_0001014 3300048929 Bacteria 47842
983 Ga0496126_0007111 3300048929 Bacteria 12330
984 Ga0496126_0123760 3300048929 Bacteria 2240
985 Ga0496126_0191593 3300048929 Bacteria 1731
986 Ga0496126_0206619 3300048929 Bacteria 1655
987 Ga0496126_0588425 3300048929 Bacteria 878
988 Ga0495678_037387 3300049459 Bacteria 1973
989 Ga0495682_0017233 3300049460 Bacteria 2729
990 Ga0501031_0020584 3300049568 Bacteria 4301
991 Ga0501031_0107743 3300049568 Bacteria 1819
992 Ga0501031_0150963 3300049568 Bacteria 1518
993 Ga0501032_0014188 3300049569 Bacteria 5645
994 Ga0501032_0114080 3300049569 Bacteria 1787
995 Ga0501032_0178721 3300049569 Bacteria 1390
996 Ga0501033_0001868 3300049570 Bacteria 18315
997 Ga0501033_0002545 3300049570 Bacteria 15427
998 Ga0501033_0090785 3300049570 Bacteria 2234
999 Ga0501033_0199045 3300049570 Bacteria 1431
1000 Ga0501033_0523668 3300049570 Bacteria 819
1001 Ga0501034_0001977 3300049571 Bacteria 25973
1002 Ga0501034_0007048 3300049571 Bacteria 11989
1003 Ga0501034_0028239 3300049571 Bacteria 5708
1004 Ga0501034_0103298 3300049571 Bacteria 2843
1005 Ga0501034_0143066 3300049571 Bacteria 2370
1006 Ga0501034_0192995 3300049571 Bacteria 1998
1007 Ga0501034_0343555 3300049571 Bacteria 1422
1008 Ga0501034_0635658 3300049571 Bacteria 970
1009 Ga0501036_0095765 3300049572 Bacteria 2509
1010 Ga0501036_0111278 3300049572 Bacteria 2314
1011 Ga0501037_0015245 3300049573 Bacteria 5654
1012 Ga0501037_0041434 3300049573 Bacteria 3386
1013 Ga0501038_0066603 3300049574 Bacteria 3066
1014 Ga0501038_0119491 3300049574 Bacteria 2175
1015 Ga0501039_0362605 3300049575 Bacteria 1138
1016 Ga0501039_0605447 3300049575 Bacteria 859
1017 Ga0501043_0128950 3300049579 Bacteria 1982
1018 Ga0501043_0185757 3300049579 Bacteria 1618
1019 Ga0501043_0386785 3300049579 Bacteria 1058
1020 Ga0501046_0025262 3300049580 Bacteria 4862
1021 Ga0501046_0091874 3300049580 Bacteria 2334
1022 Ga0501046_0103124 3300049580 Bacteria 2187
1023 Ga0501047_0003603 3300049581 Bacteria 14602
1024 Ga0501047_0011089 3300049581 Bacteria 8529
1025 Ga0501047_0031361 3300049581 Bacteria 5126
1026 Ga0501047_0101772 3300049581 Bacteria 2752
1027 Ga0501048_0078848 3300049582 Bacteria 2324
1028 Ga0501069_0011564 3300049585 Bacteria 4678
1029 Ga0501069_0048655 3300049585 Bacteria 2355
1030 Ga0501070_0000587 3300049586 Bacteria 33165
1031 Ga0501070_0020482 3300049586 Bacteria 5547
1032 Ga0501070_0358320 3300049586 Bacteria 1183
1033 Ga0501073_0188926 3300049589 Bacteria 1425
1034 Ga0501077_0277500 3300049593 Bacteria 1066
1035 Ga0501216_011253 3300049660 Bacteria 1451
1036 Ga0501249_043326 3300049679 Bacteria 1024
1037 Ga0501259_027992 3300049688 Bacteria 1047
1038 Ga0501080_0038483 3300049742 Bacteria 4465
1039 Ga0501272_008281 3300049769 Bacteria 1139
1040 Ga0501275_000447 3300049772 Bacteria 4640
1041 Ga0501035_0005912 3300049822 Bacteria 11521
1042 Ga0501035_0017043 3300049822 Bacteria 6694
1043 Ga0501035_0023420 3300049822 Bacteria 5664
1044 Ga0501035_0070003 3300049822 Bacteria 3108
1045 Ga0501035_0097596 3300049822 Bacteria 2580
1046 Ga0501035_0499810 3300049822 Bacteria 1001
1047 Ga0501044_0020827 3300049823 Bacteria 6999
1048 Ga0501044_0025356 3300049823 Bacteria 6284
1049 Ga0501044_0042471 3300049823 Bacteria 4728
1050 Ga0501044_0213400 3300049823 Bacteria 1883
1051 Ga0501044_0345473 3300049823 Bacteria 1408
1052 Ga0501044_0601604 3300049823 Bacteria 993
1053 nmdc:mga00v17_20876_c1 3300050491 Bacteria 3758
1054 nmdc:mga00v17_729_c2 3300050491 Bacteria 11208
1055 nmdc:mga0yw44_137900_c1 3300050492 Bacteria 1583
1056 nmdc:mga06z11_426937_c1 3300050494 Bacteria 799
1057 nmdc:mga05p37_678987_c1 3300050507 Bacteria 1148
1058 nmdc:mga08y16_479171_c1 3300050511 Bacteria 1266
1059 nmdc:mga08y16_512095_c1 3300050511 Bacteria 1218
1060 nmdc:mga0n895_1019311_c1 3300050512 Bacteria 808
1061 Ga0500626_053803 3300053128 Bacteria 1808
1062 Ga0500658_0196854 3300053134 Bacteria 921
1063 Ga0500568_0004359 3300053139 Bacteria 7574
1064 Ga0500604_0000002 3300053151 Bacteria 165603
1065 Ga0500616_0000238 3300053153 Bacteria 86573
1066 Ga0500634_0000322 3300053161 Bacteria 15273
1067 Ga0500565_020439 3300053734 Bacteria 791
1068 Ga0466962_0000083 3300061719 Bacteria 38031
1069 Ga0466962_0003389 3300061719 Bacteria 7588
1070 Ga0466962_0004622 3300061719 Bacteria 6610
1071 Ga0466962_0066683 3300061719 Unclassified 1718
1072 Ga0466962_0131145 3300061719 Unclassified 1211

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049769 Ga0501272_008281 Ga0501272_008281_367_945 181
2 3300037418 Ga0395900_0225941 Ga0395900_0225941_505_1080 189
3 3300037471 Ga0395905_0020118 Ga0395905_0020118_5334_5909 189
4 3300001904 JGI24736J21556_1000339 JGI24736J21556_10003397 190
5 3300003323 rootH1_10103103 rootH1_101031032 190
6 3300005327 Ga0070658_10097525 Ga0070658_100975252 190
7 3300005327 Ga0070658_10212515 Ga0070658_102125153 190
8 3300005327 Ga0070658_10343262 Ga0070658_103432622 190
9 3300005327 Ga0070658_10371877 Ga0070658_103718771 190
10 3300005328 Ga0070676_10257509 Ga0070676_102575092 190
11 3300005335 Ga0070666_10254484 Ga0070666_102544842 190
12 3300005339 Ga0070660_100019590 Ga0070660_1000195902 190
13 3300005339 Ga0070660_101054913 Ga0070660_1010549131 190
14 3300005344 Ga0070661_100037021 Ga0070661_1000370213 190
15 3300005344 Ga0070661_100084639 Ga0070661_1000846393 190
16 3300005345 Ga0070692_10215947 Ga0070692_102159472 190
17 3300005354 Ga0070675_100119317 Ga0070675_1001193172 190
18 3300005355 Ga0070671_100013860 Ga0070671_1000138607 190
19 3300005366 Ga0070659_100034565 Ga0070659_1000345653 190
20 3300005366 Ga0070659_100362442 Ga0070659_1003624422 190
21 3300005435 Ga0070714_100164743 Ga0070714_1001647432 190
22 3300005435 Ga0070714_100241691 Ga0070714_1002416912 190
23 3300005435 Ga0070714_100304389 Ga0070714_1003043892 190
24 3300005436 Ga0070713_100014588 Ga0070713_1000145886 190
25 3300005455 Ga0070663_100093093 Ga0070663_1000930933 190
26 3300005455 Ga0070663_100186336 Ga0070663_1001863362 190
27 3300005455 Ga0070663_100312998 Ga0070663_1003129982 190
28 3300005455 Ga0070663_100428567 Ga0070663_1004285671 190
29 3300005457 Ga0070662_100127321 Ga0070662_1001273213 190
30 3300005457 Ga0070662_100208443 Ga0070662_1002084433 190
31 3300005539 Ga0068853_100161588 Ga0068853_1001615883 190
32 3300005548 Ga0070665_100499008 Ga0070665_1004990082 190
33 3300005563 Ga0068855_100082253 Ga0068855_1000822533 190
34 3300005563 Ga0068855_100092531 Ga0068855_1000925312 190
35 3300005563 Ga0068855_100399958 Ga0068855_1003999582 190
36 3300005577 Ga0068857_100380365 Ga0068857_1003803652 190
37 3300005578 Ga0068854_100027013 Ga0068854_1000270132 190
38 3300005578 Ga0068854_100063684 Ga0068854_1000636842 190
39 3300005614 Ga0068856_100008083 Ga0068856_1000080835 190
40 3300005614 Ga0068856_100923512 Ga0068856_1009235122 190
41 3300005616 Ga0068852_100003835 Ga0068852_1000038359 190
42 3300005616 Ga0068852_100105743 Ga0068852_1001057432 190
43 3300005616 Ga0068852_100453352 Ga0068852_1004533522 190
44 3300005618 Ga0068864_100028252 Ga0068864_1000282523 190
45 3300005841 Ga0068863_100156943 Ga0068863_1001569433 190
46 3300005841 Ga0068863_101395398 Ga0068863_1013953981 190
47 3300006237 Ga0097621_100107133 Ga0097621_1001071332 190
48 3300006358 Ga0068871_100027620 Ga0068871_1000276202 190
49 3300006844 Ga0075428_100836136 Ga0075428_1008361362 190
50 3300006881 Ga0068865_100491865 Ga0068865_1004918652 190
51 3300009093 Ga0105240_10009039 Ga0105240_100090399 190
52 3300009093 Ga0105240_10172954 Ga0105240_101729542 190
53 3300009093 Ga0105240_10977755 Ga0105240_109777552 190
54 3300009177 Ga0105248_10183860 Ga0105248_101838602 190
55 3300009177 Ga0105248_10686207 Ga0105248_106862072 190
56 3300010375 Ga0105239_10636726 Ga0105239_106367262 190
57 3300013100 Ga0157373_10044297 Ga0157373_100442972 190
58 3300013100 Ga0157373_10075101 Ga0157373_100751012 190
59 3300013100 Ga0157373_10462764 Ga0157373_104627642 190
60 3300013102 Ga0157371_10005924 Ga0157371_100059245 190
61 3300013102 Ga0157371_10049262 Ga0157371_100492622 190
62 3300013102 Ga0157371_10741917 Ga0157371_107419172 190
63 3300013104 Ga0157370_10000707 Ga0157370_1000070735 190
64 3300013104 Ga0157370_10104116 Ga0157370_101041164 190
65 3300013104 Ga0157370_10177749 Ga0157370_101777492 190
66 3300013104 Ga0157370_10289114 Ga0157370_102891142 190
67 3300013105 Ga0157369_10000239 Ga0157369_1000023932 190
68 3300013105 Ga0157369_10026692 Ga0157369_100266928 190
69 3300013105 Ga0157369_10076617 Ga0157369_100766172 190
70 3300013105 Ga0157369_10095626 Ga0157369_100956265 190
71 3300013105 Ga0157369_10128439 Ga0157369_101284392 190
72 3300013105 Ga0157369_10690381 Ga0157369_106903812 190
73 3300013296 Ga0157374_10010711 Ga0157374_100107116 190
74 3300013297 Ga0157378_10673704 Ga0157378_106737042 190
75 3300013307 Ga0157372_10382008 Ga0157372_103820082 190
76 3300013307 Ga0157372_11018677 Ga0157372_110186771 190
77 3300013308 Ga0157375_11021767 Ga0157375_110217672 190
78 3300014325 Ga0163163_10840434 Ga0163163_108404342 190
79 3300025904 Ga0207647_10007732 Ga0207647_100077323 190
80 3300025904 Ga0207647_10037022 Ga0207647_100370223 190
81 3300025904 Ga0207647_10110117 Ga0207647_101101172 190
82 3300025909 Ga0207705_10000003 Ga0207705_10000003611 190
83 3300025909 Ga0207705_10038222 Ga0207705_100382222 190
84 3300025909 Ga0207705_10040692 Ga0207705_100406922 190
85 3300025909 Ga0207705_10183601 Ga0207705_101836012 190
86 3300025913 Ga0207695_10010391 Ga0207695_100103916 190
87 3300025913 Ga0207695_10043582 Ga0207695_100435822 190
88 3300025913 Ga0207695_10766180 Ga0207695_107661801 190
89 3300025919 Ga0207657_10207414 Ga0207657_102074142 190
90 3300025920 Ga0207649_10001485 Ga0207649_100014858 190
91 3300025920 Ga0207649_10017022 Ga0207649_100170225 190
92 3300025920 Ga0207649_10610356 Ga0207649_106103562 190
93 3300025925 Ga0207650_10352869 Ga0207650_103528692 190
94 3300025928 Ga0207700_10024335 Ga0207700_100243354 190
95 3300025929 Ga0207664_10822840 Ga0207664_108228402 190
96 3300025931 Ga0207644_10000833 Ga0207644_100008337 190
97 3300025931 Ga0207644_10002832 Ga0207644_100028322 190
98 3300025932 Ga0207690_10034749 Ga0207690_100347493 190
99 3300025932 Ga0207690_10255072 Ga0207690_102550722 190
100 3300025933 Ga0207706_10083461 Ga0207706_100834614 190
101 3300025933 Ga0207706_10254836 Ga0207706_102548362 190
102 3300025941 Ga0207711_10070123 Ga0207711_100701233 190
103 3300025941 Ga0207711_10636030 Ga0207711_106360302 190
104 3300025949 Ga0207667_10013015 Ga0207667_100130158 190
105 3300025949 Ga0207667_10015306 Ga0207667_100153067 190
106 3300025949 Ga0207667_10064596 Ga0207667_100645963 190
107 3300025949 Ga0207667_10131954 Ga0207667_101319542 190
108 3300025949 Ga0207667_10132801 Ga0207667_101328012 190
109 3300025960 Ga0207651_10287750 Ga0207651_102877502 190
110 3300025981 Ga0207640_10000838 Ga0207640_100008384 190
111 3300026023 Ga0207677_10371122 Ga0207677_103711222 190
112 3300026041 Ga0207639_10316142 Ga0207639_103161422 190
113 3300026067 Ga0207678_10004283 Ga0207678_100042838 190
114 3300026067 Ga0207678_10012591 Ga0207678_100125917 190
115 3300026067 Ga0207678_10077801 Ga0207678_100778012 190
116 3300026067 Ga0207678_10250517 Ga0207678_102505172 190
117 3300026067 Ga0207678_10467075 Ga0207678_104670752 190
118 3300026067 Ga0207678_10608017 Ga0207678_106080172 190
119 3300026078 Ga0207702_10016985 Ga0207702_100169856 190
120 3300026078 Ga0207702_10043331 Ga0207702_100433315 190
121 3300026078 Ga0207702_10053697 Ga0207702_100536975 190
122 3300026078 Ga0207702_10548603 Ga0207702_105486032 190
123 3300026088 Ga0207641_10057113 Ga0207641_100571133 190
124 3300026095 Ga0207676_10018047 Ga0207676_100180472 190
125 3300026142 Ga0207698_10015885 Ga0207698_100158854 190
126 3300026142 Ga0207698_10045800 Ga0207698_100458003 190
127 3300026142 Ga0207698_10556360 Ga0207698_105563602 190
128 3300028379 Ga0268266_10774463 Ga0268266_107744632 190
129 3300031548 Ga0307408_100001207 Ga0307408_10000120717 190
130 3300031548 Ga0307408_100056195 Ga0307408_1000561952 190
131 3300031548 Ga0307408_100089274 Ga0307408_1000892742 190
132 3300031731 Ga0307405_10009341 Ga0307405_100093415 190
133 3300031731 Ga0307405_10036573 Ga0307405_100365733 190
134 3300031824 Ga0307413_10026248 Ga0307413_100262483 190
135 3300031824 Ga0307413_10044844 Ga0307413_100448443 190
136 3300031824 Ga0307413_10177855 Ga0307413_101778553 190
137 3300031852 Ga0307410_10002549 Ga0307410_100025492 190
138 3300031852 Ga0307410_10010008 Ga0307410_100100083 190
139 3300031852 Ga0307410_10026571 Ga0307410_100265712 190
140 3300031852 Ga0307410_10944271 Ga0307410_109442712 190
141 3300031901 Ga0307406_10016843 Ga0307406_100168435 190
142 3300031901 Ga0307406_10138571 Ga0307406_101385712 190
143 3300031901 Ga0307406_10512447 Ga0307406_105124472 190
144 3300031903 Ga0307407_10000195 Ga0307407_100001957 190
145 3300031903 Ga0307407_10159425 Ga0307407_101594252 190
146 3300031911 Ga0307412_10005980 Ga0307412_100059803 190
147 3300031911 Ga0307412_10240330 Ga0307412_102403302 190
148 3300031995 Ga0307409_100003317 Ga0307409_1000033174 190
149 3300031995 Ga0307409_100018175 Ga0307409_1000181752 190
150 3300031995 Ga0307409_100066180 Ga0307409_1000661802 190
151 3300031995 Ga0307409_100560622 Ga0307409_1005606222 190
152 3300032002 Ga0307416_100001750 Ga0307416_1000017505 190
153 3300032002 Ga0307416_100177034 Ga0307416_1001770342 190
154 3300032004 Ga0307414_10001053 Ga0307414_1000105312 190
155 3300032004 Ga0307414_10003789 Ga0307414_100037896 190
156 3300032004 Ga0307414_10160897 Ga0307414_101608972 190
157 3300032005 Ga0307411_10000206 Ga0307411_100002065 190
158 3300032005 Ga0307411_10002634 Ga0307411_100026348 190
159 3300032005 Ga0307411_10016389 Ga0307411_100163892 190
160 3300032005 Ga0307411_10094833 Ga0307411_100948333 190
161 3300032005 Ga0307411_10264160 Ga0307411_102641601 190
162 3300032005 Ga0307411_10702476 Ga0307411_107024762 190
163 3300032126 Ga0307415_100574187 Ga0307415_1005741872 190
164 3300035170 Ga0373943_0410418 Ga0373943_0410418_124_702 190
165 3300037312 Ga0395899_0000184 Ga0395899_0000184_66487_67065 190
166 3300037312 Ga0395899_0026186 Ga0395899_0026186_3512_4090 190
167 3300037312 Ga0395899_0026471 Ga0395899_0026471_766_1344 190
168 3300037312 Ga0395899_0030102 Ga0395899_0030102_2213_2791 190
169 3300037312 Ga0395899_0041528 Ga0395899_0041528_170_748 190
170 3300037312 Ga0395899_0053971 Ga0395899_0053971_80_658 190
171 3300037312 Ga0395899_0089521 Ga0395899_0089521_996_1574 190
172 3300037312 Ga0395899_0104800 Ga0395899_0104800_901_1479 190
173 3300037312 Ga0395899_0193216 Ga0395899_0193216_80_658 190
174 3300037418 Ga0395900_0000723 Ga0395900_0000723_38783_39361 190
175 3300037418 Ga0395900_0015111 Ga0395900_0015111_807_1385 190
176 3300037418 Ga0395900_0015235 Ga0395900_0015235_6497_7075 190
177 3300037418 Ga0395900_0016216 Ga0395900_0016216_1231_1809 190
178 3300037418 Ga0395900_0034194 Ga0395900_0034194_2413_2991 190
179 3300037418 Ga0395900_0034975 Ga0395900_0034975_1423_2001 190
180 3300037418 Ga0395900_0152977 Ga0395900_0152977_510_1088 190
181 3300037418 Ga0395900_0180553 Ga0395900_0180553_725_1303 190
182 3300037418 Ga0395900_0283099 Ga0395900_0283099_20_598 190
183 3300037418 Ga0395900_0367667 Ga0395900_0367667_65_643 190
184 3300037418 Ga0395900_0394087 Ga0395900_0394087_740_1318 190
185 3300037418 Ga0395900_0426287 Ga0395900_0426287_601_1179 190
186 3300037418 Ga0395900_0510831 Ga0395900_0510831_85_663 190
187 3300037418 Ga0395900_0673295 Ga0395900_0673295_370_948 190
188 3300037466 Ga0395898_0000087 Ga0395898_0000087_68995_69573 190
189 3300037466 Ga0395898_0004020 Ga0395898_0004020_11142_11720 190
190 3300037466 Ga0395898_0009646 Ga0395898_0009646_9167_9745 190
191 3300037466 Ga0395898_0021149 Ga0395898_0021149_2388_2966 190
192 3300037466 Ga0395898_0073821 Ga0395898_0073821_2265_2843 190
193 3300037466 Ga0395898_0105564 Ga0395898_0105564_1392_1970 190
194 3300037466 Ga0395898_0305517 Ga0395898_0305517_157_735 190
195 3300037466 Ga0395898_0689979 Ga0395898_0689979_314_892 190
196 3300037466 Ga0395898_0730900 Ga0395898_0730900_16_594 190
197 3300037471 Ga0395905_0000005 Ga0395905_0000005_68995_69573 190
198 3300037471 Ga0395905_0006920 Ga0395905_0006920_9601_10179 190
199 3300037471 Ga0395905_0014911 Ga0395905_0014911_2015_2593 190
200 3300037471 Ga0395905_0017740 Ga0395905_0017740_4057_4635 190
201 3300037471 Ga0395905_0038867 Ga0395905_0038867_3820_4401 190
202 3300037471 Ga0395905_0092920 Ga0395905_0092920_1125_1703 190
203 3300037471 Ga0395905_0156703 Ga0395905_0156703_220_798 190
204 3300038443 Ga0395901_0001808 Ga0395901_0001808_5994_6572 190
205 3300038443 Ga0395901_0004038 Ga0395901_0004038_8157_8735 190
206 3300038443 Ga0395901_0011865 Ga0395901_0011865_788_1366 190
207 3300038443 Ga0395901_0047175 Ga0395901_0047175_3394_3972 190
208 3300038443 Ga0395901_0056242 Ga0395901_0056242_2414_2992 190
209 3300038443 Ga0395901_0062101 Ga0395901_0062101_494_1072 190
210 3300038443 Ga0395901_0325934 Ga0395901_0325934_758_1336 190
211 3300038443 Ga0395901_0428574 Ga0395901_0428574_158_736 190
212 3300038443 Ga0395901_0628422 Ga0395901_0628422_56_634 190
213 3300041413 Ga0439465_0205265 Ga0439465_0205265_40_618 190
214 3300042004 Ga0439445_0000014 Ga0439445_0000014_12564_13142 190
215 3300042006 Ga0439432_028035 Ga0439432_028035_163_741 190
216 3300042116 Ga0450912_000246 Ga0450912_000246_830_1408 190
217 3300042122 Ga0450920_009978 Ga0450920_009978_877_1455 190
218 3300044658 Ga0466972_0008198 Ga0466972_0008198_2270_2848 190
219 3300044683 Ga0466965_0077533 Ga0466965_0077533_925_1503 190
220 3300044684 Ga0466966_0000039 Ga0466966_0000039_51572_52150 190
221 3300044684 Ga0466966_0000802 Ga0466966_0000802_15131_15709 190
222 3300044684 Ga0466966_0039427 Ga0466966_0039427_907_1485 190
223 3300044684 Ga0466966_0045857 Ga0466966_0045857_1913_2491 190
224 3300044684 Ga0466966_0050544 Ga0466966_0050544_1684_2262 190
225 3300044684 Ga0466966_0368928 Ga0466966_0368928_146_724 190
226 3300044693 Ga0466961_0024458 Ga0466961_0024458_1483_2061 190
227 3300044693 Ga0466961_0052657 Ga0466961_0052657_837_1415 190
228 3300044693 Ga0466961_0053178 Ga0466961_0053178_625_1203 190
229 3300044693 Ga0466961_0296031 Ga0466961_0296031_66_644 190
230 3300044694 Ga0466963_0450303 Ga0466963_0450303_146_724 190
231 3300044706 Ga0466964_0006390 Ga0466964_0006390_1592_2170 190
232 3300044719 Ga0466971_0006606 Ga0466971_0006606_1703_2281 190
233 3300044719 Ga0466971_0039618 Ga0466971_0039618_293_871 190
234 3300044719 Ga0466971_0102646 Ga0466971_0102646_599_1177 190
235 3300044735 Ga0466968_0000227 Ga0466968_0000227_456_1034 190
236 3300044735 Ga0466968_0363235 Ga0466968_0363235_42_620 190
237 3300044765 Ga0466970_0000836 Ga0466970_0000836_12253_12831 190
238 3300044765 Ga0466970_0019102 Ga0466970_0019102_114_692 190
239 3300044765 Ga0466970_0020879 Ga0466970_0020879_733_1311 190
240 3300044765 Ga0466970_0060892 Ga0466970_0060892_864_1442 190
241 3300044765 Ga0466970_0522763 Ga0466970_0522763_31_609 190
242 3300044765 Ga0466970_0581900 Ga0466970_0581900_12_590 190
243 3300044842 Ga0466957_0006130 Ga0466957_0006130_3852_4430 190
244 3300044842 Ga0466957_0088901 Ga0466957_0088901_835_1413 190
245 3300045049 Ga0466959_0008432 Ga0466959_0008432_4547_5125 190
246 3300045049 Ga0466959_0039700 Ga0466959_0039700_160_738 190
247 3300045049 Ga0466959_0042264 Ga0466959_0042264_802_1380 190
248 3300045049 Ga0466959_0172748 Ga0466959_0172748_346_924 190
249 3300045049 Ga0466959_0178635 Ga0466959_0178635_231_809 190
250 3300045049 Ga0466959_0493413 Ga0466959_0493413_34_612 190
251 3300045836 Ga0466958_0004354 Ga0466958_0004354_6048_6626 190
252 3300045836 Ga0466958_0011059 Ga0466958_0011059_2781_3359 190
253 3300045836 Ga0466958_0019140 Ga0466958_0019140_1628_2206 190
254 3300045836 Ga0466958_0208934 Ga0466958_0208934_643_1221 190
255 3300045836 Ga0466958_0316658 Ga0466958_0316658_33_611 190
256 3300045976 Ga0466967_0077687 Ga0466967_0077687_465_1043 190
257 3300045976 Ga0466967_0271783 Ga0466967_0271783_214_792 190
258 3300045976 Ga0466967_0271814 Ga0466967_0271814_380_958 190
259 3300045976 Ga0466967_0563575 Ga0466967_0563575_450_1028 190
260 3300046525 Ga0495663_0044739 Ga0495663_0044739_430_1008 190
261 3300046539 Ga0495621_0000983 Ga0495621_0000983_5398_5976 190
262 3300046691 Ga0495670_0011668 Ga0495670_0011668_2267_2845 190
263 3300048904 Ga0496101_0177997 Ga0496101_0177997_607_1185 190
264 3300048905 Ga0496102_0859362 Ga0496102_0859362_43_621 190
265 3300048910 Ga0496107_0786771 Ga0496107_0786771_108_686 190
266 3300048911 Ga0496108_0148092 Ga0496108_0148092_311_889 190
267 3300048912 Ga0496109_0136187 Ga0496109_0136187_1635_2213 190
268 3300048912 Ga0496109_0267515 Ga0496109_0267515_379_957 190
269 3300048913 Ga0496110_0188119 Ga0496110_0188119_962_1540 190
270 3300048913 Ga0496110_1025254 Ga0496110_1025254_66_644 190
271 3300048914 Ga0496111_0213700 Ga0496111_0213700_670_1248 190
272 3300048916 Ga0496113_0115447 Ga0496113_0115447_1067_1645 190
273 3300048917 Ga0496114_0000594 Ga0496114_0000594_2460_3041 190
274 3300048917 Ga0496114_0937283 Ga0496114_0937283_58_636 190
275 3300061719 Ga0466962_0004622 Ga0466962_0004622_1739_2317 190
276 3300061719 Ga0466962_0066683 Ga0466962_0066683_801_1379 190
277 3300061719 Ga0466962_0131145 Ga0466962_0131145_172_750 190
278 3300003323 rootH1_10048164 rootH1_100481642 191
279 3300005356 Ga0070674_100133202 Ga0070674_1001332023 191
280 3300005364 Ga0070673_100506750 Ga0070673_1005067502 191
281 3300005364 Ga0070673_100669910 Ga0070673_1006699102 191
282 3300005548 Ga0070665_100003847 Ga0070665_10000384711 191
283 3300005843 Ga0068860_100061662 Ga0068860_1000616625 191
284 3300009094 Ga0111539_11273889 Ga0111539_112738892 191
285 3300013307 Ga0157372_10008488 Ga0157372_100084884 191
286 3300013308 Ga0157375_11987819 Ga0157375_119878192 191
287 3300025918 Ga0207662_10255148 Ga0207662_102551482 191
288 3300025923 Ga0207681_10114151 Ga0207681_101141512 191
289 3300025937 Ga0207669_10678038 Ga0207669_106780382 191
290 3300025942 Ga0207689_10513710 Ga0207689_105137101 191
291 3300025972 Ga0207668_10612466 Ga0207668_106124662 191
292 3300026089 Ga0207648_10407013 Ga0207648_104070132 191
293 3300028379 Ga0268266_10000514 Ga0268266_100005148 191
294 3300028381 Ga0268264_10046584 Ga0268264_100465845 191
295 3300032004 Ga0307414_10978216 Ga0307414_109782162 191
296 3300038443 Ga0395901_0455686 Ga0395901_0455686_494_1171 191
297 3300046519 Ga0495632_0130654 Ga0495632_0130654_415_996 191
298 3300046616 Ga0495668_0084960 Ga0495668_0084960_1062_1643 191
299 3300046660 Ga0495625_0125600 Ga0495625_0125600_392_973 191
300 3300050511 nmdc:mga08y16_512095_c1 nmdc:mga08y16_512095_c1_37_618 191
301 3300053134 Ga0500658_0196854 Ga0500658_0196854_225_806 191
302 3300053139 Ga0500568_0004359 Ga0500568_0004359_4608_5189 191
303 3300053151 Ga0500604_0000002 Ga0500604_0000002_144017_144598 191
304 3300053153 Ga0500616_0000238 Ga0500616_0000238_33766_34347 191
305 3300031548 Ga0307408_100196370 Ga0307408_1001963702 192
306 3300031901 Ga0307406_10390814 Ga0307406_103908142 192
307 3300031911 Ga0307412_10240820 Ga0307412_102408202 192
308 3300032126 Ga0307415_100171924 Ga0307415_1001719242 192
309 iso_pu_bacteria 2643221562 2643830455 192
310 iso_pu_bacteria 2643221577 2643894229 192
311 iso_pu_bacteria 2643221685 2644476431 192
312 iso_pu_bacteria 2687453130 2687582890 192
313 iso_pu_bacteria 2739367700 2739730760 192
314 iso_pu_bacteria 2884411467 2884414413 192
315 iso_pu_bacteria 2895395659 2895398770 192
316 iso_pu_bacteria 2928963466 2928964166 192
317 iso_pu_bacteria 2939611941 2939612354 192
318 3300001989 JGI24739J22299_10056009 JGI24739J22299_100560092 194
319 3300001990 JGI24737J22298_10002784 JGI24737J22298_100027844 194
320 3300005339 Ga0070660_100061965 Ga0070660_1000619652 194
321 3300005356 Ga0070674_100031562 Ga0070674_1000315621 194
322 3300005364 Ga0070673_100096136 Ga0070673_1000961363 194
323 3300005366 Ga0070659_100058107 Ga0070659_1000581072 194
324 3300005366 Ga0070659_100161313 Ga0070659_1001613131 194
325 3300005457 Ga0070662_100012504 Ga0070662_1000125045 194
326 3300005577 Ga0068857_100004075 Ga0068857_1000040759 194
327 3300005841 Ga0068863_100000991 Ga0068863_1000009914 194
328 3300005844 Ga0068862_100057171 Ga0068862_1000571713 194
329 3300006195 Ga0075366_10183309 Ga0075366_101833092 194
330 3300009098 Ga0105245_10543037 Ga0105245_105430372 194
331 3300011119 Ga0105246_10023433 Ga0105246_100234334 194
332 3300013102 Ga0157371_10165528 Ga0157371_101655282 194
333 3300013307 Ga0157372_10455589 Ga0157372_104555892 194
334 3300014325 Ga0163163_10007998 Ga0163163_100079987 194
335 3300025904 Ga0207647_10010023 Ga0207647_100100236 194
336 3300025904 Ga0207647_10012011 Ga0207647_100120116 194
337 3300025932 Ga0207690_10215986 Ga0207690_102159862 194
338 3300025933 Ga0207706_10006757 Ga0207706_100067572 194
339 3300025937 Ga0207669_10044209 Ga0207669_100442092 194
340 3300025960 Ga0207651_10432056 Ga0207651_104320562 194
341 3300026023 Ga0207677_10354174 Ga0207677_103541742 194
342 3300026088 Ga0207641_10031254 Ga0207641_100312547 194
343 3300026095 Ga0207676_10747026 Ga0207676_107470262 194
344 3300026116 Ga0207674_10000132 Ga0207674_1000013254 194
345 3300037418 Ga0395900_0003562 Ga0395900_0003562_14509_15132 194
346 3300037418 Ga0395900_0015753 Ga0395900_0015753_2046_2666 194
347 3300037418 Ga0395900_0018901 Ga0395900_0018901_3954_4586 194
348 3300037418 Ga0395900_0023262 Ga0395900_0023262_4432_5064 194
349 3300037418 Ga0395900_0023486 Ga0395900_0023486_3234_3866 194
350 3300037418 Ga0395900_0032996 Ga0395900_0032996_515_1135 194
351 3300037418 Ga0395900_0371655 Ga0395900_0371655_150_776 194
352 3300037466 Ga0395898_0076450 Ga0395898_0076450_677_1309 194
353 3300037466 Ga0395898_0211881 Ga0395898_0211881_534_1160 194
354 3300037471 Ga0395905_0002000 Ga0395905_0002000_14325_14957 194
355 3300037471 Ga0395905_0002910 Ga0395905_0002910_11954_12574 194
356 3300037471 Ga0395905_0005131 Ga0395905_0005131_10864_11487 194
357 3300037471 Ga0395905_0014364 Ga0395905_0014364_1995_2627 194
358 3300037471 Ga0395905_0019323 Ga0395905_0019323_1688_2314 194
359 3300037471 Ga0395905_0048848 Ga0395905_0048848_400_1026 194
360 3300037471 Ga0395905_0112028 Ga0395905_0112028_1746_2378 194
361 3300037471 Ga0395905_0155998 Ga0395905_0155998_443_1063 194
362 3300037471 Ga0395905_0368606 Ga0395905_0368606_621_1241 194
363 3300038443 Ga0395901_0015235 Ga0395901_0015235_2580_3212 194
364 3300038443 Ga0395901_0024583 Ga0395901_0024583_3945_4568 194
365 3300038443 Ga0395901_0036907 Ga0395901_0036907_4105_4731 194
366 3300038443 Ga0395901_0039387 Ga0395901_0039387_3868_4488 194
367 3300038443 Ga0395901_0090198 Ga0395901_0090198_287_907 194
368 3300038443 Ga0395901_0145796 Ga0395901_0145796_1734_2366 194
369 3300038443 Ga0395901_0219532 Ga0395901_0219532_1148_1780 194
370 3300042157 Ga0439458_0000243 Ga0439458_0000243_6683_7303 194
371 3300042157 Ga0439458_0007783 Ga0439458_0007783_961_1587 194
372 3300048905 Ga0496102_0034842 Ga0496102_0034842_3209_3793 194
373 3300048906 Ga0496103_0101135 Ga0496103_0101135_774_1358 194
374 3300048921 Ga0496118_0021905 Ga0496118_0021905_4289_4873 194
375 iso_pu_bacteria 2894414249 2894415468 195
376 3300001989 JGI24739J22299_10000040 JGI24739J22299_100000407 196
377 3300001990 JGI24737J22298_10002132 JGI24737J22298_100021325 196
378 3300002705 JGI25156J39149_1010714 JGI25156J39149_10107141 196
379 3300002737 JGI25162J39368_1000395 JGI25162J39368_100039517 196
380 3300002737 JGI25162J39368_1000684 JGI25162J39368_100068413 196
381 3300002737 JGI25162J39368_1002286 JGI25162J39368_10022862 196
382 3300002741 JGI25157J39369_1000081 JGI25157J39369_100008145 196
383 3300002741 JGI25157J39369_1000547 JGI25157J39369_10005475 196
384 3300002771 JGI25163J39215_1000313 JGI25163J39215_10003139 196
385 3300002772 JGI25164J39214_1000028 JGI25164J39214_100002837 196
386 3300002772 JGI25164J39214_1000338 JGI25164J39214_100033811 196
387 3300002772 JGI25164J39214_1000416 JGI25164J39214_100041617 196
388 3300003214 JGI25165J46597_1000108 JGI25165J46597_100010837 196
389 3300003214 JGI25165J46597_1000513 JGI25165J46597_100051325 196
390 3300003214 JGI25165J46597_1003664 JGI25165J46597_10036644 196
391 3300003215 JGI25153J46596_10003689 JGI25153J46596_100036895 196
392 3300003316 rootH1_10048199 rootH1_100481994 196
393 3300003320 rootH2_10026728 rootH2_1002672817 196
394 3300003323 rootH1_10162681 rootH1_101626813 196
395 3300003578 Ga0006562J51391_1011160 Ga0006562J51391_10111607 196
396 3300003578 Ga0006562J51391_1011163 Ga0006562J51391_10111633 196
397 3300003752 Ga0055539_1001625 Ga0055539_10016253 196
398 3300003761 Ga0055535_1000771 Ga0055535_100077113 196
399 3300003762 Ga0055542_1000772 Ga0055542_100077215 196
400 3300003762 Ga0055542_1000787 Ga0055542_100078715 196
401 3300003763 Ga0055529_1000078 Ga0055529_100007837 196
402 3300005327 Ga0070658_10473418 Ga0070658_104734181 196
403 3300005329 Ga0070683_100048684 Ga0070683_1000486842 196
404 3300005337 Ga0070682_100023945 Ga0070682_1000239453 196
405 3300005337 Ga0070682_100179353 Ga0070682_1001793532 196
406 3300005339 Ga0070660_100156685 Ga0070660_1001566852 196
407 3300005339 Ga0070660_100865117 Ga0070660_1008651171 196
408 3300005340 Ga0070689_100010930 Ga0070689_1000109302 196
409 3300005341 Ga0070691_10112024 Ga0070691_101120242 196
410 3300005341 Ga0070691_10196097 Ga0070691_101960971 196
411 3300005344 Ga0070661_100038689 Ga0070661_1000386893 196
412 3300005344 Ga0070661_100139852 Ga0070661_1001398522 196
413 3300005344 Ga0070661_100459547 Ga0070661_1004595472 196
414 3300005345 Ga0070692_10044215 Ga0070692_100442153 196
415 3300005356 Ga0070674_100300121 Ga0070674_1003001212 196
416 3300005365 Ga0070688_100136001 Ga0070688_1001360012 196
417 3300005366 Ga0070659_100005797 Ga0070659_1000057973 196
418 3300005366 Ga0070659_100133964 Ga0070659_1001339643 196
419 3300005366 Ga0070659_100267417 Ga0070659_1002674172 196
420 3300005435 Ga0070714_100104775 Ga0070714_1001047752 196
421 3300005435 Ga0070714_100116833 Ga0070714_1001168332 196
422 3300005436 Ga0070713_100006097 Ga0070713_1000060977 196
423 3300005438 Ga0070701_10145876 Ga0070701_101458762 196
424 3300005455 Ga0070663_100252768 Ga0070663_1002527682 196
425 3300005455 Ga0070663_100306505 Ga0070663_1003065052 196
426 3300005455 Ga0070663_100638384 Ga0070663_1006383842 196
427 3300005457 Ga0070662_100655373 Ga0070662_1006553732 196
428 3300005457 Ga0070662_100771357 Ga0070662_1007713572 196
429 3300005530 Ga0070679_100019902 Ga0070679_1000199025 196
430 3300005535 Ga0070684_100000098 Ga0070684_10000009812 196
431 3300005539 Ga0068853_100007676 Ga0068853_1000076762 196
432 3300005539 Ga0068853_100200769 Ga0068853_1002007691 196
433 3300005546 Ga0070696_100005210 Ga0070696_1000052108 196
434 3300005546 Ga0070696_100052356 Ga0070696_1000523563 196
435 3300005547 Ga0070693_100051465 Ga0070693_1000514652 196
436 3300005547 Ga0070693_100065349 Ga0070693_1000653492 196
437 3300005563 Ga0068855_100002059 Ga0068855_1000020597 196
438 3300005563 Ga0068855_100005690 Ga0068855_1000056905 196
439 3300005563 Ga0068855_100020597 Ga0068855_1000205975 196
440 3300005563 Ga0068855_100107211 Ga0068855_1001072112 196
441 3300005577 Ga0068857_100000511 Ga0068857_1000005116 196
442 3300005577 Ga0068857_100004673 Ga0068857_1000046735 196
443 3300005577 Ga0068857_100042446 Ga0068857_1000424463 196
444 3300005577 Ga0068857_100059143 Ga0068857_1000591434 196
445 3300005578 Ga0068854_100001254 Ga0068854_1000012547 196
446 3300005578 Ga0068854_100009920 Ga0068854_1000099205 196
447 3300005578 Ga0068854_100036209 Ga0068854_1000362093 196
448 3300005578 Ga0068854_100148510 Ga0068854_1001485102 196
449 3300005614 Ga0068856_100001449 Ga0068856_10000144914 196
450 3300005614 Ga0068856_100217728 Ga0068856_1002177282 196
451 3300005616 Ga0068852_100243143 Ga0068852_1002431432 196
452 3300005617 Ga0068859_100419067 Ga0068859_1004190671 196
453 3300005718 Ga0068866_10183996 Ga0068866_101839962 196
454 3300005842 Ga0068858_100013472 Ga0068858_1000134727 196
455 3300005843 Ga0068860_100522419 Ga0068860_1005224192 196
456 3300005844 Ga0068862_100055198 Ga0068862_1000551984 196
457 3300006844 Ga0075428_100534850 Ga0075428_1005348502 196
458 3300006931 Ga0097620_100419059 Ga0097620_1004190591 196
459 3300009093 Ga0105240_10003424 Ga0105240_100034246 196
460 3300009093 Ga0105240_10014865 Ga0105240_100148659 196
461 3300009093 Ga0105240_10020015 Ga0105240_100200155 196
462 3300009093 Ga0105240_10030261 Ga0105240_100302613 196
463 3300009093 Ga0105240_10031164 Ga0105240_100311642 196
464 3300009093 Ga0105240_10164754 Ga0105240_101647542 196
465 3300009094 Ga0111539_10409346 Ga0111539_104093462 196
466 3300009147 Ga0114129_10815943 Ga0114129_108159432 196
467 3300009174 Ga0105241_10098806 Ga0105241_100988063 196
468 3300009174 Ga0105241_10879278 Ga0105241_108792782 196
469 3300009174 Ga0105241_10936705 Ga0105241_109367051 196
470 3300009545 Ga0105237_10000023 Ga0105237_1000002363 196
471 3300009545 Ga0105237_10000595 Ga0105237_1000059510 196
472 3300009551 Ga0105238_10005372 Ga0105238_1000537214 196
473 3300009551 Ga0105238_10005720 Ga0105238_100057208 196
474 3300009551 Ga0105238_10104398 Ga0105238_101043982 196
475 3300009551 Ga0105238_10113419 Ga0105238_101134192 196
476 3300009551 Ga0105238_10747423 Ga0105238_107474232 196
477 3300009551 Ga0105238_11270837 Ga0105238_112708372 196
478 3300010375 Ga0105239_10000022 Ga0105239_10000022106 196
479 3300010375 Ga0105239_10078397 Ga0105239_100783972 196
480 3300010375 Ga0105239_10451297 Ga0105239_104512972 196
481 3300012500 Ga0157314_1000105 Ga0157314_10001056 196
482 3300013100 Ga0157373_10027400 Ga0157373_100274003 196
483 3300013100 Ga0157373_10115399 Ga0157373_101153992 196
484 3300013102 Ga0157371_10005020 Ga0157371_100050201 196
485 3300013102 Ga0157371_10021458 Ga0157371_100214587 196
486 3300013102 Ga0157371_10024187 Ga0157371_100241874 196
487 3300013104 Ga0157370_10001239 Ga0157370_1000123932 196
488 3300013104 Ga0157370_10009476 Ga0157370_100094768 196
489 3300013104 Ga0157370_10471752 Ga0157370_104717521 196
490 3300013105 Ga0157369_10087931 Ga0157369_100879312 196
491 3300013105 Ga0157369_10164684 Ga0157369_101646841 196
492 3300013105 Ga0157369_10297926 Ga0157369_102979262 196
493 3300013105 Ga0157369_10337263 Ga0157369_103372632 196
494 3300013307 Ga0157372_10151239 Ga0157372_101512393 196
495 3300013307 Ga0157372_11312997 Ga0157372_113129972 196
496 3300014497 Ga0182008_10111837 Ga0182008_101118371 196
497 3300014745 Ga0157377_10170118 Ga0157377_101701182 196
498 3300015261 Ga0182006_1155977 Ga0182006_11559772 196
499 3300015262 Ga0182007_10013574 Ga0182007_100135744 196
500 3300015262 Ga0182007_10059055 Ga0182007_100590552 196
501 3300015687 Ga0183368_1004 Ga0183368_1004238 196
502 3300020070 Ga0206356_10015297 Ga0206356_100152973 196
503 3300020082 Ga0206353_10295629 Ga0206353_102956292 196
504 3300025207 Ga0209760_100676 Ga0209760_1006765 196
505 3300025224 Ga0209784_100047 Ga0209784_100047118 196
506 3300025226 Ga0209674_100053 Ga0209674_100053152 196
507 3300025231 Ga0207427_100023 Ga0207427_100023376 196
508 3300025231 Ga0207427_100115 Ga0207427_10011569 196
509 3300025231 Ga0207427_100130 Ga0207427_10013062 196
510 3300025231 Ga0207427_101434 Ga0207427_1014342 196
511 3300025233 Ga0209437_100015 Ga0209437_100015540 196
512 3300025233 Ga0209437_100020 Ga0209437_100020205 196
513 3300025233 Ga0209437_100079 Ga0209437_100079205 196
514 3300025233 Ga0209437_100276 Ga0209437_10027666 196
515 3300025242 Ga0209258_100043 Ga0209258_10004395 196
516 3300025242 Ga0209258_101362 Ga0209258_1013625 196
517 3300025246 Ga0209646_1001086 Ga0209646_10010864 196
518 3300025246 Ga0209646_1001409 Ga0209646_10014095 196
519 3300025246 Ga0209646_1005518 Ga0209646_10055182 196
520 3300025250 Ga0209026_1000047 Ga0209026_100004795 196
521 3300025250 Ga0209026_1000105 Ga0209026_100010586 196
522 3300025250 Ga0209026_1000162 Ga0209026_100016210 196
523 3300025250 Ga0209026_1004849 Ga0209026_10048492 196
524 3300025253 Ga0209677_107553 Ga0209677_1075532 196
525 3300025254 Ga0209148_1000002 Ga0209148_10000021942 196
526 3300025254 Ga0209148_1000010 Ga0209148_1000010375 196
527 3300025256 Ga0209759_1000318 Ga0209759_100031829 196
528 3300025258 Ga0209129_1002006 Ga0209129_10020064 196
529 3300025261 Ga0209233_1000009 Ga0209233_1000009797 196
530 3300025261 Ga0209233_1000020 Ga0209233_1000020420 196
531 3300025261 Ga0209233_1000121 Ga0209233_1000121162 196
532 3300025261 Ga0209233_1004374 Ga0209233_10043743 196
533 3300025272 Ga0209455_1000020 Ga0209455_1000020229 196
534 3300025272 Ga0209455_1000560 Ga0209455_10005606 196
535 3300025297 Ga0209758_1000959 Ga0209758_100095921 196
536 3300025904 Ga0207647_10018195 Ga0207647_100181955 196
537 3300025904 Ga0207647_10021257 Ga0207647_100212574 196
538 3300025904 Ga0207647_10059981 Ga0207647_100599812 196
539 3300025909 Ga0207705_10105804 Ga0207705_101058042 196
540 3300025911 Ga0207654_10168043 Ga0207654_101680432 196
541 3300025911 Ga0207654_10335523 Ga0207654_103355232 196
542 3300025912 Ga0207707_10011138 Ga0207707_1001113810 196
543 3300025913 Ga0207695_10000654 Ga0207695_1000065440 196
544 3300025913 Ga0207695_10000907 Ga0207695_1000090745 196
545 3300025913 Ga0207695_10008059 Ga0207695_100080595 196
546 3300025913 Ga0207695_10046136 Ga0207695_100461364 196
547 3300025913 Ga0207695_10047480 Ga0207695_100474804 196
548 3300025913 Ga0207695_10111216 Ga0207695_101112163 196
549 3300025914 Ga0207671_10000020 Ga0207671_10000020172 196
550 3300025914 Ga0207671_10000033 Ga0207671_1000003383 196
551 3300025914 Ga0207671_10000726 Ga0207671_1000072618 196
552 3300025919 Ga0207657_10031993 Ga0207657_100319934 196
553 3300025919 Ga0207657_10689750 Ga0207657_106897501 196
554 3300025920 Ga0207649_10079824 Ga0207649_100798242 196
555 3300025920 Ga0207649_10124865 Ga0207649_101248653 196
556 3300025920 Ga0207649_10398768 Ga0207649_103987681 196
557 3300025921 Ga0207652_10166505 Ga0207652_101665052 196
558 3300025924 Ga0207694_10006130 Ga0207694_100061306 196
559 3300025924 Ga0207694_10017824 Ga0207694_100178242 196
560 3300025924 Ga0207694_10362700 Ga0207694_103627002 196
561 3300025928 Ga0207700_10003865 Ga0207700_1000386510 196
562 3300025929 Ga0207664_10000419 Ga0207664_100004192 196
563 3300025929 Ga0207664_10022981 Ga0207664_100229815 196
564 3300025929 Ga0207664_10138967 Ga0207664_101389673 196
565 3300025932 Ga0207690_10000314 Ga0207690_1000031414 196
566 3300025932 Ga0207690_10000797 Ga0207690_1000079716 196
567 3300025932 Ga0207690_10008204 Ga0207690_100082042 196
568 3300025932 Ga0207690_10043020 Ga0207690_100430202 196
569 3300025932 Ga0207690_10155955 Ga0207690_101559552 196
570 3300025932 Ga0207690_10447939 Ga0207690_104479392 196
571 3300025933 Ga0207706_10064116 Ga0207706_100641163 196
572 3300025936 Ga0207670_10006401 Ga0207670_100064018 196
573 3300025942 Ga0207689_10150058 Ga0207689_101500582 196
574 3300025944 Ga0207661_10001403 Ga0207661_1000140316 196
575 3300025949 Ga0207667_10000130 Ga0207667_1000013060 196
576 3300025949 Ga0207667_10000169 Ga0207667_100001695 196
577 3300025949 Ga0207667_10006239 Ga0207667_100062392 196
578 3300025981 Ga0207640_10000908 Ga0207640_100009087 196
579 3300025981 Ga0207640_10001060 Ga0207640_100010607 196
580 3300025981 Ga0207640_10104123 Ga0207640_101041232 196
581 3300026041 Ga0207639_10033345 Ga0207639_100333452 196
582 3300026041 Ga0207639_10118496 Ga0207639_101184961 196
583 3300026067 Ga0207678_10009382 Ga0207678_1000938210 196
584 3300026067 Ga0207678_10071671 Ga0207678_100716714 196
585 3300026067 Ga0207678_10246941 Ga0207678_102469412 196
586 3300026067 Ga0207678_10261620 Ga0207678_102616202 196
587 3300026078 Ga0207702_10000456 Ga0207702_1000045636 196
588 3300026116 Ga0207674_10000971 Ga0207674_100009717 196
589 3300026116 Ga0207674_10021327 Ga0207674_100213274 196
590 3300026116 Ga0207674_10039041 Ga0207674_100390411 196
591 3300026116 Ga0207674_10047238 Ga0207674_100472383 196
592 3300026116 Ga0207674_10264604 Ga0207674_102646043 196
593 3300026116 Ga0207674_10605584 Ga0207674_106055842 196
594 3300026142 Ga0207698_10016173 Ga0207698_100161736 196
595 3300028380 Ga0268265_10175325 Ga0268265_101753252 196
596 3300028380 Ga0268265_11381258 Ga0268265_113812581 196
597 3300031730 Ga0307516_10162244 Ga0307516_101622442 196
598 3300037312 Ga0395899_0108198 Ga0395899_0108198_392_1015 196
599 3300037312 Ga0395899_0245317 Ga0395899_0245317_15_605 196
600 3300037312 Ga0395899_0402416 Ga0395899_0402416_13_636 196
601 3300037418 Ga0395900_0048973 Ga0395900_0048973_2209_2823 196
602 3300037418 Ga0395900_0116238 Ga0395900_0116238_289_879 196
603 3300037466 Ga0395898_0003277 Ga0395898_0003277_15148_15771 196
604 3300038443 Ga0395901_0000280 Ga0395901_0000280_47405_48019 196
605 3300038443 Ga0395901_0013263 Ga0395901_0013263_6453_7043 196
606 3300038443 Ga0395901_0135655 Ga0395901_0135655_1914_2504 196
607 3300042000 Ga0439437_018934 Ga0439437_018934_69_659 196
608 3300042005 Ga0439448_0018099 Ga0439448_0018099_1088_1678 196
609 3300042005 Ga0439448_0063189 Ga0439448_0063189_13_603 196
610 3300042438 Ga0439459_0002997 Ga0439459_0002997_843_1433 196
611 3300044656 Ga0466969_0055225 Ga0466969_0055225_452_1042 196
612 3300044658 Ga0466972_0036255 Ga0466972_0036255_350_940 196
613 3300044672 Ga0466982_0000020 Ga0466982_0000020_28127_28717 196
614 3300044683 Ga0466965_0078668 Ga0466965_0078668_65_655 196
615 3300044684 Ga0466966_0008999 Ga0466966_0008999_4031_4621 196
616 3300044719 Ga0466971_0006892 Ga0466971_0006892_301_891 196
617 3300044735 Ga0466968_0016306 Ga0466968_0016306_718_1308 196
618 3300044765 Ga0466970_0024226 Ga0466970_0024226_1028_1618 196
619 3300044842 Ga0466957_0233213 Ga0466957_0233213_375_965 196
620 3300044901 Ga0466960_0034356 Ga0466960_0034356_339_929 196
621 3300045049 Ga0466959_0099272 Ga0466959_0099272_931_1521 196
622 3300045836 Ga0466958_0016632 Ga0466958_0016632_530_1120 196
623 3300045976 Ga0466967_0460225 Ga0466967_0460225_182_772 196
624 3300046460 Ga0495638_0000049 Ga0495638_0000049_21742_22332 196
625 3300046460 Ga0495638_0000916 Ga0495638_0000916_21450_22040 196
626 3300046471 Ga0495650_0001214 Ga0495650_0001214_8100_8690 196
627 3300046507 Ga0495606_0001000 Ga0495606_0001000_32961_33551 196
628 3300046557 Ga0495622_0023430 Ga0495622_0023430_1299_1889 196
629 3300046660 Ga0495625_0120402 Ga0495625_0120402_502_1092 196
630 3300046694 Ga0495649_0000823 Ga0495649_0000823_8030_8620 196
631 3300048903 Ga0496100_0167599 Ga0496100_0167599_889_1479 196
632 3300048903 Ga0496100_0229956 Ga0496100_0229956_138_728 196
633 3300048904 Ga0496101_0048090 Ga0496101_0048090_2233_2823 196
634 3300048907 Ga0496104_0055648 Ga0496104_0055648_1760_2350 196
635 3300048907 Ga0496104_0091848 Ga0496104_0091848_873_1463 196
636 3300048907 Ga0496104_0346063 Ga0496104_0346063_49_639 196
637 3300048908 Ga0496105_0001964 Ga0496105_0001964_2871_3461 196
638 3300048909 Ga0496106_0046723 Ga0496106_0046723_352_942 196
639 3300048910 Ga0496107_0234325 Ga0496107_0234325_363_953 196
640 3300048910 Ga0496107_0361177 Ga0496107_0361177_54_644 196
641 3300048916 Ga0496113_0030099 Ga0496113_0030099_522_1112 196
642 3300048918 Ga0496115_0000024 Ga0496115_0000024_112233_112823 196
643 3300048918 Ga0496115_0000103 Ga0496115_0000103_16637_17227 196
644 3300048918 Ga0496115_0002161 Ga0496115_0002161_5421_6011 196
645 3300048918 Ga0496115_0002922 Ga0496115_0002922_7343_7933 196
646 3300048918 Ga0496115_0011553 Ga0496115_0011553_669_1259 196
647 3300048919 Ga0496116_0076650 Ga0496116_0076650_442_1032 196
648 3300048920 Ga0496117_0086255 Ga0496117_0086255_857_1447 196
649 3300048920 Ga0496117_0117784 Ga0496117_0117784_27_617 196
650 3300048921 Ga0496118_0006935 Ga0496118_0006935_10469_11059 196
651 3300048921 Ga0496118_0012624 Ga0496118_0012624_2188_2778 196
652 3300048922 Ga0496119_0001743 Ga0496119_0001743_12007_12597 196
653 3300048922 Ga0496119_0002432 Ga0496119_0002432_14288_14878 196
654 3300048923 Ga0496120_0000167 Ga0496120_0000167_95862_96452 196
655 3300048923 Ga0496120_0000868 Ga0496120_0000868_24959_25549 196
656 3300048924 Ga0496121_0000532 Ga0496121_0000532_50846_51436 196
657 3300048924 Ga0496121_0028676 Ga0496121_0028676_1981_2571 196
658 3300048924 Ga0496121_0042063 Ga0496121_0042063_292_882 196
659 3300048924 Ga0496121_0046716 Ga0496121_0046716_881_1471 196
660 3300048924 Ga0496121_0209945 Ga0496121_0209945_279_869 196
661 3300048928 Ga0496125_0000344 Ga0496125_0000344_27375_27965 196
662 3300048929 Ga0496126_0000581 Ga0496126_0000581_29191_29781 196
663 3300048929 Ga0496126_0007111 Ga0496126_0007111_1454_2044 196
664 3300048929 Ga0496126_0191593 Ga0496126_0191593_536_1126 196
665 3300049459 Ga0495678_037387 Ga0495678_037387_128_718 196
666 3300049460 Ga0495682_0017233 Ga0495682_0017233_1853_2443 196
667 3300049568 Ga0501031_0020584 Ga0501031_0020584_761_1351 196
668 3300049568 Ga0501031_0107743 Ga0501031_0107743_897_1487 196
669 3300049569 Ga0501032_0014188 Ga0501032_0014188_743_1333 196
670 3300049569 Ga0501032_0114080 Ga0501032_0114080_705_1295 196
671 3300049570 Ga0501033_0002545 Ga0501033_0002545_12215_12805 196
672 3300049570 Ga0501033_0090785 Ga0501033_0090785_1121_1711 196
673 3300049570 Ga0501033_0199045 Ga0501033_0199045_554_1144 196
674 3300049571 Ga0501034_0028239 Ga0501034_0028239_502_1092 196
675 3300049571 Ga0501034_0103298 Ga0501034_0103298_1783_2373 196
676 3300049571 Ga0501034_0143066 Ga0501034_0143066_168_758 196
677 3300049571 Ga0501034_0343555 Ga0501034_0343555_355_978 196
678 3300049572 Ga0501036_0095765 Ga0501036_0095765_799_1389 196
679 3300049573 Ga0501037_0015245 Ga0501037_0015245_3418_4008 196
680 3300049573 Ga0501037_0041434 Ga0501037_0041434_766_1356 196
681 3300049574 Ga0501038_0066603 Ga0501038_0066603_312_902 196
682 3300049574 Ga0501038_0119491 Ga0501038_0119491_517_1107 196
683 3300049575 Ga0501039_0362605 Ga0501039_0362605_244_834 196
684 3300049575 Ga0501039_0605447 Ga0501039_0605447_58_648 196
685 3300049579 Ga0501043_0128950 Ga0501043_0128950_825_1415 196
686 3300049579 Ga0501043_0185757 Ga0501043_0185757_505_1095 196
687 3300049579 Ga0501043_0386785 Ga0501043_0386785_317_907 196
688 3300049580 Ga0501046_0025262 Ga0501046_0025262_1079_1669 196
689 3300049580 Ga0501046_0091874 Ga0501046_0091874_52_642 196
690 3300049581 Ga0501047_0003603 Ga0501047_0003603_5972_6595 196
691 3300049581 Ga0501047_0011089 Ga0501047_0011089_6223_6813 196
692 3300049581 Ga0501047_0031361 Ga0501047_0031361_2703_3293 196
693 3300049582 Ga0501048_0078848 Ga0501048_0078848_1112_1702 196
694 3300049585 Ga0501069_0011564 Ga0501069_0011564_2572_3162 196
695 3300049586 Ga0501070_0000587 Ga0501070_0000587_19531_20121 196
696 3300049586 Ga0501070_0358320 Ga0501070_0358320_471_1061 196
697 3300049589 Ga0501073_0188926 Ga0501073_0188926_262_852 196
698 3300049593 Ga0501077_0277500 Ga0501077_0277500_207_797 196
699 3300049742 Ga0501080_0038483 Ga0501080_0038483_1654_2244 196
700 3300049822 Ga0501035_0005912 Ga0501035_0005912_1686_2276 196
701 3300049822 Ga0501035_0017043 Ga0501035_0017043_1364_1954 196
702 3300049822 Ga0501035_0070003 Ga0501035_0070003_1700_2290 196
703 3300049822 Ga0501035_0097596 Ga0501035_0097596_1216_1806 196
704 3300049822 Ga0501035_0499810 Ga0501035_0499810_268_858 196
705 3300049823 Ga0501044_0020827 Ga0501044_0020827_701_1291 196
706 3300049823 Ga0501044_0025356 Ga0501044_0025356_5534_6124 196
707 3300049823 Ga0501044_0213400 Ga0501044_0213400_768_1358 196
708 3300049823 Ga0501044_0345473 Ga0501044_0345473_96_686 196
709 3300049823 Ga0501044_0601604 Ga0501044_0601604_233_856 196
710 3300050507 nmdc:mga05p37_678987_c1 nmdc:mga05p37_678987_c1_256_873 196
711 3300050511 nmdc:mga08y16_479171_c1 nmdc:mga08y16_479171_c1_364_978 196
712 3300050512 nmdc:mga0n895_1019311_c1 nmdc:mga0n895_1019311_c1_42_656 196
713 3300061719 Ga0466962_0003389 Ga0466962_0003389_6331_6921 196
714 iso_pu_bacteria 2547132130 2547502928 196
715 iso_pu_bacteria 2576861471 2578458532 196
716 iso_pu_bacteria 2747842428 2747949454 196
717 iso_pu_bacteria 2747842501 2748019754 196
718 iso_pu_bacteria 2765235840 2765578859 196
719 iso_pu_bacteria 2816332141 2816516922 196
720 iso_pu_bacteria 2818991457 2819659690 196
721 iso_pu_bacteria 2842391507 2842393095 196
722 iso_pu_bacteria 2842757796 2842758283 196
723 iso_pu_bacteria 2852649853 2852650950 196
724 iso_pu_bacteria 2852684882 2852685497 196
725 iso_pu_bacteria 2857442823 2857443793 196
726 iso_pu_bacteria 2874220319 2874221498 196
727 iso_pu_bacteria 2919089067 2919089833 196
728 iso_pu_bacteria 2919130084 2919131658 196
729 iso_pu_bacteria 2919134579 2919137845 196
730 iso_pu_bacteria 2928496128 2928496536 196
731 iso_pu_bacteria 2929195423 2929197971 196
732 iso_pu_bacteria 2931380184 2931380878 196
733 iso_pu_bacteria 2937610967 2937612316 196
734 iso_pu_bacteria 2939589442 2939590876 196
735 iso_pu_bacteria 2939622612 2939623133 196
736 iso_pu_bacteria 2939626828 2939630747 196
737 iso_pu_bacteria 2941475908 2941478202 196
738 iso_pu_bacteria 2961047084 2961048264 196
739 iso_pu_bacteria 2961064222 2961065262 196
740 iso_pu_bacteria 2974307012 2974309091 196
741 iso_pu_bacteria 2977247770 2977249811 196
742 iso_pu_bacteria 2987605356 2987606080 196
743 iso_pu_bacteria 8021622325 8021624276 196
744 iso_pu_bacteria 8021626552 8021629120 196
745 iso_pu_bacteria 8021648035 8021649111 196
746 3300005616 Ga0068852_100037468 Ga0068852_1000374683 197
747 3300007265 Ga0099794_10049341 Ga0099794_100493413 197
748 3300009093 Ga0105240_10239123 Ga0105240_102391231 197
749 3300009545 Ga0105237_10420762 Ga0105237_104207622 197
750 3300025913 Ga0207695_10048652 Ga0207695_100486523 197
751 3300026142 Ga0207698_10013331 Ga0207698_100133314 197
752 3300037418 Ga0395900_0195738 Ga0395900_0195738_578_1243 197
753 3300037466 Ga0395898_0021259 Ga0395898_0021259_4413_5078 197
754 3300038443 Ga0395901_0041573 Ga0395901_0041573_852_1517 197
755 3300039437 Ga0436365_0505056 Ga0436365_0505056_1779_2375 197
756 3300039450 Ga0436363_1707670 Ga0436363_1707670_181_777 197
757 3300045976 Ga0466967_0281394 Ga0466967_0281394_185_835 197
758 3300049568 Ga0501031_0150963 Ga0501031_0150963_643_1293 197
759 3300049569 Ga0501032_0178721 Ga0501032_0178721_220_870 197
760 3300049570 Ga0501033_0001868 Ga0501033_0001868_9919_10569 197
761 3300049570 Ga0501033_0523668 Ga0501033_0523668_128_745 197
762 3300049571 Ga0501034_0192995 Ga0501034_0192995_585_1235 197
763 3300049572 Ga0501036_0111278 Ga0501036_0111278_140_790 197
764 3300049580 Ga0501046_0103124 Ga0501046_0103124_1352_2002 197
765 3300049581 Ga0501047_0101772 Ga0501047_0101772_616_1266 197
766 3300049585 Ga0501069_0048655 Ga0501069_0048655_1007_1603 197
767 3300049586 Ga0501070_0020482 Ga0501070_0020482_534_1130 197
768 3300049822 Ga0501035_0023420 Ga0501035_0023420_2021_2671 197
769 3300049823 Ga0501044_0042471 Ga0501044_0042471_704_1354 197
770 3300005335 Ga0070666_10000388 Ga0070666_100003887 198
771 3300005344 Ga0070661_100257471 Ga0070661_1002574711 198
772 3300005353 Ga0070669_100020435 Ga0070669_1000204354 198
773 3300006051 Ga0075364_10017738 Ga0075364_100177384 198
774 3300006237 Ga0097621_100411855 Ga0097621_1004118552 198
775 3300010375 Ga0105239_10039292 Ga0105239_100392924 198
776 3300010375 Ga0105239_10049113 Ga0105239_100491134 198
777 3300013297 Ga0157378_10272408 Ga0157378_102724082 198
778 3300025903 Ga0207680_10000227 Ga0207680_1000022732 198
779 3300025920 Ga0207649_10214274 Ga0207649_102142742 198
780 3300026089 Ga0207648_11017111 Ga0207648_110171112 198
781 3300031691 Ga0316579_10040992 Ga0316579_100409923 198
782 3300031727 Ga0316576_10007734 Ga0316576_100077347 198
783 3300031727 Ga0316576_10010970 Ga0316576_100109705 198
784 3300031727 Ga0316576_10036293 Ga0316576_100362932 198
785 3300031727 Ga0316576_10708104 Ga0316576_107081041 198
786 3300031728 Ga0316578_10006565 Ga0316578_100065652 198
787 3300031733 Ga0316577_10105319 Ga0316577_101053192 198
788 3300035398 Ga0316574_0006768 Ga0316574_0006768_2655_3251 198
789 3300035398 Ga0316574_0013668 Ga0316574_0013668_3188_3784 198
790 3300035398 Ga0316574_0035290 Ga0316574_0035290_1411_2007 198
791 3300035398 Ga0316574_0040143 Ga0316574_0040143_531_1127 198
792 3300035398 Ga0316574_0087546 Ga0316574_0087546_95_691 198
793 3300035398 Ga0316574_0114224 Ga0316574_0114224_962_1558 198
794 3300035398 Ga0316574_0170516 Ga0316574_0170516_447_1043 198
795 3300035398 Ga0316574_0227671 Ga0316574_0227671_419_1015 198
796 3300035398 Ga0316574_0266986 Ga0316574_0266986_25_621 198
797 3300035398 Ga0316574_0526489 Ga0316574_0526489_116_712 198
798 3300036647 Ga0316582_0108618 Ga0316582_0108618_234_830 198
799 3300036647 Ga0316582_0130962 Ga0316582_0130962_966_1562 198
800 3300036712 Ga0316584_0391071 Ga0316584_0391071_173_781 198
801 3300041494 Ga0451837_0344179 Ga0451837_0344179_390_986 198
802 3300044656 Ga0466969_0000310 Ga0466969_0000310_3973_4572 198
803 3300044684 Ga0466966_0001010 Ga0466966_0001010_14833_15432 198
804 3300044693 Ga0466961_0000332 Ga0466961_0000332_4990_5589 198
805 3300044706 Ga0466964_0002553 Ga0466964_0002553_2416_3015 198
806 3300044719 Ga0466971_0001750 Ga0466971_0001750_7149_7748 198
807 3300044765 Ga0466970_0000410 Ga0466970_0000410_17368_17967 198
808 3300045049 Ga0466959_0000334 Ga0466959_0000334_21277_21876 198
809 3300050491 nmdc:mga00v17_20876_c1 nmdc:mga00v17_20876_c1_2493_3092 198
810 3300061719 Ga0466962_0000083 Ga0466962_0000083_21405_22004 198
811 2162886007 SwRhRL2b_contig_3936045 SwRhRL2b_0860.00002930 199
812 3300002773 JGI25152J39213_1001386 JGI25152J39213_10013866 199
813 3300002774 JGI25150J39212_1000817 JGI25150J39212_10008176 199
814 3300003187 JGI25151J46595_10001867 JGI25151J46595_100018676 199
815 3300003215 JGI25153J46596_10000167 JGI25153J46596_1000016750 199
816 3300005329 Ga0070683_100814161 Ga0070683_1008141612 199
817 3300005330 Ga0070690_100175666 Ga0070690_1001756662 199
818 3300005335 Ga0070666_10058900 Ga0070666_100589003 199
819 3300005344 Ga0070661_100384145 Ga0070661_1003841452 199
820 3300005355 Ga0070671_100306657 Ga0070671_1003066572 199
821 3300005367 Ga0070667_100156091 Ga0070667_1001560911 199
822 3300005535 Ga0070684_100208421 Ga0070684_1002084212 199
823 3300005539 Ga0068853_100050236 Ga0068853_1000502362 199
824 3300005539 Ga0068853_100360905 Ga0068853_1003609052 199
825 3300005539 Ga0068853_100361954 Ga0068853_1003619542 199
826 3300005563 Ga0068855_100080776 Ga0068855_1000807763 199
827 3300005563 Ga0068855_100624049 Ga0068855_1006240492 199
828 3300005564 Ga0070664_100091821 Ga0070664_1000918213 199
829 3300005578 Ga0068854_100231495 Ga0068854_1002314952 199
830 3300005614 Ga0068856_100020139 Ga0068856_1000201393 199
831 3300005616 Ga0068852_100357589 Ga0068852_1003575892 199
832 3300005616 Ga0068852_100488648 Ga0068852_1004886482 199
833 3300005843 Ga0068860_100017406 Ga0068860_1000174064 199
834 3300006051 Ga0075364_10000075 Ga0075364_100000758 199
835 3300009093 Ga0105240_10414486 Ga0105240_104144862 199
836 3300009093 Ga0105240_10575495 Ga0105240_105754952 199
837 3300009098 Ga0105245_11213042 Ga0105245_112130422 199
838 3300009174 Ga0105241_10083769 Ga0105241_100837693 199
839 3300009545 Ga0105237_10282236 Ga0105237_102822362 199
840 3300009545 Ga0105237_10363183 Ga0105237_103631832 199
841 3300009979 Ga0105032_109395 Ga0105032_1093951 199
842 3300010375 Ga0105239_10074918 Ga0105239_100749183 199
843 3300010375 Ga0105239_10625658 Ga0105239_106256582 199
844 3300013104 Ga0157370_10187919 Ga0157370_101879192 199
845 3300013105 Ga0157369_10011860 Ga0157369_1001186014 199
846 3300013307 Ga0157372_10126760 Ga0157372_101267603 199
847 3300014325 Ga0163163_10000597 Ga0163163_100005978 199
848 3300014969 Ga0157376_10840628 Ga0157376_108406282 199
849 3300025245 Ga0207425_1000097 Ga0207425_100009765 199
850 3300025258 Ga0209129_1000189 Ga0209129_100018965 199
851 3300025294 Ga0209025_1000054 Ga0209025_100005465 199
852 3300025297 Ga0209758_1000062 Ga0209758_100006265 199
853 3300025321 Ga0207656_10029913 Ga0207656_100299132 199
854 3300025904 Ga0207647_10001844 Ga0207647_1000184420 199
855 3300025911 Ga0207654_10181440 Ga0207654_101814402 199
856 3300025911 Ga0207654_10526933 Ga0207654_105269332 199
857 3300025912 Ga0207707_10137111 Ga0207707_101371112 199
858 3300025913 Ga0207695_10000261 Ga0207695_1000026178 199
859 3300025913 Ga0207695_10266207 Ga0207695_102662072 199
860 3300025914 Ga0207671_10010073 Ga0207671_100100736 199
861 3300025919 Ga0207657_10082222 Ga0207657_100822223 199
862 3300025920 Ga0207649_10354522 Ga0207649_103545222 199
863 3300025924 Ga0207694_10271084 Ga0207694_102710842 199
864 3300025932 Ga0207690_10119941 Ga0207690_101199412 199
865 3300025938 Ga0207704_10128325 Ga0207704_101283252 199
866 3300025949 Ga0207667_10264973 Ga0207667_102649732 199
867 3300025949 Ga0207667_10426315 Ga0207667_104263152 199
868 3300025981 Ga0207640_10237128 Ga0207640_102371282 199
869 3300026023 Ga0207677_10062497 Ga0207677_100624972 199
870 3300026035 Ga0207703_10076370 Ga0207703_100763702 199
871 3300026041 Ga0207639_10001886 Ga0207639_1000188613 199
872 3300026041 Ga0207639_10306901 Ga0207639_103069012 199
873 3300026078 Ga0207702_10001809 Ga0207702_100018098 199
874 3300026088 Ga0207641_11154779 Ga0207641_111547792 199
875 3300028380 Ga0268265_10271456 Ga0268265_102714562 199
876 3300028381 Ga0268264_10180457 Ga0268264_101804572 199
877 3300031548 Ga0307408_100136374 Ga0307408_1001363743 199
878 3300031824 Ga0307413_10503860 Ga0307413_105038602 199
879 3300031824 Ga0307413_10733133 Ga0307413_107331331 199
880 3300031911 Ga0307412_10307364 Ga0307412_103073642 199
881 3300032004 Ga0307414_10023949 Ga0307414_100239493 199
882 3300032004 Ga0307414_10074267 Ga0307414_100742672 199
883 3300032004 Ga0307414_10296325 Ga0307414_102963252 199
884 3300032005 Ga0307411_10232904 Ga0307411_102329042 199
885 3300032005 Ga0307411_10502491 Ga0307411_105024912 199
886 3300032005 Ga0307411_10609503 Ga0307411_106095032 199
887 3300033179 Ga0307507_10000880 Ga0307507_1000088022 199
888 3300038705 Ga0237819_00169 Ga0237819_00169_15202_15801 199
889 3300041406 Ga0439439_0130190 Ga0439439_0130190_73_672 199
890 3300041413 Ga0439465_0001563 Ga0439465_0001563_3088_3687 199
891 3300041494 Ga0451837_0033562 Ga0451837_0033562_242_844 199
892 3300042006 Ga0439432_167382 Ga0439432_167382_32_631 199
893 3300042007 Ga0439449_0000069 Ga0439449_0000069_24928_25527 199
894 3300046539 Ga0495621_0065359 Ga0495621_0065359_254_853 199
895 3300046615 Ga0495656_0002149 Ga0495656_0002149_1234_1833 199
896 3300047318 Ga0495636_0006533 Ga0495636_0006533_1375_1974 199
897 3300047472 Ga0495686_0015670 Ga0495686_0015670_2106_2705 199
898 3300048928 Ga0496125_0131233 Ga0496125_0131233_994_1593 199
899 3300048929 Ga0496126_0588425 Ga0496126_0588425_243_842 199
900 3300049571 Ga0501034_0001977 Ga0501034_0001977_15509_16123 199
901 3300049772 Ga0501275_000447 Ga0501275_000447_3201_3842 199
902 3300050491 nmdc:mga00v17_729_c2 nmdc:mga00v17_729_c2_6371_6976 199
903 iso_pu_bacteria 2895498888 2895500779 199
904 iso_pu_bacteria 2895511927 2895516351 199
905 iso_pu_bacteria 2895522137 2895523730 199
906 iso_pu_bacteria 2895525241 2895526689 199
907 2162886007 SwRhRL2b_contig_2191643 SwRhRL2b_0907.00000550 200
908 3300003771 Ga0055526_1000268 Ga0055526_100026811 200
909 3300003773 Ga0055537_1000348 Ga0055537_10003487 200
910 3300003781 Ga0055536_1001728 Ga0055536_100172810 200
911 3300003781 Ga0055536_1008641 Ga0055536_10086412 200
912 3300003784 Ga0055534_1000043 Ga0055534_100004325 200
913 3300003790 Ga0055528_1000065 Ga0055528_100006512 200
914 3300003791 Ga0055530_10001974 Ga0055530_100019748 200
915 3300003791 Ga0055530_10002320 Ga0055530_100023206 200
916 3300003792 Ga0055540_1037333 Ga0055540_10373331 200
917 3300003794 Ga0055531_10010116 Ga0055531_100101164 200
918 3300003794 Ga0055531_10011251 Ga0055531_100112512 200
919 3300003794 Ga0055531_10011262 Ga0055531_100112622 200
920 3300003856 Ga0058692_1000031 Ga0058692_100003187 200
921 3300003856 Ga0058692_1000060 Ga0058692_100006010 200
922 3300005289 Ga0065704_10070367 Ga0065704_1007036719 200
923 3300005289 Ga0065704_10134021 Ga0065704_101340212 200
924 3300005331 Ga0070670_100007794 Ga0070670_10000779411 200
925 3300005347 Ga0070668_100112328 Ga0070668_1001123282 200
926 3300005353 Ga0070669_100224637 Ga0070669_1002246372 200
927 3300005456 Ga0070678_100568995 Ga0070678_1005689952 200
928 3300005548 Ga0070665_100022951 Ga0070665_1000229512 200
929 3300005616 Ga0068852_100505328 Ga0068852_1005053282 200
930 3300005618 Ga0068864_100067635 Ga0068864_1000676352 200
931 3300005841 Ga0068863_100001728 Ga0068863_10000172813 200
932 3300005843 Ga0068860_100043436 Ga0068860_1000434362 200
933 3300005985 Ga0081539_10029649 Ga0081539_100296493 200
934 3300006051 Ga0075364_10033599 Ga0075364_100335992 200
935 3300006051 Ga0075364_10045173 Ga0075364_100451734 200
936 3300006177 Ga0075362_10034213 Ga0075362_100342133 200
937 3300006178 Ga0075367_10107375 Ga0075367_101073752 200
938 3300006186 Ga0075369_10031861 Ga0075369_100318612 200
939 3300006195 Ga0075366_10204202 Ga0075366_102042022 200
940 3300009011 Ga0105251_10000684 Ga0105251_1000068419 200
941 3300009011 Ga0105251_10010358 Ga0105251_100103586 200
942 3300009148 Ga0105243_10012752 Ga0105243_100127522 200
943 3300009148 Ga0105243_10096358 Ga0105243_100963582 200
944 3300009177 Ga0105248_10084810 Ga0105248_100848105 200
945 3300009553 Ga0105249_10064480 Ga0105249_100644804 200
946 3300011119 Ga0105246_10004902 Ga0105246_100049026 200
947 3300013102 Ga0157371_10002070 Ga0157371_100020708 200
948 3300013102 Ga0157371_10002097 Ga0157371_1000209714 200
949 3300013102 Ga0157371_10036564 Ga0157371_100365642 200
950 3300013104 Ga0157370_10025187 Ga0157370_100251873 200
951 3300013104 Ga0157370_10045181 Ga0157370_100451813 200
952 3300013104 Ga0157370_10082267 Ga0157370_100822672 200
953 3300013105 Ga0157369_10005861 Ga0157369_1000586111 200
954 3300014325 Ga0163163_10000788 Ga0163163_1000078817 200
955 3300014497 Ga0182008_10000032 Ga0182008_10000032148 200
956 3300014497 Ga0182008_10053209 Ga0182008_100532093 200
957 3300014968 Ga0157379_10003251 Ga0157379_1000325112 200
958 3300015261 Ga0182006_1027840 Ga0182006_10278402 200
959 3300015261 Ga0182006_1034584 Ga0182006_10345843 200
960 3300015261 Ga0182006_1055039 Ga0182006_10550392 200
961 3300015261 Ga0182006_1078117 Ga0182006_10781172 200
962 3300015261 Ga0182006_1092595 Ga0182006_10925951 200
963 3300015262 Ga0182007_10000067 Ga0182007_1000006722 200
964 3300015265 Ga0182005_1000487 Ga0182005_100048719 200
965 3300015265 Ga0182005_1003544 Ga0182005_10035442 200
966 3300017792 Ga0163161_10000314 Ga0163161_100003149 200
967 3300017792 Ga0163161_10020581 Ga0163161_100205813 200
968 3300017792 Ga0163161_10022836 Ga0163161_100228365 200
969 3300017792 Ga0163161_10130017 Ga0163161_101300173 200
970 3300025263 Ga0209565_1000063 Ga0209565_100006314 200
971 3300025273 Ga0209673_1000065 Ga0209673_1000065125 200
972 3300025284 Ga0209130_1022608 Ga0209130_10226082 200
973 3300025291 Ga0209675_1000011 Ga0209675_1000011268 200
974 3300025292 Ga0209676_1000011 Ga0209676_1000011626 200
975 3300025292 Ga0209676_1000068 Ga0209676_1000068190 200
976 3300025292 Ga0209676_1000804 Ga0209676_100080435 200
977 3300025295 Ga0209564_1000433 Ga0209564_100043351 200
978 3300025298 Ga0209050_1000239 Ga0209050_100023991 200
979 3300025298 Ga0209050_1000599 Ga0209050_100059941 200
980 3300025298 Ga0209050_1012752 Ga0209050_10127522 200
981 3300025298 Ga0209050_1022399 Ga0209050_10223992 200
982 3300025299 Ga0209256_1010810 Ga0209256_10108104 200
983 3300025303 Ga0209051_1003250 Ga0209051_10032507 200
984 3300025304 Ga0209257_1000014 Ga0209257_1000014685 200
985 3300025304 Ga0209257_1005372 Ga0209257_10053728 200
986 3300025304 Ga0209257_1006688 Ga0209257_10066887 200
987 3300025735 Ga0207713_1000806 Ga0207713_100080618 200
988 3300025735 Ga0207713_1012433 Ga0207713_10124334 200
989 3300025923 Ga0207681_10239811 Ga0207681_102398113 200
990 3300025925 Ga0207650_10020651 Ga0207650_100206512 200
991 3300025935 Ga0207709_10001731 Ga0207709_100017313 200
992 3300025935 Ga0207709_10006989 Ga0207709_100069892 200
993 3300025941 Ga0207711_10135700 Ga0207711_101357001 200
994 3300025961 Ga0207712_10123710 Ga0207712_101237102 200
995 3300025972 Ga0207668_10126656 Ga0207668_101266562 200
996 3300026088 Ga0207641_10097631 Ga0207641_100976314 200
997 3300026121 Ga0207683_10677450 Ga0207683_106774502 200
998 3300026142 Ga0207698_10151618 Ga0207698_101516182 200
999 3300027252 Ga0209973_1019921 Ga0209973_10199212 200
1000 3300027312 Ga0209371_1000004 Ga0209371_100000491 200
1001 3300027312 Ga0209371_1000139 Ga0209371_100013910 200
1002 3300027543 Ga0209999_1008881 Ga0209999_10088812 200
1003 3300027614 Ga0209970_1011151 Ga0209970_10111512 200
1004 3300027665 Ga0209983_1005635 Ga0209983_10056352 200
1005 3300027876 Ga0209974_10010051 Ga0209974_100100512 200
1006 3300028381 Ga0268264_10032658 Ga0268264_100326583 200
1007 3300030500 Ga0268256_1000005 Ga0268256_1000005954 200
1008 3300030500 Ga0268256_1000109 Ga0268256_100010993 200
1009 3300030732 Ga0316176_1166069 Ga0316176_11660691 200
1010 3300030733 Ga0314311_1025340 Ga0314311_10253405 200
1011 3300030735 Ga0316178_1066114 Ga0316178_10661142 200
1012 3300030742 Ga0316183_1086976 Ga0316183_10869765 200
1013 3300030744 Ga0316181_1180556 Ga0316181_11805562 200
1014 3300031731 Ga0307405_10224636 Ga0307405_102246362 200
1015 3300031901 Ga0307406_10524310 Ga0307406_105243102 200
1016 3300031911 Ga0307412_10000548 Ga0307412_100005485 200
1017 3300031995 Ga0307409_100537009 Ga0307409_1005370092 200
1018 3300032004 Ga0307414_10307317 Ga0307414_103073172 200
1019 3300032004 Ga0307414_10562854 Ga0307414_105628542 200
1020 3300032004 Ga0307414_10566378 Ga0307414_105663782 200
1021 3300032004 Ga0307414_10602496 Ga0307414_106024962 200
1022 3300032005 Ga0307411_10014544 Ga0307411_100145442 200
1023 3300041459 Ga0451800_0005888 Ga0451800_0005888_1395_2009 200
1024 3300041462 Ga0451806_032754 Ga0451806_032754_416_1030 200
1025 3300042007 Ga0439449_0003704 Ga0439449_0003704_3564_4166 200
1026 3300046453 Ga0495627_017920 Ga0495627_017920_1753_2355 200
1027 3300046460 Ga0495638_0000202 Ga0495638_0000202_21296_21898 200
1028 3300046460 Ga0495638_0027546 Ga0495638_0027546_36_638 200
1029 3300046512 Ga0495610_0049600 Ga0495610_0049600_557_1159 200
1030 3300046518 Ga0495631_0034299 Ga0495631_0034299_45_647 200
1031 3300046522 Ga0495643_0000919 Ga0495643_0000919_4978_5580 200
1032 3300046525 Ga0495663_0002339 Ga0495663_0002339_1192_1794 200
1033 3300046525 Ga0495663_0006455 Ga0495663_0006455_2462_3064 200
1034 3300046525 Ga0495663_0013907 Ga0495663_0013907_1149_1751 200
1035 3300046539 Ga0495621_0020509 Ga0495621_0020509_1281_1910 200
1036 3300046558 Ga0495633_0011833 Ga0495633_0011833_3984_4586 200
1037 3300046558 Ga0495633_0046333 Ga0495633_0046333_577_1182 200
1038 3300046558 Ga0495633_0174398 Ga0495633_0174398_48_650 200
1039 3300046558 Ga0495633_0209316 Ga0495633_0209316_157_759 200
1040 3300046660 Ga0495625_0048020 Ga0495625_0048020_1163_1765 200
1041 3300046810 Ga0495660_0106768 Ga0495660_0106768_68_670 200
1042 3300047320 Ga0495672_0000105 Ga0495672_0000105_89492_90094 200
1043 3300047320 Ga0495672_0158322 Ga0495672_0158322_142_744 200
1044 3300047472 Ga0495686_0008426 Ga0495686_0008426_6858_7460 200
1045 3300048907 Ga0496104_0268192 Ga0496104_0268192_877_1479 200
1046 3300048908 Ga0496105_0172208 Ga0496105_0172208_46_648 200
1047 3300048914 Ga0496111_0118009 Ga0496111_0118009_846_1448 200
1048 3300048919 Ga0496116_0000218 Ga0496116_0000218_72023_72625 200
1049 3300048919 Ga0496116_0013717 Ga0496116_0013717_298_900 200
1050 3300048919 Ga0496116_0032122 Ga0496116_0032122_283_885 200
1051 3300048919 Ga0496116_0113902 Ga0496116_0113902_284_886 200
1052 3300048919 Ga0496116_0213622 Ga0496116_0213622_242_844 200
1053 3300048920 Ga0496117_0000314 Ga0496117_0000314_58356_58958 200
1054 3300048920 Ga0496117_0001191 Ga0496117_0001191_6939_7541 200
1055 3300048920 Ga0496117_0003149 Ga0496117_0003149_10431_11033 200
1056 3300048920 Ga0496117_0004544 Ga0496117_0004544_5675_6277 200
1057 3300048920 Ga0496117_0009737 Ga0496117_0009737_7565_8167 200
1058 3300048920 Ga0496117_0083137 Ga0496117_0083137_597_1199 200
1059 3300048920 Ga0496117_0276306 Ga0496117_0276306_177_779 200
1060 3300048921 Ga0496118_0000371 Ga0496118_0000371_7591_8193 200
1061 3300048921 Ga0496118_0002136 Ga0496118_0002136_11323_11925 200
1062 3300048921 Ga0496118_0002547 Ga0496118_0002547_3417_4019 200
1063 3300048921 Ga0496118_0006150 Ga0496118_0006150_7095_7697 200
1064 3300048921 Ga0496118_0033714 Ga0496118_0033714_932_1534 200
1065 3300048921 Ga0496118_0117972 Ga0496118_0117972_197_799 200
1066 3300048921 Ga0496118_0127254 Ga0496118_0127254_233_835 200
1067 3300048922 Ga0496119_0000239 Ga0496119_0000239_59036_59638 200
1068 3300048922 Ga0496119_0002973 Ga0496119_0002973_10372_10974 200
1069 3300048922 Ga0496119_0054521 Ga0496119_0054521_893_1495 200
1070 3300048923 Ga0496120_0000181 Ga0496120_0000181_61402_62004 200
1071 3300048923 Ga0496120_0000676 Ga0496120_0000676_31601_32203 200
1072 3300048924 Ga0496121_0004104 Ga0496121_0004104_15173_15775 200
1073 3300048924 Ga0496121_0016876 Ga0496121_0016876_5500_6102 200
1074 3300048924 Ga0496121_0039123 Ga0496121_0039123_1361_1963 200
1075 3300048924 Ga0496121_0175446 Ga0496121_0175446_166_768 200
1076 3300048925 Ga0496122_0000901 Ga0496122_0000901_21131_21733 200
1077 3300048925 Ga0496122_0001122 Ga0496122_0001122_15137_15739 200
1078 3300048925 Ga0496122_0012066 Ga0496122_0012066_5645_6247 200
1079 3300048925 Ga0496122_0021920 Ga0496122_0021920_1560_2162 200
1080 3300048925 Ga0496122_0102293 Ga0496122_0102293_466_1068 200
1081 3300048925 Ga0496122_0185702 Ga0496122_0185702_154_756 200
1082 3300048925 Ga0496122_0262235 Ga0496122_0262235_217_819 200
1083 3300048926 Ga0496123_0000727 Ga0496123_0000727_21397_21999 200
1084 3300048926 Ga0496123_0000920 Ga0496123_0000920_15095_15697 200
1085 3300048926 Ga0496123_0002564 Ga0496123_0002564_15868_16470 200
1086 3300048926 Ga0496123_0005759 Ga0496123_0005759_6077_6679 200
1087 3300048926 Ga0496123_0010634 Ga0496123_0010634_269_871 200
1088 3300048926 Ga0496123_0042551 Ga0496123_0042551_618_1220 200
1089 3300048926 Ga0496123_0046388 Ga0496123_0046388_1668_2270 200
1090 3300048926 Ga0496123_0318995 Ga0496123_0318995_46_648 200
1091 3300048927 Ga0496124_0001061 Ga0496124_0001061_11397_11999 200
1092 3300048927 Ga0496124_0001652 Ga0496124_0001652_4899_5501 200
1093 3300048927 Ga0496124_0005126 Ga0496124_0005126_8412_9014 200
1094 3300048927 Ga0496124_0006193 Ga0496124_0006193_6640_7242 200
1095 3300048927 Ga0496124_0009321 Ga0496124_0009321_73_675 200
1096 3300048927 Ga0496124_0019095 Ga0496124_0019095_4503_5105 200
1097 3300048927 Ga0496124_0021047 Ga0496124_0021047_176_778 200
1098 3300048927 Ga0496124_0058646 Ga0496124_0058646_981_1583 200
1099 3300048927 Ga0496124_0239956 Ga0496124_0239956_386_988 200
1100 3300048927 Ga0496124_0335034 Ga0496124_0335034_343_945 200
1101 3300048928 Ga0496125_0000320 Ga0496125_0000320_13263_13865 200
1102 3300048928 Ga0496125_0005964 Ga0496125_0005964_12429_13031 200
1103 3300048928 Ga0496125_0025180 Ga0496125_0025180_4398_5000 200
1104 3300048928 Ga0496125_0121582 Ga0496125_0121582_462_1064 200
1105 3300048928 Ga0496125_0268578 Ga0496125_0268578_266_868 200
1106 3300048929 Ga0496126_0001014 Ga0496126_0001014_18785_19387 200
1107 3300048929 Ga0496126_0123760 Ga0496126_0123760_781_1383 200
1108 3300048929 Ga0496126_0206619 Ga0496126_0206619_803_1405 200
1109 3300049571 Ga0501034_0007048 Ga0501034_0007048_10376_10978 200
1110 3300049571 Ga0501034_0635658 Ga0501034_0635658_325_927 200
1111 3300049660 Ga0501216_011253 Ga0501216_011253_268_870 200
1112 3300049679 Ga0501249_043326 Ga0501249_043326_336_938 200
1113 3300049688 Ga0501259_027992 Ga0501259_027992_173_775 200
1114 3300050492 nmdc:mga0yw44_137900_c1 nmdc:mga0yw44_137900_c1_634_1236 200
1115 3300050494 nmdc:mga06z11_426937_c1 nmdc:mga06z11_426937_c1_73_675 200
1116 3300053128 Ga0500626_053803 Ga0500626_053803_813_1415 200
1117 3300053161 Ga0500634_0000322 Ga0500634_0000322_7572_8174 200
1118 3300053734 Ga0500565_020439 Ga0500565_020439_37_639 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00117

GATase

Glutamine amidotransferase class-I

44

236

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.958 4 196
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.9552 1 196
4gud-assembly1.cif.gz_A crystal structure of amidotransferase hish from vibrio cholerae 0.9344 4 196
4gud-assembly2.cif.gz_B crystal structure of amidotransferase hish from vibrio cholerae 0.932 1 196
1ka9-assembly1.cif.gz_H imidazole glycerol phosphate synthase 0.9167 3 197
ID Description Score Start End Superfamily
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9519 4 196 3.40.50.880
af_P9WMM1_1_205_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9407 1 197 3.40.50.880
af_Q2FUU1_1_190_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9357 4 200 3.40.50.880
af_Q57929_1_195_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9332 4 196 3.40.50.880
4gudA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9328 4 196 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A357NIC5-F1-model_v4 deleted 0.9957 116 180
AF-A0A7C9LXU4-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) 0.9921 2 196 GO:0000105
GO:0000107
GO:0004359
GO:0005737
GO:0006541
GO:0016829
AF-A0A1G0QUI8-F1-model_v4 Imidazole glycerol phosphate synthase, glutamine amidotransferase subunit 0.9918 113 196 GO:0000105
GO:0000107
GO:0004359
GO:0016829
AF-A0A848QA24-F1-model_v4 deleted 0.9892 44 196
AF-A0A3C0X9Q2-F1-model_v4 deleted 0.9883 1 121

Feature Viewer

pLDDT pTM Quality
95.88 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map