F490337
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1118 | 404 | 1072 | 197 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10936705|Ga0105241_109367051 |
| Length | 236 |
| Sequence | MNVVLVDAGGGTALDHPVVADADVEVVGVALQRAPERLVGLAAVLIDAGGANLGSVRYALERLGATVKLVRDAEGLAGAQRVILPGVGAAGPGMARLRELGLVELLRSLKQPVLGVCLGMQLLFDRSEEAGVDTLGLIPGVVRKLVPACGIRVPHMGWNLLSAKQAHPLLAGLGGDEQAYFVHSYAVPVGDWTLASSDYGEAFSAVIARDNYYGMQFHPERSAAVGAKLLKSFLEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 5 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 6 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 7 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 8 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 9 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 10 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 11 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 12 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 13 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 14 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 15 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 16 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 17 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 18 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 19 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 20 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 21 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 22 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 23 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 24 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 25 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 26 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 27 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 28 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 29 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 30 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 31 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 32 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 33 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 34 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 35 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 36 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 37 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 38 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 39 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 40 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 41 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 42 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 43 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 44 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 45 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 46 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 47 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 48 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 49 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 50 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 51 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 52 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 53 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 54 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 55 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 56 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 57 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 58 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 59 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 60 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 61 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 62 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 64 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 65 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 66 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 67 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 69 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 70 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 71 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 73 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 75 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 76 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 79 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 80 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 95 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 104 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 106 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 110 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 112 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 113 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 114 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 115 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 116 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 117 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 118 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 119 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 120 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 121 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 122 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 123 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 124 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 125 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 126 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 127 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 128 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 130 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 131 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 132 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 134 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 149 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 164 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 168 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 169 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 178 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 181 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 189 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 194 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 250 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 251 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 252 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 253 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 254 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 255 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 256 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 257 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 258 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 259 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 260 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 261 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 262 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 263 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 264 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 265 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 266 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 267 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 268 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 269 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 270 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 271 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 272 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 275 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 276 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 277 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 278 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 279 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 280 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 281 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 282 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 283 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 284 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 285 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 286 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 287 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 288 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 289 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 290 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 291 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 292 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 293 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 294 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 295 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 296 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 297 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 298 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 299 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 300 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 301 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 302 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 303 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 304 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 305 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 306 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 307 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 308 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 309 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 310 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 311 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 312 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 313 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 314 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 315 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 337 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 339 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 340 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 341 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 342 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 343 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 344 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 347 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 348 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 349 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 350 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 351 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 352 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 353 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 354 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 355 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 356 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 357 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 358 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 359 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 360 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 361 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 362 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 381 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 382 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 383 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 385 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 386 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 390 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 395 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 397 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 398 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 400 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 401 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 402 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 403 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 404 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.53 |
| Metatranscriptomes | 0.36 |
| Isolates | 4.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.68 |
| Nodule | 0.09 |
| Rhizoplane | 3.13 |
| Rhizosphere | 76.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2191643 | 2162886007 | Bacteria | 1273 |
| 2 | SwRhRL2b_contig_3936045 | 2162886007 | Bacteria | 1173 |
| 3 | JGI24736J21556_1000339 | 3300001904 | Bacteria | 8765 |
| 4 | JGI24739J22299_10000040 | 3300001989 | Bacteria | 35361 |
| 5 | JGI24739J22299_10056009 | 3300001989 | Bacteria | 1259 |
| 6 | JGI24737J22298_10002132 | 3300001990 | Bacteria | 7051 |
| 7 | JGI24737J22298_10002784 | 3300001990 | Bacteria | 6194 |
| 8 | JGI25156J39149_1010714 | 3300002705 | Bacteria | 2134 |
| 9 | JGI25162J39368_1000395 | 3300002737 | Bacteria | 36803 |
| 10 | JGI25162J39368_1000684 | 3300002737 | Bacteria | 23728 |
| 11 | JGI25162J39368_1002286 | 3300002737 | Bacteria | 7726 |
| 12 | JGI25157J39369_1000081 | 3300002741 | Bacteria | 85798 |
| 13 | JGI25157J39369_1000547 | 3300002741 | Bacteria | 22506 |
| 14 | JGI25163J39215_1000313 | 3300002771 | Bacteria | 16376 |
| 15 | JGI25164J39214_1000028 | 3300002772 | Bacteria | 150310 |
| 16 | JGI25164J39214_1000338 | 3300002772 | Bacteria | 29675 |
| 17 | JGI25164J39214_1000416 | 3300002772 | Bacteria | 24162 |
| 18 | JGI25152J39213_1001386 | 3300002773 | Bacteria | 10503 |
| 19 | JGI25150J39212_1000817 | 3300002774 | Bacteria | 10499 |
| 20 | JGI25151J46595_10001867 | 3300003187 | Bacteria | 13477 |
| 21 | JGI25165J46597_1000108 | 3300003214 | Bacteria | 150310 |
| 22 | JGI25165J46597_1000513 | 3300003214 | Bacteria | 36803 |
| 23 | JGI25165J46597_1003664 | 3300003214 | Bacteria | 3673 |
| 24 | JGI25153J46596_10000167 | 3300003215 | Bacteria | 66040 |
| 25 | JGI25153J46596_10003689 | 3300003215 | Bacteria | 8469 |
| 26 | rootH1_10048199 | 3300003316 | Bacteria | 3478 |
| 27 | rootH2_10026728 | 3300003320 | Bacteria | 23571 |
| 28 | rootH1_10048164 | 3300003323 | Bacteria | 1855 |
| 29 | rootH1_10103103 | 3300003323 | Bacteria | 1709 |
| 30 | rootH1_10162681 | 3300003323 | Bacteria | 3348 |
| 31 | Ga0006562J51391_1011160 | 3300003578 | Bacteria | 7470 |
| 32 | Ga0006562J51391_1011163 | 3300003578 | Bacteria | 2930 |
| 33 | Ga0055539_1001625 | 3300003752 | Bacteria | 4033 |
| 34 | Ga0055535_1000771 | 3300003761 | Bacteria | 23731 |
| 35 | Ga0055542_1000772 | 3300003762 | Bacteria | 24080 |
| 36 | Ga0055542_1000787 | 3300003762 | Bacteria | 23728 |
| 37 | Ga0055529_1000078 | 3300003763 | Bacteria | 150310 |
| 38 | Ga0055526_1000268 | 3300003771 | Bacteria | 43933 |
| 39 | Ga0055537_1000348 | 3300003773 | Bacteria | 31460 |
| 40 | Ga0055536_1001728 | 3300003781 | Bacteria | 12918 |
| 41 | Ga0055536_1008641 | 3300003781 | Bacteria | 4339 |
| 42 | Ga0055534_1000043 | 3300003784 | Bacteria | 99338 |
| 43 | Ga0055528_1000065 | 3300003790 | Bacteria | 85294 |
| 44 | Ga0055530_10001974 | 3300003791 | Bacteria | 13958 |
| 45 | Ga0055530_10002320 | 3300003791 | Bacteria | 12437 |
| 46 | Ga0055540_1037333 | 3300003792 | Bacteria | 1072 |
| 47 | Ga0055531_10010116 | 3300003794 | Bacteria | 4734 |
| 48 | Ga0055531_10011251 | 3300003794 | Bacteria | 4342 |
| 49 | Ga0055531_10011262 | 3300003794 | Bacteria | 4339 |
| 50 | Ga0058692_1000031 | 3300003856 | Bacteria | 188488 |
| 51 | Ga0058692_1000060 | 3300003856 | Bacteria | 98866 |
| 52 | Ga0065704_10070367 | 3300005289 | Bacteria | 29287 |
| 53 | Ga0065704_10134021 | 3300005289 | Bacteria | 1593 |
| 54 | Ga0070658_10097525 | 3300005327 | Bacteria | 2427 |
| 55 | Ga0070658_10212515 | 3300005327 | Bacteria | 1634 |
| 56 | Ga0070658_10343262 | 3300005327 | Bacteria | 1277 |
| 57 | Ga0070658_10371877 | 3300005327 | Bacteria | 1225 |
| 58 | Ga0070658_10473418 | 3300005327 | Bacteria | 1080 |
| 59 | Ga0070676_10257509 | 3300005328 | Bacteria | 1167 |
| 60 | Ga0070683_100048684 | 3300005329 | Bacteria | 3919 |
| 61 | Ga0070683_100814161 | 3300005329 | Bacteria | 895 |
| 62 | Ga0070690_100175666 | 3300005330 | Bacteria | 1477 |
| 63 | Ga0070670_100007794 | 3300005331 | Bacteria | 9111 |
| 64 | Ga0070666_10000388 | 3300005335 | Bacteria | 27657 |
| 65 | Ga0070666_10058900 | 3300005335 | Bacteria | 2597 |
| 66 | Ga0070666_10254484 | 3300005335 | Bacteria | 1244 |
| 67 | Ga0070682_100023945 | 3300005337 | Bacteria | 3629 |
| 68 | Ga0070682_100179353 | 3300005337 | Bacteria | 1478 |
| 69 | Ga0070660_100019590 | 3300005339 | Bacteria | 4960 |
| 70 | Ga0070660_100061965 | 3300005339 | Bacteria | 2905 |
| 71 | Ga0070660_100156685 | 3300005339 | Bacteria | 1833 |
| 72 | Ga0070660_100865117 | 3300005339 | Bacteria | 761 |
| 73 | Ga0070660_101054913 | 3300005339 | Bacteria | 687 |
| 74 | Ga0070689_100010930 | 3300005340 | Bacteria | 6487 |
| 75 | Ga0070691_10112024 | 3300005341 | Bacteria | 1366 |
| 76 | Ga0070691_10196097 | 3300005341 | Bacteria | 1059 |
| 77 | Ga0070661_100037021 | 3300005344 | Bacteria | 3549 |
| 78 | Ga0070661_100038689 | 3300005344 | Bacteria | 3474 |
| 79 | Ga0070661_100084639 | 3300005344 | Bacteria | 2343 |
| 80 | Ga0070661_100139852 | 3300005344 | Bacteria | 1824 |
| 81 | Ga0070661_100257471 | 3300005344 | Bacteria | 1348 |
| 82 | Ga0070661_100384145 | 3300005344 | Bacteria | 1107 |
| 83 | Ga0070661_100459547 | 3300005344 | Bacteria | 1014 |
| 84 | Ga0070692_10044215 | 3300005345 | Bacteria | 2293 |
| 85 | Ga0070692_10215947 | 3300005345 | Bacteria | 1131 |
| 86 | Ga0070668_100112328 | 3300005347 | Bacteria | 2170 |
| 87 | Ga0070669_100020435 | 3300005353 | Bacteria | 4729 |
| 88 | Ga0070669_100224637 | 3300005353 | Bacteria | 1486 |
| 89 | Ga0070675_100119317 | 3300005354 | Bacteria | 2240 |
| 90 | Ga0070671_100013860 | 3300005355 | Bacteria | 6504 |
| 91 | Ga0070671_100306657 | 3300005355 | Bacteria | 1352 |
| 92 | Ga0070674_100031562 | 3300005356 | Bacteria | 3511 |
| 93 | Ga0070674_100133202 | 3300005356 | Bacteria | 1856 |
| 94 | Ga0070674_100300121 | 3300005356 | Bacteria | 1280 |
| 95 | Ga0070673_100096136 | 3300005364 | Bacteria | 2430 |
| 96 | Ga0070673_100506750 | 3300005364 | Bacteria | 1092 |
| 97 | Ga0070673_100669910 | 3300005364 | Bacteria | 951 |
| 98 | Ga0070688_100136001 | 3300005365 | Bacteria | 1664 |
| 99 | Ga0070659_100005797 | 3300005366 | Bacteria | 8894 |
| 100 | Ga0070659_100034565 | 3300005366 | Bacteria | 3932 |
| 101 | Ga0070659_100058107 | 3300005366 | Bacteria | 3051 |
| 102 | Ga0070659_100133964 | 3300005366 | Bacteria | 2014 |
| 103 | Ga0070659_100161313 | 3300005366 | Bacteria | 1833 |
| 104 | Ga0070659_100267417 | 3300005366 | Bacteria | 1420 |
| 105 | Ga0070659_100362442 | 3300005366 | Bacteria | 1218 |
| 106 | Ga0070667_100156091 | 3300005367 | Bacteria | 2007 |
| 107 | Ga0070714_100104775 | 3300005435 | Bacteria | 2496 |
| 108 | Ga0070714_100116833 | 3300005435 | Bacteria | 2368 |
| 109 | Ga0070714_100164743 | 3300005435 | Bacteria | 2008 |
| 110 | Ga0070714_100241691 | 3300005435 | Bacteria | 1667 |
| 111 | Ga0070714_100304389 | 3300005435 | Bacteria | 1487 |
| 112 | Ga0070713_100006097 | 3300005436 | Bacteria | 8314 |
| 113 | Ga0070713_100014588 | 3300005436 | Bacteria | 5843 |
| 114 | Ga0070701_10145876 | 3300005438 | Bacteria | 1358 |
| 115 | Ga0070663_100093093 | 3300005455 | Bacteria | 2236 |
| 116 | Ga0070663_100186336 | 3300005455 | Bacteria | 1613 |
| 117 | Ga0070663_100252768 | 3300005455 | Bacteria | 1395 |
| 118 | Ga0070663_100306505 | 3300005455 | Bacteria | 1273 |
| 119 | Ga0070663_100312998 | 3300005455 | Bacteria | 1260 |
| 120 | Ga0070663_100428567 | 3300005455 | Bacteria | 1086 |
| 121 | Ga0070663_100638384 | 3300005455 | Bacteria | 899 |
| 122 | Ga0070678_100568995 | 3300005456 | Bacteria | 1008 |
| 123 | Ga0070662_100012504 | 3300005457 | Bacteria | 5629 |
| 124 | Ga0070662_100127321 | 3300005457 | Bacteria | 1959 |
| 125 | Ga0070662_100208443 | 3300005457 | Bacteria | 1554 |
| 126 | Ga0070662_100655373 | 3300005457 | Bacteria | 886 |
| 127 | Ga0070662_100771357 | 3300005457 | Bacteria | 816 |
| 128 | Ga0070679_100019902 | 3300005530 | Bacteria | 6535 |
| 129 | Ga0070684_100000098 | 3300005535 | Bacteria | 56167 |
| 130 | Ga0070684_100208421 | 3300005535 | Bacteria | 1781 |
| 131 | Ga0068853_100007676 | 3300005539 | Bacteria | 8648 |
| 132 | Ga0068853_100050236 | 3300005539 | Bacteria | 3587 |
| 133 | Ga0068853_100161588 | 3300005539 | Bacteria | 2022 |
| 134 | Ga0068853_100200769 | 3300005539 | Bacteria | 1815 |
| 135 | Ga0068853_100360905 | 3300005539 | Bacteria | 1353 |
| 136 | Ga0068853_100361954 | 3300005539 | Bacteria | 1351 |
| 137 | Ga0070696_100005210 | 3300005546 | Bacteria | 8690 |
| 138 | Ga0070696_100052356 | 3300005546 | Bacteria | 2840 |
| 139 | Ga0070693_100051465 | 3300005547 | Bacteria | 2359 |
| 140 | Ga0070693_100065349 | 3300005547 | Bacteria | 2126 |
| 141 | Ga0070665_100003847 | 3300005548 | Bacteria | 15889 |
| 142 | Ga0070665_100022951 | 3300005548 | Bacteria | 6283 |
| 143 | Ga0070665_100499008 | 3300005548 | Bacteria | 1228 |
| 144 | Ga0068855_100002059 | 3300005563 | Bacteria | 24913 |
| 145 | Ga0068855_100005690 | 3300005563 | Bacteria | 15228 |
| 146 | Ga0068855_100020597 | 3300005563 | Bacteria | 7909 |
| 147 | Ga0068855_100080776 | 3300005563 | Bacteria | 3770 |
| 148 | Ga0068855_100082253 | 3300005563 | Bacteria | 3732 |
| 149 | Ga0068855_100092531 | 3300005563 | Bacteria | 3487 |
| 150 | Ga0068855_100107211 | 3300005563 | Bacteria | 3210 |
| 151 | Ga0068855_100399958 | 3300005563 | Bacteria | 1505 |
| 152 | Ga0068855_100624049 | 3300005563 | Bacteria | 1160 |
| 153 | Ga0070664_100091821 | 3300005564 | Bacteria | 2628 |
| 154 | Ga0068857_100000511 | 3300005577 | Bacteria | 27856 |
| 155 | Ga0068857_100004075 | 3300005577 | Bacteria | 12305 |
| 156 | Ga0068857_100004673 | 3300005577 | Bacteria | 11601 |
| 157 | Ga0068857_100042446 | 3300005577 | Bacteria | 4035 |
| 158 | Ga0068857_100059143 | 3300005577 | Bacteria | 3404 |
| 159 | Ga0068857_100380365 | 3300005577 | Bacteria | 1311 |
| 160 | Ga0068854_100001254 | 3300005578 | Bacteria | 15235 |
| 161 | Ga0068854_100009920 | 3300005578 | Bacteria | 6161 |
| 162 | Ga0068854_100027013 | 3300005578 | Bacteria | 3951 |
| 163 | Ga0068854_100036209 | 3300005578 | Bacteria | 3459 |
| 164 | Ga0068854_100063684 | 3300005578 | Bacteria | 2677 |
| 165 | Ga0068854_100148510 | 3300005578 | Bacteria | 1805 |
| 166 | Ga0068854_100231495 | 3300005578 | Bacteria | 1467 |
| 167 | Ga0068856_100001449 | 3300005614 | Bacteria | 24884 |
| 168 | Ga0068856_100008083 | 3300005614 | Bacteria | 10271 |
| 169 | Ga0068856_100020139 | 3300005614 | Bacteria | 6480 |
| 170 | Ga0068856_100217728 | 3300005614 | Bacteria | 1925 |
| 171 | Ga0068856_100923512 | 3300005614 | Bacteria | 891 |
| 172 | Ga0068852_100003835 | 3300005616 | Bacteria | 10557 |
| 173 | Ga0068852_100037468 | 3300005616 | Bacteria | 4066 |
| 174 | Ga0068852_100105743 | 3300005616 | Bacteria | 2550 |
| 175 | Ga0068852_100243143 | 3300005616 | Bacteria | 1721 |
| 176 | Ga0068852_100357589 | 3300005616 | Bacteria | 1427 |
| 177 | Ga0068852_100453352 | 3300005616 | Bacteria | 1270 |
| 178 | Ga0068852_100488648 | 3300005616 | Bacteria | 1224 |
| 179 | Ga0068852_100505328 | 3300005616 | Bacteria | 1204 |
| 180 | Ga0068859_100419067 | 3300005617 | Bacteria | 1435 |
| 181 | Ga0068864_100028252 | 3300005618 | Bacteria | 4739 |
| 182 | Ga0068864_100067635 | 3300005618 | Bacteria | 3102 |
| 183 | Ga0068866_10183996 | 3300005718 | Bacteria | 1236 |
| 184 | Ga0068863_100000991 | 3300005841 | Bacteria | 28498 |
| 185 | Ga0068863_100001728 | 3300005841 | Bacteria | 21634 |
| 186 | Ga0068863_100156943 | 3300005841 | Bacteria | 2178 |
| 187 | Ga0068863_101395398 | 3300005841 | Bacteria | 708 |
| 188 | Ga0068858_100013472 | 3300005842 | Bacteria | 7715 |
| 189 | Ga0068860_100017406 | 3300005843 | Bacteria | 7002 |
| 190 | Ga0068860_100043436 | 3300005843 | Bacteria | 4288 |
| 191 | Ga0068860_100061662 | 3300005843 | Bacteria | 3563 |
| 192 | Ga0068860_100522419 | 3300005843 | Bacteria | 1187 |
| 193 | Ga0068862_100055198 | 3300005844 | Bacteria | 3403 |
| 194 | Ga0068862_100057171 | 3300005844 | Bacteria | 3344 |
| 195 | Ga0081539_10029649 | 3300005985 | Bacteria | 3413 |
| 196 | Ga0075364_10000075 | 3300006051 | Bacteria | 38780 |
| 197 | Ga0075364_10017738 | 3300006051 | Bacteria | 4452 |
| 198 | Ga0075364_10033599 | 3300006051 | Bacteria | 3304 |
| 199 | Ga0075364_10045173 | 3300006051 | Bacteria | 2867 |
| 200 | Ga0075362_10034213 | 3300006177 | Bacteria | 2214 |
| 201 | Ga0075367_10107375 | 3300006178 | Bacteria | 1711 |
| 202 | Ga0075369_10031861 | 3300006186 | Bacteria | 2228 |
| 203 | Ga0075366_10183309 | 3300006195 | Bacteria | 1272 |
| 204 | Ga0075366_10204202 | 3300006195 | Bacteria | 1202 |
| 205 | Ga0097621_100107133 | 3300006237 | Bacteria | 2358 |
| 206 | Ga0097621_100411855 | 3300006237 | Bacteria | 1212 |
| 207 | Ga0068871_100027620 | 3300006358 | Bacteria | 4440 |
| 208 | Ga0075428_100534850 | 3300006844 | Bacteria | 1253 |
| 209 | Ga0075428_100836136 | 3300006844 | Bacteria | 978 |
| 210 | Ga0068865_100491865 | 3300006881 | Bacteria | 1021 |
| 211 | Ga0097620_100419059 | 3300006931 | Bacteria | 1435 |
| 212 | Ga0099794_10049341 | 3300007265 | Bacteria | 2023 |
| 213 | Ga0105251_10000684 | 3300009011 | Bacteria | 31292 |
| 214 | Ga0105251_10010358 | 3300009011 | Bacteria | 5416 |
| 215 | Ga0105240_10003424 | 3300009093 | Bacteria | 24649 |
| 216 | Ga0105240_10009039 | 3300009093 | Bacteria | 14150 |
| 217 | Ga0105240_10014865 | 3300009093 | Bacteria | 10609 |
| 218 | Ga0105240_10020015 | 3300009093 | Bacteria | 8934 |
| 219 | Ga0105240_10030261 | 3300009093 | Bacteria | 7037 |
| 220 | Ga0105240_10031164 | 3300009093 | Bacteria | 6919 |
| 221 | Ga0105240_10164754 | 3300009093 | Bacteria | 2630 |
| 222 | Ga0105240_10172954 | 3300009093 | Bacteria | 2556 |
| 223 | Ga0105240_10239123 | 3300009093 | Bacteria | 2106 |
| 224 | Ga0105240_10414486 | 3300009093 | Bacteria | 1515 |
| 225 | Ga0105240_10575495 | 3300009093 | Bacteria | 1243 |
| 226 | Ga0105240_10977755 | 3300009093 | Bacteria | 906 |
| 227 | Ga0111539_10409346 | 3300009094 | Bacteria | 1580 |
| 228 | Ga0111539_11273889 | 3300009094 | Bacteria | 853 |
| 229 | Ga0105245_10543037 | 3300009098 | Bacteria | 1184 |
| 230 | Ga0105245_11213042 | 3300009098 | Bacteria | 802 |
| 231 | Ga0114129_10815943 | 3300009147 | Bacteria | 1189 |
| 232 | Ga0105243_10012752 | 3300009148 | Bacteria | 6349 |
| 233 | Ga0105243_10096358 | 3300009148 | Bacteria | 2447 |
| 234 | Ga0105241_10083769 | 3300009174 | Bacteria | 2502 |
| 235 | Ga0105241_10098806 | 3300009174 | Bacteria | 2317 |
| 236 | Ga0105241_10879278 | 3300009174 | Bacteria | 831 |
| 237 | Ga0105241_10936705 | 3300009174 | Bacteria | 806 |
| 238 | Ga0105248_10084810 | 3300009177 | Bacteria | 3564 |
| 239 | Ga0105248_10183860 | 3300009177 | Bacteria | 2355 |
| 240 | Ga0105248_10686207 | 3300009177 | Bacteria | 1155 |
| 241 | Ga0105237_10000023 | 3300009545 | Bacteria | 226144 |
| 242 | Ga0105237_10000595 | 3300009545 | Bacteria | 50470 |
| 243 | Ga0105237_10282236 | 3300009545 | Bacteria | 1663 |
| 244 | Ga0105237_10363183 | 3300009545 | Bacteria | 1452 |
| 245 | Ga0105237_10420762 | 3300009545 | Bacteria | 1341 |
| 246 | Ga0105238_10005372 | 3300009551 | Bacteria | 12662 |
| 247 | Ga0105238_10005720 | 3300009551 | Bacteria | 12290 |
| 248 | Ga0105238_10104398 | 3300009551 | Bacteria | 2815 |
| 249 | Ga0105238_10113419 | 3300009551 | Bacteria | 2690 |
| 250 | Ga0105238_10747423 | 3300009551 | Bacteria | 992 |
| 251 | Ga0105238_11270837 | 3300009551 | Bacteria | 762 |
| 252 | Ga0105249_10064480 | 3300009553 | Bacteria | 3368 |
| 253 | Ga0105032_109395 | 3300009979 | Bacteria | 799 |
| 254 | Ga0105239_10000022 | 3300010375 | Bacteria | 257744 |
| 255 | Ga0105239_10039292 | 3300010375 | Bacteria | 5184 |
| 256 | Ga0105239_10049113 | 3300010375 | Bacteria | 4627 |
| 257 | Ga0105239_10074918 | 3300010375 | Bacteria | 3721 |
| 258 | Ga0105239_10078397 | 3300010375 | Bacteria | 3635 |
| 259 | Ga0105239_10451297 | 3300010375 | Bacteria | 1459 |
| 260 | Ga0105239_10625658 | 3300010375 | Bacteria | 1228 |
| 261 | Ga0105239_10636726 | 3300010375 | Bacteria | 1217 |
| 262 | Ga0105246_10004902 | 3300011119 | Bacteria | 8154 |
| 263 | Ga0105246_10023433 | 3300011119 | Bacteria | 3994 |
| 264 | Ga0157314_1000105 | 3300012500 | Bacteria | 8981 |
| 265 | Ga0157373_10027400 | 3300013100 | Bacteria | 4110 |
| 266 | Ga0157373_10044297 | 3300013100 | Bacteria | 3177 |
| 267 | Ga0157373_10075101 | 3300013100 | Bacteria | 2385 |
| 268 | Ga0157373_10115399 | 3300013100 | Bacteria | 1888 |
| 269 | Ga0157373_10462764 | 3300013100 | Bacteria | 914 |
| 270 | Ga0157371_10002070 | 3300013102 | Bacteria | 19660 |
| 271 | Ga0157371_10002097 | 3300013102 | Bacteria | 19462 |
| 272 | Ga0157371_10005020 | 3300013102 | Bacteria | 11339 |
| 273 | Ga0157371_10005924 | 3300013102 | Bacteria | 10208 |
| 274 | Ga0157371_10021458 | 3300013102 | Bacteria | 4742 |
| 275 | Ga0157371_10024187 | 3300013102 | Bacteria | 4437 |
| 276 | Ga0157371_10036564 | 3300013102 | Bacteria | 3516 |
| 277 | Ga0157371_10049262 | 3300013102 | Bacteria | 2993 |
| 278 | Ga0157371_10165528 | 3300013102 | Bacteria | 1579 |
| 279 | Ga0157371_10741917 | 3300013102 | Unclassified | 737 |
| 280 | Ga0157370_10000707 | 3300013104 | Bacteria | 41767 |
| 281 | Ga0157370_10001239 | 3300013104 | Bacteria | 31925 |
| 282 | Ga0157370_10009476 | 3300013104 | Bacteria | 10395 |
| 283 | Ga0157370_10025187 | 3300013104 | Bacteria | 5890 |
| 284 | Ga0157370_10045181 | 3300013104 | Bacteria | 4227 |
| 285 | Ga0157370_10082267 | 3300013104 | Bacteria | 3029 |
| 286 | Ga0157370_10104116 | 3300013104 | Bacteria | 2656 |
| 287 | Ga0157370_10177749 | 3300013104 | Bacteria | 1978 |
| 288 | Ga0157370_10187919 | 3300013104 | Bacteria | 1918 |
| 289 | Ga0157370_10289114 | 3300013104 | Bacteria | 1514 |
| 290 | Ga0157370_10471752 | 3300013104 | Bacteria | 1153 |
| 291 | Ga0157369_10000239 | 3300013105 | Bacteria | 76144 |
| 292 | Ga0157369_10005861 | 3300013105 | Bacteria | 14272 |
| 293 | Ga0157369_10011860 | 3300013105 | Bacteria | 9898 |
| 294 | Ga0157369_10026692 | 3300013105 | Bacteria | 6404 |
| 295 | Ga0157369_10076617 | 3300013105 | Bacteria | 3585 |
| 296 | Ga0157369_10087931 | 3300013105 | Bacteria | 3317 |
| 297 | Ga0157369_10095626 | 3300013105 | Bacteria | 3169 |
| 298 | Ga0157369_10128439 | 3300013105 | Bacteria | 2687 |
| 299 | Ga0157369_10164684 | 3300013105 | Bacteria | 2339 |
| 300 | Ga0157369_10297926 | 3300013105 | Bacteria | 1678 |
| 301 | Ga0157369_10337263 | 3300013105 | Bacteria | 1566 |
| 302 | Ga0157369_10690381 | 3300013105 | Bacteria | 1051 |
| 303 | Ga0157374_10010711 | 3300013296 | Bacteria | 7898 |
| 304 | Ga0157378_10272408 | 3300013297 | Bacteria | 1628 |
| 305 | Ga0157378_10673704 | 3300013297 | Bacteria | 1052 |
| 306 | Ga0157372_10008488 | 3300013307 | Bacteria | 10902 |
| 307 | Ga0157372_10126760 | 3300013307 | Bacteria | 2936 |
| 308 | Ga0157372_10151239 | 3300013307 | Bacteria | 2679 |
| 309 | Ga0157372_10382008 | 3300013307 | Bacteria | 1641 |
| 310 | Ga0157372_10455589 | 3300013307 | Bacteria | 1491 |
| 311 | Ga0157372_11018677 | 3300013307 | Bacteria | 959 |
| 312 | Ga0157372_11312997 | 3300013307 | Bacteria | 835 |
| 313 | Ga0157375_11021767 | 3300013308 | Bacteria | 966 |
| 314 | Ga0157375_11987819 | 3300013308 | Bacteria | 691 |
| 315 | Ga0163163_10000597 | 3300014325 | Bacteria | 31566 |
| 316 | Ga0163163_10000788 | 3300014325 | Bacteria | 26861 |
| 317 | Ga0163163_10007998 | 3300014325 | Bacteria | 9357 |
| 318 | Ga0163163_10840434 | 3300014325 | Bacteria | 982 |
| 319 | Ga0182008_10000032 | 3300014497 | Bacteria | 162985 |
| 320 | Ga0182008_10053209 | 3300014497 | Bacteria | 2005 |
| 321 | Ga0182008_10111837 | 3300014497 | Bacteria | 1353 |
| 322 | Ga0157377_10170118 | 3300014745 | Bacteria | 1362 |
| 323 | Ga0157379_10003251 | 3300014968 | Bacteria | 13770 |
| 324 | Ga0157376_10840628 | 3300014969 | Bacteria | 933 |
| 325 | Ga0182006_1027840 | 3300015261 | Bacteria | 2304 |
| 326 | Ga0182006_1034584 | 3300015261 | Bacteria | 2020 |
| 327 | Ga0182006_1055039 | 3300015261 | Bacteria | 1520 |
| 328 | Ga0182006_1078117 | 3300015261 | Bacteria | 1213 |
| 329 | Ga0182006_1092595 | 3300015261 | Bacteria | 1085 |
| 330 | Ga0182006_1155977 | 3300015261 | Bacteria | 771 |
| 331 | Ga0182007_10000067 | 3300015262 | Bacteria | 82879 |
| 332 | Ga0182007_10013574 | 3300015262 | Bacteria | 3101 |
| 333 | Ga0182007_10059055 | 3300015262 | Bacteria | 1258 |
| 334 | Ga0182005_1000487 | 3300015265 | Bacteria | 20470 |
| 335 | Ga0182005_1003544 | 3300015265 | Bacteria | 5268 |
| 336 | Ga0183368_1004 | 3300015687 | Bacteria | 1211761 |
| 337 | Ga0163161_10000314 | 3300017792 | Bacteria | 41729 |
| 338 | Ga0163161_10020581 | 3300017792 | Bacteria | 4632 |
| 339 | Ga0163161_10022836 | 3300017792 | Bacteria | 4407 |
| 340 | Ga0163161_10130017 | 3300017792 | Bacteria | 1898 |
| 341 | Ga0206356_10015297 | 3300020070 | Bacteria | 2268 |
| 342 | Ga0206353_10295629 | 3300020082 | Bacteria | 1190 |
| 343 | Ga0209760_100676 | 3300025207 | Bacteria | 5407 |
| 344 | Ga0209784_100047 | 3300025224 | Bacteria | 199596 |
| 345 | Ga0209674_100053 | 3300025226 | Bacteria | 323159 |
| 346 | Ga0207427_100023 | 3300025231 | Bacteria | 439725 |
| 347 | Ga0207427_100115 | 3300025231 | Bacteria | 104282 |
| 348 | Ga0207427_100130 | 3300025231 | Bacteria | 94510 |
| 349 | Ga0207427_101434 | 3300025231 | Bacteria | 8642 |
| 350 | Ga0209437_100015 | 3300025233 | Bacteria | 713457 |
| 351 | Ga0209437_100020 | 3300025233 | Bacteria | 656374 |
| 352 | Ga0209437_100079 | 3300025233 | Bacteria | 275948 |
| 353 | Ga0209437_100276 | 3300025233 | Bacteria | 76094 |
| 354 | Ga0209258_100043 | 3300025242 | Bacteria | 380685 |
| 355 | Ga0209258_101362 | 3300025242 | Bacteria | 8861 |
| 356 | Ga0207425_1000097 | 3300025245 | Bacteria | 84719 |
| 357 | Ga0209646_1001086 | 3300025246 | Bacteria | 8118 |
| 358 | Ga0209646_1001409 | 3300025246 | Bacteria | 6528 |
| 359 | Ga0209646_1005518 | 3300025246 | Bacteria | 2199 |
| 360 | Ga0209026_1000047 | 3300025250 | Bacteria | 261867 |
| 361 | Ga0209026_1000105 | 3300025250 | Bacteria | 150738 |
| 362 | Ga0209026_1000162 | 3300025250 | Bacteria | 102867 |
| 363 | Ga0209026_1004849 | 3300025250 | Bacteria | 3822 |
| 364 | Ga0209677_107553 | 3300025253 | Bacteria | 2281 |
| 365 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 366 | Ga0209148_1000010 | 3300025254 | Bacteria | 1265567 |
| 367 | Ga0209759_1000318 | 3300025256 | Bacteria | 63865 |
| 368 | Ga0209129_1000189 | 3300025258 | Bacteria | 84712 |
| 369 | Ga0209129_1002006 | 3300025258 | Bacteria | 10556 |
| 370 | Ga0209233_1000009 | 3300025261 | Bacteria | 1265567 |
| 371 | Ga0209233_1000020 | 3300025261 | Bacteria | 798224 |
| 372 | Ga0209233_1000121 | 3300025261 | Bacteria | 233309 |
| 373 | Ga0209233_1004374 | 3300025261 | Bacteria | 4818 |
| 374 | Ga0209565_1000063 | 3300025263 | Bacteria | 183711 |
| 375 | Ga0209455_1000020 | 3300025272 | Bacteria | 702259 |
| 376 | Ga0209455_1000560 | 3300025272 | Bacteria | 25084 |
| 377 | Ga0209673_1000065 | 3300025273 | Bacteria | 252799 |
| 378 | Ga0209130_1022608 | 3300025284 | Bacteria | 1399 |
| 379 | Ga0209675_1000011 | 3300025291 | Bacteria | 520597 |
| 380 | Ga0209676_1000011 | 3300025292 | Bacteria | 860463 |
| 381 | Ga0209676_1000068 | 3300025292 | Bacteria | 314068 |
| 382 | Ga0209676_1000804 | 3300025292 | Bacteria | 41314 |
| 383 | Ga0209025_1000054 | 3300025294 | Bacteria | 317002 |
| 384 | Ga0209564_1000433 | 3300025295 | Bacteria | 72594 |
| 385 | Ga0209758_1000062 | 3300025297 | Bacteria | 317002 |
| 386 | Ga0209758_1000959 | 3300025297 | Bacteria | 38968 |
| 387 | Ga0209050_1000239 | 3300025298 | Bacteria | 119530 |
| 388 | Ga0209050_1000599 | 3300025298 | Bacteria | 57405 |
| 389 | Ga0209050_1012752 | 3300025298 | Bacteria | 3817 |
| 390 | Ga0209050_1022399 | 3300025298 | Bacteria | 2264 |
| 391 | Ga0209256_1010810 | 3300025299 | Bacteria | 3756 |
| 392 | Ga0209051_1003250 | 3300025303 | Bacteria | 10799 |
| 393 | Ga0209257_1000014 | 3300025304 | Bacteria | 946850 |
| 394 | Ga0209257_1005372 | 3300025304 | Bacteria | 9045 |
| 395 | Ga0209257_1006688 | 3300025304 | Bacteria | 7302 |
| 396 | Ga0207656_10029913 | 3300025321 | Bacteria | 2246 |
| 397 | Ga0207713_1000806 | 3300025735 | Bacteria | 29049 |
| 398 | Ga0207713_1012433 | 3300025735 | Bacteria | 4550 |
| 399 | Ga0207680_10000227 | 3300025903 | Bacteria | 27167 |
| 400 | Ga0207647_10001844 | 3300025904 | Bacteria | 16266 |
| 401 | Ga0207647_10007732 | 3300025904 | Bacteria | 7739 |
| 402 | Ga0207647_10010023 | 3300025904 | Bacteria | 6709 |
| 403 | Ga0207647_10012011 | 3300025904 | Bacteria | 6044 |
| 404 | Ga0207647_10018195 | 3300025904 | Bacteria | 4761 |
| 405 | Ga0207647_10021257 | 3300025904 | Bacteria | 4334 |
| 406 | Ga0207647_10037022 | 3300025904 | Bacteria | 3096 |
| 407 | Ga0207647_10059981 | 3300025904 | Bacteria | 2326 |
| 408 | Ga0207647_10110117 | 3300025904 | Bacteria | 1628 |
| 409 | Ga0207705_10000003 | 3300025909 | Bacteria | 709270 |
| 410 | Ga0207705_10038222 | 3300025909 | Bacteria | 3436 |
| 411 | Ga0207705_10040692 | 3300025909 | Bacteria | 3334 |
| 412 | Ga0207705_10105804 | 3300025909 | Bacteria | 2074 |
| 413 | Ga0207705_10183601 | 3300025909 | Bacteria | 1579 |
| 414 | Ga0207654_10168043 | 3300025911 | Bacteria | 1422 |
| 415 | Ga0207654_10181440 | 3300025911 | Bacteria | 1374 |
| 416 | Ga0207654_10335523 | 3300025911 | Bacteria | 1037 |
| 417 | Ga0207654_10526933 | 3300025911 | Bacteria | 837 |
| 418 | Ga0207707_10011138 | 3300025912 | Bacteria | 7822 |
| 419 | Ga0207707_10137111 | 3300025912 | Bacteria | 2139 |
| 420 | Ga0207695_10000261 | 3300025913 | Bacteria | 133038 |
| 421 | Ga0207695_10000654 | 3300025913 | Bacteria | 68735 |
| 422 | Ga0207695_10000907 | 3300025913 | Bacteria | 53347 |
| 423 | Ga0207695_10008059 | 3300025913 | Bacteria | 13262 |
| 424 | Ga0207695_10010391 | 3300025913 | Bacteria | 11391 |
| 425 | Ga0207695_10043582 | 3300025913 | Bacteria | 4782 |
| 426 | Ga0207695_10046136 | 3300025913 | Bacteria | 4620 |
| 427 | Ga0207695_10047480 | 3300025913 | Bacteria | 4544 |
| 428 | Ga0207695_10048652 | 3300025913 | Bacteria | 4476 |
| 429 | Ga0207695_10111216 | 3300025913 | Bacteria | 2718 |
| 430 | Ga0207695_10266207 | 3300025913 | Bacteria | 1610 |
| 431 | Ga0207695_10766180 | 3300025913 | Bacteria | 845 |
| 432 | Ga0207671_10000020 | 3300025914 | Bacteria | 309636 |
| 433 | Ga0207671_10000033 | 3300025914 | Bacteria | 245869 |
| 434 | Ga0207671_10000726 | 3300025914 | Bacteria | 41902 |
| 435 | Ga0207671_10010073 | 3300025914 | Bacteria | 7836 |
| 436 | Ga0207662_10255148 | 3300025918 | Bacteria | 1152 |
| 437 | Ga0207657_10031993 | 3300025919 | Bacteria | 4758 |
| 438 | Ga0207657_10082222 | 3300025919 | Bacteria | 2703 |
| 439 | Ga0207657_10207414 | 3300025919 | Bacteria | 1574 |
| 440 | Ga0207657_10689750 | 3300025919 | Bacteria | 794 |
| 441 | Ga0207649_10001485 | 3300025920 | Bacteria | 13767 |
| 442 | Ga0207649_10017022 | 3300025920 | Bacteria | 4114 |
| 443 | Ga0207649_10079824 | 3300025920 | Bacteria | 2115 |
| 444 | Ga0207649_10124865 | 3300025920 | Bacteria | 1740 |
| 445 | Ga0207649_10214274 | 3300025920 | Bacteria | 1368 |
| 446 | Ga0207649_10354522 | 3300025920 | Bacteria | 1087 |
| 447 | Ga0207649_10398768 | 3300025920 | Bacteria | 1029 |
| 448 | Ga0207649_10610356 | 3300025920 | Unclassified | 840 |
| 449 | Ga0207652_10166505 | 3300025921 | Bacteria | 1977 |
| 450 | Ga0207681_10114151 | 3300025923 | Bacteria | 1970 |
| 451 | Ga0207681_10239811 | 3300025923 | Bacteria | 1411 |
| 452 | Ga0207694_10006130 | 3300025924 | Bacteria | 9187 |
| 453 | Ga0207694_10017824 | 3300025924 | Bacteria | 5367 |
| 454 | Ga0207694_10271084 | 3300025924 | Bacteria | 1392 |
| 455 | Ga0207694_10362700 | 3300025924 | Bacteria | 1201 |
| 456 | Ga0207650_10020651 | 3300025925 | Bacteria | 4647 |
| 457 | Ga0207650_10352869 | 3300025925 | Bacteria | 1210 |
| 458 | Ga0207700_10003865 | 3300025928 | Bacteria | 8752 |
| 459 | Ga0207700_10024335 | 3300025928 | Bacteria | 4190 |
| 460 | Ga0207664_10000419 | 3300025929 | Bacteria | 30364 |
| 461 | Ga0207664_10022981 | 3300025929 | Bacteria | 4666 |
| 462 | Ga0207664_10138967 | 3300025929 | Bacteria | 2052 |
| 463 | Ga0207664_10822840 | 3300025929 | Bacteria | 835 |
| 464 | Ga0207644_10000833 | 3300025931 | Bacteria | 19607 |
| 465 | Ga0207644_10002832 | 3300025931 | Bacteria | 11181 |
| 466 | Ga0207690_10000314 | 3300025932 | Bacteria | 32801 |
| 467 | Ga0207690_10000797 | 3300025932 | Bacteria | 20327 |
| 468 | Ga0207690_10008204 | 3300025932 | Bacteria | 6196 |
| 469 | Ga0207690_10034749 | 3300025932 | Bacteria | 3250 |
| 470 | Ga0207690_10043020 | 3300025932 | Bacteria | 2970 |
| 471 | Ga0207690_10119941 | 3300025932 | Bacteria | 1909 |
| 472 | Ga0207690_10155955 | 3300025932 | Bacteria | 1697 |
| 473 | Ga0207690_10215986 | 3300025932 | Bacteria | 1465 |
| 474 | Ga0207690_10255072 | 3300025932 | Bacteria | 1357 |
| 475 | Ga0207690_10447939 | 3300025932 | Bacteria | 1037 |
| 476 | Ga0207706_10006757 | 3300025933 | Bacteria | 10606 |
| 477 | Ga0207706_10064116 | 3300025933 | Bacteria | 3235 |
| 478 | Ga0207706_10083461 | 3300025933 | Bacteria | 2809 |
| 479 | Ga0207706_10254836 | 3300025933 | Bacteria | 1532 |
| 480 | Ga0207709_10001731 | 3300025935 | Bacteria | 14693 |
| 481 | Ga0207709_10006989 | 3300025935 | Bacteria | 6307 |
| 482 | Ga0207670_10006401 | 3300025936 | Bacteria | 6526 |
| 483 | Ga0207669_10044209 | 3300025937 | Bacteria | 2615 |
| 484 | Ga0207669_10678038 | 3300025937 | Bacteria | 845 |
| 485 | Ga0207704_10128325 | 3300025938 | Bacteria | 1751 |
| 486 | Ga0207711_10070123 | 3300025941 | Bacteria | 3039 |
| 487 | Ga0207711_10135700 | 3300025941 | Bacteria | 2210 |
| 488 | Ga0207711_10636030 | 3300025941 | Bacteria | 995 |
| 489 | Ga0207689_10150058 | 3300025942 | Bacteria | 1921 |
| 490 | Ga0207689_10513710 | 3300025942 | Bacteria | 1004 |
| 491 | Ga0207661_10001403 | 3300025944 | Bacteria | 16228 |
| 492 | Ga0207667_10000130 | 3300025949 | Bacteria | 115321 |
| 493 | Ga0207667_10000169 | 3300025949 | Bacteria | 95977 |
| 494 | Ga0207667_10006239 | 3300025949 | Bacteria | 14468 |
| 495 | Ga0207667_10013015 | 3300025949 | Bacteria | 9550 |
| 496 | Ga0207667_10015306 | 3300025949 | Bacteria | 8721 |
| 497 | Ga0207667_10064596 | 3300025949 | Bacteria | 3820 |
| 498 | Ga0207667_10131954 | 3300025949 | Bacteria | 2573 |
| 499 | Ga0207667_10132801 | 3300025949 | Bacteria | 2564 |
| 500 | Ga0207667_10264973 | 3300025949 | Bacteria | 1757 |
| 501 | Ga0207667_10426315 | 3300025949 | Bacteria | 1349 |
| 502 | Ga0207651_10287750 | 3300025960 | Bacteria | 1361 |
| 503 | Ga0207651_10432056 | 3300025960 | Bacteria | 1126 |
| 504 | Ga0207712_10123710 | 3300025961 | Bacteria | 1961 |
| 505 | Ga0207668_10126656 | 3300025972 | Bacteria | 1943 |
| 506 | Ga0207668_10612466 | 3300025972 | Bacteria | 950 |
| 507 | Ga0207640_10000838 | 3300025981 | Bacteria | 17511 |
| 508 | Ga0207640_10000908 | 3300025981 | Bacteria | 16632 |
| 509 | Ga0207640_10001060 | 3300025981 | Bacteria | 15224 |
| 510 | Ga0207640_10104123 | 3300025981 | Bacteria | 1997 |
| 511 | Ga0207640_10237128 | 3300025981 | Bacteria | 1407 |
| 512 | Ga0207677_10062497 | 3300026023 | Bacteria | 2583 |
| 513 | Ga0207677_10354174 | 3300026023 | Bacteria | 1231 |
| 514 | Ga0207677_10371122 | 3300026023 | Bacteria | 1205 |
| 515 | Ga0207703_10076370 | 3300026035 | Bacteria | 2778 |
| 516 | Ga0207639_10001886 | 3300026041 | Bacteria | 14081 |
| 517 | Ga0207639_10033345 | 3300026041 | Bacteria | 3798 |
| 518 | Ga0207639_10118496 | 3300026041 | Bacteria | 2171 |
| 519 | Ga0207639_10306901 | 3300026041 | Bacteria | 1405 |
| 520 | Ga0207639_10316142 | 3300026041 | Bacteria | 1385 |
| 521 | Ga0207678_10004283 | 3300026067 | Bacteria | 12797 |
| 522 | Ga0207678_10009382 | 3300026067 | Bacteria | 8612 |
| 523 | Ga0207678_10012591 | 3300026067 | Bacteria | 7432 |
| 524 | Ga0207678_10071671 | 3300026067 | Bacteria | 2971 |
| 525 | Ga0207678_10077801 | 3300026067 | Bacteria | 2841 |
| 526 | Ga0207678_10246941 | 3300026067 | Bacteria | 1528 |
| 527 | Ga0207678_10250517 | 3300026067 | Bacteria | 1517 |
| 528 | Ga0207678_10261620 | 3300026067 | Bacteria | 1483 |
| 529 | Ga0207678_10467075 | 3300026067 | Bacteria | 1098 |
| 530 | Ga0207678_10608017 | 3300026067 | Bacteria | 959 |
| 531 | Ga0207702_10000456 | 3300026078 | Bacteria | 46149 |
| 532 | Ga0207702_10001809 | 3300026078 | Bacteria | 21033 |
| 533 | Ga0207702_10016985 | 3300026078 | Bacteria | 6022 |
| 534 | Ga0207702_10043331 | 3300026078 | Bacteria | 3778 |
| 535 | Ga0207702_10053697 | 3300026078 | Bacteria | 3412 |
| 536 | Ga0207702_10548603 | 3300026078 | Bacteria | 1130 |
| 537 | Ga0207641_10031254 | 3300026088 | Bacteria | 4416 |
| 538 | Ga0207641_10057113 | 3300026088 | Bacteria | 3319 |
| 539 | Ga0207641_10097631 | 3300026088 | Bacteria | 2582 |
| 540 | Ga0207641_11154779 | 3300026088 | Bacteria | 774 |
| 541 | Ga0207648_10407013 | 3300026089 | Bacteria | 1233 |
| 542 | Ga0207648_11017111 | 3300026089 | Bacteria | 776 |
| 543 | Ga0207676_10018047 | 3300026095 | Bacteria | 5122 |
| 544 | Ga0207676_10747026 | 3300026095 | Bacteria | 951 |
| 545 | Ga0207674_10000132 | 3300026116 | Bacteria | 87692 |
| 546 | Ga0207674_10000971 | 3300026116 | Bacteria | 37506 |
| 547 | Ga0207674_10021327 | 3300026116 | Bacteria | 6980 |
| 548 | Ga0207674_10039041 | 3300026116 | Bacteria | 4924 |
| 549 | Ga0207674_10047238 | 3300026116 | Bacteria | 4415 |
| 550 | Ga0207674_10264604 | 3300026116 | Bacteria | 1667 |
| 551 | Ga0207674_10605584 | 3300026116 | Bacteria | 1058 |
| 552 | Ga0207683_10677450 | 3300026121 | Bacteria | 956 |
| 553 | Ga0207698_10013331 | 3300026142 | Bacteria | 5418 |
| 554 | Ga0207698_10015885 | 3300026142 | Bacteria | 5059 |
| 555 | Ga0207698_10016173 | 3300026142 | Bacteria | 5020 |
| 556 | Ga0207698_10045800 | 3300026142 | Bacteria | 3298 |
| 557 | Ga0207698_10151618 | 3300026142 | Bacteria | 2013 |
| 558 | Ga0207698_10556360 | 3300026142 | Bacteria | 1125 |
| 559 | Ga0209973_1019921 | 3300027252 | Bacteria | 883 |
| 560 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 561 | Ga0209371_1000139 | 3300027312 | Bacteria | 120350 |
| 562 | Ga0209999_1008881 | 3300027543 | Bacteria | 1818 |
| 563 | Ga0209970_1011151 | 3300027614 | Bacteria | 1476 |
| 564 | Ga0209983_1005635 | 3300027665 | Bacteria | 2583 |
| 565 | Ga0209974_10010051 | 3300027876 | Bacteria | 3198 |
| 566 | Ga0268266_10000514 | 3300028379 | Bacteria | 54510 |
| 567 | Ga0268266_10774463 | 3300028379 | Bacteria | 926 |
| 568 | Ga0268265_10175325 | 3300028380 | Bacteria | 1837 |
| 569 | Ga0268265_10271456 | 3300028380 | Bacteria | 1513 |
| 570 | Ga0268265_11381258 | 3300028380 | Bacteria | 706 |
| 571 | Ga0268264_10032658 | 3300028381 | Bacteria | 4271 |
| 572 | Ga0268264_10046584 | 3300028381 | Bacteria | 3602 |
| 573 | Ga0268264_10180457 | 3300028381 | Bacteria | 1917 |
| 574 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 575 | Ga0268256_1000109 | 3300030500 | Bacteria | 120350 |
| 576 | Ga0316176_1166069 | 3300030732 | Bacteria | 962 |
| 577 | Ga0314311_1025340 | 3300030733 | Bacteria | 9144 |
| 578 | Ga0316178_1066114 | 3300030735 | Bacteria | 1651 |
| 579 | Ga0316183_1086976 | 3300030742 | Bacteria | 6685 |
| 580 | Ga0316181_1180556 | 3300030744 | Bacteria | 2478 |
| 581 | Ga0307408_100001207 | 3300031548 | Bacteria | 19481 |
| 582 | Ga0307408_100056195 | 3300031548 | Bacteria | 2854 |
| 583 | Ga0307408_100089274 | 3300031548 | Bacteria | 2323 |
| 584 | Ga0307408_100136374 | 3300031548 | Bacteria | 1921 |
| 585 | Ga0307408_100196370 | 3300031548 | Bacteria | 1630 |
| 586 | Ga0316579_10040992 | 3300031691 | Bacteria | 2149 |
| 587 | Ga0316576_10007734 | 3300031727 | Bacteria | 6783 |
| 588 | Ga0316576_10010970 | 3300031727 | Bacteria | 5909 |
| 589 | Ga0316576_10036293 | 3300031727 | Bacteria | 3524 |
| 590 | Ga0316576_10708104 | 3300031727 | Bacteria | 729 |
| 591 | Ga0316578_10006565 | 3300031728 | Bacteria | 5757 |
| 592 | Ga0307516_10162244 | 3300031730 | Bacteria | 1984 |
| 593 | Ga0307405_10009341 | 3300031731 | Bacteria | 5022 |
| 594 | Ga0307405_10036573 | 3300031731 | Bacteria | 2943 |
| 595 | Ga0307405_10224636 | 3300031731 | Bacteria | 1380 |
| 596 | Ga0316577_10105319 | 3300031733 | Bacteria | 1582 |
| 597 | Ga0307413_10026248 | 3300031824 | Bacteria | 3207 |
| 598 | Ga0307413_10044844 | 3300031824 | Bacteria | 2616 |
| 599 | Ga0307413_10177855 | 3300031824 | Bacteria | 1513 |
| 600 | Ga0307413_10503860 | 3300031824 | Bacteria | 973 |
| 601 | Ga0307413_10733133 | 3300031824 | Bacteria | 824 |
| 602 | Ga0307410_10002549 | 3300031852 | Bacteria | 8824 |
| 603 | Ga0307410_10010008 | 3300031852 | Bacteria | 5351 |
| 604 | Ga0307410_10026571 | 3300031852 | Bacteria | 3646 |
| 605 | Ga0307410_10944271 | 3300031852 | Bacteria | 741 |
| 606 | Ga0307406_10016843 | 3300031901 | Bacteria | 4252 |
| 607 | Ga0307406_10138571 | 3300031901 | Bacteria | 1719 |
| 608 | Ga0307406_10390814 | 3300031901 | Bacteria | 1100 |
| 609 | Ga0307406_10512447 | 3300031901 | Bacteria | 975 |
| 610 | Ga0307406_10524310 | 3300031901 | Bacteria | 965 |
| 611 | Ga0307407_10000195 | 3300031903 | Bacteria | 18328 |
| 612 | Ga0307407_10159425 | 3300031903 | Bacteria | 1475 |
| 613 | Ga0307412_10000548 | 3300031911 | Bacteria | 22392 |
| 614 | Ga0307412_10005980 | 3300031911 | Bacteria | 6853 |
| 615 | Ga0307412_10240330 | 3300031911 | Bacteria | 1400 |
| 616 | Ga0307412_10240820 | 3300031911 | Bacteria | 1399 |
| 617 | Ga0307412_10307364 | 3300031911 | Bacteria | 1256 |
| 618 | Ga0307409_100003317 | 3300031995 | Bacteria | 8701 |
| 619 | Ga0307409_100018175 | 3300031995 | Bacteria | 4714 |
| 620 | Ga0307409_100066180 | 3300031995 | Bacteria | 2848 |
| 621 | Ga0307409_100537009 | 3300031995 | Bacteria | 1145 |
| 622 | Ga0307409_100560622 | 3300031995 | Bacteria | 1123 |
| 623 | Ga0307416_100001750 | 3300032002 | Bacteria | 12019 |
| 624 | Ga0307416_100177034 | 3300032002 | Bacteria | 1994 |
| 625 | Ga0307414_10001053 | 3300032004 | Bacteria | 14103 |
| 626 | Ga0307414_10003789 | 3300032004 | Bacteria | 8126 |
| 627 | Ga0307414_10023949 | 3300032004 | Bacteria | 3883 |
| 628 | Ga0307414_10074267 | 3300032004 | Bacteria | 2463 |
| 629 | Ga0307414_10160897 | 3300032004 | Bacteria | 1783 |
| 630 | Ga0307414_10296325 | 3300032004 | Bacteria | 1366 |
| 631 | Ga0307414_10307317 | 3300032004 | Bacteria | 1344 |
| 632 | Ga0307414_10562854 | 3300032004 | Bacteria | 1017 |
| 633 | Ga0307414_10566378 | 3300032004 | Bacteria | 1014 |
| 634 | Ga0307414_10602496 | 3300032004 | Bacteria | 985 |
| 635 | Ga0307414_10978216 | 3300032004 | Bacteria | 778 |
| 636 | Ga0307411_10000206 | 3300032005 | Bacteria | 18997 |
| 637 | Ga0307411_10002634 | 3300032005 | Bacteria | 8032 |
| 638 | Ga0307411_10014544 | 3300032005 | Bacteria | 4384 |
| 639 | Ga0307411_10016389 | 3300032005 | Bacteria | 4193 |
| 640 | Ga0307411_10094833 | 3300032005 | Bacteria | 2093 |
| 641 | Ga0307411_10232904 | 3300032005 | Bacteria | 1437 |
| 642 | Ga0307411_10264160 | 3300032005 | Bacteria | 1361 |
| 643 | Ga0307411_10502491 | 3300032005 | Bacteria | 1025 |
| 644 | Ga0307411_10609503 | 3300032005 | Bacteria | 940 |
| 645 | Ga0307411_10702476 | 3300032005 | Bacteria | 881 |
| 646 | Ga0307415_100171924 | 3300032126 | Bacteria | 1691 |
| 647 | Ga0307415_100574187 | 3300032126 | Bacteria | 999 |
| 648 | Ga0307507_10000880 | 3300033179 | Bacteria | 66789 |
| 649 | Ga0373943_0410418 | 3300035170 | Bacteria | 783 |
| 650 | Ga0316574_0006768 | 3300035398 | Bacteria | 6227 |
| 651 | Ga0316574_0013668 | 3300035398 | Bacteria | 4672 |
| 652 | Ga0316574_0035290 | 3300035398 | Bacteria | 3055 |
| 653 | Ga0316574_0040143 | 3300035398 | Bacteria | 2880 |
| 654 | Ga0316574_0087546 | 3300035398 | Bacteria | 1983 |
| 655 | Ga0316574_0114224 | 3300035398 | Bacteria | 1732 |
| 656 | Ga0316574_0170516 | 3300035398 | Bacteria | 1401 |
| 657 | Ga0316574_0227671 | 3300035398 | Bacteria | 1193 |
| 658 | Ga0316574_0266986 | 3300035398 | Bacteria | 1092 |
| 659 | Ga0316574_0526489 | 3300035398 | Bacteria | 735 |
| 660 | Ga0316582_0108618 | 3300036647 | Bacteria | 1844 |
| 661 | Ga0316582_0130962 | 3300036647 | Bacteria | 1685 |
| 662 | Ga0316584_0391071 | 3300036712 | Bacteria | 992 |
| 663 | Ga0395899_0000184 | 3300037312 | Bacteria | 91815 |
| 664 | Ga0395899_0026186 | 3300037312 | Bacteria | 4401 |
| 665 | Ga0395899_0026471 | 3300037312 | Bacteria | 4377 |
| 666 | Ga0395899_0030102 | 3300037312 | Bacteria | 4084 |
| 667 | Ga0395899_0041528 | 3300037312 | Bacteria | 3437 |
| 668 | Ga0395899_0053971 | 3300037312 | Bacteria | 2975 |
| 669 | Ga0395899_0089521 | 3300037312 | Bacteria | 2232 |
| 670 | Ga0395899_0104800 | 3300037312 | Bacteria | 2038 |
| 671 | Ga0395899_0108198 | 3300037312 | Bacteria | 2000 |
| 672 | Ga0395899_0193216 | 3300037312 | Bacteria | 1423 |
| 673 | Ga0395899_0245317 | 3300037312 | Bacteria | 1231 |
| 674 | Ga0395899_0402416 | 3300037312 | Bacteria | 905 |
| 675 | Ga0395900_0000723 | 3300037418 | Bacteria | 43948 |
| 676 | Ga0395900_0003562 | 3300037418 | Bacteria | 16749 |
| 677 | Ga0395900_0015111 | 3300037418 | Bacteria | 7869 |
| 678 | Ga0395900_0015235 | 3300037418 | Bacteria | 7840 |
| 679 | Ga0395900_0015753 | 3300037418 | Bacteria | 7707 |
| 680 | Ga0395900_0016216 | 3300037418 | Bacteria | 7590 |
| 681 | Ga0395900_0018901 | 3300037418 | Bacteria | 7028 |
| 682 | Ga0395900_0023262 | 3300037418 | Bacteria | 6342 |
| 683 | Ga0395900_0023486 | 3300037418 | Bacteria | 6311 |
| 684 | Ga0395900_0032996 | 3300037418 | Bacteria | 5328 |
| 685 | Ga0395900_0034194 | 3300037418 | Bacteria | 5233 |
| 686 | Ga0395900_0034975 | 3300037418 | Bacteria | 5174 |
| 687 | Ga0395900_0048973 | 3300037418 | Bacteria | 4352 |
| 688 | Ga0395900_0116238 | 3300037418 | Bacteria | 2745 |
| 689 | Ga0395900_0152977 | 3300037418 | Bacteria | 2356 |
| 690 | Ga0395900_0180553 | 3300037418 | Bacteria | 2145 |
| 691 | Ga0395900_0195738 | 3300037418 | Bacteria | 2048 |
| 692 | Ga0395900_0225941 | 3300037418 | Bacteria | 1885 |
| 693 | Ga0395900_0283099 | 3300037418 | Bacteria | 1649 |
| 694 | Ga0395900_0367667 | 3300037418 | Bacteria | 1408 |
| 695 | Ga0395900_0371655 | 3300037418 | Bacteria | 1399 |
| 696 | Ga0395900_0394087 | 3300037418 | Bacteria | 1350 |
| 697 | Ga0395900_0426287 | 3300037418 | Bacteria | 1286 |
| 698 | Ga0395900_0510831 | 3300037418 | Bacteria | 1151 |
| 699 | Ga0395900_0673295 | 3300037418 | Unclassified | 970 |
| 700 | Ga0395898_0000087 | 3300037466 | Bacteria | 239211 |
| 701 | Ga0395898_0003277 | 3300037466 | Bacteria | 18196 |
| 702 | Ga0395898_0004020 | 3300037466 | Bacteria | 16164 |
| 703 | Ga0395898_0009646 | 3300037466 | Bacteria | 10135 |
| 704 | Ga0395898_0021149 | 3300037466 | Bacteria | 6599 |
| 705 | Ga0395898_0021259 | 3300037466 | Bacteria | 6581 |
| 706 | Ga0395898_0073821 | 3300037466 | Bacteria | 3295 |
| 707 | Ga0395898_0076450 | 3300037466 | Bacteria | 3233 |
| 708 | Ga0395898_0105564 | 3300037466 | Bacteria | 2701 |
| 709 | Ga0395898_0211881 | 3300037466 | Bacteria | 1848 |
| 710 | Ga0395898_0305517 | 3300037466 | Bacteria | 1517 |
| 711 | Ga0395898_0689979 | 3300037466 | Bacteria | 963 |
| 712 | Ga0395898_0730900 | 3300037466 | Bacteria | 931 |
| 713 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 714 | Ga0395905_0002000 | 3300037471 | Bacteria | 23293 |
| 715 | Ga0395905_0002910 | 3300037471 | Bacteria | 18678 |
| 716 | Ga0395905_0005131 | 3300037471 | Bacteria | 13445 |
| 717 | Ga0395905_0006920 | 3300037471 | Bacteria | 11334 |
| 718 | Ga0395905_0014364 | 3300037471 | Bacteria | 7565 |
| 719 | Ga0395905_0014911 | 3300037471 | Bacteria | 7414 |
| 720 | Ga0395905_0017740 | 3300037471 | Bacteria | 6758 |
| 721 | Ga0395905_0019323 | 3300037471 | Bacteria | 6460 |
| 722 | Ga0395905_0020118 | 3300037471 | Bacteria | 6324 |
| 723 | Ga0395905_0038867 | 3300037471 | Bacteria | 4464 |
| 724 | Ga0395905_0048848 | 3300037471 | Bacteria | 3964 |
| 725 | Ga0395905_0092920 | 3300037471 | Bacteria | 2829 |
| 726 | Ga0395905_0112028 | 3300037471 | Bacteria | 2562 |
| 727 | Ga0395905_0155998 | 3300037471 | Bacteria | 2147 |
| 728 | Ga0395905_0156703 | 3300037471 | Bacteria | 2142 |
| 729 | Ga0395905_0368606 | 3300037471 | Bacteria | 1329 |
| 730 | Ga0395901_0000280 | 3300038443 | Bacteria | 63153 |
| 731 | Ga0395901_0001808 | 3300038443 | Bacteria | 22093 |
| 732 | Ga0395901_0004038 | 3300038443 | Bacteria | 14781 |
| 733 | Ga0395901_0011865 | 3300038443 | Bacteria | 8835 |
| 734 | Ga0395901_0013263 | 3300038443 | Bacteria | 8369 |
| 735 | Ga0395901_0015235 | 3300038443 | Bacteria | 7823 |
| 736 | Ga0395901_0024583 | 3300038443 | Bacteria | 6185 |
| 737 | Ga0395901_0036907 | 3300038443 | Bacteria | 5053 |
| 738 | Ga0395901_0039387 | 3300038443 | Bacteria | 4890 |
| 739 | Ga0395901_0041573 | 3300038443 | Bacteria | 4765 |
| 740 | Ga0395901_0047175 | 3300038443 | Bacteria | 4473 |
| 741 | Ga0395901_0056242 | 3300038443 | Bacteria | 4092 |
| 742 | Ga0395901_0062101 | 3300038443 | Bacteria | 3888 |
| 743 | Ga0395901_0090198 | 3300038443 | Bacteria | 3208 |
| 744 | Ga0395901_0135655 | 3300038443 | Bacteria | 2587 |
| 745 | Ga0395901_0145796 | 3300038443 | Bacteria | 2488 |
| 746 | Ga0395901_0219532 | 3300038443 | Bacteria | 1987 |
| 747 | Ga0395901_0325934 | 3300038443 | Bacteria | 1589 |
| 748 | Ga0395901_0428574 | 3300038443 | Bacteria | 1355 |
| 749 | Ga0395901_0455686 | 3300038443 | Bacteria | 1307 |
| 750 | Ga0395901_0628422 | 3300038443 | Bacteria | 1080 |
| 751 | Ga0237819_00169 | 3300038705 | Bacteria | 24069 |
| 752 | Ga0436365_0505056 | 3300039437 | Bacteria | 7152 |
| 753 | Ga0436363_1707670 | 3300039450 | Bacteria | 2046 |
| 754 | Ga0439439_0130190 | 3300041406 | Bacteria | 706 |
| 755 | Ga0439465_0001563 | 3300041413 | Bacteria | 7448 |
| 756 | Ga0439465_0205265 | 3300041413 | Bacteria | 719 |
| 757 | Ga0451800_0005888 | 3300041459 | Bacteria | 2818 |
| 758 | Ga0451806_032754 | 3300041462 | Bacteria | 2478 |
| 759 | Ga0451837_0033562 | 3300041494 | Bacteria | 1395 |
| 760 | Ga0451837_0344179 | 3300041494 | Bacteria | 1634 |
| 761 | Ga0439437_018934 | 3300042000 | Bacteria | 825 |
| 762 | Ga0439445_0000014 | 3300042004 | Bacteria | 23823 |
| 763 | Ga0439448_0018099 | 3300042005 | Bacteria | 2156 |
| 764 | Ga0439448_0063189 | 3300042005 | Bacteria | 1226 |
| 765 | Ga0439432_028035 | 3300042006 | Bacteria | 1836 |
| 766 | Ga0439432_167382 | 3300042006 | Bacteria | 642 |
| 767 | Ga0439449_0000069 | 3300042007 | Bacteria | 32108 |
| 768 | Ga0439449_0003704 | 3300042007 | Bacteria | 5933 |
| 769 | Ga0450912_000246 | 3300042116 | Bacteria | 2368 |
| 770 | Ga0450920_009978 | 3300042122 | Bacteria | 1756 |
| 771 | Ga0439458_0000243 | 3300042157 | Bacteria | 13137 |
| 772 | Ga0439458_0007783 | 3300042157 | Bacteria | 2386 |
| 773 | Ga0439459_0002997 | 3300042438 | Bacteria | 2649 |
| 774 | Ga0466969_0000310 | 3300044656 | Bacteria | 26790 |
| 775 | Ga0466969_0055225 | 3300044656 | Bacteria | 1943 |
| 776 | Ga0466972_0008198 | 3300044658 | Bacteria | 5239 |
| 777 | Ga0466972_0036255 | 3300044658 | Bacteria | 2413 |
| 778 | Ga0466982_0000020 | 3300044672 | Bacteria | 99164 |
| 779 | Ga0466965_0077533 | 3300044683 | Bacteria | 1678 |
| 780 | Ga0466965_0078668 | 3300044683 | Bacteria | 1665 |
| 781 | Ga0466966_0000039 | 3300044684 | Bacteria | 97202 |
| 782 | Ga0466966_0000802 | 3300044684 | Bacteria | 19991 |
| 783 | Ga0466966_0001010 | 3300044684 | Bacteria | 17949 |
| 784 | Ga0466966_0008999 | 3300044684 | Bacteria | 6617 |
| 785 | Ga0466966_0039427 | 3300044684 | Bacteria | 3042 |
| 786 | Ga0466966_0045857 | 3300044684 | Bacteria | 2793 |
| 787 | Ga0466966_0050544 | 3300044684 | Bacteria | 2644 |
| 788 | Ga0466966_0368928 | 3300044684 | Bacteria | 862 |
| 789 | Ga0466961_0000332 | 3300044693 | Bacteria | 31109 |
| 790 | Ga0466961_0024458 | 3300044693 | Bacteria | 3885 |
| 791 | Ga0466961_0052657 | 3300044693 | Bacteria | 2598 |
| 792 | Ga0466961_0053178 | 3300044693 | Bacteria | 2584 |
| 793 | Ga0466961_0296031 | 3300044693 | Bacteria | 989 |
| 794 | Ga0466963_0450303 | 3300044694 | Bacteria | 908 |
| 795 | Ga0466964_0002553 | 3300044706 | Bacteria | 6491 |
| 796 | Ga0466964_0006390 | 3300044706 | Bacteria | 4393 |
| 797 | Ga0466971_0001750 | 3300044719 | Bacteria | 9205 |
| 798 | Ga0466971_0006606 | 3300044719 | Bacteria | 5042 |
| 799 | Ga0466971_0006892 | 3300044719 | Bacteria | 4938 |
| 800 | Ga0466971_0039618 | 3300044719 | Bacteria | 2114 |
| 801 | Ga0466971_0102646 | 3300044719 | Bacteria | 1315 |
| 802 | Ga0466968_0000227 | 3300044735 | Bacteria | 17595 |
| 803 | Ga0466968_0016306 | 3300044735 | Bacteria | 2956 |
| 804 | Ga0466968_0363235 | 3300044735 | Bacteria | 705 |
| 805 | Ga0466970_0000410 | 3300044765 | Bacteria | 20927 |
| 806 | Ga0466970_0000836 | 3300044765 | Bacteria | 14806 |
| 807 | Ga0466970_0019102 | 3300044765 | Bacteria | 3552 |
| 808 | Ga0466970_0020879 | 3300044765 | Bacteria | 3407 |
| 809 | Ga0466970_0024226 | 3300044765 | Bacteria | 3173 |
| 810 | Ga0466970_0060892 | 3300044765 | Unclassified | 2022 |
| 811 | Ga0466970_0522763 | 3300044765 | Bacteria | 684 |
| 812 | Ga0466970_0581900 | 3300044765 | Bacteria | 648 |
| 813 | Ga0466957_0006130 | 3300044842 | Bacteria | 6786 |
| 814 | Ga0466957_0088901 | 3300044842 | Bacteria | 1933 |
| 815 | Ga0466957_0233213 | 3300044842 | Bacteria | 1219 |
| 816 | Ga0466960_0034356 | 3300044901 | Bacteria | 2362 |
| 817 | Ga0466959_0000334 | 3300045049 | Bacteria | 27826 |
| 818 | Ga0466959_0008432 | 3300045049 | Bacteria | 7288 |
| 819 | Ga0466959_0039700 | 3300045049 | Bacteria | 3479 |
| 820 | Ga0466959_0042264 | 3300045049 | Bacteria | 3361 |
| 821 | Ga0466959_0099272 | 3300045049 | Bacteria | 2085 |
| 822 | Ga0466959_0172748 | 3300045049 | Unclassified | 1515 |
| 823 | Ga0466959_0178635 | 3300045049 | Unclassified | 1486 |
| 824 | Ga0466959_0493413 | 3300045049 | Bacteria | 828 |
| 825 | Ga0466958_0004354 | 3300045836 | Bacteria | 7468 |
| 826 | Ga0466958_0011059 | 3300045836 | Bacteria | 5073 |
| 827 | Ga0466958_0016632 | 3300045836 | Bacteria | 4239 |
| 828 | Ga0466958_0019140 | 3300045836 | Bacteria | 3982 |
| 829 | Ga0466958_0208934 | 3300045836 | Bacteria | 1243 |
| 830 | Ga0466958_0316658 | 3300045836 | Bacteria | 1002 |
| 831 | Ga0466967_0077687 | 3300045976 | Bacteria | 2989 |
| 832 | Ga0466967_0271783 | 3300045976 | Bacteria | 1624 |
| 833 | Ga0466967_0271814 | 3300045976 | Bacteria | 1624 |
| 834 | Ga0466967_0281394 | 3300045976 | Bacteria | 1596 |
| 835 | Ga0466967_0460225 | 3300045976 | Bacteria | 1244 |
| 836 | Ga0466967_0563575 | 3300045976 | Bacteria | 1122 |
| 837 | Ga0495627_017920 | 3300046453 | Bacteria | 2398 |
| 838 | Ga0495638_0000049 | 3300046460 | Bacteria | 206725 |
| 839 | Ga0495638_0000202 | 3300046460 | Bacteria | 84492 |
| 840 | Ga0495638_0000916 | 3300046460 | Bacteria | 30114 |
| 841 | Ga0495638_0027546 | 3300046460 | Bacteria | 3677 |
| 842 | Ga0495650_0001214 | 3300046471 | Bacteria | 27066 |
| 843 | Ga0495606_0001000 | 3300046507 | Bacteria | 41217 |
| 844 | Ga0495610_0049600 | 3300046512 | Bacteria | 2054 |
| 845 | Ga0495631_0034299 | 3300046518 | Bacteria | 2275 |
| 846 | Ga0495632_0130654 | 3300046519 | Bacteria | 1169 |
| 847 | Ga0495643_0000919 | 3300046522 | Bacteria | 30964 |
| 848 | Ga0495663_0002339 | 3300046525 | Bacteria | 5734 |
| 849 | Ga0495663_0006455 | 3300046525 | Bacteria | 3241 |
| 850 | Ga0495663_0013907 | 3300046525 | Bacteria | 2251 |
| 851 | Ga0495663_0044739 | 3300046525 | Bacteria | 1356 |
| 852 | Ga0495621_0000983 | 3300046539 | Bacteria | 7289 |
| 853 | Ga0495621_0020509 | 3300046539 | Bacteria | 2170 |
| 854 | Ga0495621_0065359 | 3300046539 | Bacteria | 1329 |
| 855 | Ga0495622_0023430 | 3300046557 | Bacteria | 2878 |
| 856 | Ga0495633_0011833 | 3300046558 | Bacteria | 4678 |
| 857 | Ga0495633_0046333 | 3300046558 | Bacteria | 2057 |
| 858 | Ga0495633_0174398 | 3300046558 | Bacteria | 990 |
| 859 | Ga0495633_0209316 | 3300046558 | Bacteria | 894 |
| 860 | Ga0495656_0002149 | 3300046615 | Bacteria | 6516 |
| 861 | Ga0495668_0084960 | 3300046616 | Bacteria | 1736 |
| 862 | Ga0495625_0048020 | 3300046660 | Bacteria | 3075 |
| 863 | Ga0495625_0120402 | 3300046660 | Bacteria | 1786 |
| 864 | Ga0495625_0125600 | 3300046660 | Bacteria | 1742 |
| 865 | Ga0495670_0011668 | 3300046691 | Bacteria | 4324 |
| 866 | Ga0495649_0000823 | 3300046694 | Bacteria | 24933 |
| 867 | Ga0495660_0106768 | 3300046810 | Bacteria | 1434 |
| 868 | Ga0495636_0006533 | 3300047318 | Bacteria | 4585 |
| 869 | Ga0495672_0000105 | 3300047320 | Bacteria | 133882 |
| 870 | Ga0495672_0158322 | 3300047320 | Bacteria | 1167 |
| 871 | Ga0495686_0008426 | 3300047472 | Bacteria | 7563 |
| 872 | Ga0495686_0015670 | 3300047472 | Bacteria | 5167 |
| 873 | Ga0496100_0167599 | 3300048903 | Bacteria | 1579 |
| 874 | Ga0496100_0229956 | 3300048903 | Bacteria | 1364 |
| 875 | Ga0496101_0048090 | 3300048904 | Bacteria | 3064 |
| 876 | Ga0496101_0177997 | 3300048904 | Bacteria | 1637 |
| 877 | Ga0496102_0034842 | 3300048905 | Bacteria | 4531 |
| 878 | Ga0496102_0859362 | 3300048905 | Bacteria | 829 |
| 879 | Ga0496103_0101135 | 3300048906 | Bacteria | 1824 |
| 880 | Ga0496104_0055648 | 3300048907 | Bacteria | 3741 |
| 881 | Ga0496104_0091848 | 3300048907 | Bacteria | 2902 |
| 882 | Ga0496104_0268192 | 3300048907 | Bacteria | 1619 |
| 883 | Ga0496104_0346063 | 3300048907 | Bacteria | 1399 |
| 884 | Ga0496105_0001964 | 3300048908 | Bacteria | 14781 |
| 885 | Ga0496105_0172208 | 3300048908 | Bacteria | 1774 |
| 886 | Ga0496106_0046723 | 3300048909 | Bacteria | 3256 |
| 887 | Ga0496107_0234325 | 3300048910 | Bacteria | 1366 |
| 888 | Ga0496107_0361177 | 3300048910 | Bacteria | 1080 |
| 889 | Ga0496107_0786771 | 3300048910 | Bacteria | 697 |
| 890 | Ga0496108_0148092 | 3300048911 | Bacteria | 2025 |
| 891 | Ga0496109_0136187 | 3300048912 | Bacteria | 2295 |
| 892 | Ga0496109_0267515 | 3300048912 | Bacteria | 1610 |
| 893 | Ga0496110_0188119 | 3300048913 | Bacteria | 1875 |
| 894 | Ga0496110_1025254 | 3300048913 | Bacteria | 733 |
| 895 | Ga0496111_0118009 | 3300048914 | Bacteria | 1958 |
| 896 | Ga0496111_0213700 | 3300048914 | Bacteria | 1433 |
| 897 | Ga0496113_0030099 | 3300048916 | Bacteria | 3927 |
| 898 | Ga0496113_0115447 | 3300048916 | Bacteria | 2094 |
| 899 | Ga0496114_0000594 | 3300048917 | Bacteria | 26726 |
| 900 | Ga0496114_0937283 | 3300048917 | Bacteria | 748 |
| 901 | Ga0496115_0000024 | 3300048918 | Bacteria | 154488 |
| 902 | Ga0496115_0000103 | 3300048918 | Bacteria | 80518 |
| 903 | Ga0496115_0002161 | 3300048918 | Bacteria | 14061 |
| 904 | Ga0496115_0002922 | 3300048918 | Bacteria | 12322 |
| 905 | Ga0496115_0011553 | 3300048918 | Bacteria | 6620 |
| 906 | Ga0496116_0000218 | 3300048919 | Bacteria | 107445 |
| 907 | Ga0496116_0013717 | 3300048919 | Bacteria | 6515 |
| 908 | Ga0496116_0032122 | 3300048919 | Bacteria | 3746 |
| 909 | Ga0496116_0076650 | 3300048919 | Bacteria | 2093 |
| 910 | Ga0496116_0113902 | 3300048919 | Bacteria | 1581 |
| 911 | Ga0496116_0213622 | 3300048919 | Bacteria | 997 |
| 912 | Ga0496117_0000314 | 3300048920 | Bacteria | 84712 |
| 913 | Ga0496117_0001191 | 3300048920 | Bacteria | 39121 |
| 914 | Ga0496117_0003149 | 3300048920 | Bacteria | 19675 |
| 915 | Ga0496117_0004544 | 3300048920 | Bacteria | 15213 |
| 916 | Ga0496117_0009737 | 3300048920 | Bacteria | 8868 |
| 917 | Ga0496117_0083137 | 3300048920 | Bacteria | 2094 |
| 918 | Ga0496117_0086255 | 3300048920 | Bacteria | 2040 |
| 919 | Ga0496117_0117784 | 3300048920 | Bacteria | 1638 |
| 920 | Ga0496117_0276306 | 3300048920 | Bacteria | 902 |
| 921 | Ga0496118_0000371 | 3300048921 | Bacteria | 75491 |
| 922 | Ga0496118_0002136 | 3300048921 | Bacteria | 27584 |
| 923 | Ga0496118_0002547 | 3300048921 | Bacteria | 24411 |
| 924 | Ga0496118_0006150 | 3300048921 | Bacteria | 13317 |
| 925 | Ga0496118_0006935 | 3300048921 | Bacteria | 12250 |
| 926 | Ga0496118_0012624 | 3300048921 | Bacteria | 8083 |
| 927 | Ga0496118_0021905 | 3300048921 | Bacteria | 5605 |
| 928 | Ga0496118_0033714 | 3300048921 | Bacteria | 4194 |
| 929 | Ga0496118_0117972 | 3300048921 | Bacteria | 1739 |
| 930 | Ga0496118_0127254 | 3300048921 | Bacteria | 1644 |
| 931 | Ga0496119_0000239 | 3300048922 | Bacteria | 77503 |
| 932 | Ga0496119_0001743 | 3300048922 | Bacteria | 25359 |
| 933 | Ga0496119_0002432 | 3300048922 | Bacteria | 20445 |
| 934 | Ga0496119_0002973 | 3300048922 | Bacteria | 18010 |
| 935 | Ga0496119_0054521 | 3300048922 | Bacteria | 2433 |
| 936 | Ga0496120_0000167 | 3300048923 | Bacteria | 110734 |
| 937 | Ga0496120_0000181 | 3300048923 | Bacteria | 107114 |
| 938 | Ga0496120_0000676 | 3300048923 | Bacteria | 50058 |
| 939 | Ga0496120_0000868 | 3300048923 | Bacteria | 42806 |
| 940 | Ga0496121_0000532 | 3300048924 | Bacteria | 72417 |
| 941 | Ga0496121_0004104 | 3300048924 | Bacteria | 19979 |
| 942 | Ga0496121_0016876 | 3300048924 | Bacteria | 7508 |
| 943 | Ga0496121_0028676 | 3300048924 | Bacteria | 5176 |
| 944 | Ga0496121_0039123 | 3300048924 | Bacteria | 4186 |
| 945 | Ga0496121_0042063 | 3300048924 | Bacteria | 3982 |
| 946 | Ga0496121_0046716 | 3300048924 | Bacteria | 3702 |
| 947 | Ga0496121_0175446 | 3300048924 | Bacteria | 1552 |
| 948 | Ga0496121_0209945 | 3300048924 | Bacteria | 1380 |
| 949 | Ga0496122_0000901 | 3300048925 | Bacteria | 54955 |
| 950 | Ga0496122_0001122 | 3300048925 | Bacteria | 46123 |
| 951 | Ga0496122_0012066 | 3300048925 | Bacteria | 8660 |
| 952 | Ga0496122_0021920 | 3300048925 | Bacteria | 5696 |
| 953 | Ga0496122_0102293 | 3300048925 | Bacteria | 1910 |
| 954 | Ga0496122_0185702 | 3300048925 | Bacteria | 1233 |
| 955 | Ga0496122_0262235 | 3300048925 | Bacteria | 958 |
| 956 | Ga0496123_0000727 | 3300048926 | Bacteria | 53518 |
| 957 | Ga0496123_0000920 | 3300048926 | Bacteria | 46126 |
| 958 | Ga0496123_0002564 | 3300048926 | Bacteria | 22119 |
| 959 | Ga0496123_0005759 | 3300048926 | Bacteria | 12328 |
| 960 | Ga0496123_0010634 | 3300048926 | Bacteria | 8097 |
| 961 | Ga0496123_0042551 | 3300048926 | Bacteria | 3133 |
| 962 | Ga0496123_0046388 | 3300048926 | Bacteria | 2948 |
| 963 | Ga0496123_0318995 | 3300048926 | Bacteria | 734 |
| 964 | Ga0496124_0001061 | 3300048927 | Bacteria | 43394 |
| 965 | Ga0496124_0001652 | 3300048927 | Bacteria | 31905 |
| 966 | Ga0496124_0005126 | 3300048927 | Bacteria | 14915 |
| 967 | Ga0496124_0006193 | 3300048927 | Bacteria | 13112 |
| 968 | Ga0496124_0009321 | 3300048927 | Bacteria | 10115 |
| 969 | Ga0496124_0019095 | 3300048927 | Bacteria | 6397 |
| 970 | Ga0496124_0021047 | 3300048927 | Bacteria | 6015 |
| 971 | Ga0496124_0058646 | 3300048927 | Bacteria | 3236 |
| 972 | Ga0496124_0239956 | 3300048927 | Bacteria | 1348 |
| 973 | Ga0496124_0335034 | 3300048927 | Bacteria | 1077 |
| 974 | Ga0496125_0000320 | 3300048928 | Bacteria | 93682 |
| 975 | Ga0496125_0000344 | 3300048928 | Bacteria | 88380 |
| 976 | Ga0496125_0005964 | 3300048928 | Bacteria | 13336 |
| 977 | Ga0496125_0025180 | 3300048928 | Bacteria | 5455 |
| 978 | Ga0496125_0121582 | 3300048928 | Bacteria | 1861 |
| 979 | Ga0496125_0131233 | 3300048928 | Bacteria | 1763 |
| 980 | Ga0496125_0268578 | 3300048928 | Bacteria | 1064 |
| 981 | Ga0496126_0000581 | 3300048929 | Bacteria | 69541 |
| 982 | Ga0496126_0001014 | 3300048929 | Bacteria | 47842 |
| 983 | Ga0496126_0007111 | 3300048929 | Bacteria | 12330 |
| 984 | Ga0496126_0123760 | 3300048929 | Bacteria | 2240 |
| 985 | Ga0496126_0191593 | 3300048929 | Bacteria | 1731 |
| 986 | Ga0496126_0206619 | 3300048929 | Bacteria | 1655 |
| 987 | Ga0496126_0588425 | 3300048929 | Bacteria | 878 |
| 988 | Ga0495678_037387 | 3300049459 | Bacteria | 1973 |
| 989 | Ga0495682_0017233 | 3300049460 | Bacteria | 2729 |
| 990 | Ga0501031_0020584 | 3300049568 | Bacteria | 4301 |
| 991 | Ga0501031_0107743 | 3300049568 | Bacteria | 1819 |
| 992 | Ga0501031_0150963 | 3300049568 | Bacteria | 1518 |
| 993 | Ga0501032_0014188 | 3300049569 | Bacteria | 5645 |
| 994 | Ga0501032_0114080 | 3300049569 | Bacteria | 1787 |
| 995 | Ga0501032_0178721 | 3300049569 | Bacteria | 1390 |
| 996 | Ga0501033_0001868 | 3300049570 | Bacteria | 18315 |
| 997 | Ga0501033_0002545 | 3300049570 | Bacteria | 15427 |
| 998 | Ga0501033_0090785 | 3300049570 | Bacteria | 2234 |
| 999 | Ga0501033_0199045 | 3300049570 | Bacteria | 1431 |
| 1000 | Ga0501033_0523668 | 3300049570 | Bacteria | 819 |
| 1001 | Ga0501034_0001977 | 3300049571 | Bacteria | 25973 |
| 1002 | Ga0501034_0007048 | 3300049571 | Bacteria | 11989 |
| 1003 | Ga0501034_0028239 | 3300049571 | Bacteria | 5708 |
| 1004 | Ga0501034_0103298 | 3300049571 | Bacteria | 2843 |
| 1005 | Ga0501034_0143066 | 3300049571 | Bacteria | 2370 |
| 1006 | Ga0501034_0192995 | 3300049571 | Bacteria | 1998 |
| 1007 | Ga0501034_0343555 | 3300049571 | Bacteria | 1422 |
| 1008 | Ga0501034_0635658 | 3300049571 | Bacteria | 970 |
| 1009 | Ga0501036_0095765 | 3300049572 | Bacteria | 2509 |
| 1010 | Ga0501036_0111278 | 3300049572 | Bacteria | 2314 |
| 1011 | Ga0501037_0015245 | 3300049573 | Bacteria | 5654 |
| 1012 | Ga0501037_0041434 | 3300049573 | Bacteria | 3386 |
| 1013 | Ga0501038_0066603 | 3300049574 | Bacteria | 3066 |
| 1014 | Ga0501038_0119491 | 3300049574 | Bacteria | 2175 |
| 1015 | Ga0501039_0362605 | 3300049575 | Bacteria | 1138 |
| 1016 | Ga0501039_0605447 | 3300049575 | Bacteria | 859 |
| 1017 | Ga0501043_0128950 | 3300049579 | Bacteria | 1982 |
| 1018 | Ga0501043_0185757 | 3300049579 | Bacteria | 1618 |
| 1019 | Ga0501043_0386785 | 3300049579 | Bacteria | 1058 |
| 1020 | Ga0501046_0025262 | 3300049580 | Bacteria | 4862 |
| 1021 | Ga0501046_0091874 | 3300049580 | Bacteria | 2334 |
| 1022 | Ga0501046_0103124 | 3300049580 | Bacteria | 2187 |
| 1023 | Ga0501047_0003603 | 3300049581 | Bacteria | 14602 |
| 1024 | Ga0501047_0011089 | 3300049581 | Bacteria | 8529 |
| 1025 | Ga0501047_0031361 | 3300049581 | Bacteria | 5126 |
| 1026 | Ga0501047_0101772 | 3300049581 | Bacteria | 2752 |
| 1027 | Ga0501048_0078848 | 3300049582 | Bacteria | 2324 |
| 1028 | Ga0501069_0011564 | 3300049585 | Bacteria | 4678 |
| 1029 | Ga0501069_0048655 | 3300049585 | Bacteria | 2355 |
| 1030 | Ga0501070_0000587 | 3300049586 | Bacteria | 33165 |
| 1031 | Ga0501070_0020482 | 3300049586 | Bacteria | 5547 |
| 1032 | Ga0501070_0358320 | 3300049586 | Bacteria | 1183 |
| 1033 | Ga0501073_0188926 | 3300049589 | Bacteria | 1425 |
| 1034 | Ga0501077_0277500 | 3300049593 | Bacteria | 1066 |
| 1035 | Ga0501216_011253 | 3300049660 | Bacteria | 1451 |
| 1036 | Ga0501249_043326 | 3300049679 | Bacteria | 1024 |
| 1037 | Ga0501259_027992 | 3300049688 | Bacteria | 1047 |
| 1038 | Ga0501080_0038483 | 3300049742 | Bacteria | 4465 |
| 1039 | Ga0501272_008281 | 3300049769 | Bacteria | 1139 |
| 1040 | Ga0501275_000447 | 3300049772 | Bacteria | 4640 |
| 1041 | Ga0501035_0005912 | 3300049822 | Bacteria | 11521 |
| 1042 | Ga0501035_0017043 | 3300049822 | Bacteria | 6694 |
| 1043 | Ga0501035_0023420 | 3300049822 | Bacteria | 5664 |
| 1044 | Ga0501035_0070003 | 3300049822 | Bacteria | 3108 |
| 1045 | Ga0501035_0097596 | 3300049822 | Bacteria | 2580 |
| 1046 | Ga0501035_0499810 | 3300049822 | Bacteria | 1001 |
| 1047 | Ga0501044_0020827 | 3300049823 | Bacteria | 6999 |
| 1048 | Ga0501044_0025356 | 3300049823 | Bacteria | 6284 |
| 1049 | Ga0501044_0042471 | 3300049823 | Bacteria | 4728 |
| 1050 | Ga0501044_0213400 | 3300049823 | Bacteria | 1883 |
| 1051 | Ga0501044_0345473 | 3300049823 | Bacteria | 1408 |
| 1052 | Ga0501044_0601604 | 3300049823 | Bacteria | 993 |
| 1053 | nmdc:mga00v17_20876_c1 | 3300050491 | Bacteria | 3758 |
| 1054 | nmdc:mga00v17_729_c2 | 3300050491 | Bacteria | 11208 |
| 1055 | nmdc:mga0yw44_137900_c1 | 3300050492 | Bacteria | 1583 |
| 1056 | nmdc:mga06z11_426937_c1 | 3300050494 | Bacteria | 799 |
| 1057 | nmdc:mga05p37_678987_c1 | 3300050507 | Bacteria | 1148 |
| 1058 | nmdc:mga08y16_479171_c1 | 3300050511 | Bacteria | 1266 |
| 1059 | nmdc:mga08y16_512095_c1 | 3300050511 | Bacteria | 1218 |
| 1060 | nmdc:mga0n895_1019311_c1 | 3300050512 | Bacteria | 808 |
| 1061 | Ga0500626_053803 | 3300053128 | Bacteria | 1808 |
| 1062 | Ga0500658_0196854 | 3300053134 | Bacteria | 921 |
| 1063 | Ga0500568_0004359 | 3300053139 | Bacteria | 7574 |
| 1064 | Ga0500604_0000002 | 3300053151 | Bacteria | 165603 |
| 1065 | Ga0500616_0000238 | 3300053153 | Bacteria | 86573 |
| 1066 | Ga0500634_0000322 | 3300053161 | Bacteria | 15273 |
| 1067 | Ga0500565_020439 | 3300053734 | Bacteria | 791 |
| 1068 | Ga0466962_0000083 | 3300061719 | Bacteria | 38031 |
| 1069 | Ga0466962_0003389 | 3300061719 | Bacteria | 7588 |
| 1070 | Ga0466962_0004622 | 3300061719 | Bacteria | 6610 |
| 1071 | Ga0466962_0066683 | 3300061719 | Unclassified | 1718 |
| 1072 | Ga0466962_0131145 | 3300061719 | Unclassified | 1211 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049769 | Ga0501272_008281 | Ga0501272_008281_367_945 | 181 |
| 2 | 3300037418 | Ga0395900_0225941 | Ga0395900_0225941_505_1080 | 189 |
| 3 | 3300037471 | Ga0395905_0020118 | Ga0395905_0020118_5334_5909 | 189 |
| 4 | 3300001904 | JGI24736J21556_1000339 | JGI24736J21556_10003397 | 190 |
| 5 | 3300003323 | rootH1_10103103 | rootH1_101031032 | 190 |
| 6 | 3300005327 | Ga0070658_10097525 | Ga0070658_100975252 | 190 |
| 7 | 3300005327 | Ga0070658_10212515 | Ga0070658_102125153 | 190 |
| 8 | 3300005327 | Ga0070658_10343262 | Ga0070658_103432622 | 190 |
| 9 | 3300005327 | Ga0070658_10371877 | Ga0070658_103718771 | 190 |
| 10 | 3300005328 | Ga0070676_10257509 | Ga0070676_102575092 | 190 |
| 11 | 3300005335 | Ga0070666_10254484 | Ga0070666_102544842 | 190 |
| 12 | 3300005339 | Ga0070660_100019590 | Ga0070660_1000195902 | 190 |
| 13 | 3300005339 | Ga0070660_101054913 | Ga0070660_1010549131 | 190 |
| 14 | 3300005344 | Ga0070661_100037021 | Ga0070661_1000370213 | 190 |
| 15 | 3300005344 | Ga0070661_100084639 | Ga0070661_1000846393 | 190 |
| 16 | 3300005345 | Ga0070692_10215947 | Ga0070692_102159472 | 190 |
| 17 | 3300005354 | Ga0070675_100119317 | Ga0070675_1001193172 | 190 |
| 18 | 3300005355 | Ga0070671_100013860 | Ga0070671_1000138607 | 190 |
| 19 | 3300005366 | Ga0070659_100034565 | Ga0070659_1000345653 | 190 |
| 20 | 3300005366 | Ga0070659_100362442 | Ga0070659_1003624422 | 190 |
| 21 | 3300005435 | Ga0070714_100164743 | Ga0070714_1001647432 | 190 |
| 22 | 3300005435 | Ga0070714_100241691 | Ga0070714_1002416912 | 190 |
| 23 | 3300005435 | Ga0070714_100304389 | Ga0070714_1003043892 | 190 |
| 24 | 3300005436 | Ga0070713_100014588 | Ga0070713_1000145886 | 190 |
| 25 | 3300005455 | Ga0070663_100093093 | Ga0070663_1000930933 | 190 |
| 26 | 3300005455 | Ga0070663_100186336 | Ga0070663_1001863362 | 190 |
| 27 | 3300005455 | Ga0070663_100312998 | Ga0070663_1003129982 | 190 |
| 28 | 3300005455 | Ga0070663_100428567 | Ga0070663_1004285671 | 190 |
| 29 | 3300005457 | Ga0070662_100127321 | Ga0070662_1001273213 | 190 |
| 30 | 3300005457 | Ga0070662_100208443 | Ga0070662_1002084433 | 190 |
| 31 | 3300005539 | Ga0068853_100161588 | Ga0068853_1001615883 | 190 |
| 32 | 3300005548 | Ga0070665_100499008 | Ga0070665_1004990082 | 190 |
| 33 | 3300005563 | Ga0068855_100082253 | Ga0068855_1000822533 | 190 |
| 34 | 3300005563 | Ga0068855_100092531 | Ga0068855_1000925312 | 190 |
| 35 | 3300005563 | Ga0068855_100399958 | Ga0068855_1003999582 | 190 |
| 36 | 3300005577 | Ga0068857_100380365 | Ga0068857_1003803652 | 190 |
| 37 | 3300005578 | Ga0068854_100027013 | Ga0068854_1000270132 | 190 |
| 38 | 3300005578 | Ga0068854_100063684 | Ga0068854_1000636842 | 190 |
| 39 | 3300005614 | Ga0068856_100008083 | Ga0068856_1000080835 | 190 |
| 40 | 3300005614 | Ga0068856_100923512 | Ga0068856_1009235122 | 190 |
| 41 | 3300005616 | Ga0068852_100003835 | Ga0068852_1000038359 | 190 |
| 42 | 3300005616 | Ga0068852_100105743 | Ga0068852_1001057432 | 190 |
| 43 | 3300005616 | Ga0068852_100453352 | Ga0068852_1004533522 | 190 |
| 44 | 3300005618 | Ga0068864_100028252 | Ga0068864_1000282523 | 190 |
| 45 | 3300005841 | Ga0068863_100156943 | Ga0068863_1001569433 | 190 |
| 46 | 3300005841 | Ga0068863_101395398 | Ga0068863_1013953981 | 190 |
| 47 | 3300006237 | Ga0097621_100107133 | Ga0097621_1001071332 | 190 |
| 48 | 3300006358 | Ga0068871_100027620 | Ga0068871_1000276202 | 190 |
| 49 | 3300006844 | Ga0075428_100836136 | Ga0075428_1008361362 | 190 |
| 50 | 3300006881 | Ga0068865_100491865 | Ga0068865_1004918652 | 190 |
| 51 | 3300009093 | Ga0105240_10009039 | Ga0105240_100090399 | 190 |
| 52 | 3300009093 | Ga0105240_10172954 | Ga0105240_101729542 | 190 |
| 53 | 3300009093 | Ga0105240_10977755 | Ga0105240_109777552 | 190 |
| 54 | 3300009177 | Ga0105248_10183860 | Ga0105248_101838602 | 190 |
| 55 | 3300009177 | Ga0105248_10686207 | Ga0105248_106862072 | 190 |
| 56 | 3300010375 | Ga0105239_10636726 | Ga0105239_106367262 | 190 |
| 57 | 3300013100 | Ga0157373_10044297 | Ga0157373_100442972 | 190 |
| 58 | 3300013100 | Ga0157373_10075101 | Ga0157373_100751012 | 190 |
| 59 | 3300013100 | Ga0157373_10462764 | Ga0157373_104627642 | 190 |
| 60 | 3300013102 | Ga0157371_10005924 | Ga0157371_100059245 | 190 |
| 61 | 3300013102 | Ga0157371_10049262 | Ga0157371_100492622 | 190 |
| 62 | 3300013102 | Ga0157371_10741917 | Ga0157371_107419172 | 190 |
| 63 | 3300013104 | Ga0157370_10000707 | Ga0157370_1000070735 | 190 |
| 64 | 3300013104 | Ga0157370_10104116 | Ga0157370_101041164 | 190 |
| 65 | 3300013104 | Ga0157370_10177749 | Ga0157370_101777492 | 190 |
| 66 | 3300013104 | Ga0157370_10289114 | Ga0157370_102891142 | 190 |
| 67 | 3300013105 | Ga0157369_10000239 | Ga0157369_1000023932 | 190 |
| 68 | 3300013105 | Ga0157369_10026692 | Ga0157369_100266928 | 190 |
| 69 | 3300013105 | Ga0157369_10076617 | Ga0157369_100766172 | 190 |
| 70 | 3300013105 | Ga0157369_10095626 | Ga0157369_100956265 | 190 |
| 71 | 3300013105 | Ga0157369_10128439 | Ga0157369_101284392 | 190 |
| 72 | 3300013105 | Ga0157369_10690381 | Ga0157369_106903812 | 190 |
| 73 | 3300013296 | Ga0157374_10010711 | Ga0157374_100107116 | 190 |
| 74 | 3300013297 | Ga0157378_10673704 | Ga0157378_106737042 | 190 |
| 75 | 3300013307 | Ga0157372_10382008 | Ga0157372_103820082 | 190 |
| 76 | 3300013307 | Ga0157372_11018677 | Ga0157372_110186771 | 190 |
| 77 | 3300013308 | Ga0157375_11021767 | Ga0157375_110217672 | 190 |
| 78 | 3300014325 | Ga0163163_10840434 | Ga0163163_108404342 | 190 |
| 79 | 3300025904 | Ga0207647_10007732 | Ga0207647_100077323 | 190 |
| 80 | 3300025904 | Ga0207647_10037022 | Ga0207647_100370223 | 190 |
| 81 | 3300025904 | Ga0207647_10110117 | Ga0207647_101101172 | 190 |
| 82 | 3300025909 | Ga0207705_10000003 | Ga0207705_10000003611 | 190 |
| 83 | 3300025909 | Ga0207705_10038222 | Ga0207705_100382222 | 190 |
| 84 | 3300025909 | Ga0207705_10040692 | Ga0207705_100406922 | 190 |
| 85 | 3300025909 | Ga0207705_10183601 | Ga0207705_101836012 | 190 |
| 86 | 3300025913 | Ga0207695_10010391 | Ga0207695_100103916 | 190 |
| 87 | 3300025913 | Ga0207695_10043582 | Ga0207695_100435822 | 190 |
| 88 | 3300025913 | Ga0207695_10766180 | Ga0207695_107661801 | 190 |
| 89 | 3300025919 | Ga0207657_10207414 | Ga0207657_102074142 | 190 |
| 90 | 3300025920 | Ga0207649_10001485 | Ga0207649_100014858 | 190 |
| 91 | 3300025920 | Ga0207649_10017022 | Ga0207649_100170225 | 190 |
| 92 | 3300025920 | Ga0207649_10610356 | Ga0207649_106103562 | 190 |
| 93 | 3300025925 | Ga0207650_10352869 | Ga0207650_103528692 | 190 |
| 94 | 3300025928 | Ga0207700_10024335 | Ga0207700_100243354 | 190 |
| 95 | 3300025929 | Ga0207664_10822840 | Ga0207664_108228402 | 190 |
| 96 | 3300025931 | Ga0207644_10000833 | Ga0207644_100008337 | 190 |
| 97 | 3300025931 | Ga0207644_10002832 | Ga0207644_100028322 | 190 |
| 98 | 3300025932 | Ga0207690_10034749 | Ga0207690_100347493 | 190 |
| 99 | 3300025932 | Ga0207690_10255072 | Ga0207690_102550722 | 190 |
| 100 | 3300025933 | Ga0207706_10083461 | Ga0207706_100834614 | 190 |
| 101 | 3300025933 | Ga0207706_10254836 | Ga0207706_102548362 | 190 |
| 102 | 3300025941 | Ga0207711_10070123 | Ga0207711_100701233 | 190 |
| 103 | 3300025941 | Ga0207711_10636030 | Ga0207711_106360302 | 190 |
| 104 | 3300025949 | Ga0207667_10013015 | Ga0207667_100130158 | 190 |
| 105 | 3300025949 | Ga0207667_10015306 | Ga0207667_100153067 | 190 |
| 106 | 3300025949 | Ga0207667_10064596 | Ga0207667_100645963 | 190 |
| 107 | 3300025949 | Ga0207667_10131954 | Ga0207667_101319542 | 190 |
| 108 | 3300025949 | Ga0207667_10132801 | Ga0207667_101328012 | 190 |
| 109 | 3300025960 | Ga0207651_10287750 | Ga0207651_102877502 | 190 |
| 110 | 3300025981 | Ga0207640_10000838 | Ga0207640_100008384 | 190 |
| 111 | 3300026023 | Ga0207677_10371122 | Ga0207677_103711222 | 190 |
| 112 | 3300026041 | Ga0207639_10316142 | Ga0207639_103161422 | 190 |
| 113 | 3300026067 | Ga0207678_10004283 | Ga0207678_100042838 | 190 |
| 114 | 3300026067 | Ga0207678_10012591 | Ga0207678_100125917 | 190 |
| 115 | 3300026067 | Ga0207678_10077801 | Ga0207678_100778012 | 190 |
| 116 | 3300026067 | Ga0207678_10250517 | Ga0207678_102505172 | 190 |
| 117 | 3300026067 | Ga0207678_10467075 | Ga0207678_104670752 | 190 |
| 118 | 3300026067 | Ga0207678_10608017 | Ga0207678_106080172 | 190 |
| 119 | 3300026078 | Ga0207702_10016985 | Ga0207702_100169856 | 190 |
| 120 | 3300026078 | Ga0207702_10043331 | Ga0207702_100433315 | 190 |
| 121 | 3300026078 | Ga0207702_10053697 | Ga0207702_100536975 | 190 |
| 122 | 3300026078 | Ga0207702_10548603 | Ga0207702_105486032 | 190 |
| 123 | 3300026088 | Ga0207641_10057113 | Ga0207641_100571133 | 190 |
| 124 | 3300026095 | Ga0207676_10018047 | Ga0207676_100180472 | 190 |
| 125 | 3300026142 | Ga0207698_10015885 | Ga0207698_100158854 | 190 |
| 126 | 3300026142 | Ga0207698_10045800 | Ga0207698_100458003 | 190 |
| 127 | 3300026142 | Ga0207698_10556360 | Ga0207698_105563602 | 190 |
| 128 | 3300028379 | Ga0268266_10774463 | Ga0268266_107744632 | 190 |
| 129 | 3300031548 | Ga0307408_100001207 | Ga0307408_10000120717 | 190 |
| 130 | 3300031548 | Ga0307408_100056195 | Ga0307408_1000561952 | 190 |
| 131 | 3300031548 | Ga0307408_100089274 | Ga0307408_1000892742 | 190 |
| 132 | 3300031731 | Ga0307405_10009341 | Ga0307405_100093415 | 190 |
| 133 | 3300031731 | Ga0307405_10036573 | Ga0307405_100365733 | 190 |
| 134 | 3300031824 | Ga0307413_10026248 | Ga0307413_100262483 | 190 |
| 135 | 3300031824 | Ga0307413_10044844 | Ga0307413_100448443 | 190 |
| 136 | 3300031824 | Ga0307413_10177855 | Ga0307413_101778553 | 190 |
| 137 | 3300031852 | Ga0307410_10002549 | Ga0307410_100025492 | 190 |
| 138 | 3300031852 | Ga0307410_10010008 | Ga0307410_100100083 | 190 |
| 139 | 3300031852 | Ga0307410_10026571 | Ga0307410_100265712 | 190 |
| 140 | 3300031852 | Ga0307410_10944271 | Ga0307410_109442712 | 190 |
| 141 | 3300031901 | Ga0307406_10016843 | Ga0307406_100168435 | 190 |
| 142 | 3300031901 | Ga0307406_10138571 | Ga0307406_101385712 | 190 |
| 143 | 3300031901 | Ga0307406_10512447 | Ga0307406_105124472 | 190 |
| 144 | 3300031903 | Ga0307407_10000195 | Ga0307407_100001957 | 190 |
| 145 | 3300031903 | Ga0307407_10159425 | Ga0307407_101594252 | 190 |
| 146 | 3300031911 | Ga0307412_10005980 | Ga0307412_100059803 | 190 |
| 147 | 3300031911 | Ga0307412_10240330 | Ga0307412_102403302 | 190 |
| 148 | 3300031995 | Ga0307409_100003317 | Ga0307409_1000033174 | 190 |
| 149 | 3300031995 | Ga0307409_100018175 | Ga0307409_1000181752 | 190 |
| 150 | 3300031995 | Ga0307409_100066180 | Ga0307409_1000661802 | 190 |
| 151 | 3300031995 | Ga0307409_100560622 | Ga0307409_1005606222 | 190 |
| 152 | 3300032002 | Ga0307416_100001750 | Ga0307416_1000017505 | 190 |
| 153 | 3300032002 | Ga0307416_100177034 | Ga0307416_1001770342 | 190 |
| 154 | 3300032004 | Ga0307414_10001053 | Ga0307414_1000105312 | 190 |
| 155 | 3300032004 | Ga0307414_10003789 | Ga0307414_100037896 | 190 |
| 156 | 3300032004 | Ga0307414_10160897 | Ga0307414_101608972 | 190 |
| 157 | 3300032005 | Ga0307411_10000206 | Ga0307411_100002065 | 190 |
| 158 | 3300032005 | Ga0307411_10002634 | Ga0307411_100026348 | 190 |
| 159 | 3300032005 | Ga0307411_10016389 | Ga0307411_100163892 | 190 |
| 160 | 3300032005 | Ga0307411_10094833 | Ga0307411_100948333 | 190 |
| 161 | 3300032005 | Ga0307411_10264160 | Ga0307411_102641601 | 190 |
| 162 | 3300032005 | Ga0307411_10702476 | Ga0307411_107024762 | 190 |
| 163 | 3300032126 | Ga0307415_100574187 | Ga0307415_1005741872 | 190 |
| 164 | 3300035170 | Ga0373943_0410418 | Ga0373943_0410418_124_702 | 190 |
| 165 | 3300037312 | Ga0395899_0000184 | Ga0395899_0000184_66487_67065 | 190 |
| 166 | 3300037312 | Ga0395899_0026186 | Ga0395899_0026186_3512_4090 | 190 |
| 167 | 3300037312 | Ga0395899_0026471 | Ga0395899_0026471_766_1344 | 190 |
| 168 | 3300037312 | Ga0395899_0030102 | Ga0395899_0030102_2213_2791 | 190 |
| 169 | 3300037312 | Ga0395899_0041528 | Ga0395899_0041528_170_748 | 190 |
| 170 | 3300037312 | Ga0395899_0053971 | Ga0395899_0053971_80_658 | 190 |
| 171 | 3300037312 | Ga0395899_0089521 | Ga0395899_0089521_996_1574 | 190 |
| 172 | 3300037312 | Ga0395899_0104800 | Ga0395899_0104800_901_1479 | 190 |
| 173 | 3300037312 | Ga0395899_0193216 | Ga0395899_0193216_80_658 | 190 |
| 174 | 3300037418 | Ga0395900_0000723 | Ga0395900_0000723_38783_39361 | 190 |
| 175 | 3300037418 | Ga0395900_0015111 | Ga0395900_0015111_807_1385 | 190 |
| 176 | 3300037418 | Ga0395900_0015235 | Ga0395900_0015235_6497_7075 | 190 |
| 177 | 3300037418 | Ga0395900_0016216 | Ga0395900_0016216_1231_1809 | 190 |
| 178 | 3300037418 | Ga0395900_0034194 | Ga0395900_0034194_2413_2991 | 190 |
| 179 | 3300037418 | Ga0395900_0034975 | Ga0395900_0034975_1423_2001 | 190 |
| 180 | 3300037418 | Ga0395900_0152977 | Ga0395900_0152977_510_1088 | 190 |
| 181 | 3300037418 | Ga0395900_0180553 | Ga0395900_0180553_725_1303 | 190 |
| 182 | 3300037418 | Ga0395900_0283099 | Ga0395900_0283099_20_598 | 190 |
| 183 | 3300037418 | Ga0395900_0367667 | Ga0395900_0367667_65_643 | 190 |
| 184 | 3300037418 | Ga0395900_0394087 | Ga0395900_0394087_740_1318 | 190 |
| 185 | 3300037418 | Ga0395900_0426287 | Ga0395900_0426287_601_1179 | 190 |
| 186 | 3300037418 | Ga0395900_0510831 | Ga0395900_0510831_85_663 | 190 |
| 187 | 3300037418 | Ga0395900_0673295 | Ga0395900_0673295_370_948 | 190 |
| 188 | 3300037466 | Ga0395898_0000087 | Ga0395898_0000087_68995_69573 | 190 |
| 189 | 3300037466 | Ga0395898_0004020 | Ga0395898_0004020_11142_11720 | 190 |
| 190 | 3300037466 | Ga0395898_0009646 | Ga0395898_0009646_9167_9745 | 190 |
| 191 | 3300037466 | Ga0395898_0021149 | Ga0395898_0021149_2388_2966 | 190 |
| 192 | 3300037466 | Ga0395898_0073821 | Ga0395898_0073821_2265_2843 | 190 |
| 193 | 3300037466 | Ga0395898_0105564 | Ga0395898_0105564_1392_1970 | 190 |
| 194 | 3300037466 | Ga0395898_0305517 | Ga0395898_0305517_157_735 | 190 |
| 195 | 3300037466 | Ga0395898_0689979 | Ga0395898_0689979_314_892 | 190 |
| 196 | 3300037466 | Ga0395898_0730900 | Ga0395898_0730900_16_594 | 190 |
| 197 | 3300037471 | Ga0395905_0000005 | Ga0395905_0000005_68995_69573 | 190 |
| 198 | 3300037471 | Ga0395905_0006920 | Ga0395905_0006920_9601_10179 | 190 |
| 199 | 3300037471 | Ga0395905_0014911 | Ga0395905_0014911_2015_2593 | 190 |
| 200 | 3300037471 | Ga0395905_0017740 | Ga0395905_0017740_4057_4635 | 190 |
| 201 | 3300037471 | Ga0395905_0038867 | Ga0395905_0038867_3820_4401 | 190 |
| 202 | 3300037471 | Ga0395905_0092920 | Ga0395905_0092920_1125_1703 | 190 |
| 203 | 3300037471 | Ga0395905_0156703 | Ga0395905_0156703_220_798 | 190 |
| 204 | 3300038443 | Ga0395901_0001808 | Ga0395901_0001808_5994_6572 | 190 |
| 205 | 3300038443 | Ga0395901_0004038 | Ga0395901_0004038_8157_8735 | 190 |
| 206 | 3300038443 | Ga0395901_0011865 | Ga0395901_0011865_788_1366 | 190 |
| 207 | 3300038443 | Ga0395901_0047175 | Ga0395901_0047175_3394_3972 | 190 |
| 208 | 3300038443 | Ga0395901_0056242 | Ga0395901_0056242_2414_2992 | 190 |
| 209 | 3300038443 | Ga0395901_0062101 | Ga0395901_0062101_494_1072 | 190 |
| 210 | 3300038443 | Ga0395901_0325934 | Ga0395901_0325934_758_1336 | 190 |
| 211 | 3300038443 | Ga0395901_0428574 | Ga0395901_0428574_158_736 | 190 |
| 212 | 3300038443 | Ga0395901_0628422 | Ga0395901_0628422_56_634 | 190 |
| 213 | 3300041413 | Ga0439465_0205265 | Ga0439465_0205265_40_618 | 190 |
| 214 | 3300042004 | Ga0439445_0000014 | Ga0439445_0000014_12564_13142 | 190 |
| 215 | 3300042006 | Ga0439432_028035 | Ga0439432_028035_163_741 | 190 |
| 216 | 3300042116 | Ga0450912_000246 | Ga0450912_000246_830_1408 | 190 |
| 217 | 3300042122 | Ga0450920_009978 | Ga0450920_009978_877_1455 | 190 |
| 218 | 3300044658 | Ga0466972_0008198 | Ga0466972_0008198_2270_2848 | 190 |
| 219 | 3300044683 | Ga0466965_0077533 | Ga0466965_0077533_925_1503 | 190 |
| 220 | 3300044684 | Ga0466966_0000039 | Ga0466966_0000039_51572_52150 | 190 |
| 221 | 3300044684 | Ga0466966_0000802 | Ga0466966_0000802_15131_15709 | 190 |
| 222 | 3300044684 | Ga0466966_0039427 | Ga0466966_0039427_907_1485 | 190 |
| 223 | 3300044684 | Ga0466966_0045857 | Ga0466966_0045857_1913_2491 | 190 |
| 224 | 3300044684 | Ga0466966_0050544 | Ga0466966_0050544_1684_2262 | 190 |
| 225 | 3300044684 | Ga0466966_0368928 | Ga0466966_0368928_146_724 | 190 |
| 226 | 3300044693 | Ga0466961_0024458 | Ga0466961_0024458_1483_2061 | 190 |
| 227 | 3300044693 | Ga0466961_0052657 | Ga0466961_0052657_837_1415 | 190 |
| 228 | 3300044693 | Ga0466961_0053178 | Ga0466961_0053178_625_1203 | 190 |
| 229 | 3300044693 | Ga0466961_0296031 | Ga0466961_0296031_66_644 | 190 |
| 230 | 3300044694 | Ga0466963_0450303 | Ga0466963_0450303_146_724 | 190 |
| 231 | 3300044706 | Ga0466964_0006390 | Ga0466964_0006390_1592_2170 | 190 |
| 232 | 3300044719 | Ga0466971_0006606 | Ga0466971_0006606_1703_2281 | 190 |
| 233 | 3300044719 | Ga0466971_0039618 | Ga0466971_0039618_293_871 | 190 |
| 234 | 3300044719 | Ga0466971_0102646 | Ga0466971_0102646_599_1177 | 190 |
| 235 | 3300044735 | Ga0466968_0000227 | Ga0466968_0000227_456_1034 | 190 |
| 236 | 3300044735 | Ga0466968_0363235 | Ga0466968_0363235_42_620 | 190 |
| 237 | 3300044765 | Ga0466970_0000836 | Ga0466970_0000836_12253_12831 | 190 |
| 238 | 3300044765 | Ga0466970_0019102 | Ga0466970_0019102_114_692 | 190 |
| 239 | 3300044765 | Ga0466970_0020879 | Ga0466970_0020879_733_1311 | 190 |
| 240 | 3300044765 | Ga0466970_0060892 | Ga0466970_0060892_864_1442 | 190 |
| 241 | 3300044765 | Ga0466970_0522763 | Ga0466970_0522763_31_609 | 190 |
| 242 | 3300044765 | Ga0466970_0581900 | Ga0466970_0581900_12_590 | 190 |
| 243 | 3300044842 | Ga0466957_0006130 | Ga0466957_0006130_3852_4430 | 190 |
| 244 | 3300044842 | Ga0466957_0088901 | Ga0466957_0088901_835_1413 | 190 |
| 245 | 3300045049 | Ga0466959_0008432 | Ga0466959_0008432_4547_5125 | 190 |
| 246 | 3300045049 | Ga0466959_0039700 | Ga0466959_0039700_160_738 | 190 |
| 247 | 3300045049 | Ga0466959_0042264 | Ga0466959_0042264_802_1380 | 190 |
| 248 | 3300045049 | Ga0466959_0172748 | Ga0466959_0172748_346_924 | 190 |
| 249 | 3300045049 | Ga0466959_0178635 | Ga0466959_0178635_231_809 | 190 |
| 250 | 3300045049 | Ga0466959_0493413 | Ga0466959_0493413_34_612 | 190 |
| 251 | 3300045836 | Ga0466958_0004354 | Ga0466958_0004354_6048_6626 | 190 |
| 252 | 3300045836 | Ga0466958_0011059 | Ga0466958_0011059_2781_3359 | 190 |
| 253 | 3300045836 | Ga0466958_0019140 | Ga0466958_0019140_1628_2206 | 190 |
| 254 | 3300045836 | Ga0466958_0208934 | Ga0466958_0208934_643_1221 | 190 |
| 255 | 3300045836 | Ga0466958_0316658 | Ga0466958_0316658_33_611 | 190 |
| 256 | 3300045976 | Ga0466967_0077687 | Ga0466967_0077687_465_1043 | 190 |
| 257 | 3300045976 | Ga0466967_0271783 | Ga0466967_0271783_214_792 | 190 |
| 258 | 3300045976 | Ga0466967_0271814 | Ga0466967_0271814_380_958 | 190 |
| 259 | 3300045976 | Ga0466967_0563575 | Ga0466967_0563575_450_1028 | 190 |
| 260 | 3300046525 | Ga0495663_0044739 | Ga0495663_0044739_430_1008 | 190 |
| 261 | 3300046539 | Ga0495621_0000983 | Ga0495621_0000983_5398_5976 | 190 |
| 262 | 3300046691 | Ga0495670_0011668 | Ga0495670_0011668_2267_2845 | 190 |
| 263 | 3300048904 | Ga0496101_0177997 | Ga0496101_0177997_607_1185 | 190 |
| 264 | 3300048905 | Ga0496102_0859362 | Ga0496102_0859362_43_621 | 190 |
| 265 | 3300048910 | Ga0496107_0786771 | Ga0496107_0786771_108_686 | 190 |
| 266 | 3300048911 | Ga0496108_0148092 | Ga0496108_0148092_311_889 | 190 |
| 267 | 3300048912 | Ga0496109_0136187 | Ga0496109_0136187_1635_2213 | 190 |
| 268 | 3300048912 | Ga0496109_0267515 | Ga0496109_0267515_379_957 | 190 |
| 269 | 3300048913 | Ga0496110_0188119 | Ga0496110_0188119_962_1540 | 190 |
| 270 | 3300048913 | Ga0496110_1025254 | Ga0496110_1025254_66_644 | 190 |
| 271 | 3300048914 | Ga0496111_0213700 | Ga0496111_0213700_670_1248 | 190 |
| 272 | 3300048916 | Ga0496113_0115447 | Ga0496113_0115447_1067_1645 | 190 |
| 273 | 3300048917 | Ga0496114_0000594 | Ga0496114_0000594_2460_3041 | 190 |
| 274 | 3300048917 | Ga0496114_0937283 | Ga0496114_0937283_58_636 | 190 |
| 275 | 3300061719 | Ga0466962_0004622 | Ga0466962_0004622_1739_2317 | 190 |
| 276 | 3300061719 | Ga0466962_0066683 | Ga0466962_0066683_801_1379 | 190 |
| 277 | 3300061719 | Ga0466962_0131145 | Ga0466962_0131145_172_750 | 190 |
| 278 | 3300003323 | rootH1_10048164 | rootH1_100481642 | 191 |
| 279 | 3300005356 | Ga0070674_100133202 | Ga0070674_1001332023 | 191 |
| 280 | 3300005364 | Ga0070673_100506750 | Ga0070673_1005067502 | 191 |
| 281 | 3300005364 | Ga0070673_100669910 | Ga0070673_1006699102 | 191 |
| 282 | 3300005548 | Ga0070665_100003847 | Ga0070665_10000384711 | 191 |
| 283 | 3300005843 | Ga0068860_100061662 | Ga0068860_1000616625 | 191 |
| 284 | 3300009094 | Ga0111539_11273889 | Ga0111539_112738892 | 191 |
| 285 | 3300013307 | Ga0157372_10008488 | Ga0157372_100084884 | 191 |
| 286 | 3300013308 | Ga0157375_11987819 | Ga0157375_119878192 | 191 |
| 287 | 3300025918 | Ga0207662_10255148 | Ga0207662_102551482 | 191 |
| 288 | 3300025923 | Ga0207681_10114151 | Ga0207681_101141512 | 191 |
| 289 | 3300025937 | Ga0207669_10678038 | Ga0207669_106780382 | 191 |
| 290 | 3300025942 | Ga0207689_10513710 | Ga0207689_105137101 | 191 |
| 291 | 3300025972 | Ga0207668_10612466 | Ga0207668_106124662 | 191 |
| 292 | 3300026089 | Ga0207648_10407013 | Ga0207648_104070132 | 191 |
| 293 | 3300028379 | Ga0268266_10000514 | Ga0268266_100005148 | 191 |
| 294 | 3300028381 | Ga0268264_10046584 | Ga0268264_100465845 | 191 |
| 295 | 3300032004 | Ga0307414_10978216 | Ga0307414_109782162 | 191 |
| 296 | 3300038443 | Ga0395901_0455686 | Ga0395901_0455686_494_1171 | 191 |
| 297 | 3300046519 | Ga0495632_0130654 | Ga0495632_0130654_415_996 | 191 |
| 298 | 3300046616 | Ga0495668_0084960 | Ga0495668_0084960_1062_1643 | 191 |
| 299 | 3300046660 | Ga0495625_0125600 | Ga0495625_0125600_392_973 | 191 |
| 300 | 3300050511 | nmdc:mga08y16_512095_c1 | nmdc:mga08y16_512095_c1_37_618 | 191 |
| 301 | 3300053134 | Ga0500658_0196854 | Ga0500658_0196854_225_806 | 191 |
| 302 | 3300053139 | Ga0500568_0004359 | Ga0500568_0004359_4608_5189 | 191 |
| 303 | 3300053151 | Ga0500604_0000002 | Ga0500604_0000002_144017_144598 | 191 |
| 304 | 3300053153 | Ga0500616_0000238 | Ga0500616_0000238_33766_34347 | 191 |
| 305 | 3300031548 | Ga0307408_100196370 | Ga0307408_1001963702 | 192 |
| 306 | 3300031901 | Ga0307406_10390814 | Ga0307406_103908142 | 192 |
| 307 | 3300031911 | Ga0307412_10240820 | Ga0307412_102408202 | 192 |
| 308 | 3300032126 | Ga0307415_100171924 | Ga0307415_1001719242 | 192 |
| 309 | iso_pu_bacteria | 2643221562 | 2643830455 | 192 |
| 310 | iso_pu_bacteria | 2643221577 | 2643894229 | 192 |
| 311 | iso_pu_bacteria | 2643221685 | 2644476431 | 192 |
| 312 | iso_pu_bacteria | 2687453130 | 2687582890 | 192 |
| 313 | iso_pu_bacteria | 2739367700 | 2739730760 | 192 |
| 314 | iso_pu_bacteria | 2884411467 | 2884414413 | 192 |
| 315 | iso_pu_bacteria | 2895395659 | 2895398770 | 192 |
| 316 | iso_pu_bacteria | 2928963466 | 2928964166 | 192 |
| 317 | iso_pu_bacteria | 2939611941 | 2939612354 | 192 |
| 318 | 3300001989 | JGI24739J22299_10056009 | JGI24739J22299_100560092 | 194 |
| 319 | 3300001990 | JGI24737J22298_10002784 | JGI24737J22298_100027844 | 194 |
| 320 | 3300005339 | Ga0070660_100061965 | Ga0070660_1000619652 | 194 |
| 321 | 3300005356 | Ga0070674_100031562 | Ga0070674_1000315621 | 194 |
| 322 | 3300005364 | Ga0070673_100096136 | Ga0070673_1000961363 | 194 |
| 323 | 3300005366 | Ga0070659_100058107 | Ga0070659_1000581072 | 194 |
| 324 | 3300005366 | Ga0070659_100161313 | Ga0070659_1001613131 | 194 |
| 325 | 3300005457 | Ga0070662_100012504 | Ga0070662_1000125045 | 194 |
| 326 | 3300005577 | Ga0068857_100004075 | Ga0068857_1000040759 | 194 |
| 327 | 3300005841 | Ga0068863_100000991 | Ga0068863_1000009914 | 194 |
| 328 | 3300005844 | Ga0068862_100057171 | Ga0068862_1000571713 | 194 |
| 329 | 3300006195 | Ga0075366_10183309 | Ga0075366_101833092 | 194 |
| 330 | 3300009098 | Ga0105245_10543037 | Ga0105245_105430372 | 194 |
| 331 | 3300011119 | Ga0105246_10023433 | Ga0105246_100234334 | 194 |
| 332 | 3300013102 | Ga0157371_10165528 | Ga0157371_101655282 | 194 |
| 333 | 3300013307 | Ga0157372_10455589 | Ga0157372_104555892 | 194 |
| 334 | 3300014325 | Ga0163163_10007998 | Ga0163163_100079987 | 194 |
| 335 | 3300025904 | Ga0207647_10010023 | Ga0207647_100100236 | 194 |
| 336 | 3300025904 | Ga0207647_10012011 | Ga0207647_100120116 | 194 |
| 337 | 3300025932 | Ga0207690_10215986 | Ga0207690_102159862 | 194 |
| 338 | 3300025933 | Ga0207706_10006757 | Ga0207706_100067572 | 194 |
| 339 | 3300025937 | Ga0207669_10044209 | Ga0207669_100442092 | 194 |
| 340 | 3300025960 | Ga0207651_10432056 | Ga0207651_104320562 | 194 |
| 341 | 3300026023 | Ga0207677_10354174 | Ga0207677_103541742 | 194 |
| 342 | 3300026088 | Ga0207641_10031254 | Ga0207641_100312547 | 194 |
| 343 | 3300026095 | Ga0207676_10747026 | Ga0207676_107470262 | 194 |
| 344 | 3300026116 | Ga0207674_10000132 | Ga0207674_1000013254 | 194 |
| 345 | 3300037418 | Ga0395900_0003562 | Ga0395900_0003562_14509_15132 | 194 |
| 346 | 3300037418 | Ga0395900_0015753 | Ga0395900_0015753_2046_2666 | 194 |
| 347 | 3300037418 | Ga0395900_0018901 | Ga0395900_0018901_3954_4586 | 194 |
| 348 | 3300037418 | Ga0395900_0023262 | Ga0395900_0023262_4432_5064 | 194 |
| 349 | 3300037418 | Ga0395900_0023486 | Ga0395900_0023486_3234_3866 | 194 |
| 350 | 3300037418 | Ga0395900_0032996 | Ga0395900_0032996_515_1135 | 194 |
| 351 | 3300037418 | Ga0395900_0371655 | Ga0395900_0371655_150_776 | 194 |
| 352 | 3300037466 | Ga0395898_0076450 | Ga0395898_0076450_677_1309 | 194 |
| 353 | 3300037466 | Ga0395898_0211881 | Ga0395898_0211881_534_1160 | 194 |
| 354 | 3300037471 | Ga0395905_0002000 | Ga0395905_0002000_14325_14957 | 194 |
| 355 | 3300037471 | Ga0395905_0002910 | Ga0395905_0002910_11954_12574 | 194 |
| 356 | 3300037471 | Ga0395905_0005131 | Ga0395905_0005131_10864_11487 | 194 |
| 357 | 3300037471 | Ga0395905_0014364 | Ga0395905_0014364_1995_2627 | 194 |
| 358 | 3300037471 | Ga0395905_0019323 | Ga0395905_0019323_1688_2314 | 194 |
| 359 | 3300037471 | Ga0395905_0048848 | Ga0395905_0048848_400_1026 | 194 |
| 360 | 3300037471 | Ga0395905_0112028 | Ga0395905_0112028_1746_2378 | 194 |
| 361 | 3300037471 | Ga0395905_0155998 | Ga0395905_0155998_443_1063 | 194 |
| 362 | 3300037471 | Ga0395905_0368606 | Ga0395905_0368606_621_1241 | 194 |
| 363 | 3300038443 | Ga0395901_0015235 | Ga0395901_0015235_2580_3212 | 194 |
| 364 | 3300038443 | Ga0395901_0024583 | Ga0395901_0024583_3945_4568 | 194 |
| 365 | 3300038443 | Ga0395901_0036907 | Ga0395901_0036907_4105_4731 | 194 |
| 366 | 3300038443 | Ga0395901_0039387 | Ga0395901_0039387_3868_4488 | 194 |
| 367 | 3300038443 | Ga0395901_0090198 | Ga0395901_0090198_287_907 | 194 |
| 368 | 3300038443 | Ga0395901_0145796 | Ga0395901_0145796_1734_2366 | 194 |
| 369 | 3300038443 | Ga0395901_0219532 | Ga0395901_0219532_1148_1780 | 194 |
| 370 | 3300042157 | Ga0439458_0000243 | Ga0439458_0000243_6683_7303 | 194 |
| 371 | 3300042157 | Ga0439458_0007783 | Ga0439458_0007783_961_1587 | 194 |
| 372 | 3300048905 | Ga0496102_0034842 | Ga0496102_0034842_3209_3793 | 194 |
| 373 | 3300048906 | Ga0496103_0101135 | Ga0496103_0101135_774_1358 | 194 |
| 374 | 3300048921 | Ga0496118_0021905 | Ga0496118_0021905_4289_4873 | 194 |
| 375 | iso_pu_bacteria | 2894414249 | 2894415468 | 195 |
| 376 | 3300001989 | JGI24739J22299_10000040 | JGI24739J22299_100000407 | 196 |
| 377 | 3300001990 | JGI24737J22298_10002132 | JGI24737J22298_100021325 | 196 |
| 378 | 3300002705 | JGI25156J39149_1010714 | JGI25156J39149_10107141 | 196 |
| 379 | 3300002737 | JGI25162J39368_1000395 | JGI25162J39368_100039517 | 196 |
| 380 | 3300002737 | JGI25162J39368_1000684 | JGI25162J39368_100068413 | 196 |
| 381 | 3300002737 | JGI25162J39368_1002286 | JGI25162J39368_10022862 | 196 |
| 382 | 3300002741 | JGI25157J39369_1000081 | JGI25157J39369_100008145 | 196 |
| 383 | 3300002741 | JGI25157J39369_1000547 | JGI25157J39369_10005475 | 196 |
| 384 | 3300002771 | JGI25163J39215_1000313 | JGI25163J39215_10003139 | 196 |
| 385 | 3300002772 | JGI25164J39214_1000028 | JGI25164J39214_100002837 | 196 |
| 386 | 3300002772 | JGI25164J39214_1000338 | JGI25164J39214_100033811 | 196 |
| 387 | 3300002772 | JGI25164J39214_1000416 | JGI25164J39214_100041617 | 196 |
| 388 | 3300003214 | JGI25165J46597_1000108 | JGI25165J46597_100010837 | 196 |
| 389 | 3300003214 | JGI25165J46597_1000513 | JGI25165J46597_100051325 | 196 |
| 390 | 3300003214 | JGI25165J46597_1003664 | JGI25165J46597_10036644 | 196 |
| 391 | 3300003215 | JGI25153J46596_10003689 | JGI25153J46596_100036895 | 196 |
| 392 | 3300003316 | rootH1_10048199 | rootH1_100481994 | 196 |
| 393 | 3300003320 | rootH2_10026728 | rootH2_1002672817 | 196 |
| 394 | 3300003323 | rootH1_10162681 | rootH1_101626813 | 196 |
| 395 | 3300003578 | Ga0006562J51391_1011160 | Ga0006562J51391_10111607 | 196 |
| 396 | 3300003578 | Ga0006562J51391_1011163 | Ga0006562J51391_10111633 | 196 |
| 397 | 3300003752 | Ga0055539_1001625 | Ga0055539_10016253 | 196 |
| 398 | 3300003761 | Ga0055535_1000771 | Ga0055535_100077113 | 196 |
| 399 | 3300003762 | Ga0055542_1000772 | Ga0055542_100077215 | 196 |
| 400 | 3300003762 | Ga0055542_1000787 | Ga0055542_100078715 | 196 |
| 401 | 3300003763 | Ga0055529_1000078 | Ga0055529_100007837 | 196 |
| 402 | 3300005327 | Ga0070658_10473418 | Ga0070658_104734181 | 196 |
| 403 | 3300005329 | Ga0070683_100048684 | Ga0070683_1000486842 | 196 |
| 404 | 3300005337 | Ga0070682_100023945 | Ga0070682_1000239453 | 196 |
| 405 | 3300005337 | Ga0070682_100179353 | Ga0070682_1001793532 | 196 |
| 406 | 3300005339 | Ga0070660_100156685 | Ga0070660_1001566852 | 196 |
| 407 | 3300005339 | Ga0070660_100865117 | Ga0070660_1008651171 | 196 |
| 408 | 3300005340 | Ga0070689_100010930 | Ga0070689_1000109302 | 196 |
| 409 | 3300005341 | Ga0070691_10112024 | Ga0070691_101120242 | 196 |
| 410 | 3300005341 | Ga0070691_10196097 | Ga0070691_101960971 | 196 |
| 411 | 3300005344 | Ga0070661_100038689 | Ga0070661_1000386893 | 196 |
| 412 | 3300005344 | Ga0070661_100139852 | Ga0070661_1001398522 | 196 |
| 413 | 3300005344 | Ga0070661_100459547 | Ga0070661_1004595472 | 196 |
| 414 | 3300005345 | Ga0070692_10044215 | Ga0070692_100442153 | 196 |
| 415 | 3300005356 | Ga0070674_100300121 | Ga0070674_1003001212 | 196 |
| 416 | 3300005365 | Ga0070688_100136001 | Ga0070688_1001360012 | 196 |
| 417 | 3300005366 | Ga0070659_100005797 | Ga0070659_1000057973 | 196 |
| 418 | 3300005366 | Ga0070659_100133964 | Ga0070659_1001339643 | 196 |
| 419 | 3300005366 | Ga0070659_100267417 | Ga0070659_1002674172 | 196 |
| 420 | 3300005435 | Ga0070714_100104775 | Ga0070714_1001047752 | 196 |
| 421 | 3300005435 | Ga0070714_100116833 | Ga0070714_1001168332 | 196 |
| 422 | 3300005436 | Ga0070713_100006097 | Ga0070713_1000060977 | 196 |
| 423 | 3300005438 | Ga0070701_10145876 | Ga0070701_101458762 | 196 |
| 424 | 3300005455 | Ga0070663_100252768 | Ga0070663_1002527682 | 196 |
| 425 | 3300005455 | Ga0070663_100306505 | Ga0070663_1003065052 | 196 |
| 426 | 3300005455 | Ga0070663_100638384 | Ga0070663_1006383842 | 196 |
| 427 | 3300005457 | Ga0070662_100655373 | Ga0070662_1006553732 | 196 |
| 428 | 3300005457 | Ga0070662_100771357 | Ga0070662_1007713572 | 196 |
| 429 | 3300005530 | Ga0070679_100019902 | Ga0070679_1000199025 | 196 |
| 430 | 3300005535 | Ga0070684_100000098 | Ga0070684_10000009812 | 196 |
| 431 | 3300005539 | Ga0068853_100007676 | Ga0068853_1000076762 | 196 |
| 432 | 3300005539 | Ga0068853_100200769 | Ga0068853_1002007691 | 196 |
| 433 | 3300005546 | Ga0070696_100005210 | Ga0070696_1000052108 | 196 |
| 434 | 3300005546 | Ga0070696_100052356 | Ga0070696_1000523563 | 196 |
| 435 | 3300005547 | Ga0070693_100051465 | Ga0070693_1000514652 | 196 |
| 436 | 3300005547 | Ga0070693_100065349 | Ga0070693_1000653492 | 196 |
| 437 | 3300005563 | Ga0068855_100002059 | Ga0068855_1000020597 | 196 |
| 438 | 3300005563 | Ga0068855_100005690 | Ga0068855_1000056905 | 196 |
| 439 | 3300005563 | Ga0068855_100020597 | Ga0068855_1000205975 | 196 |
| 440 | 3300005563 | Ga0068855_100107211 | Ga0068855_1001072112 | 196 |
| 441 | 3300005577 | Ga0068857_100000511 | Ga0068857_1000005116 | 196 |
| 442 | 3300005577 | Ga0068857_100004673 | Ga0068857_1000046735 | 196 |
| 443 | 3300005577 | Ga0068857_100042446 | Ga0068857_1000424463 | 196 |
| 444 | 3300005577 | Ga0068857_100059143 | Ga0068857_1000591434 | 196 |
| 445 | 3300005578 | Ga0068854_100001254 | Ga0068854_1000012547 | 196 |
| 446 | 3300005578 | Ga0068854_100009920 | Ga0068854_1000099205 | 196 |
| 447 | 3300005578 | Ga0068854_100036209 | Ga0068854_1000362093 | 196 |
| 448 | 3300005578 | Ga0068854_100148510 | Ga0068854_1001485102 | 196 |
| 449 | 3300005614 | Ga0068856_100001449 | Ga0068856_10000144914 | 196 |
| 450 | 3300005614 | Ga0068856_100217728 | Ga0068856_1002177282 | 196 |
| 451 | 3300005616 | Ga0068852_100243143 | Ga0068852_1002431432 | 196 |
| 452 | 3300005617 | Ga0068859_100419067 | Ga0068859_1004190671 | 196 |
| 453 | 3300005718 | Ga0068866_10183996 | Ga0068866_101839962 | 196 |
| 454 | 3300005842 | Ga0068858_100013472 | Ga0068858_1000134727 | 196 |
| 455 | 3300005843 | Ga0068860_100522419 | Ga0068860_1005224192 | 196 |
| 456 | 3300005844 | Ga0068862_100055198 | Ga0068862_1000551984 | 196 |
| 457 | 3300006844 | Ga0075428_100534850 | Ga0075428_1005348502 | 196 |
| 458 | 3300006931 | Ga0097620_100419059 | Ga0097620_1004190591 | 196 |
| 459 | 3300009093 | Ga0105240_10003424 | Ga0105240_100034246 | 196 |
| 460 | 3300009093 | Ga0105240_10014865 | Ga0105240_100148659 | 196 |
| 461 | 3300009093 | Ga0105240_10020015 | Ga0105240_100200155 | 196 |
| 462 | 3300009093 | Ga0105240_10030261 | Ga0105240_100302613 | 196 |
| 463 | 3300009093 | Ga0105240_10031164 | Ga0105240_100311642 | 196 |
| 464 | 3300009093 | Ga0105240_10164754 | Ga0105240_101647542 | 196 |
| 465 | 3300009094 | Ga0111539_10409346 | Ga0111539_104093462 | 196 |
| 466 | 3300009147 | Ga0114129_10815943 | Ga0114129_108159432 | 196 |
| 467 | 3300009174 | Ga0105241_10098806 | Ga0105241_100988063 | 196 |
| 468 | 3300009174 | Ga0105241_10879278 | Ga0105241_108792782 | 196 |
| 469 | 3300009174 | Ga0105241_10936705 | Ga0105241_109367051 | 196 |
| 470 | 3300009545 | Ga0105237_10000023 | Ga0105237_1000002363 | 196 |
| 471 | 3300009545 | Ga0105237_10000595 | Ga0105237_1000059510 | 196 |
| 472 | 3300009551 | Ga0105238_10005372 | Ga0105238_1000537214 | 196 |
| 473 | 3300009551 | Ga0105238_10005720 | Ga0105238_100057208 | 196 |
| 474 | 3300009551 | Ga0105238_10104398 | Ga0105238_101043982 | 196 |
| 475 | 3300009551 | Ga0105238_10113419 | Ga0105238_101134192 | 196 |
| 476 | 3300009551 | Ga0105238_10747423 | Ga0105238_107474232 | 196 |
| 477 | 3300009551 | Ga0105238_11270837 | Ga0105238_112708372 | 196 |
| 478 | 3300010375 | Ga0105239_10000022 | Ga0105239_10000022106 | 196 |
| 479 | 3300010375 | Ga0105239_10078397 | Ga0105239_100783972 | 196 |
| 480 | 3300010375 | Ga0105239_10451297 | Ga0105239_104512972 | 196 |
| 481 | 3300012500 | Ga0157314_1000105 | Ga0157314_10001056 | 196 |
| 482 | 3300013100 | Ga0157373_10027400 | Ga0157373_100274003 | 196 |
| 483 | 3300013100 | Ga0157373_10115399 | Ga0157373_101153992 | 196 |
| 484 | 3300013102 | Ga0157371_10005020 | Ga0157371_100050201 | 196 |
| 485 | 3300013102 | Ga0157371_10021458 | Ga0157371_100214587 | 196 |
| 486 | 3300013102 | Ga0157371_10024187 | Ga0157371_100241874 | 196 |
| 487 | 3300013104 | Ga0157370_10001239 | Ga0157370_1000123932 | 196 |
| 488 | 3300013104 | Ga0157370_10009476 | Ga0157370_100094768 | 196 |
| 489 | 3300013104 | Ga0157370_10471752 | Ga0157370_104717521 | 196 |
| 490 | 3300013105 | Ga0157369_10087931 | Ga0157369_100879312 | 196 |
| 491 | 3300013105 | Ga0157369_10164684 | Ga0157369_101646841 | 196 |
| 492 | 3300013105 | Ga0157369_10297926 | Ga0157369_102979262 | 196 |
| 493 | 3300013105 | Ga0157369_10337263 | Ga0157369_103372632 | 196 |
| 494 | 3300013307 | Ga0157372_10151239 | Ga0157372_101512393 | 196 |
| 495 | 3300013307 | Ga0157372_11312997 | Ga0157372_113129972 | 196 |
| 496 | 3300014497 | Ga0182008_10111837 | Ga0182008_101118371 | 196 |
| 497 | 3300014745 | Ga0157377_10170118 | Ga0157377_101701182 | 196 |
| 498 | 3300015261 | Ga0182006_1155977 | Ga0182006_11559772 | 196 |
| 499 | 3300015262 | Ga0182007_10013574 | Ga0182007_100135744 | 196 |
| 500 | 3300015262 | Ga0182007_10059055 | Ga0182007_100590552 | 196 |
| 501 | 3300015687 | Ga0183368_1004 | Ga0183368_1004238 | 196 |
| 502 | 3300020070 | Ga0206356_10015297 | Ga0206356_100152973 | 196 |
| 503 | 3300020082 | Ga0206353_10295629 | Ga0206353_102956292 | 196 |
| 504 | 3300025207 | Ga0209760_100676 | Ga0209760_1006765 | 196 |
| 505 | 3300025224 | Ga0209784_100047 | Ga0209784_100047118 | 196 |
| 506 | 3300025226 | Ga0209674_100053 | Ga0209674_100053152 | 196 |
| 507 | 3300025231 | Ga0207427_100023 | Ga0207427_100023376 | 196 |
| 508 | 3300025231 | Ga0207427_100115 | Ga0207427_10011569 | 196 |
| 509 | 3300025231 | Ga0207427_100130 | Ga0207427_10013062 | 196 |
| 510 | 3300025231 | Ga0207427_101434 | Ga0207427_1014342 | 196 |
| 511 | 3300025233 | Ga0209437_100015 | Ga0209437_100015540 | 196 |
| 512 | 3300025233 | Ga0209437_100020 | Ga0209437_100020205 | 196 |
| 513 | 3300025233 | Ga0209437_100079 | Ga0209437_100079205 | 196 |
| 514 | 3300025233 | Ga0209437_100276 | Ga0209437_10027666 | 196 |
| 515 | 3300025242 | Ga0209258_100043 | Ga0209258_10004395 | 196 |
| 516 | 3300025242 | Ga0209258_101362 | Ga0209258_1013625 | 196 |
| 517 | 3300025246 | Ga0209646_1001086 | Ga0209646_10010864 | 196 |
| 518 | 3300025246 | Ga0209646_1001409 | Ga0209646_10014095 | 196 |
| 519 | 3300025246 | Ga0209646_1005518 | Ga0209646_10055182 | 196 |
| 520 | 3300025250 | Ga0209026_1000047 | Ga0209026_100004795 | 196 |
| 521 | 3300025250 | Ga0209026_1000105 | Ga0209026_100010586 | 196 |
| 522 | 3300025250 | Ga0209026_1000162 | Ga0209026_100016210 | 196 |
| 523 | 3300025250 | Ga0209026_1004849 | Ga0209026_10048492 | 196 |
| 524 | 3300025253 | Ga0209677_107553 | Ga0209677_1075532 | 196 |
| 525 | 3300025254 | Ga0209148_1000002 | Ga0209148_10000021942 | 196 |
| 526 | 3300025254 | Ga0209148_1000010 | Ga0209148_1000010375 | 196 |
| 527 | 3300025256 | Ga0209759_1000318 | Ga0209759_100031829 | 196 |
| 528 | 3300025258 | Ga0209129_1002006 | Ga0209129_10020064 | 196 |
| 529 | 3300025261 | Ga0209233_1000009 | Ga0209233_1000009797 | 196 |
| 530 | 3300025261 | Ga0209233_1000020 | Ga0209233_1000020420 | 196 |
| 531 | 3300025261 | Ga0209233_1000121 | Ga0209233_1000121162 | 196 |
| 532 | 3300025261 | Ga0209233_1004374 | Ga0209233_10043743 | 196 |
| 533 | 3300025272 | Ga0209455_1000020 | Ga0209455_1000020229 | 196 |
| 534 | 3300025272 | Ga0209455_1000560 | Ga0209455_10005606 | 196 |
| 535 | 3300025297 | Ga0209758_1000959 | Ga0209758_100095921 | 196 |
| 536 | 3300025904 | Ga0207647_10018195 | Ga0207647_100181955 | 196 |
| 537 | 3300025904 | Ga0207647_10021257 | Ga0207647_100212574 | 196 |
| 538 | 3300025904 | Ga0207647_10059981 | Ga0207647_100599812 | 196 |
| 539 | 3300025909 | Ga0207705_10105804 | Ga0207705_101058042 | 196 |
| 540 | 3300025911 | Ga0207654_10168043 | Ga0207654_101680432 | 196 |
| 541 | 3300025911 | Ga0207654_10335523 | Ga0207654_103355232 | 196 |
| 542 | 3300025912 | Ga0207707_10011138 | Ga0207707_1001113810 | 196 |
| 543 | 3300025913 | Ga0207695_10000654 | Ga0207695_1000065440 | 196 |
| 544 | 3300025913 | Ga0207695_10000907 | Ga0207695_1000090745 | 196 |
| 545 | 3300025913 | Ga0207695_10008059 | Ga0207695_100080595 | 196 |
| 546 | 3300025913 | Ga0207695_10046136 | Ga0207695_100461364 | 196 |
| 547 | 3300025913 | Ga0207695_10047480 | Ga0207695_100474804 | 196 |
| 548 | 3300025913 | Ga0207695_10111216 | Ga0207695_101112163 | 196 |
| 549 | 3300025914 | Ga0207671_10000020 | Ga0207671_10000020172 | 196 |
| 550 | 3300025914 | Ga0207671_10000033 | Ga0207671_1000003383 | 196 |
| 551 | 3300025914 | Ga0207671_10000726 | Ga0207671_1000072618 | 196 |
| 552 | 3300025919 | Ga0207657_10031993 | Ga0207657_100319934 | 196 |
| 553 | 3300025919 | Ga0207657_10689750 | Ga0207657_106897501 | 196 |
| 554 | 3300025920 | Ga0207649_10079824 | Ga0207649_100798242 | 196 |
| 555 | 3300025920 | Ga0207649_10124865 | Ga0207649_101248653 | 196 |
| 556 | 3300025920 | Ga0207649_10398768 | Ga0207649_103987681 | 196 |
| 557 | 3300025921 | Ga0207652_10166505 | Ga0207652_101665052 | 196 |
| 558 | 3300025924 | Ga0207694_10006130 | Ga0207694_100061306 | 196 |
| 559 | 3300025924 | Ga0207694_10017824 | Ga0207694_100178242 | 196 |
| 560 | 3300025924 | Ga0207694_10362700 | Ga0207694_103627002 | 196 |
| 561 | 3300025928 | Ga0207700_10003865 | Ga0207700_1000386510 | 196 |
| 562 | 3300025929 | Ga0207664_10000419 | Ga0207664_100004192 | 196 |
| 563 | 3300025929 | Ga0207664_10022981 | Ga0207664_100229815 | 196 |
| 564 | 3300025929 | Ga0207664_10138967 | Ga0207664_101389673 | 196 |
| 565 | 3300025932 | Ga0207690_10000314 | Ga0207690_1000031414 | 196 |
| 566 | 3300025932 | Ga0207690_10000797 | Ga0207690_1000079716 | 196 |
| 567 | 3300025932 | Ga0207690_10008204 | Ga0207690_100082042 | 196 |
| 568 | 3300025932 | Ga0207690_10043020 | Ga0207690_100430202 | 196 |
| 569 | 3300025932 | Ga0207690_10155955 | Ga0207690_101559552 | 196 |
| 570 | 3300025932 | Ga0207690_10447939 | Ga0207690_104479392 | 196 |
| 571 | 3300025933 | Ga0207706_10064116 | Ga0207706_100641163 | 196 |
| 572 | 3300025936 | Ga0207670_10006401 | Ga0207670_100064018 | 196 |
| 573 | 3300025942 | Ga0207689_10150058 | Ga0207689_101500582 | 196 |
| 574 | 3300025944 | Ga0207661_10001403 | Ga0207661_1000140316 | 196 |
| 575 | 3300025949 | Ga0207667_10000130 | Ga0207667_1000013060 | 196 |
| 576 | 3300025949 | Ga0207667_10000169 | Ga0207667_100001695 | 196 |
| 577 | 3300025949 | Ga0207667_10006239 | Ga0207667_100062392 | 196 |
| 578 | 3300025981 | Ga0207640_10000908 | Ga0207640_100009087 | 196 |
| 579 | 3300025981 | Ga0207640_10001060 | Ga0207640_100010607 | 196 |
| 580 | 3300025981 | Ga0207640_10104123 | Ga0207640_101041232 | 196 |
| 581 | 3300026041 | Ga0207639_10033345 | Ga0207639_100333452 | 196 |
| 582 | 3300026041 | Ga0207639_10118496 | Ga0207639_101184961 | 196 |
| 583 | 3300026067 | Ga0207678_10009382 | Ga0207678_1000938210 | 196 |
| 584 | 3300026067 | Ga0207678_10071671 | Ga0207678_100716714 | 196 |
| 585 | 3300026067 | Ga0207678_10246941 | Ga0207678_102469412 | 196 |
| 586 | 3300026067 | Ga0207678_10261620 | Ga0207678_102616202 | 196 |
| 587 | 3300026078 | Ga0207702_10000456 | Ga0207702_1000045636 | 196 |
| 588 | 3300026116 | Ga0207674_10000971 | Ga0207674_100009717 | 196 |
| 589 | 3300026116 | Ga0207674_10021327 | Ga0207674_100213274 | 196 |
| 590 | 3300026116 | Ga0207674_10039041 | Ga0207674_100390411 | 196 |
| 591 | 3300026116 | Ga0207674_10047238 | Ga0207674_100472383 | 196 |
| 592 | 3300026116 | Ga0207674_10264604 | Ga0207674_102646043 | 196 |
| 593 | 3300026116 | Ga0207674_10605584 | Ga0207674_106055842 | 196 |
| 594 | 3300026142 | Ga0207698_10016173 | Ga0207698_100161736 | 196 |
| 595 | 3300028380 | Ga0268265_10175325 | Ga0268265_101753252 | 196 |
| 596 | 3300028380 | Ga0268265_11381258 | Ga0268265_113812581 | 196 |
| 597 | 3300031730 | Ga0307516_10162244 | Ga0307516_101622442 | 196 |
| 598 | 3300037312 | Ga0395899_0108198 | Ga0395899_0108198_392_1015 | 196 |
| 599 | 3300037312 | Ga0395899_0245317 | Ga0395899_0245317_15_605 | 196 |
| 600 | 3300037312 | Ga0395899_0402416 | Ga0395899_0402416_13_636 | 196 |
| 601 | 3300037418 | Ga0395900_0048973 | Ga0395900_0048973_2209_2823 | 196 |
| 602 | 3300037418 | Ga0395900_0116238 | Ga0395900_0116238_289_879 | 196 |
| 603 | 3300037466 | Ga0395898_0003277 | Ga0395898_0003277_15148_15771 | 196 |
| 604 | 3300038443 | Ga0395901_0000280 | Ga0395901_0000280_47405_48019 | 196 |
| 605 | 3300038443 | Ga0395901_0013263 | Ga0395901_0013263_6453_7043 | 196 |
| 606 | 3300038443 | Ga0395901_0135655 | Ga0395901_0135655_1914_2504 | 196 |
| 607 | 3300042000 | Ga0439437_018934 | Ga0439437_018934_69_659 | 196 |
| 608 | 3300042005 | Ga0439448_0018099 | Ga0439448_0018099_1088_1678 | 196 |
| 609 | 3300042005 | Ga0439448_0063189 | Ga0439448_0063189_13_603 | 196 |
| 610 | 3300042438 | Ga0439459_0002997 | Ga0439459_0002997_843_1433 | 196 |
| 611 | 3300044656 | Ga0466969_0055225 | Ga0466969_0055225_452_1042 | 196 |
| 612 | 3300044658 | Ga0466972_0036255 | Ga0466972_0036255_350_940 | 196 |
| 613 | 3300044672 | Ga0466982_0000020 | Ga0466982_0000020_28127_28717 | 196 |
| 614 | 3300044683 | Ga0466965_0078668 | Ga0466965_0078668_65_655 | 196 |
| 615 | 3300044684 | Ga0466966_0008999 | Ga0466966_0008999_4031_4621 | 196 |
| 616 | 3300044719 | Ga0466971_0006892 | Ga0466971_0006892_301_891 | 196 |
| 617 | 3300044735 | Ga0466968_0016306 | Ga0466968_0016306_718_1308 | 196 |
| 618 | 3300044765 | Ga0466970_0024226 | Ga0466970_0024226_1028_1618 | 196 |
| 619 | 3300044842 | Ga0466957_0233213 | Ga0466957_0233213_375_965 | 196 |
| 620 | 3300044901 | Ga0466960_0034356 | Ga0466960_0034356_339_929 | 196 |
| 621 | 3300045049 | Ga0466959_0099272 | Ga0466959_0099272_931_1521 | 196 |
| 622 | 3300045836 | Ga0466958_0016632 | Ga0466958_0016632_530_1120 | 196 |
| 623 | 3300045976 | Ga0466967_0460225 | Ga0466967_0460225_182_772 | 196 |
| 624 | 3300046460 | Ga0495638_0000049 | Ga0495638_0000049_21742_22332 | 196 |
| 625 | 3300046460 | Ga0495638_0000916 | Ga0495638_0000916_21450_22040 | 196 |
| 626 | 3300046471 | Ga0495650_0001214 | Ga0495650_0001214_8100_8690 | 196 |
| 627 | 3300046507 | Ga0495606_0001000 | Ga0495606_0001000_32961_33551 | 196 |
| 628 | 3300046557 | Ga0495622_0023430 | Ga0495622_0023430_1299_1889 | 196 |
| 629 | 3300046660 | Ga0495625_0120402 | Ga0495625_0120402_502_1092 | 196 |
| 630 | 3300046694 | Ga0495649_0000823 | Ga0495649_0000823_8030_8620 | 196 |
| 631 | 3300048903 | Ga0496100_0167599 | Ga0496100_0167599_889_1479 | 196 |
| 632 | 3300048903 | Ga0496100_0229956 | Ga0496100_0229956_138_728 | 196 |
| 633 | 3300048904 | Ga0496101_0048090 | Ga0496101_0048090_2233_2823 | 196 |
| 634 | 3300048907 | Ga0496104_0055648 | Ga0496104_0055648_1760_2350 | 196 |
| 635 | 3300048907 | Ga0496104_0091848 | Ga0496104_0091848_873_1463 | 196 |
| 636 | 3300048907 | Ga0496104_0346063 | Ga0496104_0346063_49_639 | 196 |
| 637 | 3300048908 | Ga0496105_0001964 | Ga0496105_0001964_2871_3461 | 196 |
| 638 | 3300048909 | Ga0496106_0046723 | Ga0496106_0046723_352_942 | 196 |
| 639 | 3300048910 | Ga0496107_0234325 | Ga0496107_0234325_363_953 | 196 |
| 640 | 3300048910 | Ga0496107_0361177 | Ga0496107_0361177_54_644 | 196 |
| 641 | 3300048916 | Ga0496113_0030099 | Ga0496113_0030099_522_1112 | 196 |
| 642 | 3300048918 | Ga0496115_0000024 | Ga0496115_0000024_112233_112823 | 196 |
| 643 | 3300048918 | Ga0496115_0000103 | Ga0496115_0000103_16637_17227 | 196 |
| 644 | 3300048918 | Ga0496115_0002161 | Ga0496115_0002161_5421_6011 | 196 |
| 645 | 3300048918 | Ga0496115_0002922 | Ga0496115_0002922_7343_7933 | 196 |
| 646 | 3300048918 | Ga0496115_0011553 | Ga0496115_0011553_669_1259 | 196 |
| 647 | 3300048919 | Ga0496116_0076650 | Ga0496116_0076650_442_1032 | 196 |
| 648 | 3300048920 | Ga0496117_0086255 | Ga0496117_0086255_857_1447 | 196 |
| 649 | 3300048920 | Ga0496117_0117784 | Ga0496117_0117784_27_617 | 196 |
| 650 | 3300048921 | Ga0496118_0006935 | Ga0496118_0006935_10469_11059 | 196 |
| 651 | 3300048921 | Ga0496118_0012624 | Ga0496118_0012624_2188_2778 | 196 |
| 652 | 3300048922 | Ga0496119_0001743 | Ga0496119_0001743_12007_12597 | 196 |
| 653 | 3300048922 | Ga0496119_0002432 | Ga0496119_0002432_14288_14878 | 196 |
| 654 | 3300048923 | Ga0496120_0000167 | Ga0496120_0000167_95862_96452 | 196 |
| 655 | 3300048923 | Ga0496120_0000868 | Ga0496120_0000868_24959_25549 | 196 |
| 656 | 3300048924 | Ga0496121_0000532 | Ga0496121_0000532_50846_51436 | 196 |
| 657 | 3300048924 | Ga0496121_0028676 | Ga0496121_0028676_1981_2571 | 196 |
| 658 | 3300048924 | Ga0496121_0042063 | Ga0496121_0042063_292_882 | 196 |
| 659 | 3300048924 | Ga0496121_0046716 | Ga0496121_0046716_881_1471 | 196 |
| 660 | 3300048924 | Ga0496121_0209945 | Ga0496121_0209945_279_869 | 196 |
| 661 | 3300048928 | Ga0496125_0000344 | Ga0496125_0000344_27375_27965 | 196 |
| 662 | 3300048929 | Ga0496126_0000581 | Ga0496126_0000581_29191_29781 | 196 |
| 663 | 3300048929 | Ga0496126_0007111 | Ga0496126_0007111_1454_2044 | 196 |
| 664 | 3300048929 | Ga0496126_0191593 | Ga0496126_0191593_536_1126 | 196 |
| 665 | 3300049459 | Ga0495678_037387 | Ga0495678_037387_128_718 | 196 |
| 666 | 3300049460 | Ga0495682_0017233 | Ga0495682_0017233_1853_2443 | 196 |
| 667 | 3300049568 | Ga0501031_0020584 | Ga0501031_0020584_761_1351 | 196 |
| 668 | 3300049568 | Ga0501031_0107743 | Ga0501031_0107743_897_1487 | 196 |
| 669 | 3300049569 | Ga0501032_0014188 | Ga0501032_0014188_743_1333 | 196 |
| 670 | 3300049569 | Ga0501032_0114080 | Ga0501032_0114080_705_1295 | 196 |
| 671 | 3300049570 | Ga0501033_0002545 | Ga0501033_0002545_12215_12805 | 196 |
| 672 | 3300049570 | Ga0501033_0090785 | Ga0501033_0090785_1121_1711 | 196 |
| 673 | 3300049570 | Ga0501033_0199045 | Ga0501033_0199045_554_1144 | 196 |
| 674 | 3300049571 | Ga0501034_0028239 | Ga0501034_0028239_502_1092 | 196 |
| 675 | 3300049571 | Ga0501034_0103298 | Ga0501034_0103298_1783_2373 | 196 |
| 676 | 3300049571 | Ga0501034_0143066 | Ga0501034_0143066_168_758 | 196 |
| 677 | 3300049571 | Ga0501034_0343555 | Ga0501034_0343555_355_978 | 196 |
| 678 | 3300049572 | Ga0501036_0095765 | Ga0501036_0095765_799_1389 | 196 |
| 679 | 3300049573 | Ga0501037_0015245 | Ga0501037_0015245_3418_4008 | 196 |
| 680 | 3300049573 | Ga0501037_0041434 | Ga0501037_0041434_766_1356 | 196 |
| 681 | 3300049574 | Ga0501038_0066603 | Ga0501038_0066603_312_902 | 196 |
| 682 | 3300049574 | Ga0501038_0119491 | Ga0501038_0119491_517_1107 | 196 |
| 683 | 3300049575 | Ga0501039_0362605 | Ga0501039_0362605_244_834 | 196 |
| 684 | 3300049575 | Ga0501039_0605447 | Ga0501039_0605447_58_648 | 196 |
| 685 | 3300049579 | Ga0501043_0128950 | Ga0501043_0128950_825_1415 | 196 |
| 686 | 3300049579 | Ga0501043_0185757 | Ga0501043_0185757_505_1095 | 196 |
| 687 | 3300049579 | Ga0501043_0386785 | Ga0501043_0386785_317_907 | 196 |
| 688 | 3300049580 | Ga0501046_0025262 | Ga0501046_0025262_1079_1669 | 196 |
| 689 | 3300049580 | Ga0501046_0091874 | Ga0501046_0091874_52_642 | 196 |
| 690 | 3300049581 | Ga0501047_0003603 | Ga0501047_0003603_5972_6595 | 196 |
| 691 | 3300049581 | Ga0501047_0011089 | Ga0501047_0011089_6223_6813 | 196 |
| 692 | 3300049581 | Ga0501047_0031361 | Ga0501047_0031361_2703_3293 | 196 |
| 693 | 3300049582 | Ga0501048_0078848 | Ga0501048_0078848_1112_1702 | 196 |
| 694 | 3300049585 | Ga0501069_0011564 | Ga0501069_0011564_2572_3162 | 196 |
| 695 | 3300049586 | Ga0501070_0000587 | Ga0501070_0000587_19531_20121 | 196 |
| 696 | 3300049586 | Ga0501070_0358320 | Ga0501070_0358320_471_1061 | 196 |
| 697 | 3300049589 | Ga0501073_0188926 | Ga0501073_0188926_262_852 | 196 |
| 698 | 3300049593 | Ga0501077_0277500 | Ga0501077_0277500_207_797 | 196 |
| 699 | 3300049742 | Ga0501080_0038483 | Ga0501080_0038483_1654_2244 | 196 |
| 700 | 3300049822 | Ga0501035_0005912 | Ga0501035_0005912_1686_2276 | 196 |
| 701 | 3300049822 | Ga0501035_0017043 | Ga0501035_0017043_1364_1954 | 196 |
| 702 | 3300049822 | Ga0501035_0070003 | Ga0501035_0070003_1700_2290 | 196 |
| 703 | 3300049822 | Ga0501035_0097596 | Ga0501035_0097596_1216_1806 | 196 |
| 704 | 3300049822 | Ga0501035_0499810 | Ga0501035_0499810_268_858 | 196 |
| 705 | 3300049823 | Ga0501044_0020827 | Ga0501044_0020827_701_1291 | 196 |
| 706 | 3300049823 | Ga0501044_0025356 | Ga0501044_0025356_5534_6124 | 196 |
| 707 | 3300049823 | Ga0501044_0213400 | Ga0501044_0213400_768_1358 | 196 |
| 708 | 3300049823 | Ga0501044_0345473 | Ga0501044_0345473_96_686 | 196 |
| 709 | 3300049823 | Ga0501044_0601604 | Ga0501044_0601604_233_856 | 196 |
| 710 | 3300050507 | nmdc:mga05p37_678987_c1 | nmdc:mga05p37_678987_c1_256_873 | 196 |
| 711 | 3300050511 | nmdc:mga08y16_479171_c1 | nmdc:mga08y16_479171_c1_364_978 | 196 |
| 712 | 3300050512 | nmdc:mga0n895_1019311_c1 | nmdc:mga0n895_1019311_c1_42_656 | 196 |
| 713 | 3300061719 | Ga0466962_0003389 | Ga0466962_0003389_6331_6921 | 196 |
| 714 | iso_pu_bacteria | 2547132130 | 2547502928 | 196 |
| 715 | iso_pu_bacteria | 2576861471 | 2578458532 | 196 |
| 716 | iso_pu_bacteria | 2747842428 | 2747949454 | 196 |
| 717 | iso_pu_bacteria | 2747842501 | 2748019754 | 196 |
| 718 | iso_pu_bacteria | 2765235840 | 2765578859 | 196 |
| 719 | iso_pu_bacteria | 2816332141 | 2816516922 | 196 |
| 720 | iso_pu_bacteria | 2818991457 | 2819659690 | 196 |
| 721 | iso_pu_bacteria | 2842391507 | 2842393095 | 196 |
| 722 | iso_pu_bacteria | 2842757796 | 2842758283 | 196 |
| 723 | iso_pu_bacteria | 2852649853 | 2852650950 | 196 |
| 724 | iso_pu_bacteria | 2852684882 | 2852685497 | 196 |
| 725 | iso_pu_bacteria | 2857442823 | 2857443793 | 196 |
| 726 | iso_pu_bacteria | 2874220319 | 2874221498 | 196 |
| 727 | iso_pu_bacteria | 2919089067 | 2919089833 | 196 |
| 728 | iso_pu_bacteria | 2919130084 | 2919131658 | 196 |
| 729 | iso_pu_bacteria | 2919134579 | 2919137845 | 196 |
| 730 | iso_pu_bacteria | 2928496128 | 2928496536 | 196 |
| 731 | iso_pu_bacteria | 2929195423 | 2929197971 | 196 |
| 732 | iso_pu_bacteria | 2931380184 | 2931380878 | 196 |
| 733 | iso_pu_bacteria | 2937610967 | 2937612316 | 196 |
| 734 | iso_pu_bacteria | 2939589442 | 2939590876 | 196 |
| 735 | iso_pu_bacteria | 2939622612 | 2939623133 | 196 |
| 736 | iso_pu_bacteria | 2939626828 | 2939630747 | 196 |
| 737 | iso_pu_bacteria | 2941475908 | 2941478202 | 196 |
| 738 | iso_pu_bacteria | 2961047084 | 2961048264 | 196 |
| 739 | iso_pu_bacteria | 2961064222 | 2961065262 | 196 |
| 740 | iso_pu_bacteria | 2974307012 | 2974309091 | 196 |
| 741 | iso_pu_bacteria | 2977247770 | 2977249811 | 196 |
| 742 | iso_pu_bacteria | 2987605356 | 2987606080 | 196 |
| 743 | iso_pu_bacteria | 8021622325 | 8021624276 | 196 |
| 744 | iso_pu_bacteria | 8021626552 | 8021629120 | 196 |
| 745 | iso_pu_bacteria | 8021648035 | 8021649111 | 196 |
| 746 | 3300005616 | Ga0068852_100037468 | Ga0068852_1000374683 | 197 |
| 747 | 3300007265 | Ga0099794_10049341 | Ga0099794_100493413 | 197 |
| 748 | 3300009093 | Ga0105240_10239123 | Ga0105240_102391231 | 197 |
| 749 | 3300009545 | Ga0105237_10420762 | Ga0105237_104207622 | 197 |
| 750 | 3300025913 | Ga0207695_10048652 | Ga0207695_100486523 | 197 |
| 751 | 3300026142 | Ga0207698_10013331 | Ga0207698_100133314 | 197 |
| 752 | 3300037418 | Ga0395900_0195738 | Ga0395900_0195738_578_1243 | 197 |
| 753 | 3300037466 | Ga0395898_0021259 | Ga0395898_0021259_4413_5078 | 197 |
| 754 | 3300038443 | Ga0395901_0041573 | Ga0395901_0041573_852_1517 | 197 |
| 755 | 3300039437 | Ga0436365_0505056 | Ga0436365_0505056_1779_2375 | 197 |
| 756 | 3300039450 | Ga0436363_1707670 | Ga0436363_1707670_181_777 | 197 |
| 757 | 3300045976 | Ga0466967_0281394 | Ga0466967_0281394_185_835 | 197 |
| 758 | 3300049568 | Ga0501031_0150963 | Ga0501031_0150963_643_1293 | 197 |
| 759 | 3300049569 | Ga0501032_0178721 | Ga0501032_0178721_220_870 | 197 |
| 760 | 3300049570 | Ga0501033_0001868 | Ga0501033_0001868_9919_10569 | 197 |
| 761 | 3300049570 | Ga0501033_0523668 | Ga0501033_0523668_128_745 | 197 |
| 762 | 3300049571 | Ga0501034_0192995 | Ga0501034_0192995_585_1235 | 197 |
| 763 | 3300049572 | Ga0501036_0111278 | Ga0501036_0111278_140_790 | 197 |
| 764 | 3300049580 | Ga0501046_0103124 | Ga0501046_0103124_1352_2002 | 197 |
| 765 | 3300049581 | Ga0501047_0101772 | Ga0501047_0101772_616_1266 | 197 |
| 766 | 3300049585 | Ga0501069_0048655 | Ga0501069_0048655_1007_1603 | 197 |
| 767 | 3300049586 | Ga0501070_0020482 | Ga0501070_0020482_534_1130 | 197 |
| 768 | 3300049822 | Ga0501035_0023420 | Ga0501035_0023420_2021_2671 | 197 |
| 769 | 3300049823 | Ga0501044_0042471 | Ga0501044_0042471_704_1354 | 197 |
| 770 | 3300005335 | Ga0070666_10000388 | Ga0070666_100003887 | 198 |
| 771 | 3300005344 | Ga0070661_100257471 | Ga0070661_1002574711 | 198 |
| 772 | 3300005353 | Ga0070669_100020435 | Ga0070669_1000204354 | 198 |
| 773 | 3300006051 | Ga0075364_10017738 | Ga0075364_100177384 | 198 |
| 774 | 3300006237 | Ga0097621_100411855 | Ga0097621_1004118552 | 198 |
| 775 | 3300010375 | Ga0105239_10039292 | Ga0105239_100392924 | 198 |
| 776 | 3300010375 | Ga0105239_10049113 | Ga0105239_100491134 | 198 |
| 777 | 3300013297 | Ga0157378_10272408 | Ga0157378_102724082 | 198 |
| 778 | 3300025903 | Ga0207680_10000227 | Ga0207680_1000022732 | 198 |
| 779 | 3300025920 | Ga0207649_10214274 | Ga0207649_102142742 | 198 |
| 780 | 3300026089 | Ga0207648_11017111 | Ga0207648_110171112 | 198 |
| 781 | 3300031691 | Ga0316579_10040992 | Ga0316579_100409923 | 198 |
| 782 | 3300031727 | Ga0316576_10007734 | Ga0316576_100077347 | 198 |
| 783 | 3300031727 | Ga0316576_10010970 | Ga0316576_100109705 | 198 |
| 784 | 3300031727 | Ga0316576_10036293 | Ga0316576_100362932 | 198 |
| 785 | 3300031727 | Ga0316576_10708104 | Ga0316576_107081041 | 198 |
| 786 | 3300031728 | Ga0316578_10006565 | Ga0316578_100065652 | 198 |
| 787 | 3300031733 | Ga0316577_10105319 | Ga0316577_101053192 | 198 |
| 788 | 3300035398 | Ga0316574_0006768 | Ga0316574_0006768_2655_3251 | 198 |
| 789 | 3300035398 | Ga0316574_0013668 | Ga0316574_0013668_3188_3784 | 198 |
| 790 | 3300035398 | Ga0316574_0035290 | Ga0316574_0035290_1411_2007 | 198 |
| 791 | 3300035398 | Ga0316574_0040143 | Ga0316574_0040143_531_1127 | 198 |
| 792 | 3300035398 | Ga0316574_0087546 | Ga0316574_0087546_95_691 | 198 |
| 793 | 3300035398 | Ga0316574_0114224 | Ga0316574_0114224_962_1558 | 198 |
| 794 | 3300035398 | Ga0316574_0170516 | Ga0316574_0170516_447_1043 | 198 |
| 795 | 3300035398 | Ga0316574_0227671 | Ga0316574_0227671_419_1015 | 198 |
| 796 | 3300035398 | Ga0316574_0266986 | Ga0316574_0266986_25_621 | 198 |
| 797 | 3300035398 | Ga0316574_0526489 | Ga0316574_0526489_116_712 | 198 |
| 798 | 3300036647 | Ga0316582_0108618 | Ga0316582_0108618_234_830 | 198 |
| 799 | 3300036647 | Ga0316582_0130962 | Ga0316582_0130962_966_1562 | 198 |
| 800 | 3300036712 | Ga0316584_0391071 | Ga0316584_0391071_173_781 | 198 |
| 801 | 3300041494 | Ga0451837_0344179 | Ga0451837_0344179_390_986 | 198 |
| 802 | 3300044656 | Ga0466969_0000310 | Ga0466969_0000310_3973_4572 | 198 |
| 803 | 3300044684 | Ga0466966_0001010 | Ga0466966_0001010_14833_15432 | 198 |
| 804 | 3300044693 | Ga0466961_0000332 | Ga0466961_0000332_4990_5589 | 198 |
| 805 | 3300044706 | Ga0466964_0002553 | Ga0466964_0002553_2416_3015 | 198 |
| 806 | 3300044719 | Ga0466971_0001750 | Ga0466971_0001750_7149_7748 | 198 |
| 807 | 3300044765 | Ga0466970_0000410 | Ga0466970_0000410_17368_17967 | 198 |
| 808 | 3300045049 | Ga0466959_0000334 | Ga0466959_0000334_21277_21876 | 198 |
| 809 | 3300050491 | nmdc:mga00v17_20876_c1 | nmdc:mga00v17_20876_c1_2493_3092 | 198 |
| 810 | 3300061719 | Ga0466962_0000083 | Ga0466962_0000083_21405_22004 | 198 |
| 811 | 2162886007 | SwRhRL2b_contig_3936045 | SwRhRL2b_0860.00002930 | 199 |
| 812 | 3300002773 | JGI25152J39213_1001386 | JGI25152J39213_10013866 | 199 |
| 813 | 3300002774 | JGI25150J39212_1000817 | JGI25150J39212_10008176 | 199 |
| 814 | 3300003187 | JGI25151J46595_10001867 | JGI25151J46595_100018676 | 199 |
| 815 | 3300003215 | JGI25153J46596_10000167 | JGI25153J46596_1000016750 | 199 |
| 816 | 3300005329 | Ga0070683_100814161 | Ga0070683_1008141612 | 199 |
| 817 | 3300005330 | Ga0070690_100175666 | Ga0070690_1001756662 | 199 |
| 818 | 3300005335 | Ga0070666_10058900 | Ga0070666_100589003 | 199 |
| 819 | 3300005344 | Ga0070661_100384145 | Ga0070661_1003841452 | 199 |
| 820 | 3300005355 | Ga0070671_100306657 | Ga0070671_1003066572 | 199 |
| 821 | 3300005367 | Ga0070667_100156091 | Ga0070667_1001560911 | 199 |
| 822 | 3300005535 | Ga0070684_100208421 | Ga0070684_1002084212 | 199 |
| 823 | 3300005539 | Ga0068853_100050236 | Ga0068853_1000502362 | 199 |
| 824 | 3300005539 | Ga0068853_100360905 | Ga0068853_1003609052 | 199 |
| 825 | 3300005539 | Ga0068853_100361954 | Ga0068853_1003619542 | 199 |
| 826 | 3300005563 | Ga0068855_100080776 | Ga0068855_1000807763 | 199 |
| 827 | 3300005563 | Ga0068855_100624049 | Ga0068855_1006240492 | 199 |
| 828 | 3300005564 | Ga0070664_100091821 | Ga0070664_1000918213 | 199 |
| 829 | 3300005578 | Ga0068854_100231495 | Ga0068854_1002314952 | 199 |
| 830 | 3300005614 | Ga0068856_100020139 | Ga0068856_1000201393 | 199 |
| 831 | 3300005616 | Ga0068852_100357589 | Ga0068852_1003575892 | 199 |
| 832 | 3300005616 | Ga0068852_100488648 | Ga0068852_1004886482 | 199 |
| 833 | 3300005843 | Ga0068860_100017406 | Ga0068860_1000174064 | 199 |
| 834 | 3300006051 | Ga0075364_10000075 | Ga0075364_100000758 | 199 |
| 835 | 3300009093 | Ga0105240_10414486 | Ga0105240_104144862 | 199 |
| 836 | 3300009093 | Ga0105240_10575495 | Ga0105240_105754952 | 199 |
| 837 | 3300009098 | Ga0105245_11213042 | Ga0105245_112130422 | 199 |
| 838 | 3300009174 | Ga0105241_10083769 | Ga0105241_100837693 | 199 |
| 839 | 3300009545 | Ga0105237_10282236 | Ga0105237_102822362 | 199 |
| 840 | 3300009545 | Ga0105237_10363183 | Ga0105237_103631832 | 199 |
| 841 | 3300009979 | Ga0105032_109395 | Ga0105032_1093951 | 199 |
| 842 | 3300010375 | Ga0105239_10074918 | Ga0105239_100749183 | 199 |
| 843 | 3300010375 | Ga0105239_10625658 | Ga0105239_106256582 | 199 |
| 844 | 3300013104 | Ga0157370_10187919 | Ga0157370_101879192 | 199 |
| 845 | 3300013105 | Ga0157369_10011860 | Ga0157369_1001186014 | 199 |
| 846 | 3300013307 | Ga0157372_10126760 | Ga0157372_101267603 | 199 |
| 847 | 3300014325 | Ga0163163_10000597 | Ga0163163_100005978 | 199 |
| 848 | 3300014969 | Ga0157376_10840628 | Ga0157376_108406282 | 199 |
| 849 | 3300025245 | Ga0207425_1000097 | Ga0207425_100009765 | 199 |
| 850 | 3300025258 | Ga0209129_1000189 | Ga0209129_100018965 | 199 |
| 851 | 3300025294 | Ga0209025_1000054 | Ga0209025_100005465 | 199 |
| 852 | 3300025297 | Ga0209758_1000062 | Ga0209758_100006265 | 199 |
| 853 | 3300025321 | Ga0207656_10029913 | Ga0207656_100299132 | 199 |
| 854 | 3300025904 | Ga0207647_10001844 | Ga0207647_1000184420 | 199 |
| 855 | 3300025911 | Ga0207654_10181440 | Ga0207654_101814402 | 199 |
| 856 | 3300025911 | Ga0207654_10526933 | Ga0207654_105269332 | 199 |
| 857 | 3300025912 | Ga0207707_10137111 | Ga0207707_101371112 | 199 |
| 858 | 3300025913 | Ga0207695_10000261 | Ga0207695_1000026178 | 199 |
| 859 | 3300025913 | Ga0207695_10266207 | Ga0207695_102662072 | 199 |
| 860 | 3300025914 | Ga0207671_10010073 | Ga0207671_100100736 | 199 |
| 861 | 3300025919 | Ga0207657_10082222 | Ga0207657_100822223 | 199 |
| 862 | 3300025920 | Ga0207649_10354522 | Ga0207649_103545222 | 199 |
| 863 | 3300025924 | Ga0207694_10271084 | Ga0207694_102710842 | 199 |
| 864 | 3300025932 | Ga0207690_10119941 | Ga0207690_101199412 | 199 |
| 865 | 3300025938 | Ga0207704_10128325 | Ga0207704_101283252 | 199 |
| 866 | 3300025949 | Ga0207667_10264973 | Ga0207667_102649732 | 199 |
| 867 | 3300025949 | Ga0207667_10426315 | Ga0207667_104263152 | 199 |
| 868 | 3300025981 | Ga0207640_10237128 | Ga0207640_102371282 | 199 |
| 869 | 3300026023 | Ga0207677_10062497 | Ga0207677_100624972 | 199 |
| 870 | 3300026035 | Ga0207703_10076370 | Ga0207703_100763702 | 199 |
| 871 | 3300026041 | Ga0207639_10001886 | Ga0207639_1000188613 | 199 |
| 872 | 3300026041 | Ga0207639_10306901 | Ga0207639_103069012 | 199 |
| 873 | 3300026078 | Ga0207702_10001809 | Ga0207702_100018098 | 199 |
| 874 | 3300026088 | Ga0207641_11154779 | Ga0207641_111547792 | 199 |
| 875 | 3300028380 | Ga0268265_10271456 | Ga0268265_102714562 | 199 |
| 876 | 3300028381 | Ga0268264_10180457 | Ga0268264_101804572 | 199 |
| 877 | 3300031548 | Ga0307408_100136374 | Ga0307408_1001363743 | 199 |
| 878 | 3300031824 | Ga0307413_10503860 | Ga0307413_105038602 | 199 |
| 879 | 3300031824 | Ga0307413_10733133 | Ga0307413_107331331 | 199 |
| 880 | 3300031911 | Ga0307412_10307364 | Ga0307412_103073642 | 199 |
| 881 | 3300032004 | Ga0307414_10023949 | Ga0307414_100239493 | 199 |
| 882 | 3300032004 | Ga0307414_10074267 | Ga0307414_100742672 | 199 |
| 883 | 3300032004 | Ga0307414_10296325 | Ga0307414_102963252 | 199 |
| 884 | 3300032005 | Ga0307411_10232904 | Ga0307411_102329042 | 199 |
| 885 | 3300032005 | Ga0307411_10502491 | Ga0307411_105024912 | 199 |
| 886 | 3300032005 | Ga0307411_10609503 | Ga0307411_106095032 | 199 |
| 887 | 3300033179 | Ga0307507_10000880 | Ga0307507_1000088022 | 199 |
| 888 | 3300038705 | Ga0237819_00169 | Ga0237819_00169_15202_15801 | 199 |
| 889 | 3300041406 | Ga0439439_0130190 | Ga0439439_0130190_73_672 | 199 |
| 890 | 3300041413 | Ga0439465_0001563 | Ga0439465_0001563_3088_3687 | 199 |
| 891 | 3300041494 | Ga0451837_0033562 | Ga0451837_0033562_242_844 | 199 |
| 892 | 3300042006 | Ga0439432_167382 | Ga0439432_167382_32_631 | 199 |
| 893 | 3300042007 | Ga0439449_0000069 | Ga0439449_0000069_24928_25527 | 199 |
| 894 | 3300046539 | Ga0495621_0065359 | Ga0495621_0065359_254_853 | 199 |
| 895 | 3300046615 | Ga0495656_0002149 | Ga0495656_0002149_1234_1833 | 199 |
| 896 | 3300047318 | Ga0495636_0006533 | Ga0495636_0006533_1375_1974 | 199 |
| 897 | 3300047472 | Ga0495686_0015670 | Ga0495686_0015670_2106_2705 | 199 |
| 898 | 3300048928 | Ga0496125_0131233 | Ga0496125_0131233_994_1593 | 199 |
| 899 | 3300048929 | Ga0496126_0588425 | Ga0496126_0588425_243_842 | 199 |
| 900 | 3300049571 | Ga0501034_0001977 | Ga0501034_0001977_15509_16123 | 199 |
| 901 | 3300049772 | Ga0501275_000447 | Ga0501275_000447_3201_3842 | 199 |
| 902 | 3300050491 | nmdc:mga00v17_729_c2 | nmdc:mga00v17_729_c2_6371_6976 | 199 |
| 903 | iso_pu_bacteria | 2895498888 | 2895500779 | 199 |
| 904 | iso_pu_bacteria | 2895511927 | 2895516351 | 199 |
| 905 | iso_pu_bacteria | 2895522137 | 2895523730 | 199 |
| 906 | iso_pu_bacteria | 2895525241 | 2895526689 | 199 |
| 907 | 2162886007 | SwRhRL2b_contig_2191643 | SwRhRL2b_0907.00000550 | 200 |
| 908 | 3300003771 | Ga0055526_1000268 | Ga0055526_100026811 | 200 |
| 909 | 3300003773 | Ga0055537_1000348 | Ga0055537_10003487 | 200 |
| 910 | 3300003781 | Ga0055536_1001728 | Ga0055536_100172810 | 200 |
| 911 | 3300003781 | Ga0055536_1008641 | Ga0055536_10086412 | 200 |
| 912 | 3300003784 | Ga0055534_1000043 | Ga0055534_100004325 | 200 |
| 913 | 3300003790 | Ga0055528_1000065 | Ga0055528_100006512 | 200 |
| 914 | 3300003791 | Ga0055530_10001974 | Ga0055530_100019748 | 200 |
| 915 | 3300003791 | Ga0055530_10002320 | Ga0055530_100023206 | 200 |
| 916 | 3300003792 | Ga0055540_1037333 | Ga0055540_10373331 | 200 |
| 917 | 3300003794 | Ga0055531_10010116 | Ga0055531_100101164 | 200 |
| 918 | 3300003794 | Ga0055531_10011251 | Ga0055531_100112512 | 200 |
| 919 | 3300003794 | Ga0055531_10011262 | Ga0055531_100112622 | 200 |
| 920 | 3300003856 | Ga0058692_1000031 | Ga0058692_100003187 | 200 |
| 921 | 3300003856 | Ga0058692_1000060 | Ga0058692_100006010 | 200 |
| 922 | 3300005289 | Ga0065704_10070367 | Ga0065704_1007036719 | 200 |
| 923 | 3300005289 | Ga0065704_10134021 | Ga0065704_101340212 | 200 |
| 924 | 3300005331 | Ga0070670_100007794 | Ga0070670_10000779411 | 200 |
| 925 | 3300005347 | Ga0070668_100112328 | Ga0070668_1001123282 | 200 |
| 926 | 3300005353 | Ga0070669_100224637 | Ga0070669_1002246372 | 200 |
| 927 | 3300005456 | Ga0070678_100568995 | Ga0070678_1005689952 | 200 |
| 928 | 3300005548 | Ga0070665_100022951 | Ga0070665_1000229512 | 200 |
| 929 | 3300005616 | Ga0068852_100505328 | Ga0068852_1005053282 | 200 |
| 930 | 3300005618 | Ga0068864_100067635 | Ga0068864_1000676352 | 200 |
| 931 | 3300005841 | Ga0068863_100001728 | Ga0068863_10000172813 | 200 |
| 932 | 3300005843 | Ga0068860_100043436 | Ga0068860_1000434362 | 200 |
| 933 | 3300005985 | Ga0081539_10029649 | Ga0081539_100296493 | 200 |
| 934 | 3300006051 | Ga0075364_10033599 | Ga0075364_100335992 | 200 |
| 935 | 3300006051 | Ga0075364_10045173 | Ga0075364_100451734 | 200 |
| 936 | 3300006177 | Ga0075362_10034213 | Ga0075362_100342133 | 200 |
| 937 | 3300006178 | Ga0075367_10107375 | Ga0075367_101073752 | 200 |
| 938 | 3300006186 | Ga0075369_10031861 | Ga0075369_100318612 | 200 |
| 939 | 3300006195 | Ga0075366_10204202 | Ga0075366_102042022 | 200 |
| 940 | 3300009011 | Ga0105251_10000684 | Ga0105251_1000068419 | 200 |
| 941 | 3300009011 | Ga0105251_10010358 | Ga0105251_100103586 | 200 |
| 942 | 3300009148 | Ga0105243_10012752 | Ga0105243_100127522 | 200 |
| 943 | 3300009148 | Ga0105243_10096358 | Ga0105243_100963582 | 200 |
| 944 | 3300009177 | Ga0105248_10084810 | Ga0105248_100848105 | 200 |
| 945 | 3300009553 | Ga0105249_10064480 | Ga0105249_100644804 | 200 |
| 946 | 3300011119 | Ga0105246_10004902 | Ga0105246_100049026 | 200 |
| 947 | 3300013102 | Ga0157371_10002070 | Ga0157371_100020708 | 200 |
| 948 | 3300013102 | Ga0157371_10002097 | Ga0157371_1000209714 | 200 |
| 949 | 3300013102 | Ga0157371_10036564 | Ga0157371_100365642 | 200 |
| 950 | 3300013104 | Ga0157370_10025187 | Ga0157370_100251873 | 200 |
| 951 | 3300013104 | Ga0157370_10045181 | Ga0157370_100451813 | 200 |
| 952 | 3300013104 | Ga0157370_10082267 | Ga0157370_100822672 | 200 |
| 953 | 3300013105 | Ga0157369_10005861 | Ga0157369_1000586111 | 200 |
| 954 | 3300014325 | Ga0163163_10000788 | Ga0163163_1000078817 | 200 |
| 955 | 3300014497 | Ga0182008_10000032 | Ga0182008_10000032148 | 200 |
| 956 | 3300014497 | Ga0182008_10053209 | Ga0182008_100532093 | 200 |
| 957 | 3300014968 | Ga0157379_10003251 | Ga0157379_1000325112 | 200 |
| 958 | 3300015261 | Ga0182006_1027840 | Ga0182006_10278402 | 200 |
| 959 | 3300015261 | Ga0182006_1034584 | Ga0182006_10345843 | 200 |
| 960 | 3300015261 | Ga0182006_1055039 | Ga0182006_10550392 | 200 |
| 961 | 3300015261 | Ga0182006_1078117 | Ga0182006_10781172 | 200 |
| 962 | 3300015261 | Ga0182006_1092595 | Ga0182006_10925951 | 200 |
| 963 | 3300015262 | Ga0182007_10000067 | Ga0182007_1000006722 | 200 |
| 964 | 3300015265 | Ga0182005_1000487 | Ga0182005_100048719 | 200 |
| 965 | 3300015265 | Ga0182005_1003544 | Ga0182005_10035442 | 200 |
| 966 | 3300017792 | Ga0163161_10000314 | Ga0163161_100003149 | 200 |
| 967 | 3300017792 | Ga0163161_10020581 | Ga0163161_100205813 | 200 |
| 968 | 3300017792 | Ga0163161_10022836 | Ga0163161_100228365 | 200 |
| 969 | 3300017792 | Ga0163161_10130017 | Ga0163161_101300173 | 200 |
| 970 | 3300025263 | Ga0209565_1000063 | Ga0209565_100006314 | 200 |
| 971 | 3300025273 | Ga0209673_1000065 | Ga0209673_1000065125 | 200 |
| 972 | 3300025284 | Ga0209130_1022608 | Ga0209130_10226082 | 200 |
| 973 | 3300025291 | Ga0209675_1000011 | Ga0209675_1000011268 | 200 |
| 974 | 3300025292 | Ga0209676_1000011 | Ga0209676_1000011626 | 200 |
| 975 | 3300025292 | Ga0209676_1000068 | Ga0209676_1000068190 | 200 |
| 976 | 3300025292 | Ga0209676_1000804 | Ga0209676_100080435 | 200 |
| 977 | 3300025295 | Ga0209564_1000433 | Ga0209564_100043351 | 200 |
| 978 | 3300025298 | Ga0209050_1000239 | Ga0209050_100023991 | 200 |
| 979 | 3300025298 | Ga0209050_1000599 | Ga0209050_100059941 | 200 |
| 980 | 3300025298 | Ga0209050_1012752 | Ga0209050_10127522 | 200 |
| 981 | 3300025298 | Ga0209050_1022399 | Ga0209050_10223992 | 200 |
| 982 | 3300025299 | Ga0209256_1010810 | Ga0209256_10108104 | 200 |
| 983 | 3300025303 | Ga0209051_1003250 | Ga0209051_10032507 | 200 |
| 984 | 3300025304 | Ga0209257_1000014 | Ga0209257_1000014685 | 200 |
| 985 | 3300025304 | Ga0209257_1005372 | Ga0209257_10053728 | 200 |
| 986 | 3300025304 | Ga0209257_1006688 | Ga0209257_10066887 | 200 |
| 987 | 3300025735 | Ga0207713_1000806 | Ga0207713_100080618 | 200 |
| 988 | 3300025735 | Ga0207713_1012433 | Ga0207713_10124334 | 200 |
| 989 | 3300025923 | Ga0207681_10239811 | Ga0207681_102398113 | 200 |
| 990 | 3300025925 | Ga0207650_10020651 | Ga0207650_100206512 | 200 |
| 991 | 3300025935 | Ga0207709_10001731 | Ga0207709_100017313 | 200 |
| 992 | 3300025935 | Ga0207709_10006989 | Ga0207709_100069892 | 200 |
| 993 | 3300025941 | Ga0207711_10135700 | Ga0207711_101357001 | 200 |
| 994 | 3300025961 | Ga0207712_10123710 | Ga0207712_101237102 | 200 |
| 995 | 3300025972 | Ga0207668_10126656 | Ga0207668_101266562 | 200 |
| 996 | 3300026088 | Ga0207641_10097631 | Ga0207641_100976314 | 200 |
| 997 | 3300026121 | Ga0207683_10677450 | Ga0207683_106774502 | 200 |
| 998 | 3300026142 | Ga0207698_10151618 | Ga0207698_101516182 | 200 |
| 999 | 3300027252 | Ga0209973_1019921 | Ga0209973_10199212 | 200 |
| 1000 | 3300027312 | Ga0209371_1000004 | Ga0209371_100000491 | 200 |
| 1001 | 3300027312 | Ga0209371_1000139 | Ga0209371_100013910 | 200 |
| 1002 | 3300027543 | Ga0209999_1008881 | Ga0209999_10088812 | 200 |
| 1003 | 3300027614 | Ga0209970_1011151 | Ga0209970_10111512 | 200 |
| 1004 | 3300027665 | Ga0209983_1005635 | Ga0209983_10056352 | 200 |
| 1005 | 3300027876 | Ga0209974_10010051 | Ga0209974_100100512 | 200 |
| 1006 | 3300028381 | Ga0268264_10032658 | Ga0268264_100326583 | 200 |
| 1007 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005954 | 200 |
| 1008 | 3300030500 | Ga0268256_1000109 | Ga0268256_100010993 | 200 |
| 1009 | 3300030732 | Ga0316176_1166069 | Ga0316176_11660691 | 200 |
| 1010 | 3300030733 | Ga0314311_1025340 | Ga0314311_10253405 | 200 |
| 1011 | 3300030735 | Ga0316178_1066114 | Ga0316178_10661142 | 200 |
| 1012 | 3300030742 | Ga0316183_1086976 | Ga0316183_10869765 | 200 |
| 1013 | 3300030744 | Ga0316181_1180556 | Ga0316181_11805562 | 200 |
| 1014 | 3300031731 | Ga0307405_10224636 | Ga0307405_102246362 | 200 |
| 1015 | 3300031901 | Ga0307406_10524310 | Ga0307406_105243102 | 200 |
| 1016 | 3300031911 | Ga0307412_10000548 | Ga0307412_100005485 | 200 |
| 1017 | 3300031995 | Ga0307409_100537009 | Ga0307409_1005370092 | 200 |
| 1018 | 3300032004 | Ga0307414_10307317 | Ga0307414_103073172 | 200 |
| 1019 | 3300032004 | Ga0307414_10562854 | Ga0307414_105628542 | 200 |
| 1020 | 3300032004 | Ga0307414_10566378 | Ga0307414_105663782 | 200 |
| 1021 | 3300032004 | Ga0307414_10602496 | Ga0307414_106024962 | 200 |
| 1022 | 3300032005 | Ga0307411_10014544 | Ga0307411_100145442 | 200 |
| 1023 | 3300041459 | Ga0451800_0005888 | Ga0451800_0005888_1395_2009 | 200 |
| 1024 | 3300041462 | Ga0451806_032754 | Ga0451806_032754_416_1030 | 200 |
| 1025 | 3300042007 | Ga0439449_0003704 | Ga0439449_0003704_3564_4166 | 200 |
| 1026 | 3300046453 | Ga0495627_017920 | Ga0495627_017920_1753_2355 | 200 |
| 1027 | 3300046460 | Ga0495638_0000202 | Ga0495638_0000202_21296_21898 | 200 |
| 1028 | 3300046460 | Ga0495638_0027546 | Ga0495638_0027546_36_638 | 200 |
| 1029 | 3300046512 | Ga0495610_0049600 | Ga0495610_0049600_557_1159 | 200 |
| 1030 | 3300046518 | Ga0495631_0034299 | Ga0495631_0034299_45_647 | 200 |
| 1031 | 3300046522 | Ga0495643_0000919 | Ga0495643_0000919_4978_5580 | 200 |
| 1032 | 3300046525 | Ga0495663_0002339 | Ga0495663_0002339_1192_1794 | 200 |
| 1033 | 3300046525 | Ga0495663_0006455 | Ga0495663_0006455_2462_3064 | 200 |
| 1034 | 3300046525 | Ga0495663_0013907 | Ga0495663_0013907_1149_1751 | 200 |
| 1035 | 3300046539 | Ga0495621_0020509 | Ga0495621_0020509_1281_1910 | 200 |
| 1036 | 3300046558 | Ga0495633_0011833 | Ga0495633_0011833_3984_4586 | 200 |
| 1037 | 3300046558 | Ga0495633_0046333 | Ga0495633_0046333_577_1182 | 200 |
| 1038 | 3300046558 | Ga0495633_0174398 | Ga0495633_0174398_48_650 | 200 |
| 1039 | 3300046558 | Ga0495633_0209316 | Ga0495633_0209316_157_759 | 200 |
| 1040 | 3300046660 | Ga0495625_0048020 | Ga0495625_0048020_1163_1765 | 200 |
| 1041 | 3300046810 | Ga0495660_0106768 | Ga0495660_0106768_68_670 | 200 |
| 1042 | 3300047320 | Ga0495672_0000105 | Ga0495672_0000105_89492_90094 | 200 |
| 1043 | 3300047320 | Ga0495672_0158322 | Ga0495672_0158322_142_744 | 200 |
| 1044 | 3300047472 | Ga0495686_0008426 | Ga0495686_0008426_6858_7460 | 200 |
| 1045 | 3300048907 | Ga0496104_0268192 | Ga0496104_0268192_877_1479 | 200 |
| 1046 | 3300048908 | Ga0496105_0172208 | Ga0496105_0172208_46_648 | 200 |
| 1047 | 3300048914 | Ga0496111_0118009 | Ga0496111_0118009_846_1448 | 200 |
| 1048 | 3300048919 | Ga0496116_0000218 | Ga0496116_0000218_72023_72625 | 200 |
| 1049 | 3300048919 | Ga0496116_0013717 | Ga0496116_0013717_298_900 | 200 |
| 1050 | 3300048919 | Ga0496116_0032122 | Ga0496116_0032122_283_885 | 200 |
| 1051 | 3300048919 | Ga0496116_0113902 | Ga0496116_0113902_284_886 | 200 |
| 1052 | 3300048919 | Ga0496116_0213622 | Ga0496116_0213622_242_844 | 200 |
| 1053 | 3300048920 | Ga0496117_0000314 | Ga0496117_0000314_58356_58958 | 200 |
| 1054 | 3300048920 | Ga0496117_0001191 | Ga0496117_0001191_6939_7541 | 200 |
| 1055 | 3300048920 | Ga0496117_0003149 | Ga0496117_0003149_10431_11033 | 200 |
| 1056 | 3300048920 | Ga0496117_0004544 | Ga0496117_0004544_5675_6277 | 200 |
| 1057 | 3300048920 | Ga0496117_0009737 | Ga0496117_0009737_7565_8167 | 200 |
| 1058 | 3300048920 | Ga0496117_0083137 | Ga0496117_0083137_597_1199 | 200 |
| 1059 | 3300048920 | Ga0496117_0276306 | Ga0496117_0276306_177_779 | 200 |
| 1060 | 3300048921 | Ga0496118_0000371 | Ga0496118_0000371_7591_8193 | 200 |
| 1061 | 3300048921 | Ga0496118_0002136 | Ga0496118_0002136_11323_11925 | 200 |
| 1062 | 3300048921 | Ga0496118_0002547 | Ga0496118_0002547_3417_4019 | 200 |
| 1063 | 3300048921 | Ga0496118_0006150 | Ga0496118_0006150_7095_7697 | 200 |
| 1064 | 3300048921 | Ga0496118_0033714 | Ga0496118_0033714_932_1534 | 200 |
| 1065 | 3300048921 | Ga0496118_0117972 | Ga0496118_0117972_197_799 | 200 |
| 1066 | 3300048921 | Ga0496118_0127254 | Ga0496118_0127254_233_835 | 200 |
| 1067 | 3300048922 | Ga0496119_0000239 | Ga0496119_0000239_59036_59638 | 200 |
| 1068 | 3300048922 | Ga0496119_0002973 | Ga0496119_0002973_10372_10974 | 200 |
| 1069 | 3300048922 | Ga0496119_0054521 | Ga0496119_0054521_893_1495 | 200 |
| 1070 | 3300048923 | Ga0496120_0000181 | Ga0496120_0000181_61402_62004 | 200 |
| 1071 | 3300048923 | Ga0496120_0000676 | Ga0496120_0000676_31601_32203 | 200 |
| 1072 | 3300048924 | Ga0496121_0004104 | Ga0496121_0004104_15173_15775 | 200 |
| 1073 | 3300048924 | Ga0496121_0016876 | Ga0496121_0016876_5500_6102 | 200 |
| 1074 | 3300048924 | Ga0496121_0039123 | Ga0496121_0039123_1361_1963 | 200 |
| 1075 | 3300048924 | Ga0496121_0175446 | Ga0496121_0175446_166_768 | 200 |
| 1076 | 3300048925 | Ga0496122_0000901 | Ga0496122_0000901_21131_21733 | 200 |
| 1077 | 3300048925 | Ga0496122_0001122 | Ga0496122_0001122_15137_15739 | 200 |
| 1078 | 3300048925 | Ga0496122_0012066 | Ga0496122_0012066_5645_6247 | 200 |
| 1079 | 3300048925 | Ga0496122_0021920 | Ga0496122_0021920_1560_2162 | 200 |
| 1080 | 3300048925 | Ga0496122_0102293 | Ga0496122_0102293_466_1068 | 200 |
| 1081 | 3300048925 | Ga0496122_0185702 | Ga0496122_0185702_154_756 | 200 |
| 1082 | 3300048925 | Ga0496122_0262235 | Ga0496122_0262235_217_819 | 200 |
| 1083 | 3300048926 | Ga0496123_0000727 | Ga0496123_0000727_21397_21999 | 200 |
| 1084 | 3300048926 | Ga0496123_0000920 | Ga0496123_0000920_15095_15697 | 200 |
| 1085 | 3300048926 | Ga0496123_0002564 | Ga0496123_0002564_15868_16470 | 200 |
| 1086 | 3300048926 | Ga0496123_0005759 | Ga0496123_0005759_6077_6679 | 200 |
| 1087 | 3300048926 | Ga0496123_0010634 | Ga0496123_0010634_269_871 | 200 |
| 1088 | 3300048926 | Ga0496123_0042551 | Ga0496123_0042551_618_1220 | 200 |
| 1089 | 3300048926 | Ga0496123_0046388 | Ga0496123_0046388_1668_2270 | 200 |
| 1090 | 3300048926 | Ga0496123_0318995 | Ga0496123_0318995_46_648 | 200 |
| 1091 | 3300048927 | Ga0496124_0001061 | Ga0496124_0001061_11397_11999 | 200 |
| 1092 | 3300048927 | Ga0496124_0001652 | Ga0496124_0001652_4899_5501 | 200 |
| 1093 | 3300048927 | Ga0496124_0005126 | Ga0496124_0005126_8412_9014 | 200 |
| 1094 | 3300048927 | Ga0496124_0006193 | Ga0496124_0006193_6640_7242 | 200 |
| 1095 | 3300048927 | Ga0496124_0009321 | Ga0496124_0009321_73_675 | 200 |
| 1096 | 3300048927 | Ga0496124_0019095 | Ga0496124_0019095_4503_5105 | 200 |
| 1097 | 3300048927 | Ga0496124_0021047 | Ga0496124_0021047_176_778 | 200 |
| 1098 | 3300048927 | Ga0496124_0058646 | Ga0496124_0058646_981_1583 | 200 |
| 1099 | 3300048927 | Ga0496124_0239956 | Ga0496124_0239956_386_988 | 200 |
| 1100 | 3300048927 | Ga0496124_0335034 | Ga0496124_0335034_343_945 | 200 |
| 1101 | 3300048928 | Ga0496125_0000320 | Ga0496125_0000320_13263_13865 | 200 |
| 1102 | 3300048928 | Ga0496125_0005964 | Ga0496125_0005964_12429_13031 | 200 |
| 1103 | 3300048928 | Ga0496125_0025180 | Ga0496125_0025180_4398_5000 | 200 |
| 1104 | 3300048928 | Ga0496125_0121582 | Ga0496125_0121582_462_1064 | 200 |
| 1105 | 3300048928 | Ga0496125_0268578 | Ga0496125_0268578_266_868 | 200 |
| 1106 | 3300048929 | Ga0496126_0001014 | Ga0496126_0001014_18785_19387 | 200 |
| 1107 | 3300048929 | Ga0496126_0123760 | Ga0496126_0123760_781_1383 | 200 |
| 1108 | 3300048929 | Ga0496126_0206619 | Ga0496126_0206619_803_1405 | 200 |
| 1109 | 3300049571 | Ga0501034_0007048 | Ga0501034_0007048_10376_10978 | 200 |
| 1110 | 3300049571 | Ga0501034_0635658 | Ga0501034_0635658_325_927 | 200 |
| 1111 | 3300049660 | Ga0501216_011253 | Ga0501216_011253_268_870 | 200 |
| 1112 | 3300049679 | Ga0501249_043326 | Ga0501249_043326_336_938 | 200 |
| 1113 | 3300049688 | Ga0501259_027992 | Ga0501259_027992_173_775 | 200 |
| 1114 | 3300050492 | nmdc:mga0yw44_137900_c1 | nmdc:mga0yw44_137900_c1_634_1236 | 200 |
| 1115 | 3300050494 | nmdc:mga06z11_426937_c1 | nmdc:mga06z11_426937_c1_73_675 | 200 |
| 1116 | 3300053128 | Ga0500626_053803 | Ga0500626_053803_813_1415 | 200 |
| 1117 | 3300053161 | Ga0500634_0000322 | Ga0500634_0000322_7572_8174 | 200 |
| 1118 | 3300053734 | Ga0500565_020439 | Ga0500565_020439_37_639 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.958 | 4 | 196 |
| 4gud-assembly2.cif.gz_B | crystal structure of amidotransferase hish from vibrio cholerae | 0.9552 | 1 | 196 |
| 4gud-assembly1.cif.gz_A | crystal structure of amidotransferase hish from vibrio cholerae | 0.9344 | 4 | 196 |
| 4gud-assembly2.cif.gz_B | crystal structure of amidotransferase hish from vibrio cholerae | 0.932 | 1 | 196 |
| 1ka9-assembly1.cif.gz_H | imidazole glycerol phosphate synthase | 0.9167 | 3 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4gudA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9519 | 4 | 196 | 3.40.50.880 |
| af_P9WMM1_1_205_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9407 | 1 | 197 | 3.40.50.880 |
| af_Q2FUU1_1_190_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9357 | 4 | 200 | 3.40.50.880 |
| af_Q57929_1_195_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9332 | 4 | 196 | 3.40.50.880 |
| 4gudA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9328 | 4 | 196 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A357NIC5-F1-model_v4 | deleted | 0.9957 | 116 | 180 |
|
| AF-A0A7C9LXU4-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisH (EC 4.3.2.10) (IGP synthase glutaminase subunit) (EC 3.5.1.2) (IGP synthase subunit HisH) (ImGP synthase subunit HisH) (IGPS subunit HisH) | 0.9921 | 2 | 196 |
GO:0000105
GO:0000107 GO:0004359 GO:0005737 GO:0006541 GO:0016829 |
| AF-A0A1G0QUI8-F1-model_v4 | Imidazole glycerol phosphate synthase, glutamine amidotransferase subunit | 0.9918 | 113 | 196 |
GO:0000105
GO:0000107 GO:0004359 GO:0016829 |
| AF-A0A848QA24-F1-model_v4 | deleted | 0.9892 | 44 | 196 |
|
| AF-A0A3C0X9Q2-F1-model_v4 | deleted | 0.9883 | 1 | 121 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar