metagRoot

F490319

General Info

Members	Datasets	Scaffolds	Average Seq Length
1117	529	986	249

Family's Representative Sequence

Representative Sequence	3300009036\|Ga0105244_10002548\|Ga0105244_100025488
Length	296
Sequence	MDMATVLYGSRADVDTPPPGEQNRLARHRAVPTRHRGDRMPTKGCSMTEQDLTGRRAIVTGGASGIGFACAQEFAARGAHVVIADVNRDAAGAAADSIGGEAWVVDLSDTTALDDLRLDADILVNNAGIQTIAPIAEFDPDRFRFMQRLMVESPFLLVRAVLPGMYERGWGRIINISSAHGLRASAYKSAYVTAKHALEGLSKVTALEGGPHGVTSNCINPAYVRTPLVEKQISDQARVHGIPEHEVVEAIMLTESVIKRLIEPAEVASLAGWLASDHAGMVTGASYTMDGGWTAR

Samples

	Sample ID	Description	Type	Environment
1	2523231044	Gordonia rhizosphera NBRC 16068	Isolate	Rhizosphere
2	2537561592	Arthrobacter crystallopoietes BAB-32	Isolate	Rhizosphere
3	2551306166	Nocardia tenerifensis NBRC 101015	Isolate	Rhizosphere
4	2554235227	Arthrobacter sp. PAO19	Isolate	Rhizosphere
5	2565956761	Rhodococcus qingshengii BKS 20-40	Isolate	Rhizosphere
6	2643221542	Microbacterium sp. Root1433D1	Isolate	Unclassified
7	2643221546	Microbacterium sp. Root53	Isolate	Unclassified
8	2643221566	Microbacterium sp. Root166	Isolate	Unclassified
9	2643221567	Phycicoccus sp. Root563	Isolate	Unclassified
10	2643221572	Leifsonia sp. Root60	Isolate	Unclassified
11	2643221597	Microbacterium sp. Root180	Isolate	Unclassified
12	2643221601	Kitasatospora sp. Root187	Isolate	Unclassified
13	2643221624	Phycicoccus sp. Root101	Isolate	Unclassified
14	2643221630	Microbacterium sp. Root322	Isolate	Unclassified
15	2643221631	Kitasatospora sp. Root107	Isolate	Unclassified
16	2643221669	Leifsonia sp. Root1293	Isolate	Unclassified
17	2643221673	Streptomyces sp. Root1295	Isolate	Unclassified
18	2643221692	Nocardia sp. Root136	Isolate	Unclassified
19	2643221711	Terrabacter sp. Root85	Isolate	Unclassified
20	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
21	2643221724	Microbacterium sp. Root280D1	Isolate	Unclassified
22	2654587600	Glutamicibacter halophytocola KLBMP5180	Isolate	Unclassified
23	2690315906	Arthrobacter sp. OY3WO11	Isolate	Unclassified
24	2728369380	Microbacterium sp. 1.5R	Isolate	Rhizosphere
25	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
26	2738543011	Rhodococcus sp. OK611	Isolate	Unclassified
27	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
28	2738543034	Rhodococcus sp. OK269	Isolate	Unclassified
29	2739367653	Kocuria sp. OV113	Isolate	Unclassified
30	2751185734	Saccharothrix sp. NRRL B-16314	Isolate	Rhizosphere
31	2773857762	Nocardioides sp. SAI-095	Isolate	Unclassified
32	2773857763	Microbacterium sp. SAI-030	Isolate	Unclassified
33	2775506735	Arthrobacter sp. S95 1704	Isolate	Unclassified
34	2795385472	Herbihabitans rhizosphaerae DSM 101727	Isolate	Rhizosphere
35	2808606306	Microbacterium sp. SLBN-146	Isolate	Unclassified
36	2808606357	Arthrobacter sp. SLBN-122	Isolate	Unclassified
37	2808606360	Arthrobacter sp. SLBN-112	Isolate	Unclassified
38	2808606366	Arthrobacter sp. SLBN-83	Isolate	Unclassified
39	2808606368	Microbacterium sp. SLBN-1	Isolate	Unclassified
40	2808606370	Arthrobacter sp. SLBN-100	Isolate	Unclassified
41	2808606371	Arthrobacter sp. SLBN-53	Isolate	Unclassified
42	2808606372	Agromyces sp. 23-23	Isolate	Unclassified
43	2808606439	Nocardioides sp. SLBN-172	Isolate	Unclassified
44	2808606447	Microbacterium sp. HAR-UPW-R2A-48	Isolate	Unclassified
45	2811994871	Arthrobacter sp. SLBN-179	Isolate	Unclassified
46	2811994878	Nocardioides sp. SLBN-169	Isolate	Unclassified
47	2811994882	Terrabacter sp. SLBN-196	Isolate	Unclassified
48	2811994917	Streptomyces sp. SLBN-134	Isolate	Unclassified
49	2816332305	Kocuria rhizophila FDAARGOS_302	Isolate	Rhizosphere
50	2818991318	Humibacillus xanthopallidus SLBN-155	Isolate	Unclassified
51	2818991458	Terrabacter sp. 3211	Isolate	Rhizosphere
52	2818991462	Terrabacter sp. 3264	Isolate	Rhizosphere
53	2818991469	Terrabacter lapilli 3265	Isolate	Rhizosphere
54	2821268502	Microbacterium sp. YT0620BN	Isolate	Unclassified
55	2833709550	Microbacterium sp. 3290	Isolate	Rhizosphere
56	2835312727	Microvirga calopogonii CCBAU 65841	Isolate	Nodule
57	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
58	2842888712	Tsukamurella sp. R-71941	Isolate	Unclassified
59	2844841374	Leifsonia soli DSM 23871	Isolate	Rhizosphere
60	2844849076	Arthrobacter cupressi DSM 24664	Isolate	Rhizosphere
61	2852632344	Microbacterium sp. AK009	Isolate	Rhizosphere
62	2857727296	Kocuria sp. R-72562	Isolate	Unclassified
63	2857740372	Paenarthrobacter sp. R-74611	Isolate	Unclassified
64	2862290372	Streptomyces triticagri NEAU-YY421	Isolate	Rhizosphere
65	2870628048	Microbacterium thalassium DSM 12511	Isolate	Rhizosphere
66	2870801768	Micrococcus endophyticus DSM 17945	Isolate	Unclassified
67	2887478801	Catellatospora paridis NEAU-CL2	Isolate	Rhizosphere
68	2889300758	Rhodococcus sp. PvR099	Isolate	Rhizosphere
69	2891968417	Nocardioides luteus SAI-037	Isolate	Unclassified
70	2895660088	Leifsonia flava SYP-B2174	Isolate	Rhizosphere
71	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
72	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
73	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
74	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
75	2904497146	Arthrobacter sp. 1276	Isolate	Rhizosphere
76	2904535858	Rhodococcus erythropolis 2017	Isolate	Unclassified
77	2904765812	Rhodococcus fascians 1590	Isolate	Rhizosphere
78	2904770941	Rhodococcus fascians 1339	Isolate	Rhizosphere
79	2904776348	Paenarthrobacter sp. 1092	Isolate	Rhizosphere
80	2908811453	Rhodococcus sp. 1R11	Isolate	Unclassified
81	2910809715	Paenarthrobacter sp. CM16	Isolate	Unclassified
82	2912723979	Streptomyces sp. NEAU-sy36	Isolate	Rhizosphere
83	2919034639	Paenarthrobacter nitroguajacolicus 247	Isolate	Rhizosphere
84	2919055335	Leifsonia sp. 1010	Isolate	Rhizosphere
85	2919059106	Arthrobacter sp. 1088	Isolate	Rhizosphere
86	2919391150	Arthrobacter ipis 2973	Isolate	Unclassified
87	2919395869	Microbacterium resistens 2980	Isolate	Unclassified
88	2919420072	Rhodococcus fascians 3241	Isolate	Rhizosphere
89	2919432681	Rhodococcus sp. 3258	Isolate	Rhizosphere
90	2919443155	Agromyces sp. 3263	Isolate	Rhizosphere
91	2919446982	Phycicoccus sp. 3266	Isolate	Rhizosphere
92	2919523602	Leifsonia shinshuensis 3821	Isolate	Unclassified
93	2919538618	Paenarthrobacter nitroguajacolicus 3945	Isolate	Unclassified
94	2919713450	Nocardia kruczakiae 4272	Isolate	Rhizosphere
95	2920879853	Kocuria salina CV6	Isolate	Unclassified
96	2922554459	Rhodococcus sp. 66b	Isolate	Unclassified
97	2932426870	Paenarthrobacter sp. 4246	Isolate	Rhizosphere
98	2932431166	Cellulosimicrobium sp. 4261	Isolate	Rhizosphere
99	2933418574	Jeotgalibacillus campisalis 4120	Isolate	Rhizosphere
100	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
101	2939598168	Arthrobacter sp. 754	Isolate	Rhizosphere
102	2939647034	Arthrobacter sp. 2762	Isolate	Rhizosphere
103	2939657138	Conyzicola nivalis 2857	Isolate	Rhizosphere
104	2939660829	Mycetocola sp. 2940	Isolate	Rhizosphere
105	2939674588	Arthrobacter bambusae 3552	Isolate	Rhizosphere
106	2939743619	Rhodococcus sp. PvR044	Isolate	Rhizosphere
107	2945916053	Arthrobacter ulcerisalmonis W1I2	Isolate	Rhizosphere
108	2945920336	Pseudarthrobacter siccitolerans W1I3	Isolate	Rhizosphere
109	2945941187	Arthrobacter pascens W1I14	Isolate	Rhizosphere
110	2945956166	Arthrobacter globiformus W2I3	Isolate	Rhizosphere
111	2946033335	Microbacterium sp. W4I4	Isolate	Rhizosphere
112	2946037020	Arthrobacter sp. W4I7	Isolate	Rhizosphere
113	2946045630	Streptomyces sp. W4I9-2	Isolate	Rhizosphere
114	2946059875	Arthrobacter sp. SLBN-112	Isolate	Rhizosphere
115	2946080515	Microbacterium sp. W4I20	Isolate	Rhizosphere
116	2974294766	Microbacterium proteolyticum SORGH_AS 209	Isolate	Unclassified
117	2974315732	Rhodococcus sp. SORGH_AS 301	Isolate	Unclassified
118	2974324384	Microbacterium sp. SORGH_AS 344	Isolate	Unclassified
119	2984523437	Rhodococcus sp. SORGH_AS303	Isolate	Aerial Root
120	2995463766	Streptacidiphilus fuscans NEAU-YB345	Isolate	Unclassified
121	3006486233	Streptomyces sp. BR123	Isolate	Rhizosphere
122	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
123	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
124	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
125	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
126	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
127	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
128	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
129	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
130	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
131	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
132	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
133	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
134	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
135	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
136	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
137	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
138	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
139	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
140	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
141	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
142	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
143	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
144	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
145	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
146	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
147	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
148	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
149	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
150	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
151	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
152	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
153	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
154	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
155	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
156	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
157	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
158	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
159	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
160	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
161	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
162	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
163	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
164	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
165	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
166	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
167	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
168	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
169	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
170	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
171	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
172	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
173	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
174	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
175	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
176	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
177	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
178	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
179	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
180	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
181	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
182	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
183	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
184	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
185	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
186	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
187	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
188	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
189	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
190	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
191	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
192	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
193	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
194	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
195	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
196	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
197	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
198	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
199	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
200	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
201	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
202	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
203	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
204	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
205	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
206	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
207	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
208	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
209	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
210	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
211	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
212	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
213	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
214	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
215	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
216	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
217	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
218	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
219	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
220	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
221	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
222	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
223	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
224	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
225	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
226	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
227	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
228	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
229	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
230	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
231	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
232	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
233	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
234	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
235	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
236	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
237	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
238	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
239	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
240	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
241	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
242	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
243	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
244	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
245	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
246	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
247	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
248	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
249	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
250	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
251	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
252	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
253	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
254	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
255	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
256	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
310	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
314	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
315	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
316	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
317	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
318	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
319	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
320	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
321	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
322	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
323	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
324	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
325	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
326	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
327	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
328	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
329	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
330	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
331	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
332	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
333	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
334	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
335	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
336	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
337	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
338	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
339	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
340	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
341	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
342	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
343	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
344	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
345	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
346	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
347	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
348	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
349	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
350	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
351	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
352	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
353	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
354	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
355	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
356	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
357	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
358	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
359	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
360	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
361	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
362	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
363	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
364	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
365	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
366	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
367	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
368	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
369	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
370	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
371	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
372	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
373	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
374	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
375	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
376	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
377	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
378	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
379	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
380	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
381	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
382	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
383	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
384	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
385	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
386	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
387	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
388	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
389	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
390	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
391	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
392	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
393	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
394	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
395	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
396	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
397	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
398	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
399	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
400	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
401	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
402	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
403	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
404	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
405	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
406	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
407	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
408	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
409	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
410	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
411	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
412	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
413	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
414	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
415	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
416	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
417	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
418	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
419	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
420	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
421	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
422	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
423	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
424	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
425	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
426	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
427	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
428	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
429	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
430	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
431	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
432	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
433	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
434	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
435	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
436	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
437	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
438	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
439	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
440	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
441	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
442	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
443	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
444	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
445	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
446	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
447	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
448	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
449	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
450	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
451	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
452	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
453	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
454	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
455	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
456	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
457	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
458	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
459	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
460	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
461	3300049534	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
462	3300049541	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
463	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
464	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
465	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
466	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
467	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
468	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
469	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
470	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
471	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
472	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
473	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
474	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
475	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
476	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
477	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
478	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
479	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
480	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
481	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
482	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
483	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
484	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
485	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
486	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
487	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
488	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
489	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
490	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
491	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
492	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
493	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
494	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
495	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
496	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
497	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
498	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
499	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
500	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
501	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
502	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
503	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
504	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
505	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
506	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
507	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
508	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
509	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
510	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
511	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
512	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
513	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
514	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
515	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
516	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
517	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
518	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
519	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
520	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
521	8001781756	Catellatospora tritici NEAU-YM18	Isolate	Rhizosphere
522	8003314358	Amycolatopsis sp. MtRt-6	Isolate	Unclassified
523	8004021418	Arthrobacter sp. SDTb3-6	Isolate	Rhizosphere
524	8004182704	Microbacterium paraoxydans ku-mp	Isolate	Unclassified
525	8004212874	Microbacterium sp. NC79	Isolate	Rhizosphere
526	8025530807	Streptomyces sp. 4R-3d	Isolate	Unclassified
527	8045830549	Microbacterium yannicii DSM 23203	Isolate	Unclassified
528	8046352972	Agromyces mangrovi NBRC 112812	Isolate	Rhizosphere
529	8054107350	Arthrobacter rhizosphaerae CCNWLXL 1-35	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	87.02
Metatranscriptomes	1.25
Isolates	11.73

Biome Distribution

Category	Percentage (%)
Aerial Root	0.09
Bulb	0
Endosphere	7.61
Nodule	0.18
Rhizoplane	9.22
Rhizosphere	72.25
Stem	0
Stem Tuber	0
Unclassified	10.65

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10009451	3300001989	Bacteria	3633
2	JGI24743J22301_10056781	3300001991	Bacteria	803
3	JGI24735J21928_10095166	3300002067	Bacteria	854
4	JGI24744J21845_10014594	3300002077	Bacteria	1575
5	JGI24034J26672_10007917	3300002239	Bacteria	1548
6	JGI24742J22300_10003898	3300002244	Bacteria	2429
7	JGI24751J29686_10011299	3300002459	Bacteria	1841
8	JGI25152J39213_1000880	3300002773	Bacteria	14786
9	JGI25151J46595_10018202	3300003187	Bacteria	3026
10	Ga0006562J51391_1003117	3300003578	Bacteria	3094
11	Ga0006562J51391_1034758	3300003578	Bacteria	2406
12	Ga0006562J51391_1053282	3300003578	Bacteria	14980
13	Ga0006562J51391_1053284	3300003578	Bacteria	5590
14	Ga0006562J51391_1054739	3300003578	Bacteria	18638
15	Ga0006562J51391_1054740	3300003578	Bacteria	18110
16	Ga0006562J51391_1058391	3300003578	Bacteria	2470
17	Ga0055539_1000019	3300003752	Bacteria	341727
18	Ga0055533_1000023	3300003756	Bacteria	341727
19	Ga0055525_1000088	3300003759	Bacteria	143732
20	Ga0055525_1002620	3300003759	Bacteria	1769
21	Ga0058862_12361512	3300004803	Bacteria	809
22	Ga0065714_10074058	3300005288	Bacteria	3088
23	Ga0070658_10029024	3300005327	Bacteria	4442
24	Ga0070676_10010975	3300005328	Bacteria	4921
25	Ga0070683_100056071	3300005329	Bacteria	3659
26	Ga0070690_100033290	3300005330	Bacteria	3225
27	Ga0070670_100237865	3300005331	Bacteria	1585
28	Ga0070677_10001683	3300005333	Bacteria	6982
29	Ga0070677_10040972	3300005333	Bacteria	1826
30	Ga0068869_100005745	3300005334	Bacteria	7833
31	Ga0068869_100018804	3300005334	Bacteria	4710
32	Ga0070666_10008765	3300005335	Bacteria	6287
33	Ga0070666_10505304	3300005335	Bacteria	876
34	Ga0070682_100051658	3300005337	Bacteria	2569
35	Ga0070682_100079254	3300005337	Bacteria	2121
36	Ga0070682_100114978	3300005337	Bacteria	1799
37	Ga0070682_100400632	3300005337	Bacteria	1038
38	Ga0068868_100002900	3300005338	Bacteria	11902
39	Ga0068868_100275570	3300005338	Bacteria	1422
40	Ga0068868_100280001	3300005338	Bacteria	1411
41	Ga0070691_10018706	3300005341	Bacteria	3194
42	Ga0070687_100052698	3300005343	Bacteria	2113
43	Ga0070661_100090719	3300005344	Bacteria	2263
44	Ga0070692_10006674	3300005345	Bacteria	5029
45	Ga0070692_10281681	3300005345	Bacteria	1008
46	Ga0070668_100018783	3300005347	Bacteria	5192
47	Ga0070668_100028588	3300005347	Bacteria	4232
48	Ga0070668_100045797	3300005347	Bacteria	3356
49	Ga0070668_100112877	3300005347	Bacteria	2164
50	Ga0070668_100234696	3300005347	Bacteria	1517
51	Ga0070669_100003889	3300005353	Bacteria	10802
52	Ga0070669_100095770	3300005353	Bacteria	2233
53	Ga0070669_100124650	3300005353	Bacteria	1970
54	Ga0070669_100180840	3300005353	Bacteria	1649
55	Ga0070675_100006679	3300005354	Bacteria	8867
56	Ga0070671_100000491	3300005355	Bacteria	27625
57	Ga0070671_100019426	3300005355	Bacteria	5529
58	Ga0070671_100039712	3300005355	Bacteria	3907
59	Ga0070674_100003672	3300005356	Bacteria	8653
60	Ga0070674_100057050	3300005356	Bacteria	2710
61	Ga0070674_100168141	3300005356	Bacteria	1669
62	Ga0070674_100171827	3300005356	Bacteria	1653
63	Ga0070688_100085197	3300005365	Bacteria	2054
64	Ga0070659_100057236	3300005366	Bacteria	3074
65	Ga0070659_100112073	3300005366	Bacteria	2203
66	Ga0070667_100000220	3300005367	Bacteria	65980
67	Ga0070667_100002848	3300005367	Bacteria	14930
68	Ga0070667_100016198	3300005367	Bacteria	6167
69	Ga0070667_100154020	3300005367	Bacteria	2021
70	Ga0070667_100625205	3300005367	Bacteria	993
71	Ga0070667_100788003	3300005367	Bacteria	882
72	Ga0070709_10023858	3300005434	Bacteria	3597
73	Ga0070709_10035023	3300005434	Bacteria	3049
74	Ga0070714_100029373	3300005435	Bacteria	4571
75	Ga0070714_100114939	3300005435	Bacteria	2388
76	Ga0070710_10005701	3300005437	Bacteria	5927
77	Ga0070710_10017759	3300005437	Bacteria	3648
78	Ga0070711_100015015	3300005439	Bacteria	4894
79	Ga0070711_100025598	3300005439	Bacteria	3862
80	Ga0070711_100246214	3300005439	Bacteria	1400
81	Ga0070705_100011446	3300005440	Bacteria	4475
82	Ga0070705_100093122	3300005440	Bacteria	1883
83	Ga0070700_100027071	3300005441	Bacteria	3396
84	Ga0070700_100504531	3300005441	Bacteria	931
85	Ga0070663_100076780	3300005455	Bacteria	2444
86	Ga0070663_100085574	3300005455	Bacteria	2327
87	Ga0070663_100117476	3300005455	Bacteria	2006
88	Ga0070663_100367884	3300005455	Bacteria	1168
89	Ga0070678_100000278	3300005456	Bacteria	23752
90	Ga0070678_100522240	3300005456	Bacteria	1050
91	Ga0070678_100715623	3300005456	Bacteria	903
92	Ga0070662_100006620	3300005457	Bacteria	7478
93	Ga0070685_10021239	3300005466	Bacteria	3527
94	Ga0070685_10059427	3300005466	Bacteria	2232
95	Ga0070685_10128626	3300005466	Bacteria	1581
96	Ga0070684_100058202	3300005535	Bacteria	3377
97	Ga0070684_100063282	3300005535	Bacteria	3243
98	Ga0070684_100162023	3300005535	Bacteria	2030
99	Ga0068853_100018427	3300005539	Bacteria	5777
100	Ga0068853_100023449	3300005539	Bacteria	5167
101	Ga0070672_100021981	3300005543	Bacteria	4677
102	Ga0070672_100691290	3300005543	Bacteria	893
103	Ga0070686_100052593	3300005544	Bacteria	2598
104	Ga0070695_100009178	3300005545	Bacteria	5881
105	Ga0070696_100014539	3300005546	Bacteria	5282
106	Ga0070693_100388410	3300005547	Bacteria	965
107	Ga0070665_100009829	3300005548	Bacteria	9669
108	Ga0070665_100062468	3300005548	Bacteria	3735
109	Ga0070665_100259995	3300005548	Bacteria	1737
110	Ga0070665_100457000	3300005548	Bacteria	1287
111	Ga0070704_100001527	3300005549	Bacteria	12487
112	Ga0068855_100385782	3300005563	Bacteria	1537
113	Ga0070664_100315715	3300005564	Bacteria	1415
114	Ga0068857_100012849	3300005577	Bacteria	7295
115	Ga0068854_100003078	3300005578	Bacteria	10389
116	Ga0070702_100001231	3300005615	Bacteria	10367
117	Ga0070702_100655745	3300005615	Bacteria	794
118	Ga0068852_100101458	3300005616	Bacteria	2598
119	Ga0068852_100104033	3300005616	Bacteria	2569
120	Ga0068852_100133639	3300005616	Bacteria	2288
121	Ga0068859_100001001	3300005617	Bacteria	28962
122	Ga0068859_100005790	3300005617	Bacteria	12555
123	Ga0068859_100075633	3300005617	Bacteria	3408
124	Ga0068859_100296633	3300005617	Bacteria	1710
125	Ga0068866_10001053	3300005718	Bacteria	12150
126	Ga0068866_10112295	3300005718	Bacteria	1523
127	Ga0068861_100001520	3300005719	Bacteria	14690
128	Ga0068861_100028205	3300005719	Bacteria	4096
129	Ga0068870_10231469	3300005840	Bacteria	1136
130	Ga0068863_100000442	3300005841	Bacteria	42019
131	Ga0068863_100047974	3300005841	Bacteria	4049
132	Ga0068858_100014505	3300005842	Bacteria	7423
133	Ga0068858_100023784	3300005842	Bacteria	5708
134	Ga0068858_100026185	3300005842	Bacteria	5423
135	Ga0068860_100000150	3300005843	Bacteria	113021
136	Ga0068860_100006062	3300005843	Bacteria	12168
137	Ga0068862_100000078	3300005844	Bacteria	114008
138	Ga0068862_100003622	3300005844	Bacteria	13216
139	Ga0068862_100127113	3300005844	Bacteria	2251
140	Ga0068862_100346316	3300005844	Bacteria	1377
141	Ga0068862_100761151	3300005844	Bacteria	943
142	Ga0081455_10034395	3300005937	Bacteria	4540
143	Ga0081455_10069204	3300005937	Bacteria	2936
144	Ga0070717_10250338	3300006028	Bacteria	1565
145	Ga0075365_10010672	3300006038	Bacteria	5365
146	Ga0075365_10041609	3300006038	Bacteria	3003
147	Ga0075365_10094661	3300006038	Bacteria	2039
148	Ga0075365_10229399	3300006038	Bacteria	1303
149	Ga0075363_100001481	3300006048	Bacteria	8938
150	Ga0075363_100011963	3300006048	Bacteria	4171
151	Ga0075363_100047614	3300006048	Bacteria	2278
152	Ga0075363_100047773	3300006048	Bacteria	2274
153	Ga0075363_100123137	3300006048	Bacteria	1449
154	Ga0075363_100192223	3300006048	Bacteria	1164
155	Ga0075364_10004342	3300006051	Bacteria	8134
156	Ga0075364_10011414	3300006051	Bacteria	5397
157	Ga0075364_10016519	3300006051	Bacteria	4593
158	Ga0075364_10021753	3300006051	Bacteria	4043
159	Ga0075364_10134494	3300006051	Bacteria	1661
160	Ga0075364_10156142	3300006051	Bacteria	1539
161	Ga0075364_10167021	3300006051	Bacteria	1487
162	Ga0075364_10385135	3300006051	Bacteria	956
163	Ga0075432_10000242	3300006058	Bacteria	14759
164	Ga0075432_10001139	3300006058	Bacteria	8510
165	Ga0075432_10002921	3300006058	Bacteria	5748
166	Ga0070715_10040086	3300006163	Bacteria	1956
167	Ga0070712_100001364	3300006175	Bacteria	14811
168	Ga0075367_10015753	3300006178	Bacteria	4116
169	Ga0075367_10229050	3300006178	Bacteria	1164
170	Ga0075369_10001579	3300006186	Bacteria	7826
171	Ga0075369_10003092	3300006186	Bacteria	6026
172	Ga0075369_10008700	3300006186	Bacteria	3919
173	Ga0075369_10018523	3300006186	Bacteria	2836
174	Ga0075369_10018594	3300006186	Bacteria	2831
175	Ga0075369_10029707	3300006186	Bacteria	2298
176	Ga0075369_10117877	3300006186	Bacteria	1200
177	Ga0097621_100455615	3300006237	Bacteria	1153
178	Ga0075370_10026865	3300006353	Bacteria	3191
179	Ga0075370_10045241	3300006353	Bacteria	2489
180	Ga0075370_10191100	3300006353	Bacteria	1206
181	Ga0075428_100022228	3300006844	Bacteria	7022
182	Ga0075428_100092251	3300006844	Bacteria	3302
183	Ga0075430_100299678	3300006846	Bacteria	1330
184	Ga0075431_100022463	3300006847	Bacteria	6449
185	Ga0075431_100075931	3300006847	Bacteria	3468
186	Ga0075433_10003360	3300006852	Bacteria	12371
187	Ga0075433_10006369	3300006852	Bacteria	9332
188	Ga0075434_100000910	3300006871	Bacteria	23742
189	Ga0075434_100001550	3300006871	Bacteria	19467
190	Ga0075429_100154001	3300006880	Bacteria	2013
191	Ga0068865_100004213	3300006881	Bacteria	8667
192	Ga0068865_100027123	3300006881	Bacteria	3781
193	Ga0068865_100526059	3300006881	Bacteria	990
194	Ga0075436_100002147	3300006914	Bacteria	13597
195	Ga0097620_100001001	3300006931	Bacteria	28962
196	Ga0097620_100005791	3300006931	Bacteria	12555
197	Ga0097620_100075633	3300006931	Bacteria	3408
198	Ga0097620_100296649	3300006931	Bacteria	1710
199	Ga0075435_100002984	3300007076	Bacteria	11381
200	Ga0075435_100011330	3300007076	Bacteria	6554
201	Ga0105251_10029977	3300009011	Bacteria	2736
202	Ga0105251_10029994	3300009011	Bacteria	2735
203	Ga0105244_10000373	3300009036	Bacteria	41552
204	Ga0105244_10002548	3300009036	Bacteria	13682
205	Ga0105244_10027622	3300009036	Bacteria	3056
206	Ga0105244_10110566	3300009036	Bacteria	1337
207	Ga0105240_10146680	3300009093	Bacteria	2815
208	Ga0105240_10569953	3300009093	Bacteria	1250
209	Ga0111539_10016681	3300009094	Bacteria	9103
210	Ga0105245_10007016	3300009098	Bacteria	9883
211	Ga0105245_10175709	3300009098	Bacteria	2042
212	Ga0105245_10294813	3300009098	Bacteria	1590
213	Ga0105245_10448311	3300009098	Bacteria	1298
214	Ga0105247_10000074	3300009101	Bacteria	113207
215	Ga0105247_10018232	3300009101	Bacteria	4211
216	Ga0105247_10143500	3300009101	Bacteria	1567
217	Ga0105247_10257983	3300009101	Bacteria	1194
218	Ga0114129_10001649	3300009147	Bacteria	30343
219	Ga0114129_10014817	3300009147	Bacteria	11110
220	Ga0114129_10585768	3300009147	Bacteria	1447
221	Ga0105243_10001864	3300009148	Bacteria	17998
222	Ga0105243_10004341	3300009148	Bacteria	11227
223	Ga0105243_10006613	3300009148	Bacteria	8952
224	Ga0105243_10008548	3300009148	Bacteria	7855
225	Ga0105243_10040067	3300009148	Bacteria	3656
226	Ga0105243_10044421	3300009148	Bacteria	3486
227	Ga0105241_10015734	3300009174	Bacteria	5542
228	Ga0105242_10001286	3300009176	Bacteria	19813
229	Ga0105242_10003622	3300009176	Bacteria	12025
230	Ga0105242_10193796	3300009176	Bacteria	1801
231	Ga0105242_10209662	3300009176	Bacteria	1736
232	Ga0105242_10244572	3300009176	Bacteria	1614
233	Ga0105248_10000077	3300009177	Bacteria	113148
234	Ga0105248_10009879	3300009177	Bacteria	10507
235	Ga0105248_10010973	3300009177	Bacteria	9996
236	Ga0105248_10060850	3300009177	Bacteria	4239
237	Ga0105248_10641334	3300009177	Bacteria	1198
238	Ga0105237_10004421	3300009545	Bacteria	16294
239	Ga0105237_10477732	3300009545	Bacteria	1253
240	Ga0105238_10451835	3300009551	Bacteria	1282
241	Ga0105249_10000111	3300009553	Bacteria	109164
242	Ga0105249_10006026	3300009553	Bacteria	10506
243	Ga0105249_10011082	3300009553	Bacteria	7922
244	Ga0105249_10049655	3300009553	Bacteria	3826
245	Ga0105249_10066354	3300009553	Bacteria	3322
246	Ga0105239_10027436	3300010375	Bacteria	6270
247	Ga0105239_10477112	3300010375	Bacteria	1417
248	Ga0105246_10030241	3300011119	Bacteria	3575
249	Ga0105246_10203638	3300011119	Bacteria	1540
250	Ga0105246_10236489	3300011119	Bacteria	1442
251	Ga0105246_10236929	3300011119	Bacteria	1440
252	Ga0157373_10189563	3300013100	Bacteria	1449
253	Ga0157371_10033164	3300013102	Bacteria	3712
254	Ga0157371_10175704	3300013102	Bacteria	1531
255	Ga0157374_10006732	3300013296	Bacteria	9768
256	Ga0157374_10585649	3300013296	Bacteria	1125
257	Ga0157378_10056122	3300013297	Bacteria	3509
258	Ga0157378_10161870	3300013297	Bacteria	2093
259	Ga0163162_10013411	3300013306	Bacteria	8001
260	Ga0163162_10036603	3300013306	Bacteria	4893
261	Ga0163162_10037844	3300013306	Bacteria	4815
262	Ga0163162_10074883	3300013306	Bacteria	3445
263	Ga0163162_10240931	3300013306	Bacteria	1939
264	Ga0163162_10419311	3300013306	Bacteria	1471
265	Ga0163162_10829686	3300013306	Bacteria	1041
266	Ga0157372_10026918	3300013307	Bacteria	6259
267	Ga0157372_10163630	3300013307	Bacteria	2572
268	Ga0157372_10292956	3300013307	Bacteria	1893
269	Ga0157372_10445692	3300013307	Bacteria	1509
270	Ga0157372_10459318	3300013307	Bacteria	1484
271	Ga0157375_10003630	3300013308	Bacteria	13384
272	Ga0157375_10240627	3300013308	Bacteria	1969
273	Ga0157375_10597147	3300013308	Bacteria	1263
274	Ga0157375_10736175	3300013308	Bacteria	1138
275	Ga0157375_10974546	3300013308	Bacteria	989
276	Ga0157375_11304545	3300013308	Bacteria	853
277	Ga0163163_10045899	3300014325	Bacteria	4290
278	Ga0163163_10054964	3300014325	Bacteria	3935
279	Ga0163163_10703814	3300014325	Bacteria	1074
280	Ga0157380_10009611	3300014326	Bacteria	6935
281	Ga0157380_10133502	3300014326	Bacteria	2121
282	Ga0157377_10012938	3300014745	Bacteria	4209
283	Ga0157377_10237708	3300014745	Bacteria	1174
284	Ga0157379_10014509	3300014968	Bacteria	6914
285	Ga0163161_10003185	3300017792	Bacteria	11553
286	Ga0163161_10105100	3300017792	Bacteria	2106
287	Ga0163161_10147843	3300017792	Bacteria	1784
288	Ga0197907_10427212	3300020069	Bacteria	948
289	Ga0206356_11020267	3300020070	Bacteria	979
290	Ga0206353_10786218	3300020082	Bacteria	7934
291	Ga0224712_10003216	3300022467	Bacteria	4200
292	Ga0209566_100031	3300025225	Bacteria	341555
293	Ga0209674_100001	3300025226	Bacteria	4013750
294	Ga0209563_100001	3300025230	Bacteria	4013775
295	Ga0209563_100229	3300025230	Bacteria	27477
296	Ga0207425_1028671	3300025245	Bacteria	1127
297	Ga0209677_100001	3300025253	Bacteria	4013787
298	Ga0209677_101081	3300025253	Bacteria	12848
299	Ga0209148_1008970	3300025254	Bacteria	1978
300	Ga0209129_1000096	3300025258	Bacteria	166298
301	Ga0209455_1001696	3300025272	Bacteria	9439
302	Ga0209025_1000045	3300025294	Bacteria	349118
303	Ga0209051_1001556	3300025303	Bacteria	18974
304	Ga0209051_1002083	3300025303	Bacteria	15089
305	Ga0209051_1008663	3300025303	Bacteria	5353
306	Ga0209051_1037139	3300025303	Bacteria	1790
307	Ga0207697_10000839	3300025315	Bacteria	17373
308	Ga0207697_10002412	3300025315	Bacteria	9728
309	Ga0207655_1000650	3300025728	Bacteria	41560
310	Ga0207655_1002763	3300025728	Bacteria	13690
311	Ga0207655_1005533	3300025728	Bacteria	8569
312	Ga0207655_1133645	3300025728	Bacteria	805
313	Ga0207713_1052264	3300025735	Bacteria	1619
314	Ga0207713_1081378	3300025735	Bacteria	1164
315	Ga0207682_10007629	3300025893	Bacteria	4305
316	Ga0207682_10046093	3300025893	Bacteria	1791
317	Ga0207692_10002014	3300025898	Bacteria	7757
318	Ga0207692_10010414	3300025898	Bacteria	3918
319	Ga0207642_10001341	3300025899	Bacteria	7622
320	Ga0207642_10103294	3300025899	Bacteria	1435
321	Ga0207710_10000086	3300025900	Bacteria	129918
322	Ga0207710_10012542	3300025900	Bacteria	3567
323	Ga0207688_10000835	3300025901	Bacteria	15460
324	Ga0207688_10002243	3300025901	Bacteria	10419
325	Ga0207680_10064946	3300025903	Bacteria	2239
326	Ga0207647_10136082	3300025904	Bacteria	1442
327	Ga0207647_10159320	3300025904	Bacteria	1317
328	Ga0207699_10027566	3300025906	Bacteria	3147
329	Ga0207699_10035694	3300025906	Bacteria	2830
330	Ga0207645_10001139	3300025907	Bacteria	21970
331	Ga0207654_10174933	3300025911	Bacteria	1397
332	Ga0207671_10010386	3300025914	Bacteria	7685
333	Ga0207693_10000380	3300025915	Bacteria	40807
334	Ga0207693_10007220	3300025915	Bacteria	9144
335	Ga0207663_10003258	3300025916	Bacteria	7916
336	Ga0207662_10117900	3300025918	Bacteria	1662
337	Ga0207657_10230054	3300025919	Bacteria	1483
338	Ga0207657_10371892	3300025919	Bacteria	1126
339	Ga0207681_10004059	3300025923	Bacteria	9070
340	Ga0207681_10020783	3300025923	Bacteria	4165
341	Ga0207681_10310881	3300025923	Bacteria	1250
342	Ga0207650_10303598	3300025925	Bacteria	1304
343	Ga0207659_10014269	3300025926	Bacteria	5116
344	Ga0207659_10049664	3300025926	Bacteria	2977
345	Ga0207687_10002408	3300025927	Bacteria	12683
346	Ga0207687_10134259	3300025927	Bacteria	1870
347	Ga0207687_10140877	3300025927	Bacteria	1829
348	Ga0207664_10008656	3300025929	Bacteria	7114
349	Ga0207664_10021922	3300025929	Bacteria	4759
350	Ga0207644_10006814	3300025931	Bacteria	7443
351	Ga0207644_10042060	3300025931	Bacteria	3236
352	Ga0207644_10058158	3300025931	Bacteria	2793
353	Ga0207690_10074304	3300025932	Bacteria	2354
354	Ga0207690_10075436	3300025932	Bacteria	2339
355	Ga0207706_10005792	3300025933	Bacteria	11497
356	Ga0207706_10036518	3300025933	Bacteria	4365
357	Ga0207686_10042297	3300025934	Bacteria	2784
358	Ga0207686_10059349	3300025934	Bacteria	2417
359	Ga0207709_10000356	3300025935	Bacteria	46632
360	Ga0207709_10002838	3300025935	Bacteria	10645
361	Ga0207709_10007401	3300025935	Bacteria	6115
362	Ga0207709_10112655	3300025935	Bacteria	1822
363	Ga0207709_10222631	3300025935	Bacteria	1362
364	Ga0207670_10260204	3300025936	Bacteria	1345
365	Ga0207669_10000773	3300025937	Bacteria	13712
366	Ga0207669_10061543	3300025937	Bacteria	2307
367	Ga0207669_10064417	3300025937	Bacteria	2268
368	Ga0207669_10120317	3300025937	Bacteria	1781
369	Ga0207704_10314596	3300025938	Bacteria	1205
370	Ga0207665_10013734	3300025939	Bacteria	5326
371	Ga0207691_10000652	3300025940	Bacteria	34259
372	Ga0207691_10054380	3300025940	Bacteria	3652
373	Ga0207691_10543401	3300025940	Bacteria	985
374	Ga0207711_10000577	3300025941	Bacteria	37314
375	Ga0207711_10187687	3300025941	Bacteria	1883
376	Ga0207711_10300887	3300025941	Bacteria	1479
377	Ga0207689_10009498	3300025942	Bacteria	8398
378	Ga0207689_10023645	3300025942	Bacteria	5153
379	Ga0207667_10103566	3300025949	Bacteria	2935
380	Ga0207667_10580766	3300025949	Bacteria	1131
381	Ga0207651_10075121	3300025960	Bacteria	2410
382	Ga0207651_10117816	3300025960	Bacteria	2007
383	Ga0207712_10000162	3300025961	Bacteria	69049
384	Ga0207712_10007565	3300025961	Bacteria	6863
385	Ga0207712_10270512	3300025961	Bacteria	1382
386	Ga0207668_10000532	3300025972	Bacteria	23828
387	Ga0207668_10003762	3300025972	Bacteria	8933
388	Ga0207668_10027637	3300025972	Bacteria	3698
389	Ga0207668_10280649	3300025972	Bacteria	1366
390	Ga0207668_10443312	3300025972	Bacteria	1106
391	Ga0207640_10009269	3300025981	Bacteria	5506
392	Ga0207640_10080078	3300025981	Bacteria	2228
393	Ga0207640_10080882	3300025981	Bacteria	2219
394	Ga0207658_10000314	3300025986	Bacteria	48821
395	Ga0207658_10003281	3300025986	Bacteria	11491
396	Ga0207658_10114605	3300025986	Bacteria	2137
397	Ga0207658_10224436	3300025986	Bacteria	1582
398	Ga0207677_10007347	3300026023	Bacteria	6087
399	Ga0207677_10073990	3300026023	Bacteria	2415
400	Ga0207677_10259835	3300026023	Bacteria	1415
401	Ga0207703_10007759	3300026035	Bacteria	8493
402	Ga0207639_10012620	3300026041	Bacteria	5888
403	Ga0207639_10350964	3300026041	Bacteria	1317
404	Ga0207678_10026792	3300026067	Bacteria	5028
405	Ga0207678_10137189	3300026067	Bacteria	2087
406	Ga0207678_10143382	3300026067	Bacteria	2039
407	Ga0207678_10205680	3300026067	Bacteria	1684
408	Ga0207708_10028734	3300026075	Bacteria	4211
409	Ga0207708_10035669	3300026075	Bacteria	3785
410	Ga0207708_10095433	3300026075	Bacteria	2297
411	Ga0207702_10078044	3300026078	Bacteria	2866
412	Ga0207702_10147655	3300026078	Bacteria	2135
413	Ga0207641_10001022	3300026088	Bacteria	28402
414	Ga0207641_10144809	3300026088	Bacteria	2147
415	Ga0207641_10512377	3300026088	Bacteria	1166
416	Ga0207648_10006374	3300026089	Bacteria	11728
417	Ga0207648_10061401	3300026089	Bacteria	3277
418	Ga0207648_10225346	3300026089	Bacteria	1667
419	Ga0207648_10437346	3300026089	Bacteria	1189
420	Ga0207674_10012314	3300026116	Bacteria	9563
421	Ga0207674_10042173	3300026116	Bacteria	4715
422	Ga0207675_100000475	3300026118	Bacteria	39052
423	Ga0207675_100035155	3300026118	Bacteria	4674
424	Ga0207675_100037740	3300026118	Bacteria	4506
425	Ga0207683_10000256	3300026121	Bacteria	47418
426	Ga0207683_10003221	3300026121	Bacteria	14238
427	Ga0207683_10007195	3300026121	Bacteria	9538
428	Ga0207683_10022405	3300026121	Bacteria	5422
429	Ga0207683_10049233	3300026121	Bacteria	3689
430	Ga0207683_10650268	3300026121	Bacteria	977
431	Ga0207698_10133743	3300026142	Bacteria	2124
432	Ga0207698_10151339	3300026142	Bacteria	2014
433	Ga0207428_10000407	3300027907	Bacteria	53529
434	Ga0207428_10004915	3300027907	Bacteria	12600
435	Ga0268266_10021094	3300028379	Bacteria	5551
436	Ga0268266_10022136	3300028379	Bacteria	5417
437	Ga0268266_10110824	3300028379	Bacteria	2431
438	Ga0268266_10171592	3300028379	Bacteria	1969
439	Ga0268265_10000012	3300028380	Bacteria	343132
440	Ga0268264_10000104	3300028381	Bacteria	217837
441	Ga0268264_10018142	3300028381	Bacteria	5755
442	Ga0268264_10086900	3300028381	Bacteria	2688
443	Ga0307515_10196411	3300028794	Bacteria	1908
444	Ga0307511_10067618	3300030521	Bacteria	2649
445	Ga0307512_10037861	3300030522	Bacteria	4068
446	Ga0307513_10083168	3300031456	Bacteria	3292
447	Ga0307408_100005048	3300031548	Bacteria	8853
448	Ga0307408_100020166	3300031548	Bacteria	4494
449	Ga0307408_100030821	3300031548	Bacteria	3727
450	Ga0307408_100061809	3300031548	Bacteria	2735
451	Ga0307508_10005275	3300031616	Bacteria	12338
452	Ga0307516_10135823	3300031730	Bacteria	2234
453	Ga0307405_10002614	3300031731	Bacteria	7999
454	Ga0307405_10038271	3300031731	Bacteria	2890
455	Ga0307405_10124889	3300031731	Bacteria	1767
456	Ga0307405_10239878	3300031731	Bacteria	1342
457	Ga0307405_10421772	3300031731	Bacteria	1050
458	Ga0307413_10016733	3300031824	Bacteria	3799
459	Ga0307413_10087783	3300031824	Bacteria	2016
460	Ga0307413_10098580	3300031824	Bacteria	1924
461	Ga0307410_10002987	3300031852	Bacteria	8350
462	Ga0307410_10008070	3300031852	Bacteria	5815
463	Ga0307410_10066335	3300031852	Bacteria	2486
464	Ga0307410_10179846	3300031852	Bacteria	1600
465	Ga0307410_10343676	3300031852	Bacteria	1190
466	Ga0307406_10000178	3300031901	Bacteria	38000
467	Ga0307406_10000792	3300031901	Bacteria	17695
468	Ga0307406_10003079	3300031901	Bacteria	9076
469	Ga0307406_10033043	3300031901	Bacteria	3163
470	Ga0307406_10039861	3300031901	Bacteria	2917
471	Ga0307406_10057964	3300031901	Bacteria	2487
472	Ga0307406_10247747	3300031901	Bacteria	1340
473	Ga0307407_10004919	3300031903	Bacteria	5738
474	Ga0307407_10016971	3300031903	Bacteria	3640
475	Ga0307407_10068883	3300031903	Bacteria	2098
476	Ga0307407_10101563	3300031903	Bacteria	1786
477	Ga0307407_10213655	3300031903	Bacteria	1300
478	Ga0307407_10372050	3300031903	Bacteria	1018
479	Ga0307412_10001699	3300031911	Bacteria	12169
480	Ga0307412_10038733	3300031911	Bacteria	3072
481	Ga0307412_10064067	3300031911	Bacteria	2482
482	Ga0307412_10140961	3300031911	Bacteria	1765
483	Ga0307412_10194790	3300031911	Bacteria	1535
484	Ga0307412_10375383	3300031911	Bacteria	1149
485	Ga0307412_10564749	3300031911	Bacteria	958
486	Ga0307412_10677049	3300031911	Bacteria	883
487	Ga0307409_100000015	3300031995	Bacteria	61871
488	Ga0307409_100001521	3300031995	Bacteria	11486
489	Ga0307409_100012965	3300031995	Bacteria	5339
490	Ga0307409_100028290	3300031995	Bacteria	3990
491	Ga0307409_100262285	3300031995	Bacteria	1586
492	Ga0307409_100279382	3300031995	Bacteria	1542
493	Ga0307409_100496648	3300031995	Bacteria	1187
494	Ga0307416_100000138	3300032002	Bacteria	42771
495	Ga0307416_100006430	3300032002	Bacteria	7358
496	Ga0307416_100019304	3300032002	Bacteria	4829
497	Ga0307416_100038397	3300032002	Bacteria	3695
498	Ga0307416_100396159	3300032002	Bacteria	1416
499	Ga0307416_100429071	3300032002	Bacteria	1368
500	Ga0307416_100598298	3300032002	Bacteria	1182
501	Ga0307414_10015195	3300032004	Bacteria	4642
502	Ga0307414_10085508	3300032004	Bacteria	2324
503	Ga0307411_10172076	3300032005	Bacteria	1634
504	Ga0307411_10246180	3300032005	Bacteria	1403
505	Ga0307415_100001322	3300032126	Bacteria	11733
506	Ga0307415_100038186	3300032126	Bacteria	3163
507	Ga0307415_100277758	3300032126	Bacteria	1376
508	Ga0307507_10027354	3300033179	Bacteria	6115
509	Ga0307507_10089811	3300033179	Bacteria	2641
510	Ga0373952_0032887	3300035092	Bacteria	1161
511	Ga0373941_0060676	3300035115	Bacteria	1230
512	Ga0373960_0019111	3300035121	Bacteria	1796
513	Ga0373942_0043822	3300035207	Bacteria	1231
514	Ga0373962_0076180	3300035242	Bacteria	1011
515	Ga0373931_0013372	3300035691	Bacteria	3996
516	Ga0373947_0105426	3300035725	Bacteria	1776
517	Ga0395899_0004087	3300037312	Bacteria	11490
518	Ga0395899_0021796	3300037312	Bacteria	4859
519	Ga0395899_0084014	3300037312	Bacteria	2315
520	Ga0395900_0006555	3300037418	Bacteria	12125
521	Ga0395900_0025070	3300037418	Bacteria	6104
522	Ga0395900_0115435	3300037418	Bacteria	2755
523	Ga0395898_0019822	3300037466	Bacteria	6840
524	Ga0395898_0055784	3300037466	Bacteria	3854
525	Ga0395898_0512119	3300037466	Bacteria	1141
526	Ga0395901_0049853	3300038443	Bacteria	4351
527	Ga0395901_0080666	3300038443	Bacteria	3398
528	Ga0395901_0214278	3300038443	Bacteria	2014
529	Ga0395901_0503555	3300038443	Bacteria	1233
530	Ga0395901_0797711	3300038443	Bacteria	933
531	Ga0439436_0000283	3300041404	Bacteria	12291
532	Ga0439439_0007960	3300041406	Bacteria	2491
533	Ga0439439_0053794	3300041406	Bacteria	1059
534	Ga0439461_0001656	3300041410	Bacteria	3468
535	Ga0439466_0004947	3300041411	Bacteria	5121
536	Ga0439466_0021222	3300041411	Bacteria	2305
537	Ga0439466_0031523	3300041411	Bacteria	1812
538	Ga0439466_0082574	3300041411	Bacteria	1013
539	Ga0439465_0004404	3300041413	Bacteria	4555
540	Ga0439465_0007398	3300041413	Bacteria	3488
541	Ga0439465_0008108	3300041413	Bacteria	3317
542	Ga0451791_0976903	3300041451	Bacteria	8746
543	Ga0451793_0846719	3300041452	Bacteria	1234
544	Ga0451793_1668687	3300041452	Bacteria	1100
545	Ga0451843_0112597	3300041509	Bacteria	5672
546	Ga0451853_0182249	3300041512	Bacteria	6356
547	Ga0439431_0005010	3300041997	Bacteria	2917
548	Ga0439433_0000008	3300041999	Bacteria	33224
549	Ga0439442_000033	3300042002	Bacteria	32780
550	Ga0439442_000171	3300042002	Bacteria	16439
551	Ga0439442_037834	3300042002	Bacteria	1011
552	Ga0439432_052044	3300042006	Bacteria	1275
553	Ga0439449_0002123	3300042007	Bacteria	7780
554	Ga0439449_0006424	3300042007	Bacteria	4495
555	Ga0439449_0047469	3300042007	Bacteria	1590
556	Ga0439457_000413	3300042014	Bacteria	12237
557	Ga0439462_0004028	3300042015	Bacteria	3563
558	Ga0439463_000941	3300042016	Bacteria	7985
559	Ga0450920_000604	3300042122	Bacteria	5736
560	Ga0450907_000200	3300042146	Bacteria	21689
561	Ga0450907_028214	3300042146	Bacteria	952
562	Ga0439434_0000721	3300042435	Bacteria	9481
563	Ga0439434_0007816	3300042435	Bacteria	3136
564	Ga0439434_0022273	3300042435	Bacteria	1904
565	Ga0439434_0038854	3300042435	Bacteria	1459
566	Ga0439444_0043169	3300042437	Bacteria	893
567	Ga0439459_0003085	3300042438	Bacteria	2616
568	Ga0439464_0036428	3300042439	Bacteria	1392
569	Ga0450918_003834	3300042531	Bacteria	2770
570	Ga0466969_0002553	3300044656	Bacteria	9733
571	Ga0466969_0206837	3300044656	Bacteria	895
572	Ga0466972_0002999	3300044658	Bacteria	8363
573	Ga0466972_0015648	3300044658	Bacteria	3793
574	Ga0466972_0019037	3300044658	Bacteria	3433
575	Ga0466972_0037094	3300044658	Bacteria	2383
576	Ga0466972_0053379	3300044658	Bacteria	1946
577	Ga0466972_0201960	3300044658	Bacteria	931
578	Ga0466965_0005502	3300044683	Bacteria	5711
579	Ga0466965_0016622	3300044683	Bacteria	3505
580	Ga0466965_0031943	3300044683	Bacteria	2570
581	Ga0466965_0181163	3300044683	Bacteria	1111
582	Ga0466966_0007305	3300044684	Bacteria	7322
583	Ga0466966_0008974	3300044684	Bacteria	6626
584	Ga0466966_0034293	3300044684	Bacteria	3282
585	Ga0466966_0083173	3300044684	Bacteria	1992
586	Ga0466961_0036439	3300044693	Bacteria	3157
587	Ga0466961_0049545	3300044693	Bacteria	2684
588	Ga0466961_0420802	3300044693	Bacteria	810
589	Ga0466963_0315434	3300044694	Bacteria	1100
590	Ga0466964_0014813	3300044706	Unclassified	2967
591	Ga0466971_0012969	3300044719	Bacteria	3656
592	Ga0466968_0000840	3300044735	Bacteria	10734
593	Ga0466968_0013643	3300044735	Bacteria	3197
594	Ga0466970_0000612	3300044765	Bacteria	17517
595	Ga0466970_0016917	3300044765	Bacteria	3764
596	Ga0466970_0034415	3300044765	Bacteria	2681
597	Ga0466970_0038312	3300044765	Bacteria	2542
598	Ga0466970_0103022	3300044765	Bacteria	1555
599	Ga0466970_0175584	3300044765	Bacteria	1188
600	Ga0466957_0012742	3300044842	Bacteria	4872
601	Ga0466957_0148729	3300044842	Bacteria	1513
602	Ga0466960_0000765	3300044901	Bacteria	11304
603	Ga0466960_0008055	3300044901	Bacteria	4302
604	Ga0466960_0008326	3300044901	Bacteria	4243
605	Ga0466960_0050712	3300044901	Bacteria	2002
606	Ga0466960_0050947	3300044901	Bacteria	1998
607	Ga0466959_0008744	3300045049	Bacteria	7168
608	Ga0466959_0014228	3300045049	Bacteria	5774
609	Ga0466959_0049817	3300045049	Bacteria	3076
610	Ga0466959_0158512	3300045049	Bacteria	1592
611	Ga0466959_0188055	3300045049	Bacteria	1442
612	Ga0466958_0003442	3300045836	Bacteria	8210
613	Ga0466958_0033749	3300045836	Bacteria	3050
614	Ga0466967_0021027	3300045976	Bacteria	5287
615	Ga0466967_0363665	3300045976	Bacteria	1402
616	Ga0466967_0393462	3300045976	Bacteria	1347
617	Ga0466967_0489475	3300045976	Bacteria	1206
618	Ga0495603_0002075	3300046455	Bacteria	11787
619	Ga0495603_0020591	3300046455	Bacteria	3996
620	Ga0495590_0089886	3300046457	Bacteria	1086
621	Ga0495629_0007580	3300046459	Bacteria	7996
622	Ga0495629_0015964	3300046459	Bacteria	5396
623	Ga0495629_0110979	3300046459	Bacteria	1912
624	Ga0495629_0437335	3300046459	Bacteria	887
625	Ga0495638_0001757	3300046460	Bacteria	18992
626	Ga0495641_0016962	3300046461	Bacteria	3814
627	Ga0495580_0059547	3300046472	Bacteria	2684
628	Ga0495580_0156652	3300046472	Bacteria	1577
629	Ga0495582_0015291	3300046473	Bacteria	4218
630	Ga0495582_0206143	3300046473	Bacteria	1123
631	Ga0495639_0013932	3300046475	Bacteria	3478
632	Ga0495639_0014643	3300046475	Bacteria	3397
633	Ga0495662_0003617	3300046476	Bacteria	7796
634	Ga0495662_0028615	3300046476	Bacteria	2690
635	Ga0495662_0149971	3300046476	Bacteria	1148
636	Ga0495664_0330671	3300046477	Bacteria	919
637	Ga0495584_0185948	3300046491	Bacteria	1056
638	Ga0495594_0023043	3300046499	Bacteria	3335
639	Ga0495594_0211522	3300046499	Bacteria	1106
640	Ga0495607_0241478	3300046501	Bacteria	874
641	Ga0495606_0006016	3300046507	Bacteria	11368
642	Ga0495606_0052510	3300046507	Bacteria	2650
643	Ga0495608_0179653	3300046511	Bacteria	1339
644	Ga0495631_0126137	3300046518	Bacteria	1100
645	Ga0495648_0001893	3300046524	Bacteria	19981
646	Ga0495663_0117293	3300046525	Bacteria	889
647	Ga0495642_0014407	3300046528	Bacteria	3064
648	Ga0495652_0004792	3300046529	Bacteria	12879
649	Ga0495665_0008142	3300046531	Bacteria	5684
650	Ga0495665_0111548	3300046531	Bacteria	1434
651	Ga0495640_0035712	3300046533	Bacteria	3517
652	Ga0495586_0054179	3300046535	Bacteria	2173
653	Ga0495587_0145906	3300046536	Bacteria	1349
654	Ga0495645_0004704	3300046543	Bacteria	9323
655	Ga0495622_0048514	3300046557	Bacteria	1973
656	Ga0495633_0041548	3300046558	Bacteria	2186
657	Ga0495656_0022331	3300046615	Bacteria	2476
658	Ga0495656_0050362	3300046615	Bacteria	1778
659	Ga0495656_0086597	3300046615	Bacteria	1425
660	Ga0495668_0000284	3300046616	Bacteria	70078
661	Ga0495668_0009288	3300046616	Bacteria	6047
662	Ga0495668_0021361	3300046616	Bacteria	3713
663	Ga0495625_0003624	3300046660	Bacteria	15157
664	Ga0495625_0023707	3300046660	Bacteria	4684
665	Ga0495625_0039586	3300046660	Bacteria	3441
666	Ga0495635_0042850	3300046663	Bacteria	3124
667	Ga0495588_0010087	3300046674	Bacteria	4381
668	Ga0495588_0012691	3300046674	Bacteria	3990
669	Ga0495588_0101706	3300046674	Bacteria	1510
670	Ga0495657_0008110	3300046675	Bacteria	8053
671	Ga0495657_0137702	3300046675	Bacteria	1524
672	Ga0495613_0014294	3300046689	Bacteria	5890
673	Ga0495613_0166178	3300046689	Bacteria	1567
674	Ga0495613_0320922	3300046689	Bacteria	1069
675	Ga0495670_0010517	3300046691	Bacteria	4546
676	Ga0495670_0013436	3300046691	Bacteria	4028
677	Ga0495671_0088144	3300046692	Bacteria	1520
678	Ga0495649_0127337	3300046694	Bacteria	1345
679	Ga0495589_0263854	3300046794	Bacteria	803
680	Ga0495600_0058586	3300046809	Bacteria	2516
681	Ga0495581_0013221	3300047315	Bacteria	4787
682	Ga0495581_0025490	3300047315	Bacteria	3429
683	Ga0495581_0027860	3300047315	Bacteria	3276
684	Ga0495581_0097191	3300047315	Bacteria	1710
685	Ga0495581_0124403	3300047315	Bacteria	1501
686	Ga0495581_0336554	3300047315	Bacteria	881
687	Ga0495604_0025047	3300047317	Bacteria	4756
688	Ga0495604_0508961	3300047317	Bacteria	780
689	Ga0495636_0028973	3300047318	Bacteria	2259
690	Ga0495674_0031252	3300047319	Bacteria	4838
691	Ga0495672_0003957	3300047320	Bacteria	12399
692	Ga0495672_0205263	3300047320	Bacteria	983
693	Ga0495676_0178378	3300047321	Bacteria	1490
694	Ga0495680_0142225	3300047322	Bacteria	1754
695	Ga0495680_0214814	3300047322	Bacteria	1375
696	Ga0495680_0334074	3300047322	Bacteria	1058
697	Ga0495675_0021904	3300047444	Bacteria	4071
698	Ga0495675_0032030	3300047444	Bacteria	3357
699	Ga0495675_0042415	3300047444	Bacteria	2898
700	Ga0495685_022144	3300047447	Bacteria	2187
701	Ga0495685_024897	3300047447	Bacteria	2060
702	Ga0495673_0000617	3300047469	Bacteria	35151
703	Ga0495684_0241344	3300047471	Bacteria	1318
704	Ga0495686_0001752	3300047472	Bacteria	22276
705	Ga0495626_0005356	3300048091	Bacteria	7538
706	Ga0495626_0074940	3300048091	Bacteria	1513
707	Ga0496100_0001571	3300048903	Bacteria	11246
708	Ga0496100_0008250	3300048903	Bacteria	5804
709	Ga0496100_0012693	3300048903	Bacteria	4839
710	Ga0496100_0021184	3300048903	Bacteria	3911
711	Ga0496100_0028638	3300048903	Bacteria	3437
712	Ga0496100_0037688	3300048903	Bacteria	3058
713	Ga0496100_0072657	3300048903	Bacteria	2300
714	Ga0496100_0102758	3300048903	Bacteria	1972
715	Ga0496100_0421936	3300048903	Bacteria	1019
716	Ga0496101_0000037	3300048904	Bacteria	166198
717	Ga0496101_0000155	3300048904	Bacteria	58347
718	Ga0496101_0001909	3300048904	Bacteria	12591
719	Ga0496101_0013567	3300048904	Bacteria	5463
720	Ga0496101_0016210	3300048904	Bacteria	5029
721	Ga0496101_0017244	3300048904	Bacteria	4895
722	Ga0496101_0046627	3300048904	Bacteria	3109
723	Ga0496101_0223390	3300048904	Bacteria	1462
724	Ga0496101_0340776	3300048904	Bacteria	1177
725	Ga0496102_0000083	3300048905	Bacteria	138102
726	Ga0496102_0000214	3300048905	Bacteria	76691
727	Ga0496102_0019565	3300048905	Bacteria	5964
728	Ga0496102_0037162	3300048905	Bacteria	4391
729	Ga0496102_0047882	3300048905	Bacteria	3886
730	Ga0496102_0082430	3300048905	Bacteria	2966
731	Ga0496102_0113533	3300048905	Bacteria	2527
732	Ga0496102_0119893	3300048905	Bacteria	2456
733	Ga0496102_0123277	3300048905	Bacteria	2421
734	Ga0496102_0325174	3300048905	Bacteria	1448
735	Ga0496103_0000060	3300048906	Bacteria	138526
736	Ga0496103_0001320	3300048906	Bacteria	16826
737	Ga0496103_0008785	3300048906	Bacteria	5994
738	Ga0496103_0009435	3300048906	Bacteria	5781
739	Ga0496103_0030354	3300048906	Bacteria	3289
740	Ga0496103_0133232	3300048906	Bacteria	1587
741	Ga0496103_0201761	3300048906	Bacteria	1279
742	Ga0496104_0005755	3300048907	Bacteria	10849
743	Ga0496104_0034970	3300048907	Bacteria	4689
744	Ga0496104_0114598	3300048907	Bacteria	2585
745	Ga0496104_0220502	3300048907	Bacteria	1809
746	Ga0496104_0250357	3300048907	Bacteria	1684
747	Ga0496105_0004580	3300048908	Bacteria	10419
748	Ga0496105_0010125	3300048908	Bacteria	7405
749	Ga0496105_0057057	3300048908	Bacteria	3224
750	Ga0496105_0080447	3300048908	Bacteria	2691
751	Ga0496105_0109699	3300048908	Bacteria	2278
752	Ga0496105_0372615	3300048908	Bacteria	1137
753	Ga0496106_0000744	3300048909	Bacteria	23478
754	Ga0496106_0007674	3300048909	Bacteria	7981
755	Ga0496106_0027949	3300048909	Bacteria	4199
756	Ga0496106_0030317	3300048909	Bacteria	4034
757	Ga0496106_0300361	3300048909	Bacteria	1287
758	Ga0496107_0003329	3300048910	Bacteria	10742
759	Ga0496107_0005555	3300048910	Bacteria	8636
760	Ga0496107_0036805	3300048910	Bacteria	3511
761	Ga0496107_0070078	3300048910	Bacteria	2545
762	Ga0496107_0126965	3300048910	Bacteria	1881
763	Ga0496107_0559478	3300048910	Bacteria	847
764	Ga0496108_0000691	3300048911	Bacteria	26123
765	Ga0496108_0010609	3300048911	Bacteria	7475
766	Ga0496108_0012383	3300048911	Bacteria	6942
767	Ga0496108_0053188	3300048911	Bacteria	3395
768	Ga0496108_0162666	3300048911	Bacteria	1930
769	Ga0496109_0001943	3300048912	Bacteria	17172
770	Ga0496109_0025849	3300048912	Bacteria	5233
771	Ga0496109_0034213	3300048912	Bacteria	4574
772	Ga0496109_0073268	3300048912	Bacteria	3147
773	Ga0496109_0130193	3300048912	Bacteria	2348
774	Ga0496109_0159013	3300048912	Bacteria	2116
775	Ga0496109_0412963	3300048912	Bacteria	1275
776	Ga0496109_0621041	3300048912	Bacteria	1017
777	Ga0496110_0009712	3300048913	Bacteria	7793
778	Ga0496110_0065280	3300048913	Bacteria	3218
779	Ga0496110_0246931	3300048913	Bacteria	1624
780	Ga0496110_0379240	3300048913	Bacteria	1288
781	Ga0496111_0031194	3300048914	Bacteria	3795
782	Ga0496111_0238173	3300048914	Bacteria	1351
783	Ga0496111_0380248	3300048914	Bacteria	1044
784	Ga0496112_0011010	3300048915	Bacteria	8242
785	Ga0496112_0048020	3300048915	Bacteria	4187
786	Ga0496112_0070562	3300048915	Bacteria	3453
787	Ga0496112_0119252	3300048915	Bacteria	2608
788	Ga0496112_0127807	3300048915	Bacteria	2512
789	Ga0496112_0229711	3300048915	Bacteria	1810
790	Ga0496112_0253495	3300048915	Bacteria	1710
791	Ga0496113_0059260	3300048916	Bacteria	2884
792	Ga0496113_0133645	3300048916	Bacteria	1948
793	Ga0496113_0197895	3300048916	Bacteria	1597
794	Ga0496113_0526575	3300048916	Bacteria	949
795	Ga0496114_0001181	3300048917	Bacteria	19787
796	Ga0496114_0002968	3300048917	Bacteria	13008
797	Ga0496114_0013791	3300048917	Bacteria	6477
798	Ga0496114_0022753	3300048917	Bacteria	5108
799	Ga0496114_0112162	3300048917	Bacteria	2337
800	Ga0496114_0276404	3300048917	Bacteria	1480
801	Ga0496114_0368778	3300048917	Bacteria	1271
802	Ga0496114_0379813	3300048917	Bacteria	1251
803	Ga0496114_0629829	3300048917	Bacteria	944
804	Ga0496115_0003248	3300048918	Bacteria	11661
805	Ga0496115_0010221	3300048918	Bacteria	7002
806	Ga0496115_0021396	3300048918	Bacteria	4997
807	Ga0496116_0000159	3300048919	Bacteria	138102
808	Ga0496116_0034145	3300048919	Bacteria	3595
809	Ga0496116_0035822	3300048919	Bacteria	3481
810	Ga0496117_0000167	3300048920	Bacteria	138102
811	Ga0496117_0000346	3300048920	Bacteria	81937
812	Ga0496117_0002042	3300048920	Bacteria	26723
813	Ga0496117_0005495	3300048920	Bacteria	13285
814	Ga0496117_0010419	3300048920	Bacteria	8478
815	Ga0496117_0011373	3300048920	Bacteria	7975
816	Ga0496117_0127680	3300048920	Bacteria	1548
817	Ga0496118_0000121	3300048921	Bacteria	138102
818	Ga0496118_0000331	3300048921	Bacteria	80747
819	Ga0496118_0072208	3300048921	Bacteria	2480
820	Ga0496118_0092228	3300048921	Bacteria	2079
821	Ga0496119_0031067	3300048922	Bacteria	3588
822	Ga0496119_0079950	3300048922	Bacteria	1886
823	Ga0496119_0096428	3300048922	Bacteria	1669
824	Ga0496119_0208260	3300048922	Bacteria	1008
825	Ga0496120_0033483	3300048923	Bacteria	3087
826	Ga0496120_0048910	3300048923	Bacteria	2430
827	Ga0496121_0000062	3300048924	Bacteria	274819
828	Ga0496121_0002221	3300048924	Bacteria	30314
829	Ga0496122_0000553	3300048925	Bacteria	77088
830	Ga0496122_0040839	3300048925	Bacteria	3679
831	Ga0496123_0004911	3300048926	Bacteria	13723
832	Ga0496124_0079426	3300048927	Bacteria	2701
833	Ga0496124_0302471	3300048927	Bacteria	1154
834	Ga0496125_0000077	3300048928	Bacteria	232629
835	Ga0496125_0011296	3300048928	Bacteria	8950
836	Ga0496126_0000368	3300048929	Bacteria	92918
837	Ga0496126_0007083	3300048929	Bacteria	12348
838	Ga0496126_0009512	3300048929	Bacteria	10314
839	Ga0496126_0041429	3300048929	Bacteria	4262
840	Ga0496126_0242340	3300048929	Bacteria	1506
841	Ga0501318_000666	3300049534	Bacteria	2318
842	Ga0501325_002181	3300049541	Bacteria	1312
843	Ga0501031_0016650	3300049568	Bacteria	4774
844	Ga0501031_0020800	3300049568	Bacteria	4278
845	Ga0501032_0002237	3300049569	Bacteria	15238
846	Ga0501032_0021157	3300049569	Bacteria	4524
847	Ga0501032_0043935	3300049569	Bacteria	3024
848	Ga0501033_0062448	3300049570	Bacteria	2743
849	Ga0501033_0062691	3300049570	Bacteria	2737
850	Ga0501034_0000075	3300049571	Bacteria	175296
851	Ga0501034_0013162	3300049571	Bacteria	8522
852	Ga0501034_0017783	3300049571	Bacteria	7292
853	Ga0501034_0024679	3300049571	Bacteria	6115
854	Ga0501034_0085363	3300049571	Bacteria	3158
855	Ga0501034_0089973	3300049571	Bacteria	3068
856	Ga0501034_0312752	3300049571	Bacteria	1505
857	Ga0501034_0372256	3300049571	Bacteria	1354
858	Ga0501034_0383788	3300049571	Bacteria	1329
859	Ga0501034_0404011	3300049571	Bacteria	1288
860	Ga0501034_0485864	3300049571	Bacteria	1150
861	Ga0501034_0544913	3300049571	Bacteria	1070
862	Ga0501036_0003435	3300049572	Bacteria	12656
863	Ga0501036_0012156	3300049572	Bacteria	7131
864	Ga0501036_0037995	3300049572	Bacteria	4073
865	Ga0501036_0125050	3300049572	Bacteria	2172
866	Ga0501037_0000534	3300049573	Bacteria	30335
867	Ga0501037_0001743	3300049573	Bacteria	15794
868	Ga0501037_0020674	3300049573	Bacteria	4861
869	Ga0501037_0071471	3300049573	Bacteria	2524
870	Ga0501037_0149604	3300049573	Bacteria	1669
871	Ga0501038_0007684	3300049574	Bacteria	9941
872	Ga0501038_0014715	3300049574	Bacteria	7128
873	Ga0501038_0106333	3300049574	Bacteria	2329
874	Ga0501038_0111388	3300049574	Bacteria	2267
875	Ga0501039_0000218	3300049575	Bacteria	41909
876	Ga0501039_0001148	3300049575	Bacteria	19530
877	Ga0501039_0007090	3300049575	Bacteria	8538
878	Ga0501039_0089513	3300049575	Bacteria	2398
879	Ga0501040_0002604	3300049576	Bacteria	11628
880	Ga0501041_0003976	3300049577	Bacteria	8530
881	Ga0501042_0004604	3300049578	Bacteria	8806
882	Ga0501043_0006476	3300049579	Bacteria	9400
883	Ga0501043_0039982	3300049579	Bacteria	3686
884	Ga0501043_0095395	3300049579	Bacteria	2338
885	Ga0501043_0132361	3300049579	Bacteria	1954
886	Ga0501043_0163012	3300049579	Bacteria	1741
887	Ga0501043_0235212	3300049579	Bacteria	1414
888	Ga0501046_0000272	3300049580	Bacteria	52767
889	Ga0501046_0009401	3300049580	Bacteria	8450
890	Ga0501046_0044449	3300049580	Bacteria	3533
891	Ga0501046_0124610	3300049580	Bacteria	1958
892	Ga0501047_0008205	3300049581	Bacteria	9865
893	Ga0501047_0019911	3300049581	Bacteria	6441
894	Ga0501047_0020772	3300049581	Bacteria	6307
895	Ga0501047_0079043	3300049581	Bacteria	3163
896	Ga0501047_0161290	3300049581	Bacteria	2114
897	Ga0501048_0001169	3300049582	Bacteria	19794
898	Ga0501069_0002212	3300049585	Bacteria	9804
899	Ga0501070_0001157	3300049586	Bacteria	23615
900	Ga0501070_0010574	3300049586	Bacteria	7800
901	Ga0501070_0136820	3300049586	Bacteria	2022
902	Ga0501070_0513842	3300049586	Bacteria	961
903	Ga0501071_0001051	3300049587	Bacteria	15292
904	Ga0501071_0003273	3300049587	Bacteria	10109
905	Ga0501073_0006480	3300049589	Bacteria	8709
906	Ga0501074_0001018	3300049590	Bacteria	18241
907	Ga0501074_0006538	3300049590	Bacteria	8419
908	Ga0501074_0368702	3300049590	Bacteria	1019
909	Ga0501075_0063176	3300049591	Bacteria	2791
910	Ga0501076_0006411	3300049592	Bacteria	8529
911	Ga0501077_0038680	3300049593	Bacteria	3038
912	Ga0501079_0001255	3300049741	Bacteria	17800
913	Ga0501080_0032687	3300049742	Bacteria	4853
914	Ga0501081_0010522	3300049743	Bacteria	6038
915	Ga0501083_0175866	3300049744	Bacteria	1398
916	Ga0501279_002540	3300049775	Bacteria	2392
917	Ga0501035_0009678	3300049822	Bacteria	8964
918	Ga0501035_0149111	3300049822	Bacteria	2030
919	Ga0501035_0298247	3300049822	Bacteria	1358
920	Ga0501035_0650843	3300049822	Bacteria	854
921	Ga0501044_0015179	3300049823	Bacteria	8298
922	Ga0501044_0015377	3300049823	Bacteria	8241
923	Ga0501044_0016583	3300049823	Bacteria	7906
924	Ga0501044_0028184	3300049823	Bacteria	5928
925	Ga0501044_0136647	3300049823	Bacteria	2442
926	Ga0501044_0161307	3300049823	Bacteria	2219
927	Ga0501045_0002985	3300049824	Bacteria	11575
928	Ga0501045_0042509	3300049824	Bacteria	3307
929	nmdc:mga03n38_10471_c1	3300050490	Bacteria	3413
930	nmdc:mga03n38_18647_c2	3300050490	Bacteria	1716
931	nmdc:mga03n38_95062_c1	3300050490	Bacteria	1427
932	nmdc:mga00v17_125493_c1	3300050491	Bacteria	1637
933	nmdc:mga00v17_13288_c1	3300050491	Bacteria	4566
934	nmdc:mga00v17_143324_c1	3300050491	Bacteria	1533
935	nmdc:mga00v17_147757_c1	3300050491	Bacteria	1509
936	nmdc:mga00v17_215114_c1	3300050491	Bacteria	1244
937	nmdc:mga00v17_3777_c1	3300050491	Bacteria	7823
938	nmdc:mga00v17_41268_c1	3300050491	Bacteria	2771
939	nmdc:mga00v17_73847_c1	3300050491	Bacteria	2118
940	nmdc:mga00v17_8866_c1	3300050491	Bacteria	5423
941	nmdc:mga00v17_952_c1	3300050491	Bacteria	15522
942	nmdc:mga00v17_95441_c1	3300050491	Bacteria	1872
943	nmdc:mga0yw44_127869_c1	3300050492	Bacteria	1642
944	nmdc:mga0yw44_249102_c1	3300050492	Bacteria	1182
945	nmdc:mga0yw44_69198_c1	3300050492	Bacteria	2185
946	nmdc:mga06z11_140093_c1	3300050494	Bacteria	1366
947	nmdc:mga04h51_7046_c1	3300050495	Bacteria	2946
948	nmdc:mga07m45_38441_c1	3300050496	Bacteria	2670
949	nmdc:mga07m45_7063_c1	3300050496	Bacteria	5282
950	nmdc:mga07m45_94326_c1	3300050496	Bacteria	1716
951	nmdc:mga05p37_16428_c1	3300050507	Bacteria	8918
952	nmdc:mga05p37_8148_c1	3300050507	Bacteria	12387
953	nmdc:mga05p37_87538_c1	3300050507	Bacteria	3839
954	nmdc:mga09592_18743_c1	3300050508	Bacteria	5676
955	nmdc:mga0qj67_279628_c1	3300050509	Bacteria	1353
956	nmdc:mga06r32_285540_c1	3300050510	Bacteria	1637
957	nmdc:mga06r32_69149_c1	3300050510	Bacteria	3412
958	nmdc:mga08y16_47837_c1	3300050511	Bacteria	4477
959	nmdc:mga08y16_5982_c1	3300050511	Bacteria	12756
960	nmdc:mga08y16_93138_c1	3300050511	Bacteria	3139
961	nmdc:mga0n895_2299_c1	3300050512	Bacteria	14856
962	nmdc:mga0n895_47294_c1	3300050512	Bacteria	4207
963	nmdc:mga0rr50_350_c1	3300050513	Bacteria	25198
964	nmdc:mga0rr50_9311_c1	3300050513	Bacteria	6170
965	nmdc:mga08x19_2280_c1	3300050514	Bacteria	11661
966	nmdc:mga0a205_2578_c1	3300050515	Bacteria	15988
967	nmdc:mga0a205_2978_c1	3300050515	Bacteria	13608
968	nmdc:mga0sz30_10871_c1	3300050516	Bacteria	3499
969	nmdc:mga0sz30_1190_c1	3300050516	Bacteria	9324
970	nmdc:mga0sz30_1821_c1	3300050516	Bacteria	7582
971	nmdc:mga0sz30_8660_c1	3300050516	Bacteria	3847
972	nmdc:mga0sz30_97765_c1	3300050516	Bacteria	1281
973	Ga0500635_0003850	3300053080	Bacteria	3810
974	Ga0495655_0002104	3300053083	Bacteria	3126
975	Ga0495619_0183000	3300053085	Bacteria	1450
976	Ga0500643_004972	3300053087	Bacteria	5842
977	Ga0500643_065591	3300053087	Bacteria	1013
978	Ga0500562_011739	3300053108	Bacteria	2224
979	Ga0500652_000314	3300053131	Bacteria	17357
980	Ga0500616_0006493	3300053153	Bacteria	7651
981	Ga0500616_0031708	3300053153	Bacteria	2893
982	Ga0501084_0010200	3300054114	Bacteria	7769
983	Ga0501084_0022081	3300054114	Bacteria	5308
984	Ga0501082_0006856	3300060353	Bacteria	9849
985	Ga0466962_0264007	3300061719	Bacteria	848
986	Ga0530510_0005893	3300061734	Bacteria	8495

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300048917	Ga0496114_0368778	Ga0496114_0368778_213_1022	183
2	3300014745	Ga0157377_10237708	Ga0157377_102377081	192
3	3300048916	Ga0496113_0059260	Ga0496113_0059260_1981_2802	193
4	3300048915	Ga0496112_0229711	Ga0496112_0229711_914_1735	195
5	3300009148	Ga0105243_10040067	Ga0105243_100400674	198
6	3300011119	Ga0105246_10236929	Ga0105246_102369292	198
7	3300025315	Ga0207697_10000839	Ga0207697_100008398	198
8	3300031901	Ga0307406_10000792	Ga0307406_100007924	198
9	3300044656	Ga0466969_0206837	Ga0466969_0206837_72_842	199
10	3300044684	Ga0466966_0007305	Ga0466966_0007305_6487_7257	199
11	3300044706	Ga0466964_0014813	Ga0466964_0014813_2133_2903	199
12	3300044735	Ga0466968_0000840	Ga0466968_0000840_2052_2822	199
13	3300044765	Ga0466970_0000612	Ga0466970_0000612_10250_11020	199
14	3300049590	Ga0501074_0368702	Ga0501074_0368702_21_701	202
15	3300047322	Ga0495680_0214814	Ga0495680_0214814_489_1319	203
16	3300046477	Ga0495664_0330671	Ga0495664_0330671_51_881	204
17	3300046529	Ga0495652_0004792	Ga0495652_0004792_211_1041	204
18	3300031911	Ga0307412_10677049	Ga0307412_106770491	207
19	3300033179	Ga0307507_10089811	Ga0307507_100898112	208
20	3300049571	Ga0501034_0024679	Ga0501034_0024679_4491_5288	208
21	3300037466	Ga0395898_0019822	Ga0395898_0019822_4262_5110	209
22	3300038443	Ga0395901_0214278	Ga0395901_0214278_27_875	209
23	3300005329	Ga0070683_100056071	Ga0070683_1000560712	210
24	3300005535	Ga0070684_100058202	Ga0070684_1000582022	210
25	3300044901	Ga0466960_0050947	Ga0466960_0050947_530_1345	211
26	3300048908	Ga0496105_0010125	Ga0496105_0010125_2607_3428	212
27	3300046501	Ga0495607_0241478	Ga0495607_0241478_97_861	213
28	3300005347	Ga0070668_100045797	Ga0070668_1000457973	214
29	3300005353	Ga0070669_100124650	Ga0070669_1001246502	214
30	3300005366	Ga0070659_100112073	Ga0070659_1001120732	214
31	3300005539	Ga0068853_100023449	Ga0068853_1000234496	214
32	3300005719	Ga0068861_100028205	Ga0068861_1000282055	214
33	3300006058	Ga0075432_10001139	Ga0075432_100011394	214
34	3300006847	Ga0075431_100022463	Ga0075431_1000224637	214
35	3300006852	Ga0075433_10003360	Ga0075433_100033608	214
36	3300006871	Ga0075434_100001550	Ga0075434_10000155017	214
37	3300006880	Ga0075429_100154001	Ga0075429_1001540013	214
38	3300007076	Ga0075435_100011330	Ga0075435_1000113307	214
39	3300009093	Ga0105240_10569953	Ga0105240_105699531	214
40	3300009094	Ga0111539_10016681	Ga0111539_100166819	214
41	3300009147	Ga0114129_10014817	Ga0114129_100148175	214
42	3300009148	Ga0105243_10044421	Ga0105243_100444212	214
43	3300009176	Ga0105242_10193796	Ga0105242_101937962	214
44	3300009176	Ga0105242_10244572	Ga0105242_102445721	214
45	3300009553	Ga0105249_10011082	Ga0105249_100110828	214
46	3300013306	Ga0163162_10037844	Ga0163162_100378442	214
47	3300013306	Ga0163162_10240931	Ga0163162_102409311	214
48	3300013307	Ga0157372_10292956	Ga0157372_102929563	214
49	3300013308	Ga0157375_10597147	Ga0157375_105971471	214
50	3300025923	Ga0207681_10310881	Ga0207681_103108812	214
51	3300025932	Ga0207690_10074304	Ga0207690_100743042	214
52	3300025935	Ga0207709_10112655	Ga0207709_101126552	214
53	3300025949	Ga0207667_10580766	Ga0207667_105807661	214
54	3300025972	Ga0207668_10443312	Ga0207668_104433121	214
55	3300026041	Ga0207639_10350964	Ga0207639_103509641	214
56	3300026118	Ga0207675_100035155	Ga0207675_1000351555	214
57	3300027907	Ga0207428_10004915	Ga0207428_100049156	214
58	3300041411	Ga0439466_0082574	Ga0439466_0082574_123_839	214
59	3300048904	Ga0496101_0340776	Ga0496101_0340776_107_928	214
60	3300048907	Ga0496104_0114598	Ga0496104_0114598_52_873	214
61	3300048912	Ga0496109_0130193	Ga0496109_0130193_657_1478	214
62	3300048913	Ga0496110_0246931	Ga0496110_0246931_317_1138	214
63	3300048916	Ga0496113_0197895	Ga0496113_0197895_714_1535	214
64	3300048917	Ga0496114_0022753	Ga0496114_0022753_737_1558	214
65	3300048917	Ga0496114_0276404	Ga0496114_0276404_413_1234	214
66	3300048920	Ga0496117_0000346	Ga0496117_0000346_44021_44752	214
67	3300050507	nmdc:mga05p37_8148_c1	nmdc:mga05p37_8148_c1_6217_6981	214
68	3300050508	nmdc:mga09592_18743_c1	nmdc:mga09592_18743_c1_3709_4473	214
69	3300050510	nmdc:mga06r32_285540_c1	nmdc:mga06r32_285540_c1_773_1537	214
70	3300050511	nmdc:mga08y16_47837_c1	nmdc:mga08y16_47837_c1_3480_4244	214
71	3300050512	nmdc:mga0n895_47294_c1	nmdc:mga0n895_47294_c1_3304_4068	214
72	3300050513	nmdc:mga0rr50_9311_c1	nmdc:mga0rr50_9311_c1_1738_2502	214
73	3300050515	nmdc:mga0a205_2978_c1	nmdc:mga0a205_2978_c1_4016_4780	214
74	3300053080	Ga0500635_0003850	Ga0500635_0003850_2386_3132	214
75	3300053131	Ga0500652_000314	Ga0500652_000314_4488_5234	214
76	iso_pu_bacteria	2842888712	2842890705	214
77	3300026121	Ga0207683_10049233	Ga0207683_100492333	215
78	3300042002	Ga0439442_000033	Ga0439442_000033_32013_32762	215
79	3300042016	Ga0439463_000941	Ga0439463_000941_2387_3154	215
80	3300042122	Ga0450920_000604	Ga0450920_000604_630_1379	215
81	3300042146	Ga0450907_000200	Ga0450907_000200_20283_21032	215
82	3300042435	Ga0439434_0000721	Ga0439434_0000721_658_1407	215
83	3300042437	Ga0439444_0043169	Ga0439444_0043169_163_882	215
84	3300042531	Ga0450918_003834	Ga0450918_003834_1381_2130	215
85	3300050494	nmdc:mga06z11_140093_c1	nmdc:mga06z11_140093_c1_370_1089	215
86	3300050516	nmdc:mga0sz30_10871_c1	nmdc:mga0sz30_10871_c1_842_1561	215
87	3300035207	Ga0373942_0043822	Ga0373942_0043822_116_883	216
88	3300048906	Ga0496103_0009435	Ga0496103_0009435_3802_4587	216
89	iso_pu_bacteria	2919713450	2919720175	216
90	3300026089	Ga0207648_10225346	Ga0207648_102253462	217
91	3300048916	Ga0496113_0526575	Ga0496113_0526575_187_912	217
92	3300031995	Ga0307409_100279382	Ga0307409_1002793822	218
93	3300048905	Ga0496102_0037162	Ga0496102_0037162_173_958	218
94	3300044683	Ga0466965_0181163	Ga0466965_0181163_270_1070	219
95	3300044765	Ga0466970_0175584	Ga0466970_0175584_371_1171	219
96	3300044901	Ga0466960_0050712	Ga0466960_0050712_159_959	219
97	3300049541	Ga0501325_002181	Ga0501325_002181_384_1148	219
98	iso_pu_bacteria	2565956761	2566991988	219
99	iso_pu_bacteria	2643221673	2644408156	219
100	iso_pu_bacteria	2904535858	2904538613	219
101	iso_pu_bacteria	2922554459	2922559343	219
102	3300002773	JGI25152J39213_1000880	JGI25152J39213_10008806	220
103	3300003187	JGI25151J46595_10018202	JGI25151J46595_100182022	220
104	3300025245	Ga0207425_1028671	Ga0207425_10286712	220
105	3300025258	Ga0209129_1000096	Ga0209129_100009617	220
106	3300025294	Ga0209025_1000045	Ga0209025_1000045115	220
107	3300031548	Ga0307408_100030821	Ga0307408_1000308212	220
108	3300031824	Ga0307413_10098580	Ga0307413_100985801	220
109	3300031852	Ga0307410_10179846	Ga0307410_101798462	220
110	3300031901	Ga0307406_10033043	Ga0307406_100330434	220
111	3300031903	Ga0307407_10004919	Ga0307407_100049194	220
112	3300031911	Ga0307412_10038733	Ga0307412_100387333	220
113	3300031995	Ga0307409_100012965	Ga0307409_1000129653	220
114	3300032002	Ga0307416_100038397	Ga0307416_1000383974	220
115	3300046794	Ga0495589_0263854	Ga0495589_0263854_18_773	220
116	iso_pu_bacteria	2551306166	2552110810	220
117	iso_pu_bacteria	2643221542	2643735220	220
118	iso_pu_bacteria	2643221630	2644172059	220
119	iso_pu_bacteria	2643221692	2644515954	220
120	iso_pu_bacteria	2643221715	2644639673	220
121	iso_pu_bacteria	2738541274	2738703534	220
122	iso_pu_bacteria	2738543028	2739329005	220
123	iso_pu_bacteria	2738543034	2739362731	220
124	iso_pu_bacteria	2808606372	2808902743	220
125	iso_pu_bacteria	2842134933	2842136510	220
126	iso_pu_bacteria	2844841374	2844843625	220
127	iso_pu_bacteria	2895660088	2895661715	220
128	iso_pu_bacteria	2902792274	2902795671	220
129	iso_pu_bacteria	2902799365	2902800885	220
130	iso_pu_bacteria	2902810491	2902814320	220
131	iso_pu_bacteria	2902837492	2902842578	220
132	iso_pu_bacteria	2904765812	2904768109	220
133	iso_pu_bacteria	2904770941	2904776090	220
134	iso_pu_bacteria	2908811453	2908815411	220
135	iso_pu_bacteria	2919055335	2919055617	220
136	iso_pu_bacteria	2919395869	2919396365	220
137	iso_pu_bacteria	2919420072	2919423457	220
138	iso_pu_bacteria	2919432681	2919436065	220
139	iso_pu_bacteria	2919443155	2919443320	220
140	iso_pu_bacteria	2919523602	2919525726	220
141	iso_pu_bacteria	2919713450	2919720297	220
142	iso_pu_bacteria	2939582691	2939584058	220
143	iso_pu_bacteria	8004182704	8004182734	220
144	iso_pu_bacteria	8046352972	8046355906	220
145	3300005337	Ga0070682_100079254	Ga0070682_1000792542	221
146	3300005356	Ga0070674_100171827	Ga0070674_1001718272	221
147	3300005441	Ga0070700_100504531	Ga0070700_1005045311	221
148	3300005718	Ga0068866_10112295	Ga0068866_101122952	221
149	3300006881	Ga0068865_100027123	Ga0068865_1000271232	221
150	3300009148	Ga0105243_10004341	Ga0105243_1000434113	221
151	3300009176	Ga0105242_10003622	Ga0105242_100036226	221
152	3300009545	Ga0105237_10477732	Ga0105237_104777322	221
153	3300009553	Ga0105249_10066354	Ga0105249_100663542	221
154	3300013307	Ga0157372_10445692	Ga0157372_104456922	221
155	3300017792	Ga0163161_10147843	Ga0163161_101478432	221
156	3300025899	Ga0207642_10103294	Ga0207642_101032942	221
157	3300025919	Ga0207657_10371892	Ga0207657_103718922	221
158	3300025933	Ga0207706_10036518	Ga0207706_100365184	221
159	3300025934	Ga0207686_10059349	Ga0207686_100593493	221
160	3300025937	Ga0207669_10120317	Ga0207669_101203172	221
161	3300025961	Ga0207712_10270512	Ga0207712_102705122	221
162	3300026075	Ga0207708_10095433	Ga0207708_100954332	221
163	3300026089	Ga0207648_10061401	Ga0207648_100614011	221
164	3300031731	Ga0307405_10421772	Ga0307405_104217722	221
165	3300046491	Ga0495584_0185948	Ga0495584_0185948_71_835	221
166	3300050491	nmdc:mga00v17_215114_c1	nmdc:mga00v17_215114_c1_324_1061	221
167	iso_pu_bacteria	2690315906	2691512457	221
168	iso_pu_bacteria	2773857763	2774399183	221
169	iso_pu_bacteria	2775506735	2775657773	221
170	iso_pu_bacteria	2808606357	2808829709	221
171	iso_pu_bacteria	2808606360	2808850889	221
172	iso_pu_bacteria	2808606366	2808876599	221
173	iso_pu_bacteria	2808606370	2808893960	221
174	iso_pu_bacteria	2808606371	2808898102	221
175	iso_pu_bacteria	2811994871	2812318588	221
176	iso_pu_bacteria	2857740372	2857742990	221
177	iso_pu_bacteria	2904497146	2904497490	221
178	iso_pu_bacteria	2904776348	2904780786	221
179	iso_pu_bacteria	2910809715	2910810099	221
180	iso_pu_bacteria	2919034639	2919038555	221
181	iso_pu_bacteria	2919059106	2919062003	221
182	iso_pu_bacteria	2919538618	2919539871	221
183	iso_pu_bacteria	2932426870	2932428716	221
184	iso_pu_bacteria	2933418574	2933422584	221
185	iso_pu_bacteria	2939598168	2939600896	221
186	iso_pu_bacteria	2939647034	2939647630	221
187	iso_pu_bacteria	2939674588	2939678321	221
188	iso_pu_bacteria	2945916053	2945916347	221
189	iso_pu_bacteria	2945920336	2945923510	221
190	iso_pu_bacteria	2945941187	2945944830	221
191	iso_pu_bacteria	2946037020	2946040766	221
192	iso_pu_bacteria	2946059875	2946060144	221
193	iso_pu_bacteria	2974294766	2974295518	221
194	iso_pu_bacteria	2974324384	2974324678	221
195	iso_pu_bacteria	8003314358	8003321701	221
196	3300038443	Ga0395901_0797711	Ga0395901_0797711_169_918	222
197	3300061719	Ga0466962_0264007	Ga0466962_0264007_75_824	222
198	iso_pu_bacteria	2643221566	2643848659	222
199	iso_pu_bacteria	2738543011	2739239077	222
200	iso_pu_bacteria	2739367653	2739603325	222
201	iso_pu_bacteria	2808606447	2809227654	222
202	iso_pu_bacteria	2816332305	2817508124	222
203	iso_pu_bacteria	2821268502	2821270281	222
204	iso_pu_bacteria	2833709550	2833711239	222
205	iso_pu_bacteria	2852632344	2852634418	222
206	iso_pu_bacteria	2857727296	2857727409	222
207	iso_pu_bacteria	2870628048	2870630610	222
208	iso_pu_bacteria	2889300758	2889304031	222
209	iso_pu_bacteria	2939743619	2939745575	222
210	iso_pu_bacteria	2946033335	2946034071	222
211	iso_pu_bacteria	8025530807	8025531982	222
212	3300003578	Ga0006562J51391_1003117	Ga0006562J51391_10031172	223
213	3300003578	Ga0006562J51391_1054739	Ga0006562J51391_10547396	223
214	3300003578	Ga0006562J51391_1054740	Ga0006562J51391_105474015	223
215	3300006353	Ga0075370_10026865	Ga0075370_100268652	223
216	3300046472	Ga0495580_0059547	Ga0495580_0059547_556_1299	223
217	3300048906	Ga0496103_0201761	Ga0496103_0201761_417_1160	223
218	3300048915	Ga0496112_0127807	Ga0496112_0127807_958_1701	223
219	3300048928	Ga0496125_0011296	Ga0496125_0011296_6931_7674	223
220	3300050496	nmdc:mga07m45_94326_c1	nmdc:mga07m45_94326_c1_725_1468	223
221	iso_pu_bacteria	2523231044	2523385941	223
222	iso_pu_bacteria	2643221597	2643996158	223
223	iso_pu_bacteria	2870801768	2870802891	223
224	iso_pu_bacteria	8004212874	8004213856	223
225	iso_pu_bacteria	8045830549	8045831846	223
226	iso_pu_bacteria	8054107350	8054111252	223
227	3300001991	JGI24743J22301_10056781	JGI24743J22301_100567811	224
228	3300002067	JGI24735J21928_10095166	JGI24735J21928_100951662	224
229	3300002077	JGI24744J21845_10014594	JGI24744J21845_100145942	224
230	3300002239	JGI24034J26672_10007917	JGI24034J26672_100079172	224
231	3300002244	JGI24742J22300_10003898	JGI24742J22300_100038982	224
232	3300002459	JGI24751J29686_10011299	JGI24751J29686_100112992	224
233	3300003578	Ga0006562J51391_1034758	Ga0006562J51391_10347582	224
234	3300003752	Ga0055539_1000019	Ga0055539_1000019237	224
235	3300003756	Ga0055533_1000023	Ga0055533_100002388	224
236	3300003759	Ga0055525_1000088	Ga0055525_100008811	224
237	3300003759	Ga0055525_1002620	Ga0055525_10026202	224
238	3300005327	Ga0070658_10029024	Ga0070658_100290241	224
239	3300005328	Ga0070676_10010975	Ga0070676_100109754	224
240	3300005330	Ga0070690_100033290	Ga0070690_1000332902	224
241	3300005331	Ga0070670_100237865	Ga0070670_1002378652	224
242	3300005333	Ga0070677_10001683	Ga0070677_100016838	224
243	3300005333	Ga0070677_10040972	Ga0070677_100409724	224
244	3300005334	Ga0068869_100005745	Ga0068869_1000057453	224
245	3300005334	Ga0068869_100018804	Ga0068869_1000188045	224
246	3300005335	Ga0070666_10008765	Ga0070666_100087658	224
247	3300005335	Ga0070666_10505304	Ga0070666_105053041	224
248	3300005337	Ga0070682_100051658	Ga0070682_1000516583	224
249	3300005337	Ga0070682_100114978	Ga0070682_1001149784	224
250	3300005338	Ga0068868_100002900	Ga0068868_1000029005	224
251	3300005338	Ga0068868_100275570	Ga0068868_1002755702	224
252	3300005338	Ga0068868_100280001	Ga0068868_1002800011	224
253	3300005341	Ga0070691_10018706	Ga0070691_100187062	224
254	3300005343	Ga0070687_100052698	Ga0070687_1000526982	224
255	3300005344	Ga0070661_100090719	Ga0070661_1000907191	224
256	3300005345	Ga0070692_10006674	Ga0070692_100066745	224
257	3300005345	Ga0070692_10281681	Ga0070692_102816811	224
258	3300005347	Ga0070668_100018783	Ga0070668_1000187834	224
259	3300005347	Ga0070668_100028588	Ga0070668_1000285883	224
260	3300005347	Ga0070668_100112877	Ga0070668_1001128772	224
261	3300005347	Ga0070668_100234696	Ga0070668_1002346961	224
262	3300005353	Ga0070669_100003889	Ga0070669_1000038897	224
263	3300005353	Ga0070669_100095770	Ga0070669_1000957701	224
264	3300005353	Ga0070669_100180840	Ga0070669_1001808402	224
265	3300005354	Ga0070675_100006679	Ga0070675_1000066792	224
266	3300005355	Ga0070671_100000491	Ga0070671_1000004912	224
267	3300005355	Ga0070671_100019426	Ga0070671_1000194262	224
268	3300005355	Ga0070671_100039712	Ga0070671_1000397122	224
269	3300005356	Ga0070674_100003672	Ga0070674_1000036724	224
270	3300005356	Ga0070674_100057050	Ga0070674_1000570501	224
271	3300005356	Ga0070674_100168141	Ga0070674_1001681411	224
272	3300005365	Ga0070688_100085197	Ga0070688_1000851972	224
273	3300005366	Ga0070659_100057236	Ga0070659_1000572362	224
274	3300005367	Ga0070667_100000220	Ga0070667_10000022044	224
275	3300005367	Ga0070667_100002848	Ga0070667_10000284811	224
276	3300005367	Ga0070667_100016198	Ga0070667_1000161981	224
277	3300005367	Ga0070667_100154020	Ga0070667_1001540202	224
278	3300005367	Ga0070667_100625205	Ga0070667_1006252052	224
279	3300005434	Ga0070709_10023858	Ga0070709_100238582	224
280	3300005434	Ga0070709_10035023	Ga0070709_100350233	224
281	3300005435	Ga0070714_100114939	Ga0070714_1001149392	224
282	3300005437	Ga0070710_10005701	Ga0070710_100057015	224
283	3300005437	Ga0070710_10017759	Ga0070710_100177592	224
284	3300005439	Ga0070711_100015015	Ga0070711_1000150153	224
285	3300005439	Ga0070711_100025598	Ga0070711_1000255983	224
286	3300005439	Ga0070711_100246214	Ga0070711_1002462141	224
287	3300005440	Ga0070705_100011446	Ga0070705_1000114462	224
288	3300005440	Ga0070705_100093122	Ga0070705_1000931222	224
289	3300005441	Ga0070700_100027071	Ga0070700_1000270712	224
290	3300005455	Ga0070663_100076780	Ga0070663_1000767802	224
291	3300005455	Ga0070663_100085574	Ga0070663_1000855743	224
292	3300005455	Ga0070663_100117476	Ga0070663_1001174762	224
293	3300005455	Ga0070663_100367884	Ga0070663_1003678842	224
294	3300005456	Ga0070678_100000278	Ga0070678_1000002786	224
295	3300005456	Ga0070678_100522240	Ga0070678_1005222401	224
296	3300005456	Ga0070678_100715623	Ga0070678_1007156231	224
297	3300005457	Ga0070662_100006620	Ga0070662_1000066204	224
298	3300005466	Ga0070685_10021239	Ga0070685_100212393	224
299	3300005466	Ga0070685_10059427	Ga0070685_100594272	224
300	3300005466	Ga0070685_10128626	Ga0070685_101286261	224
301	3300005535	Ga0070684_100063282	Ga0070684_1000632824	224
302	3300005539	Ga0068853_100018427	Ga0068853_1000184272	224
303	3300005543	Ga0070672_100021981	Ga0070672_1000219816	224
304	3300005543	Ga0070672_100691290	Ga0070672_1006912902	224
305	3300005544	Ga0070686_100052593	Ga0070686_1000525933	224
306	3300005545	Ga0070695_100009178	Ga0070695_1000091787	224
307	3300005547	Ga0070693_100388410	Ga0070693_1003884101	224
308	3300005548	Ga0070665_100009829	Ga0070665_1000098292	224
309	3300005548	Ga0070665_100062468	Ga0070665_1000624684	224
310	3300005548	Ga0070665_100259995	Ga0070665_1002599952	224
311	3300005549	Ga0070704_100001527	Ga0070704_1000015274	224
312	3300005563	Ga0068855_100385782	Ga0068855_1003857822	224
313	3300005564	Ga0070664_100315715	Ga0070664_1003157151	224
314	3300005578	Ga0068854_100003078	Ga0068854_10000307812	224
315	3300005615	Ga0070702_100001231	Ga0070702_1000012318	224
316	3300005615	Ga0070702_100655745	Ga0070702_1006557451	224
317	3300005616	Ga0068852_100101458	Ga0068852_1001014583	224
318	3300005616	Ga0068852_100104033	Ga0068852_1001040331	224
319	3300005616	Ga0068852_100133639	Ga0068852_1001336391	224
320	3300005617	Ga0068859_100001001	Ga0068859_10000100120	224
321	3300005617	Ga0068859_100005790	Ga0068859_1000057906	224
322	3300005617	Ga0068859_100296633	Ga0068859_1002966332	224
323	3300005718	Ga0068866_10001053	Ga0068866_100010532	224
324	3300005719	Ga0068861_100001520	Ga0068861_10000152010	224
325	3300005840	Ga0068870_10231469	Ga0068870_102314692	224
326	3300005841	Ga0068863_100000442	Ga0068863_10000044240	224
327	3300005841	Ga0068863_100047974	Ga0068863_1000479743	224
328	3300005842	Ga0068858_100014505	Ga0068858_1000145056	224
329	3300005842	Ga0068858_100023784	Ga0068858_1000237842	224
330	3300005842	Ga0068858_100026185	Ga0068858_1000261856	224
331	3300005843	Ga0068860_100000150	Ga0068860_10000015045	224
332	3300005843	Ga0068860_100006062	Ga0068860_1000060625	224
333	3300005844	Ga0068862_100000078	Ga0068862_10000007875	224
334	3300005844	Ga0068862_100003622	Ga0068862_1000036224	224
335	3300005844	Ga0068862_100346316	Ga0068862_1003463162	224
336	3300005937	Ga0081455_10034395	Ga0081455_100343953	224
337	3300006028	Ga0070717_10250338	Ga0070717_102503382	224
338	3300006038	Ga0075365_10041609	Ga0075365_100416093	224
339	3300006038	Ga0075365_10094661	Ga0075365_100946612	224
340	3300006038	Ga0075365_10229399	Ga0075365_102293991	224
341	3300006048	Ga0075363_100001481	Ga0075363_1000014812	224
342	3300006048	Ga0075363_100011963	Ga0075363_1000119632	224
343	3300006048	Ga0075363_100047614	Ga0075363_1000476142	224
344	3300006048	Ga0075363_100123137	Ga0075363_1001231372	224
345	3300006048	Ga0075363_100192223	Ga0075363_1001922232	224
346	3300006051	Ga0075364_10004342	Ga0075364_1000434210	224
347	3300006051	Ga0075364_10011414	Ga0075364_100114142	224
348	3300006051	Ga0075364_10021753	Ga0075364_100217535	224
349	3300006051	Ga0075364_10134494	Ga0075364_101344942	224
350	3300006051	Ga0075364_10156142	Ga0075364_101561422	224
351	3300006051	Ga0075364_10167021	Ga0075364_101670212	224
352	3300006051	Ga0075364_10385135	Ga0075364_103851351	224
353	3300006058	Ga0075432_10002921	Ga0075432_100029212	224
354	3300006163	Ga0070715_10040086	Ga0070715_100400862	224
355	3300006175	Ga0070712_100001364	Ga0070712_1000013649	224
356	3300006178	Ga0075367_10229050	Ga0075367_102290502	224
357	3300006186	Ga0075369_10001579	Ga0075369_100015792	224
358	3300006186	Ga0075369_10003092	Ga0075369_100030926	224
359	3300006186	Ga0075369_10018523	Ga0075369_100185232	224
360	3300006186	Ga0075369_10018594	Ga0075369_100185942	224
361	3300006186	Ga0075369_10029707	Ga0075369_100297072	224
362	3300006186	Ga0075369_10117877	Ga0075369_101178772	224
363	3300006237	Ga0097621_100455615	Ga0097621_1004556152	224
364	3300006353	Ga0075370_10191100	Ga0075370_101911002	224
365	3300006844	Ga0075428_100022228	Ga0075428_1000222285	224
366	3300006846	Ga0075430_100299678	Ga0075430_1002996782	224
367	3300006847	Ga0075431_100075931	Ga0075431_1000759312	224
368	3300006881	Ga0068865_100004213	Ga0068865_1000042134	224
369	3300006881	Ga0068865_100526059	Ga0068865_1005260592	224
370	3300006931	Ga0097620_100001001	Ga0097620_10000100120	224
371	3300006931	Ga0097620_100005791	Ga0097620_1000057916	224
372	3300006931	Ga0097620_100296649	Ga0097620_1002966492	224
373	3300009011	Ga0105251_10029977	Ga0105251_100299772	224
374	3300009036	Ga0105244_10027622	Ga0105244_100276223	224
375	3300009036	Ga0105244_10110566	Ga0105244_101105662	224
376	3300009093	Ga0105240_10146680	Ga0105240_101466802	224
377	3300009098	Ga0105245_10007016	Ga0105245_100070165	224
378	3300009098	Ga0105245_10175709	Ga0105245_101757093	224
379	3300009098	Ga0105245_10294813	Ga0105245_102948132	224
380	3300009098	Ga0105245_10448311	Ga0105245_104483112	224
381	3300009101	Ga0105247_10000074	Ga0105247_1000007471	224
382	3300009101	Ga0105247_10018232	Ga0105247_100182322	224
383	3300009101	Ga0105247_10143500	Ga0105247_101435002	224
384	3300009101	Ga0105247_10257983	Ga0105247_102579831	224
385	3300009147	Ga0114129_10585768	Ga0114129_105857682	224
386	3300009148	Ga0105243_10001864	Ga0105243_1000186420	224
387	3300009148	Ga0105243_10008548	Ga0105243_100085487	224
388	3300009174	Ga0105241_10015734	Ga0105241_100157346	224
389	3300009176	Ga0105242_10001286	Ga0105242_100012864	224
390	3300009176	Ga0105242_10209662	Ga0105242_102096622	224
391	3300009177	Ga0105248_10000077	Ga0105248_1000007744	224
392	3300009177	Ga0105248_10009879	Ga0105248_100098795	224
393	3300009177	Ga0105248_10010973	Ga0105248_1001097310	224
394	3300009177	Ga0105248_10060850	Ga0105248_100608502	224
395	3300009177	Ga0105248_10641334	Ga0105248_106413342	224
396	3300009545	Ga0105237_10004421	Ga0105237_100044218	224
397	3300009553	Ga0105249_10000111	Ga0105249_1000011144	224
398	3300009553	Ga0105249_10006026	Ga0105249_100060262	224
399	3300009553	Ga0105249_10049655	Ga0105249_100496552	224
400	3300010375	Ga0105239_10027436	Ga0105239_100274366	224
401	3300010375	Ga0105239_10477112	Ga0105239_104771122	224
402	3300011119	Ga0105246_10030241	Ga0105246_100302411	224
403	3300011119	Ga0105246_10203638	Ga0105246_102036382	224
404	3300011119	Ga0105246_10236489	Ga0105246_102364892	224
405	3300013100	Ga0157373_10189563	Ga0157373_101895632	224
406	3300013102	Ga0157371_10033164	Ga0157371_100331643	224
407	3300013102	Ga0157371_10175704	Ga0157371_101757042	224
408	3300013296	Ga0157374_10006732	Ga0157374_100067329	224
409	3300013296	Ga0157374_10585649	Ga0157374_105856492	224
410	3300013297	Ga0157378_10056122	Ga0157378_100561221	224
411	3300013297	Ga0157378_10161870	Ga0157378_101618702	224
412	3300013306	Ga0163162_10013411	Ga0163162_100134117	224
413	3300013306	Ga0163162_10036603	Ga0163162_100366032	224
414	3300013306	Ga0163162_10074883	Ga0163162_100748835	224
415	3300013306	Ga0163162_10419311	Ga0163162_104193112	224
416	3300013307	Ga0157372_10026918	Ga0157372_100269188	224
417	3300013307	Ga0157372_10163630	Ga0157372_101636303	224
418	3300013308	Ga0157375_10003630	Ga0157375_100036307	224
419	3300013308	Ga0157375_10240627	Ga0157375_102406272	224
420	3300013308	Ga0157375_10974546	Ga0157375_109745461	224
421	3300013308	Ga0157375_11304545	Ga0157375_113045451	224
422	3300014325	Ga0163163_10045899	Ga0163163_100458993	224
423	3300014325	Ga0163163_10054964	Ga0163163_100549642	224
424	3300014326	Ga0157380_10009611	Ga0157380_100096117	224
425	3300014745	Ga0157377_10012938	Ga0157377_100129384	224
426	3300014968	Ga0157379_10014509	Ga0157379_100145092	224
427	3300017792	Ga0163161_10003185	Ga0163161_100031854	224
428	3300017792	Ga0163161_10105100	Ga0163161_101051002	224
429	3300020069	Ga0197907_10427212	Ga0197907_104272121	224
430	3300020082	Ga0206353_10786218	Ga0206353_107862184	224
431	3300025225	Ga0209566_100031	Ga0209566_10003188	224
432	3300025226	Ga0209674_100001	Ga0209674_1000012064	224
433	3300025230	Ga0209563_100001	Ga0209563_1000012064	224
434	3300025230	Ga0209563_100229	Ga0209563_10022912	224
435	3300025253	Ga0209677_100001	Ga0209677_1000012064	224
436	3300025253	Ga0209677_101081	Ga0209677_1010812	224
437	3300025254	Ga0209148_1008970	Ga0209148_10089702	224
438	3300025272	Ga0209455_1001696	Ga0209455_100169611	224
439	3300025303	Ga0209051_1001556	Ga0209051_10015565	224
440	3300025303	Ga0209051_1002083	Ga0209051_10020838	224
441	3300025303	Ga0209051_1008663	Ga0209051_10086634	224
442	3300025303	Ga0209051_1037139	Ga0209051_10371392	224
443	3300025315	Ga0207697_10002412	Ga0207697_1000241210	224
444	3300025728	Ga0207655_1005533	Ga0207655_10055339	224
445	3300025728	Ga0207655_1133645	Ga0207655_11336451	224
446	3300025735	Ga0207713_1052264	Ga0207713_10522642	224
447	3300025893	Ga0207682_10007629	Ga0207682_100076292	224
448	3300025893	Ga0207682_10046093	Ga0207682_100460932	224
449	3300025898	Ga0207692_10002014	Ga0207692_100020145	224
450	3300025898	Ga0207692_10010414	Ga0207692_100104142	224
451	3300025899	Ga0207642_10001341	Ga0207642_100013416	224
452	3300025900	Ga0207710_10000086	Ga0207710_1000008672	224
453	3300025900	Ga0207710_10012542	Ga0207710_100125422	224
454	3300025901	Ga0207688_10000835	Ga0207688_100008356	224
455	3300025901	Ga0207688_10002243	Ga0207688_100022433	224
456	3300025903	Ga0207680_10064946	Ga0207680_100649462	224
457	3300025904	Ga0207647_10136082	Ga0207647_101360822	224
458	3300025906	Ga0207699_10027566	Ga0207699_100275662	224
459	3300025906	Ga0207699_10035694	Ga0207699_100356942	224
460	3300025907	Ga0207645_10001139	Ga0207645_1000113916	224
461	3300025911	Ga0207654_10174933	Ga0207654_101749332	224
462	3300025914	Ga0207671_10010386	Ga0207671_100103866	224
463	3300025915	Ga0207693_10000380	Ga0207693_1000038041	224
464	3300025915	Ga0207693_10007220	Ga0207693_100072204	224
465	3300025916	Ga0207663_10003258	Ga0207663_100032585	224
466	3300025918	Ga0207662_10117900	Ga0207662_101179002	224
467	3300025919	Ga0207657_10230054	Ga0207657_102300542	224
468	3300025923	Ga0207681_10004059	Ga0207681_100040599	224
469	3300025923	Ga0207681_10020783	Ga0207681_100207834	224
470	3300025925	Ga0207650_10303598	Ga0207650_103035982	224
471	3300025926	Ga0207659_10014269	Ga0207659_100142692	224
472	3300025926	Ga0207659_10049664	Ga0207659_100496642	224
473	3300025927	Ga0207687_10002408	Ga0207687_100024085	224
474	3300025927	Ga0207687_10134259	Ga0207687_101342591	224
475	3300025927	Ga0207687_10140877	Ga0207687_101408772	224
476	3300025929	Ga0207664_10008656	Ga0207664_100086562	224
477	3300025931	Ga0207644_10006814	Ga0207644_100068145	224
478	3300025931	Ga0207644_10042060	Ga0207644_100420602	224
479	3300025931	Ga0207644_10058158	Ga0207644_100581582	224
480	3300025932	Ga0207690_10075436	Ga0207690_100754362	224
481	3300025933	Ga0207706_10005792	Ga0207706_100057926	224
482	3300025934	Ga0207686_10042297	Ga0207686_100422972	224
483	3300025935	Ga0207709_10000356	Ga0207709_100003563	224
484	3300025935	Ga0207709_10002838	Ga0207709_100028388	224
485	3300025935	Ga0207709_10222631	Ga0207709_102226311	224
486	3300025936	Ga0207670_10260204	Ga0207670_102602042	224
487	3300025937	Ga0207669_10000773	Ga0207669_100007737	224
488	3300025937	Ga0207669_10061543	Ga0207669_100615433	224
489	3300025937	Ga0207669_10064417	Ga0207669_100644173	224
490	3300025938	Ga0207704_10314596	Ga0207704_103145961	224
491	3300025939	Ga0207665_10013734	Ga0207665_100137342	224
492	3300025940	Ga0207691_10000652	Ga0207691_1000065210	224
493	3300025940	Ga0207691_10054380	Ga0207691_100543804	224
494	3300025940	Ga0207691_10543401	Ga0207691_105434011	224
495	3300025941	Ga0207711_10000577	Ga0207711_1000057727	224
496	3300025941	Ga0207711_10187687	Ga0207711_101876872	224
497	3300025941	Ga0207711_10300887	Ga0207711_103008872	224
498	3300025942	Ga0207689_10009498	Ga0207689_100094983	224
499	3300025942	Ga0207689_10023645	Ga0207689_100236452	224
500	3300025949	Ga0207667_10103566	Ga0207667_101035662	224
501	3300025960	Ga0207651_10075121	Ga0207651_100751212	224
502	3300025960	Ga0207651_10117816	Ga0207651_101178162	224
503	3300025961	Ga0207712_10000162	Ga0207712_1000016267	224
504	3300025961	Ga0207712_10007565	Ga0207712_100075652	224
505	3300025972	Ga0207668_10000532	Ga0207668_100005322	224
506	3300025972	Ga0207668_10003762	Ga0207668_100037623	224
507	3300025972	Ga0207668_10027637	Ga0207668_100276371	224
508	3300025972	Ga0207668_10280649	Ga0207668_102806492	224
509	3300025981	Ga0207640_10009269	Ga0207640_100092694	224
510	3300025981	Ga0207640_10080882	Ga0207640_100808824	224
511	3300025986	Ga0207658_10000314	Ga0207658_1000031421	224
512	3300025986	Ga0207658_10003281	Ga0207658_100032819	224
513	3300025986	Ga0207658_10114605	Ga0207658_101146052	224
514	3300025986	Ga0207658_10224436	Ga0207658_102244362	224
515	3300026023	Ga0207677_10007347	Ga0207677_100073476	224
516	3300026023	Ga0207677_10073990	Ga0207677_100739902	224
517	3300026023	Ga0207677_10259835	Ga0207677_102598352	224
518	3300026035	Ga0207703_10007759	Ga0207703_100077592	224
519	3300026041	Ga0207639_10012620	Ga0207639_100126202	224
520	3300026067	Ga0207678_10026792	Ga0207678_100267926	224
521	3300026067	Ga0207678_10137189	Ga0207678_101371892	224
522	3300026067	Ga0207678_10143382	Ga0207678_101433822	224
523	3300026067	Ga0207678_10205680	Ga0207678_102056802	224
524	3300026075	Ga0207708_10028734	Ga0207708_100287343	224
525	3300026075	Ga0207708_10035669	Ga0207708_100356692	224
526	3300026078	Ga0207702_10078044	Ga0207702_100780443	224
527	3300026078	Ga0207702_10147655	Ga0207702_101476551	224
528	3300026088	Ga0207641_10001022	Ga0207641_1000102224	224
529	3300026088	Ga0207641_10144809	Ga0207641_101448092	224
530	3300026088	Ga0207641_10512377	Ga0207641_105123771	224
531	3300026089	Ga0207648_10006374	Ga0207648_100063745	224
532	3300026089	Ga0207648_10437346	Ga0207648_104373462	224
533	3300026116	Ga0207674_10042173	Ga0207674_100421733	224
534	3300026118	Ga0207675_100000475	Ga0207675_1000004754	224
535	3300026118	Ga0207675_100037740	Ga0207675_1000377402	224
536	3300026121	Ga0207683_10000256	Ga0207683_1000025610	224
537	3300026121	Ga0207683_10003221	Ga0207683_100032215	224
538	3300026121	Ga0207683_10022405	Ga0207683_100224052	224
539	3300026121	Ga0207683_10650268	Ga0207683_106502682	224
540	3300026142	Ga0207698_10133743	Ga0207698_101337431	224
541	3300026142	Ga0207698_10151339	Ga0207698_101513392	224
542	3300028379	Ga0268266_10021094	Ga0268266_100210943	224
543	3300028379	Ga0268266_10022136	Ga0268266_100221364	224
544	3300028379	Ga0268266_10110824	Ga0268266_101108242	224
545	3300028380	Ga0268265_10000012	Ga0268265_1000001244	224
546	3300028381	Ga0268264_10000104	Ga0268264_10000104173	224
547	3300028381	Ga0268264_10018142	Ga0268264_100181423	224
548	3300028381	Ga0268264_10086900	Ga0268264_100869002	224
549	3300030521	Ga0307511_10067618	Ga0307511_100676182	224
550	3300031548	Ga0307408_100020166	Ga0307408_1000201662	224
551	3300031548	Ga0307408_100061809	Ga0307408_1000618093	224
552	3300031731	Ga0307405_10002614	Ga0307405_100026144	224
553	3300031731	Ga0307405_10124889	Ga0307405_101248892	224
554	3300031731	Ga0307405_10239878	Ga0307405_102398782	224
555	3300031824	Ga0307413_10016733	Ga0307413_100167334	224
556	3300031852	Ga0307410_10008070	Ga0307410_100080702	224
557	3300031852	Ga0307410_10066335	Ga0307410_100663352	224
558	3300031852	Ga0307410_10343676	Ga0307410_103436762	224
559	3300031901	Ga0307406_10039861	Ga0307406_100398611	224
560	3300031901	Ga0307406_10057964	Ga0307406_100579643	224
561	3300031901	Ga0307406_10247747	Ga0307406_102477472	224
562	3300031903	Ga0307407_10016971	Ga0307407_100169712	224
563	3300031903	Ga0307407_10068883	Ga0307407_100688832	224
564	3300031903	Ga0307407_10213655	Ga0307407_102136552	224
565	3300031903	Ga0307407_10372050	Ga0307407_103720502	224
566	3300031911	Ga0307412_10001699	Ga0307412_1000169910	224
567	3300031911	Ga0307412_10064067	Ga0307412_100640673	224
568	3300031911	Ga0307412_10140961	Ga0307412_101409612	224
569	3300031911	Ga0307412_10194790	Ga0307412_101947902	224
570	3300031911	Ga0307412_10375383	Ga0307412_103753832	224
571	3300031911	Ga0307412_10564749	Ga0307412_105647492	224
572	3300031995	Ga0307409_100001521	Ga0307409_1000015217	224
573	3300031995	Ga0307409_100028290	Ga0307409_1000282903	224
574	3300031995	Ga0307409_100262285	Ga0307409_1002622852	224
575	3300031995	Ga0307409_100496648	Ga0307409_1004966482	224
576	3300032002	Ga0307416_100006430	Ga0307416_1000064308	224
577	3300032002	Ga0307416_100019304	Ga0307416_1000193042	224
578	3300032002	Ga0307416_100396159	Ga0307416_1003961592	224
579	3300032002	Ga0307416_100429071	Ga0307416_1004290712	224
580	3300032002	Ga0307416_100598298	Ga0307416_1005982982	224
581	3300032004	Ga0307414_10015195	Ga0307414_100151951	224
582	3300032005	Ga0307411_10246180	Ga0307411_102461801	224
583	3300032126	Ga0307415_100038186	Ga0307415_1000381861	224
584	3300035092	Ga0373952_0032887	Ga0373952_0032887_158_904	224
585	3300035115	Ga0373941_0060676	Ga0373941_0060676_48_794	224
586	3300035121	Ga0373960_0019111	Ga0373960_0019111_356_1102	224
587	3300035242	Ga0373962_0076180	Ga0373962_0076180_133_879	224
588	3300035691	Ga0373931_0013372	Ga0373931_0013372_1922_2707	224
589	3300035725	Ga0373947_0105426	Ga0373947_0105426_58_804	224
590	3300037312	Ga0395899_0004087	Ga0395899_0004087_4838_5584	224
591	3300037312	Ga0395899_0021796	Ga0395899_0021796_2394_3164	224
592	3300037418	Ga0395900_0006555	Ga0395900_0006555_8548_9294	224
593	3300037418	Ga0395900_0025070	Ga0395900_0025070_179_949	224
594	3300037418	Ga0395900_0115435	Ga0395900_0115435_731_1477	224
595	3300038443	Ga0395901_0080666	Ga0395901_0080666_104_874	224
596	3300038443	Ga0395901_0503555	Ga0395901_0503555_138_884	224
597	3300041404	Ga0439436_0000283	Ga0439436_0000283_8573_9322	224
598	3300041406	Ga0439439_0007960	Ga0439439_0007960_1327_2076	224
599	3300041406	Ga0439439_0053794	Ga0439439_0053794_250_999	224
600	3300041410	Ga0439461_0001656	Ga0439461_0001656_96_842	224
601	3300041411	Ga0439466_0004947	Ga0439466_0004947_3790_4539	224
602	3300041411	Ga0439466_0021222	Ga0439466_0021222_1174_1920	224
603	3300041411	Ga0439466_0031523	Ga0439466_0031523_237_983	224
604	3300041413	Ga0439465_0004404	Ga0439465_0004404_694_1440	224
605	3300041413	Ga0439465_0007398	Ga0439465_0007398_1515_2261	224
606	3300041413	Ga0439465_0008108	Ga0439465_0008108_1303_2049	224
607	3300041452	Ga0451793_0846719	Ga0451793_0846719_15_761	224
608	3300041997	Ga0439431_0005010	Ga0439431_0005010_1231_1977	224
609	3300041999	Ga0439433_0000008	Ga0439433_0000008_420_1169	224
610	3300042002	Ga0439442_000171	Ga0439442_000171_7177_7926	224
611	3300042006	Ga0439432_052044	Ga0439432_052044_237_986	224
612	3300042007	Ga0439449_0002123	Ga0439449_0002123_3745_4494	224
613	3300042014	Ga0439457_000413	Ga0439457_000413_9672_10421	224
614	3300042015	Ga0439462_0004028	Ga0439462_0004028_1459_2208	224
615	3300042146	Ga0450907_028214	Ga0450907_028214_141_890	224
616	3300042435	Ga0439434_0007816	Ga0439434_0007816_745_1491	224
617	3300042435	Ga0439434_0022273	Ga0439434_0022273_566_1312	224
618	3300042435	Ga0439434_0038854	Ga0439434_0038854_370_1116	224
619	3300042438	Ga0439459_0003085	Ga0439459_0003085_1366_2112	224
620	3300044658	Ga0466972_0002999	Ga0466972_0002999_1958_2704	224
621	3300044658	Ga0466972_0015648	Ga0466972_0015648_175_921	224
622	3300044658	Ga0466972_0019037	Ga0466972_0019037_2331_3077	224
623	3300044658	Ga0466972_0037094	Ga0466972_0037094_1201_1947	224
624	3300044658	Ga0466972_0053379	Ga0466972_0053379_48_794	224
625	3300044658	Ga0466972_0201960	Ga0466972_0201960_50_796	224
626	3300044683	Ga0466965_0005502	Ga0466965_0005502_2952_3698	224
627	3300044683	Ga0466965_0016622	Ga0466965_0016622_486_1232	224
628	3300044683	Ga0466965_0031943	Ga0466965_0031943_1659_2405	224
629	3300044684	Ga0466966_0008974	Ga0466966_0008974_4084_4830	224
630	3300044684	Ga0466966_0083173	Ga0466966_0083173_214_960	224
631	3300044693	Ga0466961_0036439	Ga0466961_0036439_271_1017	224
632	3300044693	Ga0466961_0420802	Ga0466961_0420802_52_798	224
633	3300044694	Ga0466963_0315434	Ga0466963_0315434_52_798	224
634	3300044719	Ga0466971_0012969	Ga0466971_0012969_215_961	224
635	3300044735	Ga0466968_0013643	Ga0466968_0013643_1443_2189	224
636	3300044765	Ga0466970_0016917	Ga0466970_0016917_1302_2048	224
637	3300044765	Ga0466970_0034415	Ga0466970_0034415_318_1064	224
638	3300044765	Ga0466970_0038312	Ga0466970_0038312_1283_2029	224
639	3300044765	Ga0466970_0103022	Ga0466970_0103022_69_815	224
640	3300044842	Ga0466957_0012742	Ga0466957_0012742_1297_2043	224
641	3300044842	Ga0466957_0148729	Ga0466957_0148729_508_1254	224
642	3300044901	Ga0466960_0000765	Ga0466960_0000765_6670_7416	224
643	3300044901	Ga0466960_0008055	Ga0466960_0008055_57_803	224
644	3300045049	Ga0466959_0014228	Ga0466959_0014228_401_1147	224
645	3300045049	Ga0466959_0049817	Ga0466959_0049817_990_1736	224
646	3300045049	Ga0466959_0188055	Ga0466959_0188055_682_1428	224
647	3300045836	Ga0466958_0003442	Ga0466958_0003442_2035_2781	224
648	3300045836	Ga0466958_0033749	Ga0466958_0033749_1801_2547	224
649	3300045976	Ga0466967_0021027	Ga0466967_0021027_4280_5026	224
650	3300045976	Ga0466967_0363665	Ga0466967_0363665_216_962	224
651	3300045976	Ga0466967_0393462	Ga0466967_0393462_308_1054	224
652	3300045976	Ga0466967_0489475	Ga0466967_0489475_397_1143	224
653	3300046455	Ga0495603_0020591	Ga0495603_0020591_2047_2793	224
654	3300046457	Ga0495590_0089886	Ga0495590_0089886_75_821	224
655	3300046459	Ga0495629_0110979	Ga0495629_0110979_459_1205	224
656	3300046459	Ga0495629_0437335	Ga0495629_0437335_61_810	224
657	3300046460	Ga0495638_0001757	Ga0495638_0001757_8728_9474	224
658	3300046461	Ga0495641_0016962	Ga0495641_0016962_381_1127	224
659	3300046472	Ga0495580_0156652	Ga0495580_0156652_530_1282	224
660	3300046473	Ga0495582_0206143	Ga0495582_0206143_347_1096	224
661	3300046475	Ga0495639_0014643	Ga0495639_0014643_387_1136	224
662	3300046507	Ga0495606_0052510	Ga0495606_0052510_1420_2166	224
663	3300046511	Ga0495608_0179653	Ga0495608_0179653_252_998	224
664	3300046518	Ga0495631_0126137	Ga0495631_0126137_265_1014	224
665	3300046524	Ga0495648_0001893	Ga0495648_0001893_15130_15876	224
666	3300046528	Ga0495642_0014407	Ga0495642_0014407_44_793	224
667	3300046531	Ga0495665_0008142	Ga0495665_0008142_53_802	224
668	3300046531	Ga0495665_0111548	Ga0495665_0111548_595_1347	224
669	3300046533	Ga0495640_0035712	Ga0495640_0035712_1343_2089	224
670	3300046535	Ga0495586_0054179	Ga0495586_0054179_1412_2161	224
671	3300046536	Ga0495587_0145906	Ga0495587_0145906_192_941	224
672	3300046543	Ga0495645_0004704	Ga0495645_0004704_4168_4917	224
673	3300046615	Ga0495656_0022331	Ga0495656_0022331_38_787	224
674	3300046615	Ga0495656_0050362	Ga0495656_0050362_971_1720	224
675	3300046615	Ga0495656_0086597	Ga0495656_0086597_18_767	224
676	3300046616	Ga0495668_0009288	Ga0495668_0009288_2660_3406	224
677	3300046616	Ga0495668_0021361	Ga0495668_0021361_1227_1976	224
678	3300046660	Ga0495625_0039586	Ga0495625_0039586_579_1325	224
679	3300046674	Ga0495588_0101706	Ga0495588_0101706_723_1472	224
680	3300046689	Ga0495613_0320922	Ga0495613_0320922_237_983	224
681	3300046691	Ga0495670_0010517	Ga0495670_0010517_1209_1958	224
682	3300046691	Ga0495670_0013436	Ga0495670_0013436_2029_2778	224
683	3300046692	Ga0495671_0088144	Ga0495671_0088144_303_1049	224
684	3300046694	Ga0495649_0127337	Ga0495649_0127337_159_905	224
685	3300047315	Ga0495581_0013221	Ga0495581_0013221_2562_3311	224
686	3300047315	Ga0495581_0025490	Ga0495581_0025490_338_1084	224
687	3300047315	Ga0495581_0027860	Ga0495581_0027860_1440_2189	224
688	3300047315	Ga0495581_0124403	Ga0495581_0124403_58_807	224
689	3300047315	Ga0495581_0336554	Ga0495581_0336554_70_819	224
690	3300047317	Ga0495604_0508961	Ga0495604_0508961_10_759	224
691	3300047318	Ga0495636_0028973	Ga0495636_0028973_49_798	224
692	3300047319	Ga0495674_0031252	Ga0495674_0031252_529_1275	224
693	3300047320	Ga0495672_0003957	Ga0495672_0003957_6961_7707	224
694	3300047320	Ga0495672_0205263	Ga0495672_0205263_179_925	224
695	3300047321	Ga0495676_0178378	Ga0495676_0178378_211_957	224
696	3300047322	Ga0495680_0142225	Ga0495680_0142225_960_1709	224
697	3300047322	Ga0495680_0334074	Ga0495680_0334074_64_810	224
698	3300047469	Ga0495673_0000617	Ga0495673_0000617_7678_8424	224
699	3300047471	Ga0495684_0241344	Ga0495684_0241344_20_766	224
700	3300047472	Ga0495686_0001752	Ga0495686_0001752_4691_5440	224
701	3300048091	Ga0495626_0074940	Ga0495626_0074940_741_1487	224
702	3300048903	Ga0496100_0001571	Ga0496100_0001571_7177_7923	224
703	3300048903	Ga0496100_0008250	Ga0496100_0008250_1410_2156	224
704	3300048903	Ga0496100_0012693	Ga0496100_0012693_1113_1859	224
705	3300048903	Ga0496100_0021184	Ga0496100_0021184_1515_2300	224
706	3300048903	Ga0496100_0037688	Ga0496100_0037688_391_1137	224
707	3300048903	Ga0496100_0072657	Ga0496100_0072657_559_1305	224
708	3300048903	Ga0496100_0102758	Ga0496100_0102758_1133_1882	224
709	3300048904	Ga0496101_0000037	Ga0496101_0000037_52409_53155	224
710	3300048904	Ga0496101_0000155	Ga0496101_0000155_34394_35140	224
711	3300048904	Ga0496101_0001909	Ga0496101_0001909_6094_6879	224
712	3300048904	Ga0496101_0016210	Ga0496101_0016210_80_829	224
713	3300048904	Ga0496101_0017244	Ga0496101_0017244_1298_2044	224
714	3300048904	Ga0496101_0223390	Ga0496101_0223390_165_911	224
715	3300048905	Ga0496102_0000083	Ga0496102_0000083_71004_71750	224
716	3300048905	Ga0496102_0000214	Ga0496102_0000214_4505_5251	224
717	3300048905	Ga0496102_0019565	Ga0496102_0019565_1172_1918	224
718	3300048905	Ga0496102_0047882	Ga0496102_0047882_418_1167	224
719	3300048905	Ga0496102_0082430	Ga0496102_0082430_2056_2802	224
720	3300048905	Ga0496102_0119893	Ga0496102_0119893_188_934	224
721	3300048905	Ga0496102_0123277	Ga0496102_0123277_226_972	224
722	3300048905	Ga0496102_0325174	Ga0496102_0325174_579_1328	224
723	3300048906	Ga0496103_0000060	Ga0496103_0000060_71428_72174	224
724	3300048906	Ga0496103_0001320	Ga0496103_0001320_3508_4254	224
725	3300048906	Ga0496103_0008785	Ga0496103_0008785_1387_2172	224
726	3300048906	Ga0496103_0030354	Ga0496103_0030354_142_888	224
727	3300048906	Ga0496103_0133232	Ga0496103_0133232_418_1167	224
728	3300048907	Ga0496104_0005755	Ga0496104_0005755_2315_3061	224
729	3300048907	Ga0496104_0220502	Ga0496104_0220502_1008_1793	224
730	3300048907	Ga0496104_0250357	Ga0496104_0250357_927_1673	224
731	3300048908	Ga0496105_0004580	Ga0496105_0004580_6289_7035	224
732	3300048908	Ga0496105_0080447	Ga0496105_0080447_718_1464	224
733	3300048909	Ga0496106_0000744	Ga0496106_0000744_15330_16115	224
734	3300048909	Ga0496106_0007674	Ga0496106_0007674_6840_7589	224
735	3300048909	Ga0496106_0027949	Ga0496106_0027949_33_779	224
736	3300048909	Ga0496106_0030317	Ga0496106_0030317_2399_3145	224
737	3300048909	Ga0496106_0300361	Ga0496106_0300361_75_824	224
738	3300048910	Ga0496107_0003329	Ga0496107_0003329_7648_8394	224
739	3300048910	Ga0496107_0005555	Ga0496107_0005555_6593_7378	224
740	3300048910	Ga0496107_0036805	Ga0496107_0036805_1693_2439	224
741	3300048910	Ga0496107_0070078	Ga0496107_0070078_1386_2135	224
742	3300048910	Ga0496107_0126965	Ga0496107_0126965_883_1629	224
743	3300048911	Ga0496108_0000691	Ga0496108_0000691_16423_17169	224
744	3300048911	Ga0496108_0012383	Ga0496108_0012383_6104_6850	224
745	3300048911	Ga0496108_0053188	Ga0496108_0053188_2175_2921	224
746	3300048911	Ga0496108_0162666	Ga0496108_0162666_1130_1879	224
747	3300048912	Ga0496109_0001943	Ga0496109_0001943_12802_13548	224
748	3300048912	Ga0496109_0073268	Ga0496109_0073268_257_1003	224
749	3300048912	Ga0496109_0159013	Ga0496109_0159013_790_1539	224
750	3300048912	Ga0496109_0412963	Ga0496109_0412963_451_1200	224
751	3300048912	Ga0496109_0621041	Ga0496109_0621041_211_957	224
752	3300048913	Ga0496110_0379240	Ga0496110_0379240_480_1229	224
753	3300048914	Ga0496111_0031194	Ga0496111_0031194_387_1136	224
754	3300048914	Ga0496111_0238173	Ga0496111_0238173_461_1210	224
755	3300048914	Ga0496111_0380248	Ga0496111_0380248_211_957	224
756	3300048915	Ga0496112_0011010	Ga0496112_0011010_6856_7602	224
757	3300048915	Ga0496112_0048020	Ga0496112_0048020_3143_3889	224
758	3300048915	Ga0496112_0070562	Ga0496112_0070562_1789_2535	224
759	3300048915	Ga0496112_0119252	Ga0496112_0119252_49_795	224
760	3300048915	Ga0496112_0253495	Ga0496112_0253495_523_1272	224
761	3300048916	Ga0496113_0133645	Ga0496113_0133645_669_1418	224
762	3300048917	Ga0496114_0001181	Ga0496114_0001181_17075_17821	224
763	3300048917	Ga0496114_0002968	Ga0496114_0002968_6947_7732	224
764	3300048917	Ga0496114_0379813	Ga0496114_0379813_246_992	224
765	3300048917	Ga0496114_0629829	Ga0496114_0629829_62_811	224
766	3300048918	Ga0496115_0003248	Ga0496115_0003248_9485_10231	224
767	3300048918	Ga0496115_0010221	Ga0496115_0010221_5765_6550	224
768	3300048918	Ga0496115_0021396	Ga0496115_0021396_730_1479	224
769	3300048919	Ga0496116_0000159	Ga0496116_0000159_66353_67099	224
770	3300048919	Ga0496116_0034145	Ga0496116_0034145_2522_3268	224
771	3300048919	Ga0496116_0035822	Ga0496116_0035822_2396_3142	224
772	3300048920	Ga0496117_0000167	Ga0496117_0000167_71004_71750	224
773	3300048920	Ga0496117_0005495	Ga0496117_0005495_5322_6068	224
774	3300048920	Ga0496117_0010419	Ga0496117_0010419_6564_7310	224
775	3300048920	Ga0496117_0011373	Ga0496117_0011373_3690_4436	224
776	3300048920	Ga0496117_0127680	Ga0496117_0127680_26_772	224
777	3300048921	Ga0496118_0000121	Ga0496118_0000121_66353_67099	224
778	3300048921	Ga0496118_0000331	Ga0496118_0000331_18122_18868	224
779	3300048921	Ga0496118_0092228	Ga0496118_0092228_1010_1756	224
780	3300048922	Ga0496119_0031067	Ga0496119_0031067_1897_2643	224
781	3300048922	Ga0496119_0079950	Ga0496119_0079950_339_1085	224
782	3300048922	Ga0496119_0096428	Ga0496119_0096428_499_1248	224
783	3300048923	Ga0496120_0033483	Ga0496120_0033483_535_1281	224
784	3300048923	Ga0496120_0048910	Ga0496120_0048910_339_1085	224
785	3300048924	Ga0496121_0000062	Ga0496121_0000062_265909_266655	224
786	3300048924	Ga0496121_0002221	Ga0496121_0002221_1372_2118	224
787	3300048925	Ga0496122_0040839	Ga0496122_0040839_592_1338	224
788	3300048927	Ga0496124_0079426	Ga0496124_0079426_832_1578	224
789	3300048927	Ga0496124_0302471	Ga0496124_0302471_374_1123	224
790	3300048929	Ga0496126_0000368	Ga0496126_0000368_86228_86974	224
791	3300048929	Ga0496126_0009512	Ga0496126_0009512_1331_2077	224
792	3300048929	Ga0496126_0242340	Ga0496126_0242340_50_799	224
793	3300049534	Ga0501318_000666	Ga0501318_000666_32_829	224
794	3300049568	Ga0501031_0016650	Ga0501031_0016650_2797_3543	224
795	3300049569	Ga0501032_0002237	Ga0501032_0002237_1397_2146	224
796	3300049569	Ga0501032_0043935	Ga0501032_0043935_524_1270	224
797	3300049570	Ga0501033_0062691	Ga0501033_0062691_1596_2342	224
798	3300049571	Ga0501034_0000075	Ga0501034_0000075_38171_38920	224
799	3300049571	Ga0501034_0017783	Ga0501034_0017783_4526_5272	224
800	3300049571	Ga0501034_0383788	Ga0501034_0383788_239_985	224
801	3300049571	Ga0501034_0404011	Ga0501034_0404011_520_1266	224
802	3300049572	Ga0501036_0012156	Ga0501036_0012156_2493_3239	224
803	3300049573	Ga0501037_0000534	Ga0501037_0000534_2025_2771	224
804	3300049573	Ga0501037_0149604	Ga0501037_0149604_589_1338	224
805	3300049574	Ga0501038_0007684	Ga0501038_0007684_692_1441	224
806	3300049574	Ga0501038_0111388	Ga0501038_0111388_1177_1923	224
807	3300049575	Ga0501039_0001148	Ga0501039_0001148_5287_6033	224
808	3300049575	Ga0501039_0089513	Ga0501039_0089513_1124_1873	224
809	3300049579	Ga0501043_0039982	Ga0501043_0039982_2868_3617	224
810	3300049579	Ga0501043_0163012	Ga0501043_0163012_779_1525	224
811	3300049580	Ga0501046_0124610	Ga0501046_0124610_345_1091	224
812	3300049581	Ga0501047_0020772	Ga0501047_0020772_779_1525	224
813	3300049586	Ga0501070_0010574	Ga0501070_0010574_6483_7229	224
814	3300049586	Ga0501070_0513842	Ga0501070_0513842_19_768	224
815	3300049587	Ga0501071_0003273	Ga0501071_0003273_4896_5642	224
816	3300049775	Ga0501279_002540	Ga0501279_002540_1633_2382	224
817	3300049822	Ga0501035_0298247	Ga0501035_0298247_396_1142	224
818	3300049823	Ga0501044_0136647	Ga0501044_0136647_1458_2204	224
819	3300049824	Ga0501045_0042509	Ga0501045_0042509_1764_2510	224
820	3300050490	nmdc:mga03n38_10471_c1	nmdc:mga03n38_10471_c1_2116_2862	224
821	3300050490	nmdc:mga03n38_95062_c1	nmdc:mga03n38_95062_c1_532_1278	224
822	3300050491	nmdc:mga00v17_143324_c1	nmdc:mga00v17_143324_c1_246_992	224
823	3300050491	nmdc:mga00v17_147757_c1	nmdc:mga00v17_147757_c1_152_898	224
824	3300050491	nmdc:mga00v17_3777_c1	nmdc:mga00v17_3777_c1_4894_5640	224
825	3300050491	nmdc:mga00v17_73847_c1	nmdc:mga00v17_73847_c1_637_1383	224
826	3300050491	nmdc:mga00v17_8866_c1	nmdc:mga00v17_8866_c1_371_1117	224
827	3300050491	nmdc:mga00v17_952_c1	nmdc:mga00v17_952_c1_4083_4829	224
828	3300050491	nmdc:mga00v17_95441_c1	nmdc:mga00v17_95441_c1_812_1558	224
829	3300050492	nmdc:mga0yw44_127869_c1	nmdc:mga0yw44_127869_c1_881_1627	224
830	3300050492	nmdc:mga0yw44_249102_c1	nmdc:mga0yw44_249102_c1_55_801	224
831	3300050492	nmdc:mga0yw44_69198_c1	nmdc:mga0yw44_69198_c1_1036_1782	224
832	3300050496	nmdc:mga07m45_38441_c1	nmdc:mga07m45_38441_c1_1566_2312	224
833	3300050507	nmdc:mga05p37_16428_c1	nmdc:mga05p37_16428_c1_7535_8281	224
834	3300050509	nmdc:mga0qj67_279628_c1	nmdc:mga0qj67_279628_c1_107_853	224
835	3300050510	nmdc:mga06r32_69149_c1	nmdc:mga06r32_69149_c1_1764_2510	224
836	3300050511	nmdc:mga08y16_93138_c1	nmdc:mga08y16_93138_c1_47_793	224
837	3300050516	nmdc:mga0sz30_1190_c1	nmdc:mga0sz30_1190_c1_3580_4326	224
838	3300050516	nmdc:mga0sz30_1821_c1	nmdc:mga0sz30_1821_c1_2250_2996	224
839	3300050516	nmdc:mga0sz30_97765_c1	nmdc:mga0sz30_97765_c1_394_1140	224
840	3300053083	Ga0495655_0002104	Ga0495655_0002104_2341_3087	224
841	3300053085	Ga0495619_0183000	Ga0495619_0183000_101_847	224
842	3300053087	Ga0500643_004972	Ga0500643_004972_30_776	224
843	3300053087	Ga0500643_065591	Ga0500643_065591_226_972	224
844	3300053108	Ga0500562_011739	Ga0500562_011739_736_1482	224
845	3300053153	Ga0500616_0006493	Ga0500616_0006493_4907_5653	224
846	3300053153	Ga0500616_0031708	Ga0500616_0031708_358_1104	224
847	iso_pu_bacteria	2537561592	2537898380	224
848	iso_pu_bacteria	2643221546	2643753789	224
849	iso_pu_bacteria	2643221572	2643877469	224
850	iso_pu_bacteria	2643221669	2644384524	224
851	iso_pu_bacteria	2643221724	2644678922	224
852	iso_pu_bacteria	2728369380	2730228434	224
853	iso_pu_bacteria	2844849076	2844851221	224
854	iso_pu_bacteria	2919391150	2919391937	224
855	iso_pu_bacteria	2939657138	2939657331	224
856	iso_pu_bacteria	2939660829	2939662132	224
857	iso_pu_bacteria	2945956166	2945956813	224
858	iso_pu_bacteria	2974315732	2974319429	224
859	iso_pu_bacteria	2984523437	2984527636	224
860	iso_pu_bacteria	3006486233	3006488840	224
861	3300004803	Ga0058862_12361512	Ga0058862_123615121	225
862	3300005577	Ga0068857_100012849	Ga0068857_1000128494	225
863	3300009147	Ga0114129_10001649	Ga0114129_100016496	225
864	3300014325	Ga0163163_10703814	Ga0163163_107038141	225
865	3300020070	Ga0206356_11020267	Ga0206356_110202672	225
866	3300022467	Ga0224712_10003216	Ga0224712_100032162	225
867	3300026116	Ga0207674_10012314	Ga0207674_100123147	225
868	3300037312	Ga0395899_0084014	Ga0395899_0084014_903_1652	225
869	3300048904	Ga0496101_0046627	Ga0496101_0046627_2064_2813	225
870	3300048908	Ga0496105_0109699	Ga0496105_0109699_670_1419	225
871	3300048908	Ga0496105_0372615	Ga0496105_0372615_147_896	225
872	3300048910	Ga0496107_0559478	Ga0496107_0559478_27_776	225
873	3300048917	Ga0496114_0112162	Ga0496114_0112162_1086_1835	225
874	3300048920	Ga0496117_0002042	Ga0496117_0002042_12719_13489	225
875	3300048929	Ga0496126_0007083	Ga0496126_0007083_3323_4093	225
876	3300049571	Ga0501034_0085363	Ga0501034_0085363_344_1093	225
877	3300049571	Ga0501034_0089973	Ga0501034_0089973_499_1248	225
878	3300049571	Ga0501034_0312752	Ga0501034_0312752_83_832	225
879	3300050507	nmdc:mga05p37_87538_c1	nmdc:mga05p37_87538_c1_438_1187	225
880	iso_pu_bacteria	2643221601	2644015108	225
881	iso_pu_bacteria	2643221631	2644176807	225
882	iso_pu_bacteria	2919446982	2919450039	225
883	iso_pu_bacteria	2920879853	2920881394	225
884	3300003578	Ga0006562J51391_1053282	Ga0006562J51391_105328217	226
885	3300003578	Ga0006562J51391_1053284	Ga0006562J51391_10532844	226
886	3300005288	Ga0065714_10074058	Ga0065714_100740583	226
887	3300005367	Ga0070667_100788003	Ga0070667_1007880031	226
888	3300006038	Ga0075365_10010672	Ga0075365_100106724	226
889	3300006048	Ga0075363_100047773	Ga0075363_1000477733	226
890	3300006051	Ga0075364_10016519	Ga0075364_100165196	226
891	3300006178	Ga0075367_10015753	Ga0075367_100157534	226
892	3300006186	Ga0075369_10008700	Ga0075369_100087003	226
893	3300006353	Ga0075370_10045241	Ga0075370_100452413	226
894	3300009036	Ga0105244_10000373	Ga0105244_100003738	226
895	3300009036	Ga0105244_10002548	Ga0105244_100025488	226
896	3300009148	Ga0105243_10006613	Ga0105243_100066139	226
897	3300013307	Ga0157372_10459318	Ga0157372_104593182	226
898	3300014326	Ga0157380_10133502	Ga0157380_101335022	226
899	3300025728	Ga0207655_1000650	Ga0207655_100065050	226
900	3300025728	Ga0207655_1002763	Ga0207655_100276310	226
901	3300025904	Ga0207647_10159320	Ga0207647_101593202	226
902	3300025935	Ga0207709_10007401	Ga0207709_100074017	226
903	3300028379	Ga0268266_10171592	Ga0268266_101715922	226
904	3300031901	Ga0307406_10003079	Ga0307406_1000307910	226
905	3300041451	Ga0451791_0976903	Ga0451791_0976903_4930_5712	226
906	3300041509	Ga0451843_0112597	Ga0451843_0112597_785_1567	226
907	3300041512	Ga0451853_0182249	Ga0451853_0182249_3185_3967	226
908	3300042007	Ga0439449_0047469	Ga0439449_0047469_250_1002	226
909	3300046507	Ga0495606_0006016	Ga0495606_0006016_7416_8189	226
910	3300046616	Ga0495668_0000284	Ga0495668_0000284_44248_45021	226
911	3300046660	Ga0495625_0003624	Ga0495625_0003624_3858_4631	226
912	3300048091	Ga0495626_0005356	Ga0495626_0005356_3056_3829	226
913	3300048921	Ga0496118_0072208	Ga0496118_0072208_154_924	226
914	3300048925	Ga0496122_0000553	Ga0496122_0000553_54095_54847	226
915	3300048926	Ga0496123_0004911	Ga0496123_0004911_5944_6696	226
916	3300049571	Ga0501034_0544913	Ga0501034_0544913_119_871	226
917	3300049572	Ga0501036_0125050	Ga0501036_0125050_817_1569	226
918	3300049573	Ga0501037_0020674	Ga0501037_0020674_1439_2191	226
919	3300049574	Ga0501038_0106333	Ga0501038_0106333_731_1483	226
920	3300049579	Ga0501043_0095395	Ga0501043_0095395_1213_1965	226
921	3300049580	Ga0501046_0044449	Ga0501046_0044449_1472_2224	226
922	3300049581	Ga0501047_0161290	Ga0501047_0161290_776_1528	226
923	3300049586	Ga0501070_0001157	Ga0501070_0001157_12389_13141	226
924	3300049822	Ga0501035_0650843	Ga0501035_0650843_54_806	226
925	3300050490	nmdc:mga03n38_18647_c2	nmdc:mga03n38_18647_c2_543_1295	226
926	3300050491	nmdc:mga00v17_125493_c1	nmdc:mga00v17_125493_c1_16_786	226
927	3300050491	nmdc:mga00v17_13288_c1	nmdc:mga00v17_13288_c1_3557_4309	226
928	3300050495	nmdc:mga04h51_7046_c1	nmdc:mga04h51_7046_c1_953_1705	226
929	3300050496	nmdc:mga07m45_7063_c1	nmdc:mga07m45_7063_c1_1332_2084	226
930	3300050516	nmdc:mga0sz30_8660_c1	nmdc:mga0sz30_8660_c1_2051_2803	226
931	iso_pu_bacteria	2554235227	2555230943	226
932	iso_pu_bacteria	2643221567	2643850345	226
933	iso_pu_bacteria	2643221624	2644135017	226
934	iso_pu_bacteria	2654587600	2655033810	226
935	iso_pu_bacteria	2773857762	2774394421	226
936	iso_pu_bacteria	2795385472	2795795210	226
937	iso_pu_bacteria	2808606306	2808630935	226
938	iso_pu_bacteria	2808606368	2808885873	226
939	iso_pu_bacteria	2808606439	2809194723	226
940	iso_pu_bacteria	2811994878	2812353042	226
941	iso_pu_bacteria	2887478801	2887485906	226
942	iso_pu_bacteria	2891968417	2891972821	226
943	iso_pu_bacteria	2932431166	2932433804	226
944	iso_pu_bacteria	2995463766	2995464756	226
945	3300005937	Ga0081455_10069204	Ga0081455_100692045	227
946	3300006058	Ga0075432_10000242	Ga0075432_1000024210	227
947	3300006844	Ga0075428_100092251	Ga0075428_1000922513	227
948	3300006852	Ga0075433_10006369	Ga0075433_100063698	227
949	3300006871	Ga0075434_100000910	Ga0075434_10000091015	227
950	3300006914	Ga0075436_100002147	Ga0075436_10000214710	227
951	3300007076	Ga0075435_100002984	Ga0075435_1000029847	227
952	3300026121	Ga0207683_10007195	Ga0207683_100071952	227
953	3300027907	Ga0207428_10000407	Ga0207428_100004079	227
954	3300031548	Ga0307408_100005048	Ga0307408_10000504810	227
955	3300031731	Ga0307405_10038271	Ga0307405_100382714	227
956	3300031824	Ga0307413_10087783	Ga0307413_100877831	227
957	3300031852	Ga0307410_10002987	Ga0307410_100029876	227
958	3300031901	Ga0307406_10000178	Ga0307406_1000017820	227
959	3300031903	Ga0307407_10101563	Ga0307407_101015632	227
960	3300031995	Ga0307409_100000015	Ga0307409_10000001549	227
961	3300032002	Ga0307416_100000138	Ga0307416_10000013826	227
962	3300032004	Ga0307414_10085508	Ga0307414_100855082	227
963	3300032005	Ga0307411_10172076	Ga0307411_101720762	227
964	3300032126	Ga0307415_100001322	Ga0307415_10000132215	227
965	3300032126	Ga0307415_100277758	Ga0307415_1002777581	227
966	3300037466	Ga0395898_0512119	Ga0395898_0512119_74_829	227
967	3300042002	Ga0439442_037834	Ga0439442_037834_125_946	227
968	3300042439	Ga0439464_0036428	Ga0439464_0036428_50_805	227
969	3300044656	Ga0466969_0002553	Ga0466969_0002553_7592_8353	227
970	3300044684	Ga0466966_0034293	Ga0466966_0034293_805_1566	227
971	3300045049	Ga0466959_0008744	Ga0466959_0008744_531_1292	227
972	3300045049	Ga0466959_0158512	Ga0466959_0158512_77_832	227
973	3300046499	Ga0495594_0211522	Ga0495594_0211522_312_1085	227
974	3300046525	Ga0495663_0117293	Ga0495663_0117293_120_875	227
975	3300047317	Ga0495604_0025047	Ga0495604_0025047_1438_2211	227
976	3300047444	Ga0495675_0021904	Ga0495675_0021904_1962_2735	227
977	3300048903	Ga0496100_0028638	Ga0496100_0028638_62_883	227
978	3300048903	Ga0496100_0421936	Ga0496100_0421936_202_957	227
979	3300048904	Ga0496101_0013567	Ga0496101_0013567_2735_3556	227
980	3300048905	Ga0496102_0113533	Ga0496102_0113533_1596_2417	227
981	3300048907	Ga0496104_0034970	Ga0496104_0034970_1890_2723	227
982	3300048908	Ga0496105_0057057	Ga0496105_0057057_2243_3064	227
983	3300048913	Ga0496110_0065280	Ga0496110_0065280_2228_3061	227
984	3300048917	Ga0496114_0013791	Ga0496114_0013791_4077_4898	227
985	3300048922	Ga0496119_0208260	Ga0496119_0208260_59_880	227
986	3300049568	Ga0501031_0020800	Ga0501031_0020800_3459_4214	227
987	3300049569	Ga0501032_0021157	Ga0501032_0021157_3705_4460	227
988	3300049571	Ga0501034_0013162	Ga0501034_0013162_3187_3942	227
989	3300049572	Ga0501036_0003435	Ga0501036_0003435_5756_6511	227
990	3300049573	Ga0501037_0001743	Ga0501037_0001743_11715_12470	227
991	3300049574	Ga0501038_0014715	Ga0501038_0014715_3409_4164	227
992	3300049575	Ga0501039_0000218	Ga0501039_0000218_37389_38144	227
993	3300049579	Ga0501043_0006476	Ga0501043_0006476_5237_5992	227
994	3300049580	Ga0501046_0000272	Ga0501046_0000272_5680_6435	227
995	3300049581	Ga0501047_0008205	Ga0501047_0008205_4530_5285	227
996	3300049585	Ga0501069_0002212	Ga0501069_0002212_5957_6712	227
997	3300049586	Ga0501070_0136820	Ga0501070_0136820_65_820	227
998	3300049589	Ga0501073_0006480	Ga0501073_0006480_5811_6566	227
999	3300049590	Ga0501074_0006538	Ga0501074_0006538_5048_5803	227
1000	3300049742	Ga0501080_0032687	Ga0501080_0032687_2818_3573	227
1001	3300049744	Ga0501083_0175866	Ga0501083_0175866_136_891	227
1002	3300049823	Ga0501044_0015377	Ga0501044_0015377_1655_2482	227
1003	3300049823	Ga0501044_0028184	Ga0501044_0028184_5109_5864	227
1004	3300050511	nmdc:mga08y16_5982_c1	nmdc:mga08y16_5982_c1_2645_3409	227
1005	3300050512	nmdc:mga0n895_2299_c1	nmdc:mga0n895_2299_c1_9348_10112	227
1006	3300050513	nmdc:mga0rr50_350_c1	nmdc:mga0rr50_350_c1_21082_21846	227
1007	3300050514	nmdc:mga08x19_2280_c1	nmdc:mga08x19_2280_c1_103_867	227
1008	3300050515	nmdc:mga0a205_2578_c1	nmdc:mga0a205_2578_c1_10667_11431	227
1009	3300054114	Ga0501084_0022081	Ga0501084_0022081_977_1732	227
1010	iso_pu_bacteria	2643221711	2644609522	227
1011	iso_pu_bacteria	2751185734	2753076075	227
1012	iso_pu_bacteria	2811994882	2812374730	227
1013	iso_pu_bacteria	2811994917	2812483379	227
1014	iso_pu_bacteria	2818991318	2819427327	227
1015	iso_pu_bacteria	2818991458	2819666356	227
1016	iso_pu_bacteria	2862290372	2862294275	227
1017	iso_pu_bacteria	2912723979	2912728746	227
1018	iso_pu_bacteria	2946045630	2946046846	227
1019	3300005617	Ga0068859_100075633	Ga0068859_1000756334	228
1020	3300005844	Ga0068862_100127113	Ga0068862_1001271132	228
1021	3300006931	Ga0097620_100075633	Ga0097620_1000756332	228
1022	3300038443	Ga0395901_0049853	Ga0395901_0049853_182_943	228
1023	3300047444	Ga0495675_0032030	Ga0495675_0032030_1601_2383	229
1024	3300048928	Ga0496125_0000077	Ga0496125_0000077_112072_112836	229
1025	3300049570	Ga0501033_0062448	Ga0501033_0062448_34_795	229
1026	3300049571	Ga0501034_0485864	Ga0501034_0485864_103_864	229
1027	3300049572	Ga0501036_0037995	Ga0501036_0037995_3053_3814	229
1028	3300049573	Ga0501037_0071471	Ga0501037_0071471_1469_2230	229
1029	3300049575	Ga0501039_0007090	Ga0501039_0007090_7240_8001	229
1030	3300049576	Ga0501040_0002604	Ga0501040_0002604_2006_2767	229
1031	3300049577	Ga0501041_0003976	Ga0501041_0003976_347_1108	229
1032	3300049578	Ga0501042_0004604	Ga0501042_0004604_565_1326	229
1033	3300049579	Ga0501043_0132361	Ga0501043_0132361_516_1277	229
1034	3300049580	Ga0501046_0009401	Ga0501046_0009401_207_968	229
1035	3300049581	Ga0501047_0079043	Ga0501047_0079043_557_1318	229
1036	3300049582	Ga0501048_0001169	Ga0501048_0001169_14160_14921	229
1037	3300049587	Ga0501071_0001051	Ga0501071_0001051_13760_14521	229
1038	3300049590	Ga0501074_0001018	Ga0501074_0001018_9998_10759	229
1039	3300049591	Ga0501075_0063176	Ga0501075_0063176_1474_2235	229
1040	3300049592	Ga0501076_0006411	Ga0501076_0006411_3430_4191	229
1041	3300049593	Ga0501077_0038680	Ga0501077_0038680_517_1278	229
1042	3300049741	Ga0501079_0001255	Ga0501079_0001255_16521_17282	229
1043	3300049743	Ga0501081_0010522	Ga0501081_0010522_3214_3975	229
1044	3300049822	Ga0501035_0149111	Ga0501035_0149111_714_1475	229
1045	3300049823	Ga0501044_0161307	Ga0501044_0161307_10_771	229
1046	3300049824	Ga0501045_0002985	Ga0501045_0002985_3332_4093	229
1047	3300054114	Ga0501084_0010200	Ga0501084_0010200_1539_2300	229
1048	3300060353	Ga0501082_0006856	Ga0501082_0006856_8462_9223	229
1049	3300061734	Ga0530510_0005893	Ga0530510_0005893_252_1013	229
1050	3300005337	Ga0070682_100400632	Ga0070682_1004006321	230
1051	3300005535	Ga0070684_100162023	Ga0070684_1001620232	230
1052	3300005844	Ga0068862_100761151	Ga0068862_1007611512	230
1053	3300013306	Ga0163162_10829686	Ga0163162_108296862	230
1054	iso_pu_bacteria	2818991462	2819693189	230
1055	iso_pu_bacteria	2818991469	2819730171	230
1056	3300033179	Ga0307507_10027354	Ga0307507_100273543	231
1057	3300041452	Ga0451793_1668687	Ga0451793_1668687_294_1061	231
1058	3300046675	Ga0495657_0137702	Ga0495657_0137702_336_1136	231
1059	3300048929	Ga0496126_0041429	Ga0496126_0041429_326_1096	231
1060	3300050491	nmdc:mga00v17_41268_c1	nmdc:mga00v17_41268_c1_462_1235	231
1061	iso_pu_bacteria	2946080515	2946083671	231
1062	iso_pu_bacteria	8001781756	8001782739	231
1063	3300005435	Ga0070714_100029373	Ga0070714_1000293736	233
1064	3300025929	Ga0207664_10021922	Ga0207664_100219222	233
1065	3300037466	Ga0395898_0055784	Ga0395898_0055784_1733_2506	233
1066	3300009551	Ga0105238_10451835	Ga0105238_104518352	234
1067	3300048911	Ga0496108_0010609	Ga0496108_0010609_4225_5013	234
1068	3300048912	Ga0496109_0025849	Ga0496109_0025849_3515_4303	234
1069	3300048913	Ga0496110_0009712	Ga0496110_0009712_2104_2892	234
1070	3300049823	Ga0501044_0016583	Ga0501044_0016583_1547_2374	235
1071	iso_pu_bacteria	8004021418	8004022401	235
1072	3300049571	Ga0501034_0372256	Ga0501034_0372256_527_1342	237
1073	3300049579	Ga0501043_0235212	Ga0501043_0235212_486_1301	237
1074	3300049581	Ga0501047_0019911	Ga0501047_0019911_331_1146	237
1075	3300049822	Ga0501035_0009678	Ga0501035_0009678_180_995	237
1076	3300049823	Ga0501044_0015179	Ga0501044_0015179_100_915	237
1077	3300005546	Ga0070696_100014539	Ga0070696_1000145394	239
1078	iso_pu_bacteria	2835312727	2835317843	239
1079	3300001989	JGI24739J22299_10009451	JGI24739J22299_100094512	242
1080	3300003578	Ga0006562J51391_1058391	Ga0006562J51391_10583912	242
1081	3300005548	Ga0070665_100457000	Ga0070665_1004570001	242
1082	3300009011	Ga0105251_10029994	Ga0105251_100299942	242
1083	3300013308	Ga0157375_10736175	Ga0157375_107361751	242
1084	3300025735	Ga0207713_1081378	Ga0207713_10813781	242
1085	3300025981	Ga0207640_10080078	Ga0207640_100800782	242
1086	3300028794	Ga0307515_10196411	Ga0307515_101964112	242
1087	3300030522	Ga0307512_10037861	Ga0307512_100378613	242
1088	3300031456	Ga0307513_10083168	Ga0307513_100831682	242
1089	3300031616	Ga0307508_10005275	Ga0307508_100052753	242
1090	3300031730	Ga0307516_10135823	Ga0307516_101358233	242
1091	3300042007	Ga0439449_0006424	Ga0439449_0006424_191_991	242
1092	3300044693	Ga0466961_0049545	Ga0466961_0049545_70_870	242
1093	3300044901	Ga0466960_0008326	Ga0466960_0008326_2280_3080	242
1094	3300046455	Ga0495603_0002075	Ga0495603_0002075_7484_8284	242
1095	3300046459	Ga0495629_0007580	Ga0495629_0007580_5549_6349	242
1096	3300046459	Ga0495629_0015964	Ga0495629_0015964_2420_3220	242
1097	3300046473	Ga0495582_0015291	Ga0495582_0015291_3093_3893	242
1098	3300046475	Ga0495639_0013932	Ga0495639_0013932_214_1014	242
1099	3300046476	Ga0495662_0003617	Ga0495662_0003617_4123_4923	242
1100	3300046476	Ga0495662_0028615	Ga0495662_0028615_1238_2038	242
1101	3300046476	Ga0495662_0149971	Ga0495662_0149971_234_1034	242
1102	3300046499	Ga0495594_0023043	Ga0495594_0023043_1724_2524	242
1103	3300046557	Ga0495622_0048514	Ga0495622_0048514_221_1021	242
1104	3300046558	Ga0495633_0041548	Ga0495633_0041548_787_1587	242
1105	3300046660	Ga0495625_0023707	Ga0495625_0023707_3547_4347	242
1106	3300046663	Ga0495635_0042850	Ga0495635_0042850_1501_2301	242
1107	3300046674	Ga0495588_0010087	Ga0495588_0010087_1517_2317	242
1108	3300046674	Ga0495588_0012691	Ga0495588_0012691_3096_3896	242
1109	3300046675	Ga0495657_0008110	Ga0495657_0008110_2639_3439	242
1110	3300046689	Ga0495613_0014294	Ga0495613_0014294_506_1306	242
1111	3300046689	Ga0495613_0166178	Ga0495613_0166178_62_862	242
1112	3300046809	Ga0495600_0058586	Ga0495600_0058586_593_1393	242
1113	3300047315	Ga0495581_0097191	Ga0495581_0097191_827_1627	242
1114	3300047444	Ga0495675_0042415	Ga0495675_0042415_73_873	242
1115	3300047447	Ga0495685_022144	Ga0495685_022144_237_1040	242
1116	3300047447	Ga0495685_024897	Ga0495685_024897_622_1422	242
1117	3300048912	Ga0496109_0034213	Ga0496109_0034213_3495_4295	242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

55

237

0.97 PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

61

294

0.91 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5b4t-assembly1.cif.gz_A	crystal structure of d-3-hydroxybutyrate dehydrogenase from alcaligenes faecalis complexed with nad+ and a substrate d-3-hydroxybutyrate	0.9168	17	242
8dt1-assembly1.cif.gz_C	crystal structure of a putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 in complex with nad	0.916	16	239
6zdz-assembly1.cif.gz_B	tetragonal crystal structure of the bulky-bulky ketone specific alcohol dehydrogenase from comamonas testosteroni	0.9123	20	167
2ztm-assembly1.cif.gz_A	t190s mutant of d-3-hydroxybutyrate dehydrogenase	0.9012	22	242
6zzq-assembly1.cif.gz_A	crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and acetoacetate	0.9005	14	242

ID	Description	Score	Start	End	Superfamily
4j36B00	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.9242	20	51	3.50.50.60
af_C6T421_12_106_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8963	15	81	3.40.50.720
3ai1A00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8923	13	242	3.40.50.720
af_P05707_2_258_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8893	20	239	3.40.50.720
2rhcB00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8873	20	242	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-A0A7S3UJT3-F1-model_v4	Protochlorophyllide reductase	0.9401	16	148	GO:0005811 GO:0016616
AF-A0A843FG90-F1-model_v4	deleted	0.9318	17	152
AF-A0A651GVF4-F1-model_v4	SDR family NAD(P)-dependent oxidoreductase	0.9315	20	139	GO:0016491
AF-A0A7K2AM17-F1-model_v4	SDR family oxidoreductase	0.9314	13	237
AF-S9XPU4-F1-model_v4	deleted	0.9282	16	155

Feature Viewer

pLDDT	pTM	Quality
89.21	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F490319

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00106

adh_short

short chain dehydrogenase

55

237

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

61

294

0.91

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map