F490293
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1115 | 447 | 1095 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300025927|Ga0207687_10392750|Ga0207687_103927501 |
| Length | 247 |
| Sequence | VNLDWSIVWIHRADLLHGALLTVLLTVLTMAVAVPAGIVLALMRLSNSKPLAFASQCFVEFFRNLPLILVVYWAFYVMPVLLHIEFSAFTTGLVALCLNVSAYNAETFRAGINSIRKGQMEAAVAIGMSRWQAMKQIIVPQAWRRVLPVLASTWVSLFKDTSLVSVIAVGELAHVALQIRSQSFRVLEMLTAMAVIYWLMGYPQAKLVDWIQKRFEVSLQRGIFVAGSLASATLFAHTSGCQRSGIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231002 | Polaromonas sp. CF318 | Isolate | Rhizosphere |
| 2 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 3 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 4 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 5 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 6 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 7 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 8 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 9 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 10 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 11 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 12 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 13 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 14 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 15 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 16 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 17 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 18 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 19 | 2941479691 | |||
| 20 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 21 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 22 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 23 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 24 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 25 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 29 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 30 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 37 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 61 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 110 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 111 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 112 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 113 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 114 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 115 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 116 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 117 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 118 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 120 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 121 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 122 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 123 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 124 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 125 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 126 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 127 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 128 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 129 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 131 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 132 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 133 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 134 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 150 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 162 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 167 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 168 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 171 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 177 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 180 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 254 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 256 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 260 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 261 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 262 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 263 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 264 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 265 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 266 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 267 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 268 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 269 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 270 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 271 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 272 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 273 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 274 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 275 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 276 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 277 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 278 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 279 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 280 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 281 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 282 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 283 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 284 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 285 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 286 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 287 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 288 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 290 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 291 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 292 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 293 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 294 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 295 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 296 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 297 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 298 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 300 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 301 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 302 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 303 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 304 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 305 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 306 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 307 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 308 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 309 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 310 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 311 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 312 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 313 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 314 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 315 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 381 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 382 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 383 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 384 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 385 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 386 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 387 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 388 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 389 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 390 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 391 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 392 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 393 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 394 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 395 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 403 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 404 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 405 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 406 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 407 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 408 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 410 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 422 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 423 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 424 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 425 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 426 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 427 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 428 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 429 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 430 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 431 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 432 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 433 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 434 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 435 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 437 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 438 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 439 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 440 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 441 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 442 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 443 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 444 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 446 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.21 |
| Metatranscriptomes | 0 |
| Isolates | 1.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.67 |
| Nodule | 0.54 |
| Rhizoplane | 4.48 |
| Rhizosphere | 79.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.02 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25159J45721_1008928 | 3300002987 | Bacteria | 2695 |
| 2 | JGI25151J46595_10000460 | 3300003187 | Bacteria | 39097 |
| 3 | JGI25153J46596_10000228 | 3300003215 | Bacteria | 47831 |
| 4 | JGI25160J50197_1004251 | 3300003354 | Bacteria | 6216 |
| 5 | JGI25161J50226_1001723 | 3300003374 | Bacteria | 6211 |
| 6 | Ga0055529_1000705 | 3300003763 | Bacteria | 22343 |
| 7 | Ga0055537_1000190 | 3300003773 | Bacteria | 45820 |
| 8 | Ga0055536_1004906 | 3300003781 | Bacteria | 6678 |
| 9 | Ga0055534_1000244 | 3300003784 | Bacteria | 38722 |
| 10 | Ga0055534_1010940 | 3300003784 | Bacteria | 1869 |
| 11 | Ga0055528_1000244 | 3300003790 | Bacteria | 45820 |
| 12 | Ga0055528_1002980 | 3300003790 | Bacteria | 8771 |
| 13 | Ga0055540_1000365 | 3300003792 | Bacteria | 38078 |
| 14 | Ga0055540_1003214 | 3300003792 | Bacteria | 8018 |
| 15 | Ga0055531_10000454 | 3300003794 | Bacteria | 38078 |
| 16 | Ga0055543_1002319 | 3300004625 | Bacteria | 6384 |
| 17 | Ga0065165_1003670 | 3300005262 | Bacteria | 10463 |
| 18 | Ga0065165_1006190 | 3300005262 | Bacteria | 6384 |
| 19 | Ga0065714_10079601 | 3300005288 | Bacteria | 2478 |
| 20 | Ga0065714_10128417 | 3300005288 | Bacteria | 1273 |
| 21 | Ga0065712_10139642 | 3300005290 | Bacteria | 1462 |
| 22 | Ga0065715_10029996 | 3300005293 | Bacteria | 1544 |
| 23 | Ga0070658_10023452 | 3300005327 | Bacteria | 4952 |
| 24 | Ga0070658_10085564 | 3300005327 | Bacteria | 2593 |
| 25 | Ga0070658_10087738 | 3300005327 | Bacteria | 2561 |
| 26 | Ga0070658_10366548 | 3300005327 | Bacteria | 1234 |
| 27 | Ga0070676_10000429 | 3300005328 | Bacteria | 19932 |
| 28 | Ga0070676_10080157 | 3300005328 | Bacteria | 1978 |
| 29 | Ga0070676_10582460 | 3300005328 | Unclassified | 805 |
| 30 | Ga0070683_100017860 | 3300005329 | Bacteria | 6270 |
| 31 | Ga0070683_100118762 | 3300005329 | Bacteria | 2497 |
| 32 | Ga0070690_100047354 | 3300005330 | Bacteria | 2735 |
| 33 | Ga0070690_100213023 | 3300005330 | Bacteria | 1350 |
| 34 | Ga0070670_100015560 | 3300005331 | Bacteria | 6534 |
| 35 | Ga0070670_100061667 | 3300005331 | Bacteria | 3218 |
| 36 | Ga0070670_100108358 | 3300005331 | Bacteria | 2393 |
| 37 | Ga0070670_100227560 | 3300005331 | Bacteria | 1623 |
| 38 | Ga0070670_100579029 | 3300005331 | Bacteria | 1003 |
| 39 | Ga0070677_10000318 | 3300005333 | Bacteria | 16823 |
| 40 | Ga0070677_10090197 | 3300005333 | Bacteria | 1331 |
| 41 | Ga0070677_10255358 | 3300005333 | Unclassified | 872 |
| 42 | Ga0068869_100011628 | 3300005334 | Bacteria | 5781 |
| 43 | Ga0068869_100014878 | 3300005334 | Bacteria | 5202 |
| 44 | Ga0068869_100023109 | 3300005334 | Bacteria | 4290 |
| 45 | Ga0068869_100035853 | 3300005334 | Bacteria | 3519 |
| 46 | Ga0068869_100279164 | 3300005334 | Bacteria | 1343 |
| 47 | Ga0068869_100310054 | 3300005334 | Bacteria | 1277 |
| 48 | Ga0068869_100324701 | 3300005334 | Bacteria | 1249 |
| 49 | Ga0070666_10001248 | 3300005335 | Bacteria | 15392 |
| 50 | Ga0070666_10021254 | 3300005335 | Bacteria | 4204 |
| 51 | Ga0070666_10149192 | 3300005335 | Bacteria | 1631 |
| 52 | Ga0070680_100114148 | 3300005336 | Bacteria | 2250 |
| 53 | Ga0070682_100088725 | 3300005337 | Bacteria | 2019 |
| 54 | Ga0068868_100006699 | 3300005338 | Bacteria | 8174 |
| 55 | Ga0068868_100006918 | 3300005338 | Bacteria | 8059 |
| 56 | Ga0068868_100008681 | 3300005338 | Bacteria | 7277 |
| 57 | Ga0070660_100014237 | 3300005339 | Bacteria | 5728 |
| 58 | Ga0070689_100010843 | 3300005340 | Bacteria | 6513 |
| 59 | Ga0070687_100049122 | 3300005343 | Bacteria | 2173 |
| 60 | Ga0070661_100002482 | 3300005344 | Bacteria | 12643 |
| 61 | Ga0070661_100067497 | 3300005344 | Bacteria | 2628 |
| 62 | Ga0070661_100134314 | 3300005344 | Bacteria | 1860 |
| 63 | Ga0070661_100307813 | 3300005344 | Bacteria | 1235 |
| 64 | Ga0070692_10160889 | 3300005345 | Bacteria | 1286 |
| 65 | Ga0070668_100000600 | 3300005347 | Bacteria | 24135 |
| 66 | Ga0070668_100010699 | 3300005347 | Bacteria | 6823 |
| 67 | Ga0070668_100013049 | 3300005347 | Bacteria | 6189 |
| 68 | Ga0070668_100078656 | 3300005347 | Bacteria | 2580 |
| 69 | Ga0070668_100104229 | 3300005347 | Bacteria | 2251 |
| 70 | Ga0070668_100210502 | 3300005347 | Bacteria | 1599 |
| 71 | Ga0070668_100281157 | 3300005347 | Bacteria | 1390 |
| 72 | Ga0070669_100037985 | 3300005353 | Bacteria | 3495 |
| 73 | Ga0070669_100063953 | 3300005353 | Bacteria | 2709 |
| 74 | Ga0070669_100084149 | 3300005353 | Bacteria | 2373 |
| 75 | Ga0070669_100113971 | 3300005353 | Bacteria | 2055 |
| 76 | Ga0070669_100267640 | 3300005353 | Bacteria | 1365 |
| 77 | Ga0070669_100287944 | 3300005353 | Bacteria | 1318 |
| 78 | Ga0070675_100012243 | 3300005354 | Bacteria | 6723 |
| 79 | Ga0070675_100012605 | 3300005354 | Bacteria | 6630 |
| 80 | Ga0070675_100073164 | 3300005354 | Bacteria | 2845 |
| 81 | Ga0070675_100089289 | 3300005354 | Bacteria | 2580 |
| 82 | Ga0070675_100455744 | 3300005354 | Bacteria | 1147 |
| 83 | Ga0070671_100006670 | 3300005355 | Bacteria | 9230 |
| 84 | Ga0070671_100025462 | 3300005355 | Bacteria | 4855 |
| 85 | Ga0070671_100054790 | 3300005355 | Bacteria | 3316 |
| 86 | Ga0070671_100061058 | 3300005355 | Bacteria | 3139 |
| 87 | Ga0070671_100099246 | 3300005355 | Bacteria | 2442 |
| 88 | Ga0070671_100331127 | 3300005355 | Bacteria | 1298 |
| 89 | Ga0070674_100001769 | 3300005356 | Bacteria | 11718 |
| 90 | Ga0070674_100131810 | 3300005356 | Bacteria | 1864 |
| 91 | Ga0070674_100787867 | 3300005356 | Bacteria | 820 |
| 92 | Ga0070673_100000043 | 3300005364 | Bacteria | 52415 |
| 93 | Ga0070673_100009905 | 3300005364 | Bacteria | 6421 |
| 94 | Ga0070673_100028796 | 3300005364 | Bacteria | 4136 |
| 95 | Ga0070673_100098621 | 3300005364 | Bacteria | 2402 |
| 96 | Ga0070673_100638515 | 3300005364 | Bacteria | 974 |
| 97 | Ga0070688_100000219 | 3300005365 | Bacteria | 30246 |
| 98 | Ga0070688_100141545 | 3300005365 | Bacteria | 1634 |
| 99 | Ga0070659_100002063 | 3300005366 | Bacteria | 14337 |
| 100 | Ga0070659_100009634 | 3300005366 | Bacteria | 7099 |
| 101 | Ga0070659_100025142 | 3300005366 | Bacteria | 4571 |
| 102 | Ga0070667_100003833 | 3300005367 | Bacteria | 12775 |
| 103 | Ga0070667_100015102 | 3300005367 | Bacteria | 6378 |
| 104 | Ga0070667_100021260 | 3300005367 | Bacteria | 5391 |
| 105 | Ga0070667_100024756 | 3300005367 | Bacteria | 4987 |
| 106 | Ga0070667_100065001 | 3300005367 | Bacteria | 3097 |
| 107 | Ga0070667_100101894 | 3300005367 | Bacteria | 2480 |
| 108 | Ga0070703_10032329 | 3300005406 | Bacteria | 1589 |
| 109 | Ga0070709_10187448 | 3300005434 | Bacteria | 1457 |
| 110 | Ga0070709_10418566 | 3300005434 | Bacteria | 1004 |
| 111 | Ga0070714_100002832 | 3300005435 | Bacteria | 12798 |
| 112 | Ga0070714_100482821 | 3300005435 | Bacteria | 1180 |
| 113 | Ga0070713_100000018 | 3300005436 | Bacteria | 118409 |
| 114 | Ga0070713_100041293 | 3300005436 | Bacteria | 3758 |
| 115 | Ga0070713_100044375 | 3300005436 | Bacteria | 3639 |
| 116 | Ga0070713_100057945 | 3300005436 | Bacteria | 3228 |
| 117 | Ga0070713_100125793 | 3300005436 | Bacteria | 2254 |
| 118 | Ga0070713_100618253 | 3300005436 | Unclassified | 1030 |
| 119 | Ga0070710_10030569 | 3300005437 | Bacteria | 2899 |
| 120 | Ga0070711_100011188 | 3300005439 | Bacteria | 5564 |
| 121 | Ga0070711_100014390 | 3300005439 | Bacteria | 4986 |
| 122 | Ga0070711_100042541 | 3300005439 | Bacteria | 3071 |
| 123 | Ga0070711_100383736 | 3300005439 | Bacteria | 1137 |
| 124 | Ga0070700_100041397 | 3300005441 | Bacteria | 2824 |
| 125 | Ga0070700_100221428 | 3300005441 | Bacteria | 1341 |
| 126 | Ga0070708_100000053 | 3300005445 | Bacteria | 77258 |
| 127 | Ga0070708_100127942 | 3300005445 | Bacteria | 2349 |
| 128 | Ga0070708_100158407 | 3300005445 | Bacteria | 2109 |
| 129 | Ga0070708_100255356 | 3300005445 | Bacteria | 1647 |
| 130 | Ga0070708_100562992 | 3300005445 | Bacteria | 1075 |
| 131 | Ga0070708_100602538 | 3300005445 | Bacteria | 1036 |
| 132 | Ga0070663_100007766 | 3300005455 | Bacteria | 6551 |
| 133 | Ga0070663_100182206 | 3300005455 | Bacteria | 1630 |
| 134 | Ga0070663_100198919 | 3300005455 | Bacteria | 1563 |
| 135 | Ga0070678_100001872 | 3300005456 | Bacteria | 11358 |
| 136 | Ga0070678_100007077 | 3300005456 | Bacteria | 6632 |
| 137 | Ga0070678_100024049 | 3300005456 | Bacteria | 4071 |
| 138 | Ga0070662_100007746 | 3300005457 | Bacteria | 6975 |
| 139 | Ga0070662_100092227 | 3300005457 | Bacteria | 2276 |
| 140 | Ga0070662_100243915 | 3300005457 | Bacteria | 1442 |
| 141 | Ga0070662_100373797 | 3300005457 | Bacteria | 1172 |
| 142 | Ga0070662_100407611 | 3300005457 | Bacteria | 1123 |
| 143 | Ga0068867_100000983 | 3300005459 | Bacteria | 19454 |
| 144 | Ga0068867_100018676 | 3300005459 | Bacteria | 4929 |
| 145 | Ga0068867_100019770 | 3300005459 | Bacteria | 4799 |
| 146 | Ga0068867_100041932 | 3300005459 | Bacteria | 3345 |
| 147 | Ga0068867_100082898 | 3300005459 | Bacteria | 2420 |
| 148 | Ga0068867_100123023 | 3300005459 | Bacteria | 2007 |
| 149 | Ga0068867_100222844 | 3300005459 | Bacteria | 1521 |
| 150 | Ga0068867_100604302 | 3300005459 | Bacteria | 957 |
| 151 | Ga0070685_10000897 | 3300005466 | Bacteria | 15970 |
| 152 | Ga0070685_10016145 | 3300005466 | Bacteria | 3973 |
| 153 | Ga0070706_100009767 | 3300005467 | Bacteria | 8915 |
| 154 | Ga0070706_100018128 | 3300005467 | Bacteria | 6494 |
| 155 | Ga0070706_100027298 | 3300005467 | Bacteria | 5254 |
| 156 | Ga0070706_100152836 | 3300005467 | Bacteria | 2155 |
| 157 | Ga0070706_100227435 | 3300005467 | Bacteria | 1741 |
| 158 | Ga0070706_100569405 | 3300005467 | Bacteria | 1053 |
| 159 | Ga0070707_100014859 | 3300005468 | Bacteria | 7300 |
| 160 | Ga0070707_100029343 | 3300005468 | Bacteria | 5237 |
| 161 | Ga0070707_100031830 | 3300005468 | Bacteria | 5025 |
| 162 | Ga0070707_100046390 | 3300005468 | Bacteria | 4158 |
| 163 | Ga0070707_100116120 | 3300005468 | Bacteria | 2598 |
| 164 | Ga0070707_100391099 | 3300005468 | Bacteria | 1350 |
| 165 | Ga0070707_100511758 | 3300005468 | Bacteria | 1162 |
| 166 | Ga0070707_100526143 | 3300005468 | Bacteria | 1144 |
| 167 | Ga0070707_100763286 | 3300005468 | Bacteria | 930 |
| 168 | Ga0070698_100008351 | 3300005471 | Bacteria | 11192 |
| 169 | Ga0070698_100027258 | 3300005471 | Bacteria | 5944 |
| 170 | Ga0070698_100242247 | 3300005471 | Bacteria | 1736 |
| 171 | Ga0070698_100378755 | 3300005471 | Bacteria | 1347 |
| 172 | Ga0070698_100537725 | 3300005471 | Bacteria | 1107 |
| 173 | Ga0070699_100013545 | 3300005518 | Bacteria | 7020 |
| 174 | Ga0070699_100018721 | 3300005518 | Bacteria | 5946 |
| 175 | Ga0070699_100217887 | 3300005518 | Bacteria | 1700 |
| 176 | Ga0070699_100270239 | 3300005518 | Bacteria | 1521 |
| 177 | Ga0070679_100064406 | 3300005530 | Bacteria | 3654 |
| 178 | Ga0070679_100145229 | 3300005530 | Bacteria | 2350 |
| 179 | Ga0070679_100353113 | 3300005530 | Bacteria | 1418 |
| 180 | Ga0070684_100032906 | 3300005535 | Bacteria | 4423 |
| 181 | Ga0070684_100216169 | 3300005535 | Bacteria | 1748 |
| 182 | Ga0070697_100012228 | 3300005536 | Bacteria | 6722 |
| 183 | Ga0070697_100018433 | 3300005536 | Bacteria | 5501 |
| 184 | Ga0070697_100034401 | 3300005536 | Bacteria | 4085 |
| 185 | Ga0070697_100244489 | 3300005536 | Bacteria | 1533 |
| 186 | Ga0070697_100324172 | 3300005536 | Bacteria | 1327 |
| 187 | Ga0068853_100006747 | 3300005539 | Bacteria | 9146 |
| 188 | Ga0068853_100020924 | 3300005539 | Bacteria | 5444 |
| 189 | Ga0068853_100061370 | 3300005539 | Bacteria | 3251 |
| 190 | Ga0068853_100233001 | 3300005539 | Bacteria | 1685 |
| 191 | Ga0068853_100257261 | 3300005539 | Bacteria | 1604 |
| 192 | Ga0068853_100380669 | 3300005539 | Bacteria | 1318 |
| 193 | Ga0070672_100002787 | 3300005543 | Bacteria | 11206 |
| 194 | Ga0070672_100003389 | 3300005543 | Bacteria | 10332 |
| 195 | Ga0070672_100011101 | 3300005543 | Bacteria | 6273 |
| 196 | Ga0070672_100032687 | 3300005543 | Bacteria | 3930 |
| 197 | Ga0070672_100391600 | 3300005543 | Bacteria | 1190 |
| 198 | Ga0070686_100077739 | 3300005544 | Bacteria | 2189 |
| 199 | Ga0070695_100210812 | 3300005545 | Bacteria | 1394 |
| 200 | Ga0070696_100074437 | 3300005546 | Bacteria | 2395 |
| 201 | Ga0070696_100104327 | 3300005546 | Bacteria | 2035 |
| 202 | Ga0070696_100332829 | 3300005546 | Bacteria | 1172 |
| 203 | Ga0070693_100183002 | 3300005547 | Bacteria | 1350 |
| 204 | Ga0070693_100191343 | 3300005547 | Bacteria | 1323 |
| 205 | Ga0070665_100010279 | 3300005548 | Bacteria | 9470 |
| 206 | Ga0070665_100018064 | 3300005548 | Bacteria | 7078 |
| 207 | Ga0070665_100125882 | 3300005548 | Bacteria | 2565 |
| 208 | Ga0070665_100148184 | 3300005548 | Bacteria | 2349 |
| 209 | Ga0070665_100267344 | 3300005548 | Bacteria | 1711 |
| 210 | Ga0070665_100434151 | 3300005548 | Bacteria | 1322 |
| 211 | Ga0070704_100203921 | 3300005549 | Bacteria | 1598 |
| 212 | Ga0070704_100755110 | 3300005549 | Bacteria | 866 |
| 213 | Ga0068855_100001509 | 3300005563 | Bacteria | 29149 |
| 214 | Ga0068855_100011108 | 3300005563 | Bacteria | 10869 |
| 215 | Ga0068855_100131288 | 3300005563 | Bacteria | 2861 |
| 216 | Ga0068855_100901776 | 3300005563 | Bacteria | 934 |
| 217 | Ga0070664_100000382 | 3300005564 | Bacteria | 32943 |
| 218 | Ga0070664_100197339 | 3300005564 | Bacteria | 1794 |
| 219 | Ga0070664_100448106 | 3300005564 | Bacteria | 1185 |
| 220 | Ga0068857_100007158 | 3300005577 | Bacteria | 9611 |
| 221 | Ga0068857_100010100 | 3300005577 | Bacteria | 8200 |
| 222 | Ga0068857_100017326 | 3300005577 | Bacteria | 6310 |
| 223 | Ga0068857_100077510 | 3300005577 | Bacteria | 2966 |
| 224 | Ga0068854_100010442 | 3300005578 | Bacteria | 6023 |
| 225 | Ga0068856_100028014 | 3300005614 | Bacteria | 5497 |
| 226 | Ga0068856_100094449 | 3300005614 | Bacteria | 2977 |
| 227 | Ga0068856_100178068 | 3300005614 | Bacteria | 2139 |
| 228 | Ga0068856_100261514 | 3300005614 | Bacteria | 1746 |
| 229 | Ga0070702_100053956 | 3300005615 | Bacteria | 2310 |
| 230 | Ga0070702_100098708 | 3300005615 | Bacteria | 1787 |
| 231 | Ga0068852_100002701 | 3300005616 | Bacteria | 12253 |
| 232 | Ga0068852_100005218 | 3300005616 | Bacteria | 9264 |
| 233 | Ga0068852_100048369 | 3300005616 | Bacteria | 3633 |
| 234 | Ga0068852_100117088 | 3300005616 | Bacteria | 2432 |
| 235 | Ga0068852_100154509 | 3300005616 | Bacteria | 2136 |
| 236 | Ga0068852_100218881 | 3300005616 | Bacteria | 1810 |
| 237 | Ga0068852_100290955 | 3300005616 | Bacteria | 1578 |
| 238 | Ga0068859_100152522 | 3300005617 | Bacteria | 2386 |
| 239 | Ga0068859_100363034 | 3300005617 | Bacteria | 1543 |
| 240 | Ga0068859_100561597 | 3300005617 | Bacteria | 1235 |
| 241 | Ga0068859_100785938 | 3300005617 | Bacteria | 1040 |
| 242 | Ga0068864_100001799 | 3300005618 | Bacteria | 17604 |
| 243 | Ga0068864_100002340 | 3300005618 | Bacteria | 15669 |
| 244 | Ga0068864_100004987 | 3300005618 | Bacteria | 10876 |
| 245 | Ga0068864_100009580 | 3300005618 | Bacteria | 7986 |
| 246 | Ga0068864_100023249 | 3300005618 | Bacteria | 5203 |
| 247 | Ga0068864_100062625 | 3300005618 | Bacteria | 3223 |
| 248 | Ga0068864_100070196 | 3300005618 | Bacteria | 3048 |
| 249 | Ga0068866_10030573 | 3300005718 | Bacteria | 2586 |
| 250 | Ga0068861_100000216 | 3300005719 | Bacteria | 30988 |
| 251 | Ga0068861_100068209 | 3300005719 | Bacteria | 2748 |
| 252 | Ga0068861_100268643 | 3300005719 | Bacteria | 1464 |
| 253 | Ga0068861_100373578 | 3300005719 | Bacteria | 1257 |
| 254 | Ga0068851_10000318 | 3300005834 | Bacteria | 21772 |
| 255 | Ga0068851_10000574 | 3300005834 | Bacteria | 16016 |
| 256 | Ga0068851_10013088 | 3300005834 | Bacteria | 3924 |
| 257 | Ga0068870_10038013 | 3300005840 | Bacteria | 2483 |
| 258 | Ga0068870_10040151 | 3300005840 | Bacteria | 2425 |
| 259 | Ga0068863_100001833 | 3300005841 | Bacteria | 21137 |
| 260 | Ga0068863_100002646 | 3300005841 | Bacteria | 17718 |
| 261 | Ga0068863_100049794 | 3300005841 | Bacteria | 3972 |
| 262 | Ga0068863_100163531 | 3300005841 | Bacteria | 2133 |
| 263 | Ga0068863_100341123 | 3300005841 | Bacteria | 1457 |
| 264 | Ga0068863_100376061 | 3300005841 | Bacteria | 1387 |
| 265 | Ga0068863_100521071 | 3300005841 | Bacteria | 1172 |
| 266 | Ga0068863_101129285 | 3300005841 | Bacteria | 789 |
| 267 | Ga0068858_100010655 | 3300005842 | Bacteria | 8697 |
| 268 | Ga0068858_100038836 | 3300005842 | Bacteria | 4415 |
| 269 | Ga0068858_100049069 | 3300005842 | Bacteria | 3910 |
| 270 | Ga0068858_100066258 | 3300005842 | Bacteria | 3343 |
| 271 | Ga0068858_100161174 | 3300005842 | Bacteria | 2112 |
| 272 | Ga0068858_100217391 | 3300005842 | Bacteria | 1809 |
| 273 | Ga0068860_100004954 | 3300005843 | Bacteria | 13573 |
| 274 | Ga0068860_100008957 | 3300005843 | Bacteria | 9969 |
| 275 | Ga0068860_100015761 | 3300005843 | Bacteria | 7379 |
| 276 | Ga0068860_100056596 | 3300005843 | Bacteria | 3727 |
| 277 | Ga0068860_100130466 | 3300005843 | Bacteria | 2411 |
| 278 | Ga0068860_100136251 | 3300005843 | Bacteria | 2358 |
| 279 | Ga0068860_100193385 | 3300005843 | Bacteria | 1969 |
| 280 | Ga0068860_100203376 | 3300005843 | Bacteria | 1920 |
| 281 | Ga0068862_100002123 | 3300005844 | Bacteria | 17861 |
| 282 | Ga0068862_100002912 | 3300005844 | Bacteria | 14961 |
| 283 | Ga0068862_100013943 | 3300005844 | Bacteria | 6662 |
| 284 | Ga0068862_100171632 | 3300005844 | Bacteria | 1942 |
| 285 | Ga0068862_100305463 | 3300005844 | Bacteria | 1465 |
| 286 | Ga0070717_10104550 | 3300006028 | Bacteria | 2409 |
| 287 | Ga0070717_10160156 | 3300006028 | Bacteria | 1952 |
| 288 | Ga0075363_100163025 | 3300006048 | Bacteria | 1263 |
| 289 | Ga0075364_10147759 | 3300006051 | Bacteria | 1583 |
| 290 | Ga0075364_10422649 | 3300006051 | Bacteria | 910 |
| 291 | Ga0075432_10008595 | 3300006058 | Bacteria | 3485 |
| 292 | Ga0075432_10225068 | 3300006058 | Bacteria | 752 |
| 293 | Ga0070716_100012365 | 3300006173 | Bacteria | 4325 |
| 294 | Ga0070712_100002661 | 3300006175 | Bacteria | 11021 |
| 295 | Ga0070712_100012249 | 3300006175 | Bacteria | 5451 |
| 296 | Ga0070712_100054698 | 3300006175 | Bacteria | 2791 |
| 297 | Ga0070712_100203067 | 3300006175 | Bacteria | 1558 |
| 298 | Ga0070712_100294192 | 3300006175 | Bacteria | 1312 |
| 299 | Ga0075362_10003903 | 3300006177 | Bacteria | 5295 |
| 300 | Ga0075362_10008343 | 3300006177 | Bacteria | 3956 |
| 301 | Ga0075362_10197722 | 3300006177 | Bacteria | 978 |
| 302 | Ga0075367_10066906 | 3300006178 | Bacteria | 2154 |
| 303 | Ga0075369_10044743 | 3300006186 | Bacteria | 1902 |
| 304 | Ga0075366_10030351 | 3300006195 | Bacteria | 3178 |
| 305 | Ga0075366_10081232 | 3300006195 | Bacteria | 1936 |
| 306 | Ga0075366_10103685 | 3300006195 | Bacteria | 1708 |
| 307 | Ga0075366_10193715 | 3300006195 | Bacteria | 1235 |
| 308 | Ga0097621_100003909 | 3300006237 | Bacteria | 10328 |
| 309 | Ga0097621_100011838 | 3300006237 | Bacteria | 6446 |
| 310 | Ga0097621_100078767 | 3300006237 | Bacteria | 2738 |
| 311 | Ga0097621_100196056 | 3300006237 | Bacteria | 1751 |
| 312 | Ga0097621_100488748 | 3300006237 | Bacteria | 1114 |
| 313 | Ga0097621_100540325 | 3300006237 | Bacteria | 1060 |
| 314 | Ga0075370_10013523 | 3300006353 | Bacteria | 4342 |
| 315 | Ga0075370_10016809 | 3300006353 | Bacteria | 3942 |
| 316 | Ga0075370_10027764 | 3300006353 | Bacteria | 3143 |
| 317 | Ga0075370_10030332 | 3300006353 | Bacteria | 3016 |
| 318 | Ga0075370_10068530 | 3300006353 | Bacteria | 2026 |
| 319 | Ga0075370_10125410 | 3300006353 | Bacteria | 1497 |
| 320 | Ga0075370_10192013 | 3300006353 | Bacteria | 1204 |
| 321 | Ga0075370_10203835 | 3300006353 | Bacteria | 1167 |
| 322 | Ga0068871_100001413 | 3300006358 | Bacteria | 16060 |
| 323 | Ga0068871_100166479 | 3300006358 | Bacteria | 1887 |
| 324 | Ga0068871_100254010 | 3300006358 | Bacteria | 1532 |
| 325 | Ga0068871_100282397 | 3300006358 | Bacteria | 1453 |
| 326 | Ga0068871_100506484 | 3300006358 | Bacteria | 1089 |
| 327 | Ga0075428_100009152 | 3300006844 | Bacteria | 10991 |
| 328 | Ga0075430_100111486 | 3300006846 | Bacteria | 2281 |
| 329 | Ga0075430_100250639 | 3300006846 | Bacteria | 1467 |
| 330 | Ga0075431_100008054 | 3300006847 | Bacteria | 10516 |
| 331 | Ga0075431_100010310 | 3300006847 | Bacteria | 9388 |
| 332 | Ga0075431_100133961 | 3300006847 | Bacteria | 2554 |
| 333 | Ga0075433_10066103 | 3300006852 | Bacteria | 3172 |
| 334 | Ga0075433_10209260 | 3300006852 | Bacteria | 1733 |
| 335 | Ga0075433_10531303 | 3300006852 | Bacteria | 1034 |
| 336 | Ga0075434_100422065 | 3300006871 | Bacteria | 1355 |
| 337 | Ga0075434_100506023 | 3300006871 | Bacteria | 1228 |
| 338 | Ga0075434_101116484 | 3300006871 | Unclassified | 801 |
| 339 | Ga0075429_100015645 | 3300006880 | Bacteria | 6573 |
| 340 | Ga0075429_100118770 | 3300006880 | Bacteria | 2311 |
| 341 | Ga0068865_100065259 | 3300006881 | Bacteria | 2564 |
| 342 | Ga0075436_100052689 | 3300006914 | Bacteria | 2809 |
| 343 | Ga0075436_100083211 | 3300006914 | Bacteria | 2220 |
| 344 | Ga0075436_100434648 | 3300006914 | Bacteria | 954 |
| 345 | Ga0097620_100152504 | 3300006931 | Bacteria | 2386 |
| 346 | Ga0097620_100363051 | 3300006931 | Bacteria | 1543 |
| 347 | Ga0097620_100561619 | 3300006931 | Bacteria | 1235 |
| 348 | Ga0097620_100785884 | 3300006931 | Bacteria | 1040 |
| 349 | Ga0079104_1016194 | 3300006946 | Bacteria | 2188 |
| 350 | Ga0099826_10000044 | 3300006948 | Bacteria | 88060 |
| 351 | Ga0075435_100039068 | 3300007076 | Bacteria | 3786 |
| 352 | Ga0075435_100449259 | 3300007076 | Bacteria | 1111 |
| 353 | Ga0075435_100500504 | 3300007076 | Bacteria | 1050 |
| 354 | Ga0075435_100641038 | 3300007076 | Bacteria | 922 |
| 355 | Ga0099794_10017711 | 3300007265 | Bacteria | 3180 |
| 356 | Ga0099794_10020806 | 3300007265 | Bacteria | 2973 |
| 357 | Ga0099794_10067732 | 3300007265 | Archaea | 1744 |
| 358 | Ga0099794_10196723 | 3300007265 | Bacteria | 1032 |
| 359 | Ga0105244_10000642 | 3300009036 | Bacteria | 30808 |
| 360 | Ga0105240_10002759 | 3300009093 | Bacteria | 27745 |
| 361 | Ga0105240_10102699 | 3300009093 | Bacteria | 3474 |
| 362 | Ga0105240_10139138 | 3300009093 | Bacteria | 2904 |
| 363 | Ga0111539_10020068 | 3300009094 | Bacteria | 8233 |
| 364 | Ga0111539_10043530 | 3300009094 | Bacteria | 5381 |
| 365 | Ga0111539_10958203 | 3300009094 | Bacteria | 995 |
| 366 | Ga0105245_10001770 | 3300009098 | Bacteria | 19678 |
| 367 | Ga0105247_10129505 | 3300009101 | Bacteria | 1643 |
| 368 | Ga0105247_10433814 | 3300009101 | Bacteria | 943 |
| 369 | Ga0114129_10008075 | 3300009147 | Bacteria | 14994 |
| 370 | Ga0114129_10015344 | 3300009147 | Bacteria | 10900 |
| 371 | Ga0114129_10554708 | 3300009147 | Bacteria | 1494 |
| 372 | Ga0105243_10000674 | 3300009148 | Bacteria | 33388 |
| 373 | Ga0105243_10011504 | 3300009148 | Bacteria | 6695 |
| 374 | Ga0105243_10115449 | 3300009148 | Bacteria | 2254 |
| 375 | Ga0105243_10191629 | 3300009148 | Bacteria | 1786 |
| 376 | Ga0105243_10416468 | 3300009148 | Bacteria | 1252 |
| 377 | Ga0105241_10131169 | 3300009174 | Bacteria | 2029 |
| 378 | Ga0105241_10782368 | 3300009174 | Bacteria | 877 |
| 379 | Ga0105242_10080901 | 3300009176 | Bacteria | 2715 |
| 380 | Ga0105248_10000918 | 3300009177 | Bacteria | 32792 |
| 381 | Ga0105248_10088978 | 3300009177 | Bacteria | 3476 |
| 382 | Ga0105248_10124237 | 3300009177 | Bacteria | 2911 |
| 383 | Ga0105248_10350385 | 3300009177 | Bacteria | 1662 |
| 384 | Ga0105237_10011550 | 3300009545 | Bacteria | 9340 |
| 385 | Ga0105237_10057988 | 3300009545 | Bacteria | 3875 |
| 386 | Ga0105237_10150429 | 3300009545 | Bacteria | 2324 |
| 387 | Ga0105237_10215267 | 3300009545 | Bacteria | 1921 |
| 388 | Ga0105238_10001347 | 3300009551 | Bacteria | 24690 |
| 389 | Ga0105238_10255875 | 3300009551 | Bacteria | 1730 |
| 390 | Ga0105238_10467029 | 3300009551 | Bacteria | 1260 |
| 391 | Ga0105238_10601223 | 3300009551 | Bacteria | 1108 |
| 392 | Ga0105238_10889391 | 3300009551 | Bacteria | 909 |
| 393 | Ga0105249_10165386 | 3300009553 | Bacteria | 2141 |
| 394 | Ga0105249_10176225 | 3300009553 | Bacteria | 2077 |
| 395 | Ga0105249_10442333 | 3300009553 | Bacteria | 1337 |
| 396 | Ga0105249_10553627 | 3300009553 | Bacteria | 1201 |
| 397 | Ga0105239_10032488 | 3300010375 | Bacteria | 5733 |
| 398 | Ga0105239_10045063 | 3300010375 | Bacteria | 4834 |
| 399 | Ga0105239_10154415 | 3300010375 | Bacteria | 2563 |
| 400 | Ga0105239_10987921 | 3300010375 | Bacteria | 968 |
| 401 | Ga0105246_10002072 | 3300011119 | Bacteria | 12076 |
| 402 | Ga0105246_10126817 | 3300011119 | Bacteria | 1900 |
| 403 | Ga0105246_10392241 | 3300011119 | Bacteria | 1150 |
| 404 | Ga0157347_1014065 | 3300012502 | Bacteria | 879 |
| 405 | Ga0157373_10002009 | 3300013100 | Bacteria | 15416 |
| 406 | Ga0157373_10003095 | 3300013100 | Bacteria | 12569 |
| 407 | Ga0157373_10107785 | 3300013100 | Bacteria | 1959 |
| 408 | Ga0157373_10109619 | 3300013100 | Bacteria | 1941 |
| 409 | Ga0157373_10664144 | 3300013100 | Bacteria | 762 |
| 410 | Ga0157371_10014516 | 3300013102 | Bacteria | 5942 |
| 411 | Ga0157370_10004298 | 3300013104 | Bacteria | 16391 |
| 412 | Ga0157370_10026577 | 3300013104 | Bacteria | 5713 |
| 413 | Ga0157370_10324300 | 3300013104 | Bacteria | 1420 |
| 414 | Ga0157369_10001502 | 3300013105 | Bacteria | 28630 |
| 415 | Ga0157369_10181978 | 3300013105 | Bacteria | 2211 |
| 416 | Ga0157369_10675773 | 3300013105 | Bacteria | 1064 |
| 417 | Ga0157374_10000978 | 3300013296 | Bacteria | 24788 |
| 418 | Ga0157374_10016654 | 3300013296 | Bacteria | 6465 |
| 419 | Ga0157374_10194123 | 3300013296 | Bacteria | 1986 |
| 420 | Ga0157374_11125232 | 3300013296 | Bacteria | 806 |
| 421 | Ga0157378_10021855 | 3300013297 | Bacteria | 5626 |
| 422 | Ga0157378_10021940 | 3300013297 | Bacteria | 5615 |
| 423 | Ga0157378_10084625 | 3300013297 | Bacteria | 2872 |
| 424 | Ga0157378_10123429 | 3300013297 | Bacteria | 2390 |
| 425 | Ga0157378_10148252 | 3300013297 | Bacteria | 2184 |
| 426 | Ga0157378_10853989 | 3300013297 | Bacteria | 939 |
| 427 | Ga0163162_10055082 | 3300013306 | Bacteria | 4002 |
| 428 | Ga0163162_10071092 | 3300013306 | Bacteria | 3532 |
| 429 | Ga0163162_10093099 | 3300013306 | Bacteria | 3098 |
| 430 | Ga0163162_10346748 | 3300013306 | Bacteria | 1618 |
| 431 | Ga0163162_10487444 | 3300013306 | Bacteria | 1364 |
| 432 | Ga0157372_10003604 | 3300013307 | Bacteria | 16666 |
| 433 | Ga0157372_10057440 | 3300013307 | Bacteria | 4350 |
| 434 | Ga0157372_10100101 | 3300013307 | Bacteria | 3307 |
| 435 | Ga0157372_10628573 | 3300013307 | Bacteria | 1251 |
| 436 | Ga0157375_10022136 | 3300013308 | Bacteria | 5846 |
| 437 | Ga0157375_10307573 | 3300013308 | Bacteria | 1749 |
| 438 | Ga0163163_10001615 | 3300014325 | Bacteria | 18953 |
| 439 | Ga0163163_10022110 | 3300014325 | Bacteria | 6015 |
| 440 | Ga0163163_10050597 | 3300014325 | Bacteria | 4092 |
| 441 | Ga0163163_10119519 | 3300014325 | Bacteria | 2668 |
| 442 | Ga0163163_10247821 | 3300014325 | Bacteria | 1832 |
| 443 | Ga0157380_10069858 | 3300014326 | Bacteria | 2836 |
| 444 | Ga0157380_10249992 | 3300014326 | Bacteria | 1604 |
| 445 | Ga0157380_10423468 | 3300014326 | Bacteria | 1271 |
| 446 | Ga0182008_10000794 | 3300014497 | Bacteria | 22137 |
| 447 | Ga0182008_10026721 | 3300014497 | Bacteria | 2926 |
| 448 | Ga0157377_10000479 | 3300014745 | Bacteria | 17223 |
| 449 | Ga0157379_10000044 | 3300014968 | Bacteria | 75399 |
| 450 | Ga0157379_10054468 | 3300014968 | Bacteria | 3574 |
| 451 | Ga0157379_10057344 | 3300014968 | Bacteria | 3481 |
| 452 | Ga0157379_10113398 | 3300014968 | Bacteria | 2436 |
| 453 | Ga0157376_10042690 | 3300014969 | Bacteria | 3717 |
| 454 | Ga0157376_10201250 | 3300014969 | Bacteria | 1833 |
| 455 | Ga0157376_10333592 | 3300014969 | Bacteria | 1446 |
| 456 | Ga0157376_10409317 | 3300014969 | Bacteria | 1313 |
| 457 | Ga0157376_10834294 | 3300014969 | Bacteria | 936 |
| 458 | Ga0182006_1000690 | 3300015261 | Bacteria | 23537 |
| 459 | Ga0182006_1021734 | 3300015261 | Bacteria | 2672 |
| 460 | Ga0182007_10000223 | 3300015262 | Bacteria | 38011 |
| 461 | Ga0182007_10035384 | 3300015262 | Bacteria | 1683 |
| 462 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 463 | Ga0163161_10015411 | 3300017792 | Bacteria | 5329 |
| 464 | Ga0163161_10053380 | 3300017792 | Bacteria | 2931 |
| 465 | Ga0209672_108769 | 3300025228 | Bacteria | 1469 |
| 466 | Ga0207425_1003414 | 3300025245 | Bacteria | 5091 |
| 467 | Ga0207425_1012591 | 3300025245 | Bacteria | 1979 |
| 468 | Ga0209129_1000281 | 3300025258 | Bacteria | 48395 |
| 469 | Ga0209565_1000047 | 3300025263 | Bacteria | 225745 |
| 470 | Ga0209565_1000278 | 3300025263 | Bacteria | 51430 |
| 471 | Ga0209565_1006520 | 3300025263 | Bacteria | 3263 |
| 472 | Ga0209455_1002782 | 3300025272 | Bacteria | 6536 |
| 473 | Ga0209673_1000079 | 3300025273 | Bacteria | 225746 |
| 474 | Ga0209673_1000693 | 3300025273 | Bacteria | 48171 |
| 475 | Ga0209130_1000890 | 3300025284 | Bacteria | 24330 |
| 476 | Ga0209130_1003561 | 3300025284 | Bacteria | 6516 |
| 477 | Ga0209675_1000046 | 3300025291 | Bacteria | 225746 |
| 478 | Ga0209675_1000423 | 3300025291 | Bacteria | 34092 |
| 479 | Ga0209675_1010260 | 3300025291 | Bacteria | 3215 |
| 480 | Ga0209676_1000383 | 3300025292 | Bacteria | 81259 |
| 481 | Ga0209676_1018495 | 3300025292 | Bacteria | 2429 |
| 482 | Ga0209025_1001476 | 3300025294 | Bacteria | 30608 |
| 483 | Ga0209025_1016419 | 3300025294 | Bacteria | 4371 |
| 484 | Ga0209025_1020008 | 3300025294 | Bacteria | 3685 |
| 485 | Ga0209564_1002819 | 3300025295 | Bacteria | 12898 |
| 486 | Ga0209758_1000665 | 3300025297 | Bacteria | 51391 |
| 487 | Ga0209758_1010522 | 3300025297 | Bacteria | 5519 |
| 488 | Ga0209050_1065904 | 3300025298 | Bacteria | 832 |
| 489 | Ga0207426_1000076 | 3300025302 | Bacteria | 320851 |
| 490 | Ga0207426_1000591 | 3300025302 | Bacteria | 47966 |
| 491 | Ga0209051_1000213 | 3300025303 | Bacteria | 98755 |
| 492 | Ga0209051_1000259 | 3300025303 | Bacteria | 88311 |
| 493 | Ga0209257_1000116 | 3300025304 | Bacteria | 228733 |
| 494 | Ga0207697_10000793 | 3300025315 | Bacteria | 17916 |
| 495 | Ga0207697_10012348 | 3300025315 | Bacteria | 3583 |
| 496 | Ga0207656_10003496 | 3300025321 | Bacteria | 5407 |
| 497 | Ga0207656_10029837 | 3300025321 | Bacteria | 2249 |
| 498 | Ga0207655_1001085 | 3300025728 | Bacteria | 26850 |
| 499 | Ga0207653_10010810 | 3300025885 | Bacteria | 2848 |
| 500 | Ga0207682_10000397 | 3300025893 | Bacteria | 19996 |
| 501 | Ga0207682_10004865 | 3300025893 | Bacteria | 5544 |
| 502 | Ga0207682_10129294 | 3300025893 | Bacteria | 1126 |
| 503 | Ga0207692_10007269 | 3300025898 | Bacteria | 4530 |
| 504 | Ga0207692_10052005 | 3300025898 | Bacteria | 2079 |
| 505 | Ga0207692_10203999 | 3300025898 | Bacteria | 1164 |
| 506 | Ga0207688_10066617 | 3300025901 | Bacteria | 2037 |
| 507 | Ga0207688_10076615 | 3300025901 | Bacteria | 1905 |
| 508 | Ga0207688_10214732 | 3300025901 | Bacteria | 1157 |
| 509 | Ga0207680_10011740 | 3300025903 | Bacteria | 4437 |
| 510 | Ga0207680_10037749 | 3300025903 | Bacteria | 2791 |
| 511 | Ga0207680_10052629 | 3300025903 | Bacteria | 2441 |
| 512 | Ga0207680_10133130 | 3300025903 | Bacteria | 1640 |
| 513 | Ga0207680_10390225 | 3300025903 | Bacteria | 983 |
| 514 | Ga0207647_10279639 | 3300025904 | Bacteria | 953 |
| 515 | Ga0207685_10119946 | 3300025905 | Bacteria | 1153 |
| 516 | Ga0207699_10104396 | 3300025906 | Bacteria | 1805 |
| 517 | Ga0207699_10116473 | 3300025906 | Bacteria | 1721 |
| 518 | Ga0207645_10000333 | 3300025907 | Bacteria | 39388 |
| 519 | Ga0207645_10083564 | 3300025907 | Bacteria | 2048 |
| 520 | Ga0207645_10444735 | 3300025907 | Unclassified | 874 |
| 521 | Ga0207643_10003574 | 3300025908 | Bacteria | 8372 |
| 522 | Ga0207643_10420612 | 3300025908 | Bacteria | 847 |
| 523 | Ga0207705_10048188 | 3300025909 | Bacteria | 3064 |
| 524 | Ga0207705_10429602 | 3300025909 | Bacteria | 1023 |
| 525 | Ga0207684_10000972 | 3300025910 | Bacteria | 32086 |
| 526 | Ga0207684_10001487 | 3300025910 | Bacteria | 25213 |
| 527 | Ga0207684_10004791 | 3300025910 | Bacteria | 12673 |
| 528 | Ga0207684_10008646 | 3300025910 | Bacteria | 9042 |
| 529 | Ga0207684_10014734 | 3300025910 | Bacteria | 6733 |
| 530 | Ga0207684_10093773 | 3300025910 | Bacteria | 2560 |
| 531 | Ga0207684_10122908 | 3300025910 | Bacteria | 2226 |
| 532 | Ga0207684_10148320 | 3300025910 | Bacteria | 2018 |
| 533 | Ga0207684_10220121 | 3300025910 | Bacteria | 1638 |
| 534 | Ga0207684_10278488 | 3300025910 | Bacteria | 1443 |
| 535 | Ga0207654_10005566 | 3300025911 | Bacteria | 6372 |
| 536 | Ga0207707_10026758 | 3300025912 | Bacteria | 5041 |
| 537 | Ga0207707_10209370 | 3300025912 | Bacteria | 1699 |
| 538 | Ga0207695_10025361 | 3300025913 | Bacteria | 6639 |
| 539 | Ga0207695_10043580 | 3300025913 | Bacteria | 4782 |
| 540 | Ga0207695_10218284 | 3300025913 | Bacteria | 1815 |
| 541 | Ga0207695_10633346 | 3300025913 | Bacteria | 950 |
| 542 | Ga0207671_10046596 | 3300025914 | Bacteria | 3208 |
| 543 | Ga0207671_10202855 | 3300025914 | Bacteria | 1549 |
| 544 | Ga0207671_10419463 | 3300025914 | Bacteria | 1065 |
| 545 | Ga0207693_10003441 | 3300025915 | Bacteria | 13505 |
| 546 | Ga0207693_10003978 | 3300025915 | Bacteria | 12558 |
| 547 | Ga0207693_10010581 | 3300025915 | Bacteria | 7485 |
| 548 | Ga0207693_10014543 | 3300025915 | Bacteria | 6324 |
| 549 | Ga0207663_10118051 | 3300025916 | Bacteria | 1811 |
| 550 | Ga0207663_10148031 | 3300025916 | Bacteria | 1644 |
| 551 | Ga0207663_10547930 | 3300025916 | Bacteria | 904 |
| 552 | Ga0207660_10016888 | 3300025917 | Bacteria | 4841 |
| 553 | Ga0207662_10039183 | 3300025918 | Bacteria | 2779 |
| 554 | Ga0207662_10096070 | 3300025918 | Bacteria | 1830 |
| 555 | Ga0207657_10015295 | 3300025919 | Bacteria | 7437 |
| 556 | Ga0207657_10018119 | 3300025919 | Bacteria | 6737 |
| 557 | Ga0207657_10028035 | 3300025919 | Bacteria | 5146 |
| 558 | Ga0207649_10005189 | 3300025920 | Bacteria | 7035 |
| 559 | Ga0207649_10015006 | 3300025920 | Bacteria | 4350 |
| 560 | Ga0207649_10299954 | 3300025920 | Bacteria | 1174 |
| 561 | Ga0207649_10313520 | 3300025920 | Bacteria | 1150 |
| 562 | Ga0207652_10142242 | 3300025921 | Bacteria | 2146 |
| 563 | Ga0207652_10174458 | 3300025921 | Bacteria | 1930 |
| 564 | Ga0207652_10175441 | 3300025921 | Bacteria | 1925 |
| 565 | Ga0207652_10462430 | 3300025921 | Bacteria | 1143 |
| 566 | Ga0207646_10004214 | 3300025922 | Bacteria | 15743 |
| 567 | Ga0207646_10011235 | 3300025922 | Bacteria | 8695 |
| 568 | Ga0207646_10012388 | 3300025922 | Bacteria | 8199 |
| 569 | Ga0207646_10012608 | 3300025922 | Bacteria | 8115 |
| 570 | Ga0207646_10025565 | 3300025922 | Bacteria | 5400 |
| 571 | Ga0207646_10106522 | 3300025922 | Bacteria | 2514 |
| 572 | Ga0207646_10296490 | 3300025922 | Bacteria | 1461 |
| 573 | Ga0207646_10323950 | 3300025922 | Bacteria | 1392 |
| 574 | Ga0207646_10809448 | 3300025922 | Bacteria | 834 |
| 575 | Ga0207681_10026046 | 3300025923 | Bacteria | 3769 |
| 576 | Ga0207681_10030363 | 3300025923 | Bacteria | 3523 |
| 577 | Ga0207681_10520589 | 3300025923 | Unclassified | 976 |
| 578 | Ga0207694_10008391 | 3300025924 | Bacteria | 7800 |
| 579 | Ga0207694_10038219 | 3300025924 | Bacteria | 3690 |
| 580 | Ga0207694_10281608 | 3300025924 | Bacteria | 1366 |
| 581 | Ga0207650_10005969 | 3300025925 | Bacteria | 8313 |
| 582 | Ga0207650_10007114 | 3300025925 | Bacteria | 7624 |
| 583 | Ga0207650_10008283 | 3300025925 | Bacteria | 7098 |
| 584 | Ga0207650_10017066 | 3300025925 | Bacteria | 5081 |
| 585 | Ga0207650_10090137 | 3300025925 | Bacteria | 2341 |
| 586 | Ga0207650_10111100 | 3300025925 | Bacteria | 2122 |
| 587 | Ga0207650_10129451 | 3300025925 | Bacteria | 1974 |
| 588 | Ga0207650_10221992 | 3300025925 | Bacteria | 1521 |
| 589 | Ga0207650_10458637 | 3300025925 | Bacteria | 1061 |
| 590 | Ga0207650_10895120 | 3300025925 | Bacteria | 753 |
| 591 | Ga0207659_10003096 | 3300025926 | Bacteria | 9932 |
| 592 | Ga0207659_10030578 | 3300025926 | Bacteria | 3681 |
| 593 | Ga0207687_10000171 | 3300025927 | Bacteria | 42958 |
| 594 | Ga0207687_10392750 | 3300025927 | Bacteria | 1139 |
| 595 | Ga0207700_10000234 | 3300025928 | Bacteria | 33281 |
| 596 | Ga0207700_10214988 | 3300025928 | Bacteria | 1627 |
| 597 | Ga0207664_10028724 | 3300025929 | Bacteria | 4229 |
| 598 | Ga0207664_10273424 | 3300025929 | Bacteria | 1480 |
| 599 | Ga0207644_10064191 | 3300025931 | Bacteria | 2668 |
| 600 | Ga0207644_10074790 | 3300025931 | Bacteria | 2487 |
| 601 | Ga0207644_10101583 | 3300025931 | Bacteria | 2161 |
| 602 | Ga0207644_10138658 | 3300025931 | Bacteria | 1870 |
| 603 | Ga0207644_10329359 | 3300025931 | Bacteria | 1236 |
| 604 | Ga0207644_10350683 | 3300025931 | Bacteria | 1198 |
| 605 | Ga0207690_10019497 | 3300025932 | Bacteria | 4179 |
| 606 | Ga0207690_10271003 | 3300025932 | Bacteria | 1319 |
| 607 | Ga0207706_10001560 | 3300025933 | Bacteria | 22717 |
| 608 | Ga0207706_10004253 | 3300025933 | Bacteria | 13474 |
| 609 | Ga0207706_10047120 | 3300025933 | Bacteria | 3815 |
| 610 | Ga0207706_10072570 | 3300025933 | Bacteria | 3027 |
| 611 | Ga0207706_10191904 | 3300025933 | Bacteria | 1793 |
| 612 | Ga0207686_10381003 | 3300025934 | Unclassified | 1070 |
| 613 | Ga0207709_10000103 | 3300025935 | Bacteria | 131589 |
| 614 | Ga0207709_10001788 | 3300025935 | Bacteria | 14412 |
| 615 | Ga0207709_10187158 | 3300025935 | Bacteria | 1467 |
| 616 | Ga0207670_10070093 | 3300025936 | Bacteria | 2420 |
| 617 | Ga0207670_10269320 | 3300025936 | Bacteria | 1323 |
| 618 | Ga0207669_10008879 | 3300025937 | Bacteria | 4746 |
| 619 | Ga0207704_10280220 | 3300025938 | Bacteria | 1267 |
| 620 | Ga0207665_10018074 | 3300025939 | Bacteria | 4633 |
| 621 | Ga0207665_10118506 | 3300025939 | Bacteria | 1868 |
| 622 | Ga0207691_10000029 | 3300025940 | Bacteria | 120814 |
| 623 | Ga0207691_10003525 | 3300025940 | Bacteria | 15222 |
| 624 | Ga0207691_10016744 | 3300025940 | Bacteria | 6959 |
| 625 | Ga0207691_10020307 | 3300025940 | Bacteria | 6281 |
| 626 | Ga0207691_10045976 | 3300025940 | Bacteria | 4013 |
| 627 | Ga0207691_10052926 | 3300025940 | Bacteria | 3707 |
| 628 | Ga0207691_10065492 | 3300025940 | Bacteria | 3289 |
| 629 | Ga0207691_10196630 | 3300025940 | Bacteria | 1756 |
| 630 | Ga0207711_10002156 | 3300025941 | Bacteria | 17721 |
| 631 | Ga0207711_10051870 | 3300025941 | Bacteria | 3515 |
| 632 | Ga0207711_10152082 | 3300025941 | Bacteria | 2089 |
| 633 | Ga0207711_10235428 | 3300025941 | Bacteria | 1678 |
| 634 | Ga0207711_10249437 | 3300025941 | Bacteria | 1630 |
| 635 | Ga0207711_10485988 | 3300025941 | Bacteria | 1150 |
| 636 | Ga0207689_10000387 | 3300025942 | Bacteria | 41370 |
| 637 | Ga0207689_10002193 | 3300025942 | Bacteria | 18314 |
| 638 | Ga0207689_10031450 | 3300025942 | Bacteria | 4418 |
| 639 | Ga0207689_10072429 | 3300025942 | Bacteria | 2831 |
| 640 | Ga0207689_10111987 | 3300025942 | Bacteria | 2243 |
| 641 | Ga0207689_10160331 | 3300025942 | Bacteria | 1854 |
| 642 | Ga0207689_10202613 | 3300025942 | Bacteria | 1638 |
| 643 | Ga0207689_10351373 | 3300025942 | Bacteria | 1226 |
| 644 | Ga0207689_10581972 | 3300025942 | Bacteria | 941 |
| 645 | Ga0207661_10019681 | 3300025944 | Bacteria | 5038 |
| 646 | Ga0207679_10034860 | 3300025945 | Bacteria | 3555 |
| 647 | Ga0207679_10046935 | 3300025945 | Bacteria | 3134 |
| 648 | Ga0207679_10103946 | 3300025945 | Bacteria | 2227 |
| 649 | Ga0207679_10136203 | 3300025945 | Bacteria | 1978 |
| 650 | Ga0207679_10607263 | 3300025945 | Bacteria | 986 |
| 651 | Ga0207667_10004959 | 3300025949 | Bacteria | 16259 |
| 652 | Ga0207667_10006229 | 3300025949 | Bacteria | 14478 |
| 653 | Ga0207667_10534652 | 3300025949 | Bacteria | 1187 |
| 654 | Ga0207667_10570797 | 3300025949 | Bacteria | 1143 |
| 655 | Ga0207667_11041048 | 3300025949 | Bacteria | 804 |
| 656 | Ga0207651_10002436 | 3300025960 | Bacteria | 8898 |
| 657 | Ga0207651_10046180 | 3300025960 | Bacteria | 2927 |
| 658 | Ga0207651_10065137 | 3300025960 | Bacteria | 2554 |
| 659 | Ga0207651_10307410 | 3300025960 | Bacteria | 1321 |
| 660 | Ga0207651_10407499 | 3300025960 | Bacteria | 1158 |
| 661 | Ga0207712_10062931 | 3300025961 | Bacteria | 2639 |
| 662 | Ga0207668_10007158 | 3300025972 | Bacteria | 6625 |
| 663 | Ga0207668_10025148 | 3300025972 | Bacteria | 3850 |
| 664 | Ga0207668_10067618 | 3300025972 | Bacteria | 2537 |
| 665 | Ga0207668_10087739 | 3300025972 | Bacteria | 2276 |
| 666 | Ga0207668_10180203 | 3300025972 | Bacteria | 1665 |
| 667 | Ga0207668_10253086 | 3300025972 | Bacteria | 1431 |
| 668 | Ga0207668_10301092 | 3300025972 | Bacteria | 1323 |
| 669 | Ga0207640_10030427 | 3300025981 | Bacteria | 3324 |
| 670 | Ga0207658_10001631 | 3300025986 | Bacteria | 17206 |
| 671 | Ga0207658_10002140 | 3300025986 | Bacteria | 14673 |
| 672 | Ga0207658_10016053 | 3300025986 | Bacteria | 5144 |
| 673 | Ga0207658_10016727 | 3300025986 | Bacteria | 5048 |
| 674 | Ga0207658_10100268 | 3300025986 | Bacteria | 2267 |
| 675 | Ga0207658_10489785 | 3300025986 | Bacteria | 1094 |
| 676 | Ga0207677_10000370 | 3300026023 | Bacteria | 31254 |
| 677 | Ga0207677_10020540 | 3300026023 | Bacteria | 4012 |
| 678 | Ga0207677_10021894 | 3300026023 | Bacteria | 3917 |
| 679 | Ga0207677_10078784 | 3300026023 | Bacteria | 2354 |
| 680 | Ga0207677_10087387 | 3300026023 | Bacteria | 2257 |
| 681 | Ga0207703_10000374 | 3300026035 | Bacteria | 47821 |
| 682 | Ga0207703_10001245 | 3300026035 | Bacteria | 23856 |
| 683 | Ga0207703_10072586 | 3300026035 | Bacteria | 2845 |
| 684 | Ga0207703_10196401 | 3300026035 | Bacteria | 1790 |
| 685 | Ga0207703_10398488 | 3300026035 | Bacteria | 1276 |
| 686 | Ga0207703_10454968 | 3300026035 | Bacteria | 1196 |
| 687 | Ga0207639_10014598 | 3300026041 | Bacteria | 5531 |
| 688 | Ga0207639_10018496 | 3300026041 | Bacteria | 4953 |
| 689 | Ga0207639_10082687 | 3300026041 | Bacteria | 2546 |
| 690 | Ga0207678_10002599 | 3300026067 | Bacteria | 16446 |
| 691 | Ga0207678_10015548 | 3300026067 | Bacteria | 6692 |
| 692 | Ga0207678_10256023 | 3300026067 | Bacteria | 1500 |
| 693 | Ga0207708_10003210 | 3300026075 | Bacteria | 12048 |
| 694 | Ga0207708_10265279 | 3300026075 | Bacteria | 1387 |
| 695 | Ga0207702_10005567 | 3300026078 | Bacteria | 11001 |
| 696 | Ga0207702_10149349 | 3300026078 | Bacteria | 2124 |
| 697 | Ga0207702_10595189 | 3300026078 | Bacteria | 1085 |
| 698 | Ga0207702_10659148 | 3300026078 | Bacteria | 1030 |
| 699 | Ga0207641_10004076 | 3300026088 | Bacteria | 12744 |
| 700 | Ga0207641_10013227 | 3300026088 | Bacteria | 6766 |
| 701 | Ga0207641_10018826 | 3300026088 | Bacteria | 5663 |
| 702 | Ga0207641_10310403 | 3300026088 | Bacteria | 1492 |
| 703 | Ga0207641_10353383 | 3300026088 | Bacteria | 1401 |
| 704 | Ga0207641_10458493 | 3300026088 | Bacteria | 1233 |
| 705 | Ga0207648_10001008 | 3300026089 | Bacteria | 31704 |
| 706 | Ga0207648_10042274 | 3300026089 | Bacteria | 4001 |
| 707 | Ga0207648_10059445 | 3300026089 | Bacteria | 3334 |
| 708 | Ga0207648_10133488 | 3300026089 | Bacteria | 2186 |
| 709 | Ga0207648_10203684 | 3300026089 | Bacteria | 1756 |
| 710 | Ga0207648_10237708 | 3300026089 | Bacteria | 1621 |
| 711 | Ga0207648_10315907 | 3300026089 | Bacteria | 1403 |
| 712 | Ga0207676_10000054 | 3300026095 | Bacteria | 128222 |
| 713 | Ga0207676_10019308 | 3300026095 | Bacteria | 4970 |
| 714 | Ga0207676_10023898 | 3300026095 | Bacteria | 4516 |
| 715 | Ga0207676_10035603 | 3300026095 | Bacteria | 3780 |
| 716 | Ga0207676_10056995 | 3300026095 | Bacteria | 3075 |
| 717 | Ga0207676_10076241 | 3300026095 | Bacteria | 2708 |
| 718 | Ga0207676_10108320 | 3300026095 | Bacteria | 2319 |
| 719 | Ga0207674_10000253 | 3300026116 | Bacteria | 66599 |
| 720 | Ga0207674_10001083 | 3300026116 | Bacteria | 35406 |
| 721 | Ga0207674_10002156 | 3300026116 | Bacteria | 24894 |
| 722 | Ga0207674_10016943 | 3300026116 | Bacteria | 7958 |
| 723 | Ga0207674_10051844 | 3300026116 | Bacteria | 4186 |
| 724 | Ga0207674_10201300 | 3300026116 | Bacteria | 1941 |
| 725 | Ga0207674_10995340 | 3300026116 | Bacteria | 807 |
| 726 | Ga0207675_100000626 | 3300026118 | Bacteria | 34619 |
| 727 | Ga0207675_100000672 | 3300026118 | Bacteria | 33681 |
| 728 | Ga0207675_100034352 | 3300026118 | Bacteria | 4727 |
| 729 | Ga0207675_100057858 | 3300026118 | Bacteria | 3617 |
| 730 | Ga0207675_100086885 | 3300026118 | Unclassified | 2937 |
| 731 | Ga0207675_100131197 | 3300026118 | Bacteria | 2376 |
| 732 | Ga0207675_100314001 | 3300026118 | Bacteria | 1529 |
| 733 | Ga0207675_100323943 | 3300026118 | Bacteria | 1505 |
| 734 | Ga0207683_10000164 | 3300026121 | Bacteria | 56430 |
| 735 | Ga0207683_10005814 | 3300026121 | Bacteria | 10577 |
| 736 | Ga0207683_10011809 | 3300026121 | Bacteria | 7452 |
| 737 | Ga0207683_10015271 | 3300026121 | Bacteria | 6537 |
| 738 | Ga0207683_10168489 | 3300026121 | Bacteria | 1983 |
| 739 | Ga0207683_10514382 | 3300026121 | Bacteria | 1106 |
| 740 | Ga0207683_10931438 | 3300026121 | Bacteria | 807 |
| 741 | Ga0207698_10002040 | 3300026142 | Bacteria | 11911 |
| 742 | Ga0207698_10004482 | 3300026142 | Bacteria | 8519 |
| 743 | Ga0207698_10052160 | 3300026142 | Bacteria | 3132 |
| 744 | Ga0207698_10059417 | 3300026142 | Bacteria | 2969 |
| 745 | Ga0207698_10078526 | 3300026142 | Bacteria | 2651 |
| 746 | Ga0207698_10088686 | 3300026142 | Bacteria | 2523 |
| 747 | Ga0207698_10713660 | 3300026142 | Bacteria | 999 |
| 748 | Ga0209371_1009416 | 3300027312 | Bacteria | 3108 |
| 749 | Ga0209282_1000117 | 3300027666 | Bacteria | 51134 |
| 750 | Ga0209588_1032409 | 3300027671 | Archaea | 1674 |
| 751 | Ga0207428_10018976 | 3300027907 | Bacteria | 5864 |
| 752 | Ga0268266_10003312 | 3300028379 | Bacteria | 16178 |
| 753 | Ga0268266_10007280 | 3300028379 | Bacteria | 10007 |
| 754 | Ga0268266_10039581 | 3300028379 | Bacteria | 4016 |
| 755 | Ga0268266_10118790 | 3300028379 | Bacteria | 2350 |
| 756 | Ga0268265_10002148 | 3300028380 | Bacteria | 15266 |
| 757 | Ga0268265_10043011 | 3300028380 | Bacteria | 3355 |
| 758 | Ga0268265_10173190 | 3300028380 | Bacteria | 1847 |
| 759 | Ga0268265_10214236 | 3300028380 | Bacteria | 1680 |
| 760 | Ga0268264_10001103 | 3300028381 | Bacteria | 26672 |
| 761 | Ga0268264_10008580 | 3300028381 | Bacteria | 8490 |
| 762 | Ga0268264_10009544 | 3300028381 | Bacteria | 8038 |
| 763 | Ga0268264_10016859 | 3300028381 | Bacteria | 5980 |
| 764 | Ga0268264_10087228 | 3300028381 | Bacteria | 2683 |
| 765 | Ga0268264_10176663 | 3300028381 | Bacteria | 1936 |
| 766 | Ga0268264_10931530 | 3300028381 | Bacteria | 873 |
| 767 | Ga0307517_10199229 | 3300028786 | Bacteria | 1255 |
| 768 | Ga0307515_10074155 | 3300028794 | Bacteria | 4557 |
| 769 | Ga0307515_10133948 | 3300028794 | Bacteria | 2708 |
| 770 | Ga0307515_10156065 | 3300028794 | Bacteria | 2355 |
| 771 | Ga0307515_10229015 | 3300028794 | Bacteria | 1656 |
| 772 | Ga0307515_10376683 | 3300028794 | Bacteria | 1053 |
| 773 | Ga0268256_1009978 | 3300030500 | Bacteria | 3108 |
| 774 | Ga0307512_10019834 | 3300030522 | Bacteria | 6112 |
| 775 | Ga0265325_10040386 | 3300031241 | Bacteria | 2450 |
| 776 | Ga0265339_10041942 | 3300031249 | Bacteria | 2536 |
| 777 | Ga0265331_10019496 | 3300031250 | Bacteria | 3503 |
| 778 | Ga0265327_10052300 | 3300031251 | Bacteria | 2127 |
| 779 | Ga0307513_10000090 | 3300031456 | Bacteria | 129750 |
| 780 | Ga0307513_10502329 | 3300031456 | Bacteria | 930 |
| 781 | Ga0307509_10000157 | 3300031507 | Bacteria | 106022 |
| 782 | Ga0307408_100167064 | 3300031548 | Bacteria | 1753 |
| 783 | Ga0265313_10000408 | 3300031595 | Bacteria | 46126 |
| 784 | Ga0307514_10004434 | 3300031649 | Bacteria | 12921 |
| 785 | Ga0307514_10068072 | 3300031649 | Bacteria | 2685 |
| 786 | Ga0307514_10255879 | 3300031649 | Bacteria | 1031 |
| 787 | Ga0265314_10025397 | 3300031711 | Bacteria | 4469 |
| 788 | Ga0265342_10017753 | 3300031712 | Bacteria | 4621 |
| 789 | Ga0307516_10083461 | 3300031730 | Bacteria | 3036 |
| 790 | Ga0307516_10108644 | 3300031730 | Bacteria | 2580 |
| 791 | Ga0307516_10365799 | 3300031730 | Bacteria | 1106 |
| 792 | Ga0307405_10506897 | 3300031731 | Bacteria | 968 |
| 793 | Ga0307518_10202859 | 3300031838 | Bacteria | 1315 |
| 794 | Ga0307410_10067714 | 3300031852 | Bacteria | 2464 |
| 795 | Ga0307406_10237264 | 3300031901 | Bacteria | 1365 |
| 796 | Ga0307407_10050849 | 3300031903 | Bacteria | 2373 |
| 797 | Ga0307412_10000103 | 3300031911 | Bacteria | 69660 |
| 798 | Ga0307412_10135886 | 3300031911 | Bacteria | 1794 |
| 799 | Ga0307416_100302784 | 3300032002 | Bacteria | 1590 |
| 800 | Ga0307510_10003490 | 3300033180 | Bacteria | 18320 |
| 801 | Ga0307510_10050330 | 3300033180 | Bacteria | 4421 |
| 802 | Ga0307510_10165550 | 3300033180 | Bacteria | 1800 |
| 803 | Ga0373926_0069117 | 3300035083 | Bacteria | 1296 |
| 804 | Ga0373923_0068041 | 3300035111 | Bacteria | 1524 |
| 805 | Ga0373945_0009050 | 3300035116 | Bacteria | 3254 |
| 806 | Ga0373945_0052026 | 3300035116 | Bacteria | 1508 |
| 807 | Ga0373953_0011049 | 3300035117 | Bacteria | 3157 |
| 808 | Ga0373953_0142511 | 3300035117 | Bacteria | 1025 |
| 809 | Ga0373954_0027905 | 3300035118 | Bacteria | 2593 |
| 810 | Ga0373954_0033876 | 3300035118 | Bacteria | 2364 |
| 811 | Ga0373956_0081633 | 3300035119 | Bacteria | 1484 |
| 812 | Ga0373956_0082517 | 3300035119 | Bacteria | 1476 |
| 813 | Ga0373956_0144394 | 3300035119 | Bacteria | 1118 |
| 814 | Ga0373957_0039296 | 3300035120 | Bacteria | 1774 |
| 815 | Ga0373943_0007400 | 3300035170 | Bacteria | 4931 |
| 816 | Ga0373943_0019919 | 3300035170 | Bacteria | 3090 |
| 817 | Ga0373946_0009476 | 3300035171 | Bacteria | 3589 |
| 818 | Ga0373946_0012966 | 3300035171 | Bacteria | 3127 |
| 819 | Ga0373955_0090097 | 3300035172 | Bacteria | 1746 |
| 820 | Ga0373931_0041360 | 3300035691 | Bacteria | 2421 |
| 821 | Ga0373931_0267013 | 3300035691 | Bacteria | 1046 |
| 822 | Ga0373935_0003835 | 3300035692 | Bacteria | 8768 |
| 823 | Ga0373935_0011519 | 3300035692 | Bacteria | 5309 |
| 824 | Ga0373935_0074394 | 3300035692 | Bacteria | 2196 |
| 825 | Ga0373935_0783590 | 3300035692 | Bacteria | 703 |
| 826 | Ga0373927_0008783 | 3300035695 | Bacteria | 6791 |
| 827 | Ga0373927_0238663 | 3300035695 | Bacteria | 1194 |
| 828 | Ga0373933_0073002 | 3300035724 | Bacteria | 2090 |
| 829 | Ga0373933_0102376 | 3300035724 | Bacteria | 1778 |
| 830 | Ga0373933_0132089 | 3300035724 | Bacteria | 1571 |
| 831 | Ga0373947_0195196 | 3300035725 | Bacteria | 1322 |
| 832 | Ga0373937_0005447 | 3300036401 | Bacteria | 10896 |
| 833 | Ga0373937_0031765 | 3300036401 | Bacteria | 4786 |
| 834 | Ga0373937_0034002 | 3300036401 | Bacteria | 4634 |
| 835 | Ga0373937_0057274 | 3300036401 | Bacteria | 3580 |
| 836 | Ga0373925_0005352 | 3300037068 | Bacteria | 9575 |
| 837 | Ga0373925_0005721 | 3300037068 | Bacteria | 9243 |
| 838 | Ga0373925_0045998 | 3300037068 | Bacteria | 3243 |
| 839 | Ga0373925_0111746 | 3300037068 | Bacteria | 2112 |
| 840 | Ga0395899_0169155 | 3300037312 | Bacteria | 1540 |
| 841 | Ga0436364_1272123 | 3300037853 | Bacteria | 1560 |
| 842 | Ga0395901_0666498 | 3300038443 | Unclassified | 1042 |
| 843 | Ga0436365_0234696 | 3300039437 | Bacteria | 3633 |
| 844 | Ga0436361_0505856 | 3300039447 | Bacteria | 3124 |
| 845 | Ga0436361_0608376 | 3300039447 | Bacteria | 19212 |
| 846 | Ga0436361_1150952 | 3300039447 | Bacteria | 846 |
| 847 | Ga0439465_0017823 | 3300041413 | Bacteria | 2219 |
| 848 | Ga0451797_1197028 | 3300041453 | Bacteria | 1054 |
| 849 | Ga0451807_1842326 | 3300041486 | Bacteria | 1984 |
| 850 | Ga0439455_0020293 | 3300042012 | Bacteria | 1574 |
| 851 | Ga0451577_0030876 | 3300042876 | Bacteria | 4838 |
| 852 | Ga0453683_0015585 | 3300044673 | Bacteria | 4919 |
| 853 | Ga0453683_0039914 | 3300044673 | Bacteria | 2950 |
| 854 | Ga0453684_0076543 | 3300044712 | Bacteria | 4200 |
| 855 | Ga0466957_0518864 | 3300044842 | Bacteria | 828 |
| 856 | Ga0466959_0024404 | 3300045049 | Bacteria | 4479 |
| 857 | Ga0466967_0830168 | 3300045976 | Bacteria | 918 |
| 858 | Ga0495627_001781 | 3300046453 | Bacteria | 11533 |
| 859 | Ga0495627_026616 | 3300046453 | Bacteria | 1863 |
| 860 | Ga0495592_0000058 | 3300046454 | Bacteria | 101492 |
| 861 | Ga0495603_0024655 | 3300046455 | Bacteria | 3639 |
| 862 | Ga0495629_0062605 | 3300046459 | Bacteria | 2598 |
| 863 | Ga0495629_0189013 | 3300046459 | Bacteria | 1426 |
| 864 | Ga0495638_0059645 | 3300046460 | Bacteria | 2362 |
| 865 | Ga0495651_0013472 | 3300046462 | Bacteria | 6324 |
| 866 | Ga0495651_0030050 | 3300046462 | Bacteria | 4237 |
| 867 | Ga0495580_0027386 | 3300046472 | Bacteria | 4147 |
| 868 | Ga0495580_0100726 | 3300046472 | Bacteria | 2009 |
| 869 | Ga0495582_0006058 | 3300046473 | Bacteria | 6738 |
| 870 | Ga0495639_0000527 | 3300046475 | Bacteria | 17920 |
| 871 | Ga0495639_0003337 | 3300046475 | Bacteria | 6960 |
| 872 | Ga0495662_0014614 | 3300046476 | Bacteria | 3816 |
| 873 | Ga0495594_0076572 | 3300046499 | Bacteria | 1865 |
| 874 | Ga0495583_0135558 | 3300046506 | Bacteria | 1028 |
| 875 | Ga0495606_0120222 | 3300046507 | Bacteria | 1573 |
| 876 | Ga0495608_0284989 | 3300046511 | Bacteria | 1025 |
| 877 | Ga0495616_0059701 | 3300046513 | Bacteria | 1875 |
| 878 | Ga0495618_0370786 | 3300046514 | Bacteria | 880 |
| 879 | Ga0495620_0040968 | 3300046515 | Bacteria | 2034 |
| 880 | Ga0495628_0043368 | 3300046516 | Bacteria | 3584 |
| 881 | Ga0495630_0208614 | 3300046517 | Bacteria | 1491 |
| 882 | Ga0495630_0210615 | 3300046517 | Bacteria | 1483 |
| 883 | Ga0495631_0091461 | 3300046518 | Bacteria | 1310 |
| 884 | Ga0495637_0028144 | 3300046520 | Bacteria | 2511 |
| 885 | Ga0495642_0041217 | 3300046528 | Bacteria | 1878 |
| 886 | Ga0495654_0006581 | 3300046530 | Bacteria | 6580 |
| 887 | Ga0495665_0001980 | 3300046531 | Bacteria | 11071 |
| 888 | Ga0495640_0045396 | 3300046533 | Bacteria | 3049 |
| 889 | Ga0495586_0073032 | 3300046535 | Bacteria | 1876 |
| 890 | Ga0495587_0122264 | 3300046536 | Bacteria | 1491 |
| 891 | Ga0495609_0132502 | 3300046538 | Bacteria | 1067 |
| 892 | Ga0495597_0025222 | 3300046542 | Bacteria | 2738 |
| 893 | Ga0495645_0028657 | 3300046543 | Bacteria | 4047 |
| 894 | Ga0495667_0214978 | 3300046559 | Bacteria | 1228 |
| 895 | Ga0495656_0026379 | 3300046615 | Bacteria | 2313 |
| 896 | Ga0495668_0172949 | 3300046616 | Bacteria | 1183 |
| 897 | Ga0495634_0099614 | 3300046642 | Bacteria | 1879 |
| 898 | Ga0495625_0000044 | 3300046660 | Bacteria | 203855 |
| 899 | Ga0495625_0001757 | 3300046660 | Bacteria | 25057 |
| 900 | Ga0495625_0044628 | 3300046660 | Bacteria | 3208 |
| 901 | Ga0495625_0104581 | 3300046660 | Bacteria | 1941 |
| 902 | Ga0495625_0300703 | 3300046660 | Bacteria | 1027 |
| 903 | Ga0495635_0047625 | 3300046663 | Bacteria | 2955 |
| 904 | Ga0495635_0255909 | 3300046663 | Bacteria | 1180 |
| 905 | Ga0495661_0121689 | 3300046665 | Bacteria | 1441 |
| 906 | Ga0495588_0001981 | 3300046674 | Bacteria | 8759 |
| 907 | Ga0495588_0013031 | 3300046674 | Bacteria | 3951 |
| 908 | Ga0495588_0200652 | 3300046674 | Bacteria | 1054 |
| 909 | Ga0495623_0172121 | 3300046679 | Bacteria | 1264 |
| 910 | Ga0495646_0060741 | 3300046680 | Bacteria | 2253 |
| 911 | Ga0495646_0194311 | 3300046680 | Bacteria | 1108 |
| 912 | Ga0495647_0001991 | 3300046681 | Bacteria | 6379 |
| 913 | Ga0495647_0184587 | 3300046681 | Bacteria | 909 |
| 914 | Ga0495613_0006118 | 3300046689 | Bacteria | 9004 |
| 915 | Ga0495624_0126357 | 3300046690 | Bacteria | 1569 |
| 916 | Ga0495671_0028593 | 3300046692 | Bacteria | 2870 |
| 917 | Ga0495649_0002553 | 3300046694 | Bacteria | 12758 |
| 918 | Ga0495581_0020189 | 3300047315 | Bacteria | 3868 |
| 919 | Ga0495581_0398255 | 3300047315 | Bacteria | 803 |
| 920 | Ga0495674_0040879 | 3300047319 | Bacteria | 4145 |
| 921 | Ga0495687_001915 | 3300047443 | Bacteria | 17872 |
| 922 | Ga0495687_002495 | 3300047443 | Bacteria | 14668 |
| 923 | Ga0495675_0218244 | 3300047444 | Bacteria | 1155 |
| 924 | Ga0495684_0019515 | 3300047471 | Bacteria | 5222 |
| 925 | Ga0495684_0081495 | 3300047471 | Bacteria | 2456 |
| 926 | Ga0495686_0000855 | 3300047472 | Bacteria | 39059 |
| 927 | Ga0495686_0202994 | 3300047472 | Bacteria | 1137 |
| 928 | Ga0495593_0024422 | 3300047673 | Bacteria | 3350 |
| 929 | Ga0495593_0282854 | 3300047673 | Bacteria | 829 |
| 930 | Ga0495602_0116167 | 3300048088 | Bacteria | 2163 |
| 931 | Ga0495602_0443322 | 3300048088 | Bacteria | 918 |
| 932 | Ga0495614_0019890 | 3300048089 | Bacteria | 2904 |
| 933 | Ga0496100_0089520 | 3300048903 | Bacteria | 2097 |
| 934 | Ga0496100_0313655 | 3300048903 | Bacteria | 1176 |
| 935 | Ga0496101_0010070 | 3300048904 | Bacteria | 6232 |
| 936 | Ga0496101_0169288 | 3300048904 | Bacteria | 1678 |
| 937 | Ga0496102_0004685 | 3300048905 | Bacteria | 11569 |
| 938 | Ga0496102_0045183 | 3300048905 | Bacteria | 3998 |
| 939 | Ga0496102_0245232 | 3300048905 | Bacteria | 1689 |
| 940 | Ga0496104_0001915 | 3300048907 | Bacteria | 18040 |
| 941 | Ga0496104_0068512 | 3300048907 | Bacteria | 3372 |
| 942 | Ga0496104_0104566 | 3300048907 | Bacteria | 2713 |
| 943 | Ga0496104_0313739 | 3300048907 | Bacteria | 1481 |
| 944 | Ga0496104_0341078 | 3300048907 | Bacteria | 1411 |
| 945 | Ga0496104_0757074 | 3300048907 | Bacteria | 878 |
| 946 | Ga0496105_0002495 | 3300048908 | Bacteria | 13340 |
| 947 | Ga0496105_0132608 | 3300048908 | Bacteria | 2053 |
| 948 | Ga0496105_0239951 | 3300048908 | Bacteria | 1471 |
| 949 | Ga0496106_0008837 | 3300048909 | Bacteria | 7445 |
| 950 | Ga0496106_0017642 | 3300048909 | Bacteria | 5280 |
| 951 | Ga0496106_0064875 | 3300048909 | Bacteria | 2779 |
| 952 | Ga0496106_0112230 | 3300048909 | Bacteria | 2124 |
| 953 | Ga0496106_0273791 | 3300048909 | Bacteria | 1352 |
| 954 | Ga0496107_0134136 | 3300048910 | Bacteria | 1829 |
| 955 | Ga0496108_0009107 | 3300048911 | Bacteria | 8037 |
| 956 | Ga0496108_0120449 | 3300048911 | Bacteria | 2250 |
| 957 | Ga0496108_0262172 | 3300048911 | Bacteria | 1504 |
| 958 | Ga0496109_0018574 | 3300048912 | Bacteria | 6109 |
| 959 | Ga0496109_0171450 | 3300048912 | Bacteria | 2036 |
| 960 | Ga0496109_0198905 | 3300048912 | Bacteria | 1884 |
| 961 | Ga0496109_0356059 | 3300048912 | Bacteria | 1383 |
| 962 | Ga0496109_0491563 | 3300048912 | Bacteria | 1158 |
| 963 | Ga0496109_0616600 | 3300048912 | Bacteria | 1021 |
| 964 | Ga0496110_0001550 | 3300048913 | Bacteria | 16736 |
| 965 | Ga0496110_0021587 | 3300048913 | Bacteria | 5455 |
| 966 | Ga0496111_0002155 | 3300048914 | Bacteria | 11779 |
| 967 | Ga0496112_0000484 | 3300048915 | Bacteria | 26701 |
| 968 | Ga0496112_0002564 | 3300048915 | Bacteria | 14680 |
| 969 | Ga0496113_0312122 | 3300048916 | Bacteria | 1260 |
| 970 | Ga0496113_0405398 | 3300048916 | Bacteria | 1095 |
| 971 | Ga0496114_0156535 | 3300048917 | Bacteria | 1979 |
| 972 | Ga0496114_0254961 | 3300048917 | Bacteria | 1544 |
| 973 | Ga0496114_0257652 | 3300048917 | Bacteria | 1535 |
| 974 | Ga0496114_0399646 | 3300048917 | Bacteria | 1217 |
| 975 | Ga0496115_0051529 | 3300048918 | Bacteria | 3300 |
| 976 | Ga0496115_0201079 | 3300048918 | Bacteria | 1646 |
| 977 | Ga0496116_0010409 | 3300048919 | Bacteria | 7797 |
| 978 | Ga0496116_0038983 | 3300048919 | Bacteria | 3290 |
| 979 | Ga0496116_0079763 | 3300048919 | Bacteria | 2035 |
| 980 | Ga0496117_0009415 | 3300048920 | Bacteria | 9090 |
| 981 | Ga0496117_0036187 | 3300048920 | Bacteria | 3697 |
| 982 | Ga0496117_0060047 | 3300048920 | Bacteria | 2623 |
| 983 | Ga0496118_0011374 | 3300048921 | Bacteria | 8697 |
| 984 | Ga0496118_0020167 | 3300048921 | Bacteria | 5922 |
| 985 | Ga0496119_0011498 | 3300048922 | Bacteria | 7319 |
| 986 | Ga0496120_0007023 | 3300048923 | Bacteria | 8461 |
| 987 | Ga0496121_0000628 | 3300048924 | Bacteria | 65856 |
| 988 | Ga0496121_0154001 | 3300048924 | Bacteria | 1688 |
| 989 | Ga0496122_0001687 | 3300048925 | Bacteria | 34240 |
| 990 | Ga0496122_0017137 | 3300048925 | Bacteria | 6794 |
| 991 | Ga0496122_0017870 | 3300048925 | Bacteria | 6591 |
| 992 | Ga0496123_0007576 | 3300048926 | Bacteria | 10172 |
| 993 | Ga0496123_0024177 | 3300048926 | Bacteria | 4625 |
| 994 | Ga0496123_0053452 | 3300048926 | Bacteria | 2669 |
| 995 | Ga0496123_0099931 | 3300048926 | Bacteria | 1692 |
| 996 | Ga0496124_0000038 | 3300048927 | Bacteria | 312485 |
| 997 | Ga0496124_0080017 | 3300048927 | Bacteria | 2690 |
| 998 | Ga0496124_0134848 | 3300048927 | Bacteria | 1956 |
| 999 | Ga0496124_0247896 | 3300048927 | Bacteria | 1319 |
| 1000 | Ga0496125_0000101 | 3300048928 | Bacteria | 202248 |
| 1001 | Ga0496125_0002468 | 3300048928 | Bacteria | 24011 |
| 1002 | Ga0496126_0022852 | 3300048929 | Bacteria | 6072 |
| 1003 | Ga0495682_0034033 | 3300049460 | Bacteria | 1880 |
| 1004 | Ga0501032_0119629 | 3300049569 | Bacteria | 1742 |
| 1005 | Ga0501034_0181401 | 3300049571 | Bacteria | 2070 |
| 1006 | Ga0501043_0151525 | 3300049579 | Bacteria | 1815 |
| 1007 | Ga0501069_0361892 | 3300049585 | Unclassified | 856 |
| 1008 | Ga0501035_0005453 | 3300049822 | Bacteria | 12029 |
| 1009 | Ga0501035_0017221 | 3300049822 | Bacteria | 6661 |
| 1010 | Ga0501044_0000617 | 3300049823 | Bacteria | 42992 |
| 1011 | nmdc:mga03683_2310_c1 | 3300050489 | Bacteria | 5904 |
| 1012 | nmdc:mga03n38_163278_c1 | 3300050490 | Bacteria | 1129 |
| 1013 | nmdc:mga00v17_142216_c1 | 3300050491 | Bacteria | 1539 |
| 1014 | nmdc:mga00v17_191249_c1 | 3300050491 | Bacteria | 1322 |
| 1015 | nmdc:mga0k408_21666_c1 | 3300050493 | Bacteria | 3612 |
| 1016 | nmdc:mga0k408_37220_c1 | 3300050493 | Bacteria | 2793 |
| 1017 | nmdc:mga0k408_55853_c2 | 3300050493 | Bacteria | 1392 |
| 1018 | nmdc:mga0k408_61082_c1 | 3300050493 | Bacteria | 2191 |
| 1019 | nmdc:mga06z11_194647_c1 | 3300050494 | Bacteria | 1175 |
| 1020 | nmdc:mga06z11_47515_c1 | 3300050494 | Bacteria | 2180 |
| 1021 | nmdc:mga07m45_106055_c1 | 3300050496 | Bacteria | 1616 |
| 1022 | nmdc:mga07m45_112789_c1 | 3300050496 | Bacteria | 1567 |
| 1023 | nmdc:mga07m45_19464_c1 | 3300050496 | Bacteria | 3679 |
| 1024 | nmdc:mga07m45_2222_c1 | 3300050496 | Bacteria | 9069 |
| 1025 | nmdc:mga07m45_36348_c1 | 3300050496 | Bacteria | 2743 |
| 1026 | nmdc:mga07m45_51032_c1 | 3300050496 | Bacteria | 2332 |
| 1027 | nmdc:mga07m45_9406_c1 | 3300050496 | Bacteria | 5069 |
| 1028 | nmdc:mga05p37_10543_c1 | 3300050507 | Bacteria | 10959 |
| 1029 | nmdc:mga05p37_227233_c1 | 3300050507 | Bacteria | 2250 |
| 1030 | nmdc:mga05p37_347312_c1 | 3300050507 | Bacteria | 1748 |
| 1031 | nmdc:mga05p37_8884_c1 | 3300050507 | Bacteria | 11871 |
| 1032 | nmdc:mga09592_21022_c1 | 3300050508 | Bacteria | 5374 |
| 1033 | nmdc:mga0qj67_154633_c1 | 3300050509 | Unclassified | 1861 |
| 1034 | nmdc:mga06r32_2159_c1 | 3300050510 | Bacteria | 17603 |
| 1035 | nmdc:mga06r32_8090_c1 | 3300050510 | Bacteria | 9460 |
| 1036 | nmdc:mga08y16_7489_c2 | 3300050511 | Bacteria | 10430 |
| 1037 | nmdc:mga08y16_824970_c1 | 3300050511 | Bacteria | 918 |
| 1038 | nmdc:mga0n895_1032_c1 | 3300050512 | Bacteria | 20251 |
| 1039 | nmdc:mga0n895_157502_c1 | 3300050512 | Bacteria | 2302 |
| 1040 | nmdc:mga0n895_302748_c1 | 3300050512 | Bacteria | 1621 |
| 1041 | nmdc:mga0n895_652503_c1 | 3300050512 | Bacteria | 1051 |
| 1042 | nmdc:mga0rr50_1036592_c1 | 3300050513 | Bacteria | 698 |
| 1043 | nmdc:mga0rr50_118270_c1 | 3300050513 | Bacteria | 2106 |
| 1044 | nmdc:mga0rr50_1210_c1 | 3300050513 | Bacteria | 14029 |
| 1045 | nmdc:mga0rr50_2039_c1 | 3300050513 | Bacteria | 11268 |
| 1046 | nmdc:mga0rr50_331479_c1 | 3300050513 | Bacteria | 1278 |
| 1047 | nmdc:mga0rr50_3745_c1 | 3300050513 | Bacteria | 8813 |
| 1048 | nmdc:mga08x19_112554_c1 | 3300050514 | Bacteria | 1817 |
| 1049 | nmdc:mga08x19_115329_c1 | 3300050514 | Bacteria | 1795 |
| 1050 | nmdc:mga08x19_13398_c1 | 3300050514 | Bacteria | 4957 |
| 1051 | nmdc:mga08x19_385097_c1 | 3300050514 | Bacteria | 982 |
| 1052 | nmdc:mga08x19_753068_c1 | 3300050514 | Unclassified | 692 |
| 1053 | nmdc:mga0a205_361352_c1 | 3300050515 | Bacteria | 1318 |
| 1054 | nmdc:mga0a205_45974_c1 | 3300050515 | Bacteria | 4210 |
| 1055 | nmdc:mga0a205_501516_c1 | 3300050515 | Bacteria | 1071 |
| 1056 | nmdc:mga0a205_834_c1 | 3300050515 | Bacteria | 25152 |
| 1057 | nmdc:mga0a205_85266_c1 | 3300050515 | Bacteria | 3051 |
| 1058 | nmdc:mga0a205_97803_c1 | 3300050515 | Bacteria | 2834 |
| 1059 | nmdc:mga0sz30_82364_c1 | 3300050516 | Bacteria | 784 |
| 1060 | Ga0495601_0169730 | 3300053077 | Bacteria | 1426 |
| 1061 | Ga0500610_0041935 | 3300053079 | Bacteria | 2367 |
| 1062 | Ga0495619_0010470 | 3300053085 | Bacteria | 5832 |
| 1063 | Ga0500578_0025790 | 3300053086 | Bacteria | 3770 |
| 1064 | Ga0500644_0028309 | 3300053088 | Bacteria | 1751 |
| 1065 | Ga0500651_0076426 | 3300053093 | Bacteria | 2079 |
| 1066 | Ga0500641_0011423 | 3300053096 | Bacteria | 3223 |
| 1067 | Ga0500562_064494 | 3300053108 | Bacteria | 986 |
| 1068 | Ga0500569_035158 | 3300053109 | Bacteria | 1435 |
| 1069 | Ga0500593_000470 | 3300053117 | Bacteria | 16048 |
| 1070 | Ga0500593_000946 | 3300053117 | Bacteria | 10692 |
| 1071 | Ga0500594_0003238 | 3300053118 | Bacteria | 3566 |
| 1072 | Ga0500607_000025 | 3300053121 | Bacteria | 95473 |
| 1073 | Ga0500607_036582 | 3300053121 | Bacteria | 2680 |
| 1074 | Ga0500608_000731 | 3300053122 | Bacteria | 11996 |
| 1075 | Ga0500608_161797 | 3300053122 | Bacteria | 969 |
| 1076 | Ga0500614_015886 | 3300053123 | Bacteria | 1683 |
| 1077 | Ga0500628_003649 | 3300053129 | Bacteria | 2543 |
| 1078 | Ga0500642_0009522 | 3300053130 | Bacteria | 3376 |
| 1079 | Ga0500652_095950 | 3300053131 | Bacteria | 1238 |
| 1080 | Ga0500658_0012428 | 3300053134 | Bacteria | 3142 |
| 1081 | Ga0500559_0000326 | 3300053136 | Bacteria | 35945 |
| 1082 | Ga0500559_0040466 | 3300053136 | Bacteria | 2029 |
| 1083 | Ga0500568_0095497 | 3300053139 | Bacteria | 1118 |
| 1084 | Ga0500574_054975 | 3300053141 | Bacteria | 1146 |
| 1085 | Ga0500616_0060192 | 3300053153 | Bacteria | 1970 |
| 1086 | Ga0500619_018760 | 3300053154 | Bacteria | 1949 |
| 1087 | Ga0500622_0004224 | 3300053156 | Bacteria | 9145 |
| 1088 | Ga0500624_004850 | 3300053157 | Bacteria | 1778 |
| 1089 | Ga0500627_0025325 | 3300053158 | Bacteria | 2437 |
| 1090 | Ga0500627_0039467 | 3300053158 | Bacteria | 2021 |
| 1091 | Ga0500636_0085747 | 3300053177 | Bacteria | 1809 |
| 1092 | Ga0500645_005314 | 3300053730 | Bacteria | 4767 |
| 1093 | Ga0500645_006086 | 3300053730 | Bacteria | 4350 |
| 1094 | Ga0500587_000798 | 3300053739 | Bacteria | 4103 |
| 1095 | Ga0501082_0000460 | 3300060353 | Bacteria | 35943 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100158407 | Ga0070708_1001584072 | 199 |
| 2 | 3300005327 | Ga0070658_10085564 | Ga0070658_100855643 | 201 |
| 3 | 3300005435 | Ga0070714_100482821 | Ga0070714_1004828212 | 202 |
| 4 | 3300006028 | Ga0070717_10160156 | Ga0070717_101601563 | 202 |
| 5 | 3300006358 | Ga0068871_100254010 | Ga0068871_1002540102 | 204 |
| 6 | 3300048916 | Ga0496113_0405398 | Ga0496113_0405398_344_1069 | 204 |
| 7 | 3300048912 | Ga0496109_0171450 | Ga0496109_0171450_10_651 | 205 |
| 8 | 3300053108 | Ga0500562_064494 | Ga0500562_064494_353_970 | 205 |
| 9 | 3300005327 | Ga0070658_10023452 | Ga0070658_100234522 | 206 |
| 10 | 3300005336 | Ga0070680_100114148 | Ga0070680_1001141482 | 206 |
| 11 | 3300005366 | Ga0070659_100025142 | Ga0070659_1000251422 | 206 |
| 12 | 3300005455 | Ga0070663_100007766 | Ga0070663_1000077663 | 206 |
| 13 | 3300005535 | Ga0070684_100032906 | Ga0070684_1000329063 | 206 |
| 14 | 3300005539 | Ga0068853_100006747 | Ga0068853_1000067476 | 206 |
| 15 | 3300005547 | Ga0070693_100191343 | Ga0070693_1001913432 | 206 |
| 16 | 3300005578 | Ga0068854_100010442 | Ga0068854_1000104425 | 206 |
| 17 | 3300005614 | Ga0068856_100094449 | Ga0068856_1000944492 | 206 |
| 18 | 3300005834 | Ga0068851_10000574 | Ga0068851_100005743 | 206 |
| 19 | 3300009545 | Ga0105237_10057988 | Ga0105237_100579883 | 206 |
| 20 | 3300009551 | Ga0105238_10601223 | Ga0105238_106012232 | 206 |
| 21 | 3300013100 | Ga0157373_10003095 | Ga0157373_100030956 | 206 |
| 22 | 3300013102 | Ga0157371_10014516 | Ga0157371_100145167 | 206 |
| 23 | 3300013306 | Ga0163162_10487444 | Ga0163162_104874442 | 206 |
| 24 | 3300025321 | Ga0207656_10029837 | Ga0207656_100298372 | 206 |
| 25 | 3300025909 | Ga0207705_10429602 | Ga0207705_104296022 | 206 |
| 26 | 3300025912 | Ga0207707_10026758 | Ga0207707_100267586 | 206 |
| 27 | 3300025913 | Ga0207695_10043580 | Ga0207695_100435805 | 206 |
| 28 | 3300025917 | Ga0207660_10016888 | Ga0207660_100168886 | 206 |
| 29 | 3300025919 | Ga0207657_10028035 | Ga0207657_100280352 | 206 |
| 30 | 3300025921 | Ga0207652_10462430 | Ga0207652_104624302 | 206 |
| 31 | 3300025924 | Ga0207694_10038219 | Ga0207694_100382194 | 206 |
| 32 | 3300025929 | Ga0207664_10028724 | Ga0207664_100287243 | 206 |
| 33 | 3300025944 | Ga0207661_10019681 | Ga0207661_100196816 | 206 |
| 34 | 3300025945 | Ga0207679_10046935 | Ga0207679_100469354 | 206 |
| 35 | 3300025949 | Ga0207667_10006229 | Ga0207667_100062296 | 206 |
| 36 | 3300026041 | Ga0207639_10014598 | Ga0207639_100145982 | 206 |
| 37 | 3300026067 | Ga0207678_10015548 | Ga0207678_100155481 | 206 |
| 38 | 3300026116 | Ga0207674_10000253 | Ga0207674_1000025359 | 206 |
| 39 | 3300026142 | Ga0207698_10059417 | Ga0207698_100594172 | 206 |
| 40 | 3300010375 | Ga0105239_10045063 | Ga0105239_100450636 | 207 |
| 41 | 3300007265 | Ga0099794_10196723 | Ga0099794_101967232 | 208 |
| 42 | 3300039437 | Ga0436365_0234696 | Ga0436365_0234696_2184_2843 | 208 |
| 43 | 3300046528 | Ga0495642_0041217 | Ga0495642_0041217_630_1289 | 208 |
| 44 | 3300006847 | Ga0075431_100133961 | Ga0075431_1001339613 | 209 |
| 45 | 3300014325 | Ga0163163_10247821 | Ga0163163_102478212 | 209 |
| 46 | 3300048903 | Ga0496100_0313655 | Ga0496100_0313655_440_1099 | 209 |
| 47 | 3300053158 | Ga0500627_0025325 | Ga0500627_0025325_1088_1747 | 209 |
| 48 | 3300060353 | Ga0501082_0000460 | Ga0501082_0000460_14442_15101 | 209 |
| 49 | 3300005842 | Ga0068858_100038836 | Ga0068858_1000388362 | 210 |
| 50 | 3300014968 | Ga0157379_10057344 | Ga0157379_100573445 | 210 |
| 51 | 3300025986 | Ga0207658_10100268 | Ga0207658_101002683 | 210 |
| 52 | 3300026035 | Ga0207703_10196401 | Ga0207703_101964012 | 210 |
| 53 | 3300031456 | Ga0307513_10502329 | Ga0307513_105023292 | 210 |
| 54 | 3300005290 | Ga0065712_10139642 | Ga0065712_101396422 | 211 |
| 55 | 3300005293 | Ga0065715_10029996 | Ga0065715_100299962 | 211 |
| 56 | 3300005327 | Ga0070658_10366548 | Ga0070658_103665482 | 211 |
| 57 | 3300005329 | Ga0070683_100017860 | Ga0070683_1000178602 | 211 |
| 58 | 3300005331 | Ga0070670_100108358 | Ga0070670_1001083583 | 211 |
| 59 | 3300005333 | Ga0070677_10090197 | Ga0070677_100901971 | 211 |
| 60 | 3300005334 | Ga0068869_100023109 | Ga0068869_1000231092 | 211 |
| 61 | 3300005344 | Ga0070661_100134314 | Ga0070661_1001343143 | 211 |
| 62 | 3300005353 | Ga0070669_100113971 | Ga0070669_1001139713 | 211 |
| 63 | 3300005354 | Ga0070675_100073164 | Ga0070675_1000731643 | 211 |
| 64 | 3300005355 | Ga0070671_100006670 | Ga0070671_1000066701 | 211 |
| 65 | 3300005355 | Ga0070671_100331127 | Ga0070671_1003311272 | 211 |
| 66 | 3300005365 | Ga0070688_100141545 | Ga0070688_1001415451 | 211 |
| 67 | 3300005367 | Ga0070667_100065001 | Ga0070667_1000650012 | 211 |
| 68 | 3300005441 | Ga0070700_100041397 | Ga0070700_1000413974 | 211 |
| 69 | 3300005457 | Ga0070662_100092227 | Ga0070662_1000922272 | 211 |
| 70 | 3300005466 | Ga0070685_10016145 | Ga0070685_100161452 | 211 |
| 71 | 3300005468 | Ga0070707_100511758 | Ga0070707_1005117582 | 211 |
| 72 | 3300005468 | Ga0070707_100763286 | Ga0070707_1007632862 | 211 |
| 73 | 3300005543 | Ga0070672_100011101 | Ga0070672_1000111016 | 211 |
| 74 | 3300005546 | Ga0070696_100074437 | Ga0070696_1000744372 | 211 |
| 75 | 3300005548 | Ga0070665_100434151 | Ga0070665_1004341512 | 211 |
| 76 | 3300005564 | Ga0070664_100197339 | Ga0070664_1001973392 | 211 |
| 77 | 3300005616 | Ga0068852_100218881 | Ga0068852_1002188812 | 211 |
| 78 | 3300005617 | Ga0068859_100363034 | Ga0068859_1003630342 | 211 |
| 79 | 3300005618 | Ga0068864_100009580 | Ga0068864_10000958010 | 211 |
| 80 | 3300005719 | Ga0068861_100373578 | Ga0068861_1003735782 | 211 |
| 81 | 3300005840 | Ga0068870_10038013 | Ga0068870_100380133 | 211 |
| 82 | 3300005844 | Ga0068862_100013943 | Ga0068862_1000139435 | 211 |
| 83 | 3300006173 | Ga0070716_100012365 | Ga0070716_1000123654 | 211 |
| 84 | 3300006852 | Ga0075433_10531303 | Ga0075433_105313032 | 211 |
| 85 | 3300006871 | Ga0075434_100506023 | Ga0075434_1005060232 | 211 |
| 86 | 3300006871 | Ga0075434_101116484 | Ga0075434_1011164841 | 211 |
| 87 | 3300006914 | Ga0075436_100083211 | Ga0075436_1000832112 | 211 |
| 88 | 3300006931 | Ga0097620_100363051 | Ga0097620_1003630512 | 211 |
| 89 | 3300007265 | Ga0099794_10020806 | Ga0099794_100208063 | 211 |
| 90 | 3300009177 | Ga0105248_10000918 | Ga0105248_1000091820 | 211 |
| 91 | 3300013296 | Ga0157374_10016654 | Ga0157374_100166542 | 211 |
| 92 | 3300013296 | Ga0157374_10194123 | Ga0157374_101941232 | 211 |
| 93 | 3300014745 | Ga0157377_10000479 | Ga0157377_100004792 | 211 |
| 94 | 3300014968 | Ga0157379_10054468 | Ga0157379_100544681 | 211 |
| 95 | 3300025315 | Ga0207697_10000793 | Ga0207697_1000079314 | 211 |
| 96 | 3300025893 | Ga0207682_10004865 | Ga0207682_100048653 | 211 |
| 97 | 3300025901 | Ga0207688_10066617 | Ga0207688_100666172 | 211 |
| 98 | 3300025903 | Ga0207680_10037749 | Ga0207680_100377493 | 211 |
| 99 | 3300025904 | Ga0207647_10279639 | Ga0207647_102796391 | 211 |
| 100 | 3300025910 | Ga0207684_10093773 | Ga0207684_100937732 | 211 |
| 101 | 3300025918 | Ga0207662_10039183 | Ga0207662_100391832 | 211 |
| 102 | 3300025919 | Ga0207657_10015295 | Ga0207657_100152957 | 211 |
| 103 | 3300025925 | Ga0207650_10221992 | Ga0207650_102219921 | 211 |
| 104 | 3300025931 | Ga0207644_10064191 | Ga0207644_100641914 | 211 |
| 105 | 3300025931 | Ga0207644_10350683 | Ga0207644_103506832 | 211 |
| 106 | 3300025939 | Ga0207665_10018074 | Ga0207665_100180743 | 211 |
| 107 | 3300025940 | Ga0207691_10020307 | Ga0207691_100203075 | 211 |
| 108 | 3300025941 | Ga0207711_10002156 | Ga0207711_1000215611 | 211 |
| 109 | 3300025941 | Ga0207711_10235428 | Ga0207711_102354282 | 211 |
| 110 | 3300025942 | Ga0207689_10581972 | Ga0207689_105819721 | 211 |
| 111 | 3300025945 | Ga0207679_10607263 | Ga0207679_106072632 | 211 |
| 112 | 3300025960 | Ga0207651_10046180 | Ga0207651_100461804 | 211 |
| 113 | 3300026023 | Ga0207677_10078784 | Ga0207677_100787842 | 211 |
| 114 | 3300026067 | Ga0207678_10002599 | Ga0207678_1000259920 | 211 |
| 115 | 3300026095 | Ga0207676_10035603 | Ga0207676_100356033 | 211 |
| 116 | 3300026116 | Ga0207674_10001083 | Ga0207674_1000108322 | 211 |
| 117 | 3300026118 | Ga0207675_100000626 | Ga0207675_10000062618 | 211 |
| 118 | 3300028380 | Ga0268265_10214236 | Ga0268265_102142363 | 211 |
| 119 | 3300041486 | Ga0451807_1842326 | Ga0451807_1842326_139_798 | 211 |
| 120 | 3300044673 | Ga0453683_0039914 | Ga0453683_0039914_529_1188 | 211 |
| 121 | 3300046674 | Ga0495588_0200652 | Ga0495588_0200652_336_995 | 211 |
| 122 | 3300048904 | Ga0496101_0169288 | Ga0496101_0169288_767_1519 | 211 |
| 123 | 3300048907 | Ga0496104_0104566 | Ga0496104_0104566_109_768 | 211 |
| 124 | 3300048908 | Ga0496105_0132608 | Ga0496105_0132608_1250_2002 | 211 |
| 125 | 3300048909 | Ga0496106_0064875 | Ga0496106_0064875_296_955 | 211 |
| 126 | 3300048910 | Ga0496107_0134136 | Ga0496107_0134136_69_728 | 211 |
| 127 | 3300048911 | Ga0496108_0009107 | Ga0496108_0009107_199_858 | 211 |
| 128 | 3300048913 | Ga0496110_0021587 | Ga0496110_0021587_719_1378 | 211 |
| 129 | 3300048917 | Ga0496114_0399646 | Ga0496114_0399646_526_1185 | 211 |
| 130 | 3300050507 | nmdc:mga05p37_347312_c1 | nmdc:mga05p37_347312_c1_804_1463 | 211 |
| 131 | 3300050512 | nmdc:mga0n895_652503_c1 | nmdc:mga0n895_652503_c1_272_931 | 211 |
| 132 | 3300050513 | nmdc:mga0rr50_331479_c1 | nmdc:mga0rr50_331479_c1_502_1161 | 211 |
| 133 | 3300050514 | nmdc:mga08x19_753068_c1 | nmdc:mga08x19_753068_c1_13_672 | 211 |
| 134 | 3300050515 | nmdc:mga0a205_501516_c1 | nmdc:mga0a205_501516_c1_379_1038 | 211 |
| 135 | 3300050515 | nmdc:mga0a205_97803_c1 | nmdc:mga0a205_97803_c1_1538_2197 | 211 |
| 136 | 3300005328 | Ga0070676_10080157 | Ga0070676_100801572 | 212 |
| 137 | 3300005330 | Ga0070690_100047354 | Ga0070690_1000473543 | 212 |
| 138 | 3300005331 | Ga0070670_100015560 | Ga0070670_1000155604 | 212 |
| 139 | 3300005331 | Ga0070670_100061667 | Ga0070670_1000616674 | 212 |
| 140 | 3300005333 | Ga0070677_10255358 | Ga0070677_102553581 | 212 |
| 141 | 3300005334 | Ga0068869_100310054 | Ga0068869_1003100541 | 212 |
| 142 | 3300005347 | Ga0070668_100010699 | Ga0070668_1000106999 | 212 |
| 143 | 3300005347 | Ga0070668_100210502 | Ga0070668_1002105022 | 212 |
| 144 | 3300005353 | Ga0070669_100084149 | Ga0070669_1000841492 | 212 |
| 145 | 3300005354 | Ga0070675_100012243 | Ga0070675_1000122432 | 212 |
| 146 | 3300005354 | Ga0070675_100012605 | Ga0070675_1000126054 | 212 |
| 147 | 3300005356 | Ga0070674_100787867 | Ga0070674_1007878671 | 212 |
| 148 | 3300005364 | Ga0070673_100028796 | Ga0070673_1000287964 | 212 |
| 149 | 3300005364 | Ga0070673_100098621 | Ga0070673_1000986213 | 212 |
| 150 | 3300005366 | Ga0070659_100009634 | Ga0070659_1000096348 | 212 |
| 151 | 3300005406 | Ga0070703_10032329 | Ga0070703_100323292 | 212 |
| 152 | 3300005434 | Ga0070709_10187448 | Ga0070709_101874482 | 212 |
| 153 | 3300005436 | Ga0070713_100000018 | Ga0070713_10000001820 | 212 |
| 154 | 3300005441 | Ga0070700_100221428 | Ga0070700_1002214282 | 212 |
| 155 | 3300005457 | Ga0070662_100407611 | Ga0070662_1004076111 | 212 |
| 156 | 3300005459 | Ga0068867_100041932 | Ga0068867_1000419321 | 212 |
| 157 | 3300005459 | Ga0068867_100123023 | Ga0068867_1001230233 | 212 |
| 158 | 3300005543 | Ga0070672_100003389 | Ga0070672_1000033892 | 212 |
| 159 | 3300005546 | Ga0070696_100332829 | Ga0070696_1003328292 | 212 |
| 160 | 3300005563 | Ga0068855_100011108 | Ga0068855_10001110810 | 212 |
| 161 | 3300005614 | Ga0068856_100261514 | Ga0068856_1002615142 | 212 |
| 162 | 3300005615 | Ga0070702_100053956 | Ga0070702_1000539562 | 212 |
| 163 | 3300005616 | Ga0068852_100154509 | Ga0068852_1001545093 | 212 |
| 164 | 3300005618 | Ga0068864_100004987 | Ga0068864_1000049875 | 212 |
| 165 | 3300005618 | Ga0068864_100070196 | Ga0068864_1000701962 | 212 |
| 166 | 3300005718 | Ga0068866_10030573 | Ga0068866_100305732 | 212 |
| 167 | 3300005841 | Ga0068863_100002646 | Ga0068863_1000026463 | 212 |
| 168 | 3300005843 | Ga0068860_100193385 | Ga0068860_1001933851 | 212 |
| 169 | 3300005844 | Ga0068862_100002912 | Ga0068862_1000029127 | 212 |
| 170 | 3300005844 | Ga0068862_100171632 | Ga0068862_1001716322 | 212 |
| 171 | 3300006175 | Ga0070712_100294192 | Ga0070712_1002941922 | 212 |
| 172 | 3300006237 | Ga0097621_100078767 | Ga0097621_1000787673 | 212 |
| 173 | 3300006237 | Ga0097621_100488748 | Ga0097621_1004887482 | 212 |
| 174 | 3300006358 | Ga0068871_100282397 | Ga0068871_1002823972 | 212 |
| 175 | 3300009094 | Ga0111539_10043530 | Ga0111539_100435307 | 212 |
| 176 | 3300009101 | Ga0105247_10433814 | Ga0105247_104338142 | 212 |
| 177 | 3300009148 | Ga0105243_10115449 | Ga0105243_101154492 | 212 |
| 178 | 3300009177 | Ga0105248_10088978 | Ga0105248_100889784 | 212 |
| 179 | 3300013105 | Ga0157369_10181978 | Ga0157369_101819782 | 212 |
| 180 | 3300013306 | Ga0163162_10071092 | Ga0163162_100710922 | 212 |
| 181 | 3300013308 | Ga0157375_10022136 | Ga0157375_100221364 | 212 |
| 182 | 3300014325 | Ga0163163_10022110 | Ga0163163_100221105 | 212 |
| 183 | 3300014325 | Ga0163163_10119519 | Ga0163163_101195194 | 212 |
| 184 | 3300014326 | Ga0157380_10069858 | Ga0157380_100698582 | 212 |
| 185 | 3300014326 | Ga0157380_10249992 | Ga0157380_102499923 | 212 |
| 186 | 3300017792 | Ga0163161_10053380 | Ga0163161_100533803 | 212 |
| 187 | 3300025885 | Ga0207653_10010810 | Ga0207653_100108104 | 212 |
| 188 | 3300025906 | Ga0207699_10116473 | Ga0207699_101164732 | 212 |
| 189 | 3300025910 | Ga0207684_10001487 | Ga0207684_100014874 | 212 |
| 190 | 3300025910 | Ga0207684_10220121 | Ga0207684_102201212 | 212 |
| 191 | 3300025916 | Ga0207663_10148031 | Ga0207663_101480312 | 212 |
| 192 | 3300025922 | Ga0207646_10004214 | Ga0207646_100042145 | 212 |
| 193 | 3300025923 | Ga0207681_10026046 | Ga0207681_100260463 | 212 |
| 194 | 3300025925 | Ga0207650_10017066 | Ga0207650_100170662 | 212 |
| 195 | 3300025925 | Ga0207650_10090137 | Ga0207650_100901372 | 212 |
| 196 | 3300025925 | Ga0207650_10129451 | Ga0207650_101294512 | 212 |
| 197 | 3300025926 | Ga0207659_10003096 | Ga0207659_100030967 | 212 |
| 198 | 3300025926 | Ga0207659_10030578 | Ga0207659_100305782 | 212 |
| 199 | 3300025928 | Ga0207700_10000234 | Ga0207700_100002344 | 212 |
| 200 | 3300025931 | Ga0207644_10329359 | Ga0207644_103293592 | 212 |
| 201 | 3300025933 | Ga0207706_10001560 | Ga0207706_100015608 | 212 |
| 202 | 3300025936 | Ga0207670_10269320 | Ga0207670_102693202 | 212 |
| 203 | 3300025939 | Ga0207665_10118506 | Ga0207665_101185062 | 212 |
| 204 | 3300025940 | Ga0207691_10003525 | Ga0207691_100035259 | 212 |
| 205 | 3300025940 | Ga0207691_10016744 | Ga0207691_100167445 | 212 |
| 206 | 3300025941 | Ga0207711_10051870 | Ga0207711_100518702 | 212 |
| 207 | 3300025942 | Ga0207689_10000387 | Ga0207689_100003873 | 212 |
| 208 | 3300025942 | Ga0207689_10160331 | Ga0207689_101603313 | 212 |
| 209 | 3300025942 | Ga0207689_10202613 | Ga0207689_102026132 | 212 |
| 210 | 3300025945 | Ga0207679_10103946 | Ga0207679_101039462 | 212 |
| 211 | 3300025949 | Ga0207667_11041048 | Ga0207667_110410481 | 212 |
| 212 | 3300025960 | Ga0207651_10065137 | Ga0207651_100651372 | 212 |
| 213 | 3300025972 | Ga0207668_10180203 | Ga0207668_101802031 | 212 |
| 214 | 3300025972 | Ga0207668_10253086 | Ga0207668_102530862 | 212 |
| 215 | 3300025972 | Ga0207668_10301092 | Ga0207668_103010922 | 212 |
| 216 | 3300026035 | Ga0207703_10454968 | Ga0207703_104549682 | 212 |
| 217 | 3300026075 | Ga0207708_10003210 | Ga0207708_1000321010 | 212 |
| 218 | 3300026075 | Ga0207708_10265279 | Ga0207708_102652792 | 212 |
| 219 | 3300026078 | Ga0207702_10595189 | Ga0207702_105951892 | 212 |
| 220 | 3300026088 | Ga0207641_10004076 | Ga0207641_100040763 | 212 |
| 221 | 3300026089 | Ga0207648_10042274 | Ga0207648_100422742 | 212 |
| 222 | 3300026089 | Ga0207648_10059445 | Ga0207648_100594452 | 212 |
| 223 | 3300026095 | Ga0207676_10056995 | Ga0207676_100569952 | 212 |
| 224 | 3300026095 | Ga0207676_10076241 | Ga0207676_100762413 | 212 |
| 225 | 3300026116 | Ga0207674_10201300 | Ga0207674_102013002 | 212 |
| 226 | 3300026118 | Ga0207675_100034352 | Ga0207675_1000343522 | 212 |
| 227 | 3300026118 | Ga0207675_100314001 | Ga0207675_1003140012 | 212 |
| 228 | 3300026121 | Ga0207683_10005814 | Ga0207683_1000581410 | 212 |
| 229 | 3300028380 | Ga0268265_10043011 | Ga0268265_100430113 | 212 |
| 230 | 3300028381 | Ga0268264_10176663 | Ga0268264_101766632 | 212 |
| 231 | 3300028381 | Ga0268264_10931530 | Ga0268264_109315301 | 212 |
| 232 | 3300035117 | Ga0373953_0142511 | Ga0373953_0142511_203_862 | 212 |
| 233 | 3300035692 | Ga0373935_0783590 | Ga0373935_0783590_23_682 | 212 |
| 234 | 3300036401 | Ga0373937_0057274 | Ga0373937_0057274_1151_1810 | 212 |
| 235 | 3300042876 | Ga0451577_0030876 | Ga0451577_0030876_4066_4725 | 212 |
| 236 | 3300044673 | Ga0453683_0015585 | Ga0453683_0015585_684_1343 | 212 |
| 237 | 3300044712 | Ga0453684_0076543 | Ga0453684_0076543_3285_3944 | 212 |
| 238 | 3300050507 | nmdc:mga05p37_227233_c1 | nmdc:mga05p37_227233_c1_1468_2127 | 212 |
| 239 | 3300050513 | nmdc:mga0rr50_118270_c1 | nmdc:mga0rr50_118270_c1_92_751 | 212 |
| 240 | 3300050514 | nmdc:mga08x19_112554_c1 | nmdc:mga08x19_112554_c1_768_1427 | 212 |
| 241 | 3300050515 | nmdc:mga0a205_85266_c1 | nmdc:mga0a205_85266_c1_92_751 | 212 |
| 242 | 3300005334 | Ga0068869_100324701 | Ga0068869_1003247012 | 213 |
| 243 | 3300005338 | Ga0068868_100006699 | Ga0068868_1000066998 | 213 |
| 244 | 3300005355 | Ga0070671_100054790 | Ga0070671_1000547902 | 213 |
| 245 | 3300005355 | Ga0070671_100061058 | Ga0070671_1000610582 | 213 |
| 246 | 3300005439 | Ga0070711_100011188 | Ga0070711_1000111881 | 213 |
| 247 | 3300005459 | Ga0068867_100222844 | Ga0068867_1002228442 | 213 |
| 248 | 3300005467 | Ga0070706_100569405 | Ga0070706_1005694052 | 213 |
| 249 | 3300005468 | Ga0070707_100014859 | Ga0070707_1000148592 | 213 |
| 250 | 3300005468 | Ga0070707_100391099 | Ga0070707_1003910992 | 213 |
| 251 | 3300005471 | Ga0070698_100027258 | Ga0070698_1000272589 | 213 |
| 252 | 3300005471 | Ga0070698_100537725 | Ga0070698_1005377252 | 213 |
| 253 | 3300005518 | Ga0070699_100018721 | Ga0070699_1000187212 | 213 |
| 254 | 3300005518 | Ga0070699_100270239 | Ga0070699_1002702392 | 213 |
| 255 | 3300005536 | Ga0070697_100012228 | Ga0070697_1000122283 | 213 |
| 256 | 3300005536 | Ga0070697_100034401 | Ga0070697_1000344012 | 213 |
| 257 | 3300005549 | Ga0070704_100755110 | Ga0070704_1007551101 | 213 |
| 258 | 3300005617 | Ga0068859_100785938 | Ga0068859_1007859382 | 213 |
| 259 | 3300005841 | Ga0068863_100163531 | Ga0068863_1001635312 | 213 |
| 260 | 3300005841 | Ga0068863_100376061 | Ga0068863_1003760612 | 213 |
| 261 | 3300006175 | Ga0070712_100002661 | Ga0070712_1000026613 | 213 |
| 262 | 3300006844 | Ga0075428_100009152 | Ga0075428_10000915210 | 213 |
| 263 | 3300006847 | Ga0075431_100008054 | Ga0075431_10000805411 | 213 |
| 264 | 3300006852 | Ga0075433_10066103 | Ga0075433_100661032 | 213 |
| 265 | 3300006852 | Ga0075433_10209260 | Ga0075433_102092603 | 213 |
| 266 | 3300006880 | Ga0075429_100015645 | Ga0075429_1000156452 | 213 |
| 267 | 3300006880 | Ga0075429_100118770 | Ga0075429_1001187702 | 213 |
| 268 | 3300006914 | Ga0075436_100052689 | Ga0075436_1000526893 | 213 |
| 269 | 3300006931 | Ga0097620_100785884 | Ga0097620_1007858842 | 213 |
| 270 | 3300007076 | Ga0075435_100449259 | Ga0075435_1004492592 | 213 |
| 271 | 3300007076 | Ga0075435_100500504 | Ga0075435_1005005042 | 213 |
| 272 | 3300007265 | Ga0099794_10017711 | Ga0099794_100177112 | 213 |
| 273 | 3300007265 | Ga0099794_10067732 | Ga0099794_100677322 | 213 |
| 274 | 3300009094 | Ga0111539_10958203 | Ga0111539_109582032 | 213 |
| 275 | 3300009147 | Ga0114129_10015344 | Ga0114129_1001534410 | 213 |
| 276 | 3300009147 | Ga0114129_10554708 | Ga0114129_105547082 | 213 |
| 277 | 3300009553 | Ga0105249_10176225 | Ga0105249_101762251 | 213 |
| 278 | 3300013296 | Ga0157374_11125232 | Ga0157374_111252321 | 213 |
| 279 | 3300013297 | Ga0157378_10021940 | Ga0157378_100219405 | 213 |
| 280 | 3300013297 | Ga0157378_10148252 | Ga0157378_101482523 | 213 |
| 281 | 3300025906 | Ga0207699_10104396 | Ga0207699_101043962 | 213 |
| 282 | 3300025910 | Ga0207684_10000972 | Ga0207684_1000097215 | 213 |
| 283 | 3300025910 | Ga0207684_10008646 | Ga0207684_100086469 | 213 |
| 284 | 3300025915 | Ga0207693_10010581 | Ga0207693_100105814 | 213 |
| 285 | 3300025922 | Ga0207646_10011235 | Ga0207646_1001123510 | 213 |
| 286 | 3300025922 | Ga0207646_10012388 | Ga0207646_100123883 | 213 |
| 287 | 3300025925 | Ga0207650_10005969 | Ga0207650_100059698 | 213 |
| 288 | 3300025931 | Ga0207644_10074790 | Ga0207644_100747903 | 213 |
| 289 | 3300025931 | Ga0207644_10101583 | Ga0207644_101015832 | 213 |
| 290 | 3300025933 | Ga0207706_10047120 | Ga0207706_100471204 | 213 |
| 291 | 3300026023 | Ga0207677_10020540 | Ga0207677_100205402 | 213 |
| 292 | 3300026088 | Ga0207641_10018826 | Ga0207641_100188263 | 213 |
| 293 | 3300026089 | Ga0207648_10237708 | Ga0207648_102377082 | 213 |
| 294 | 3300026095 | Ga0207676_10108320 | Ga0207676_101083202 | 213 |
| 295 | 3300026121 | Ga0207683_10168489 | Ga0207683_101684892 | 213 |
| 296 | 3300026121 | Ga0207683_10931438 | Ga0207683_109314381 | 213 |
| 297 | 3300027671 | Ga0209588_1032409 | Ga0209588_10324091 | 213 |
| 298 | 3300035118 | Ga0373954_0033876 | Ga0373954_0033876_189_848 | 213 |
| 299 | 3300035119 | Ga0373956_0081633 | Ga0373956_0081633_204_863 | 213 |
| 300 | 3300035724 | Ga0373933_0102376 | Ga0373933_0102376_331_990 | 213 |
| 301 | 3300046663 | Ga0495635_0255909 | Ga0495635_0255909_263_922 | 213 |
| 302 | 3300050507 | nmdc:mga05p37_10543_c1 | nmdc:mga05p37_10543_c1_4636_5295 | 213 |
| 303 | 3300050508 | nmdc:mga09592_21022_c1 | nmdc:mga09592_21022_c1_4634_5293 | 213 |
| 304 | 3300050510 | nmdc:mga06r32_2159_c1 | nmdc:mga06r32_2159_c1_16566_17225 | 213 |
| 305 | 3300050511 | nmdc:mga08y16_824970_c1 | nmdc:mga08y16_824970_c1_48_707 | 213 |
| 306 | 3300050512 | nmdc:mga0n895_1032_c1 | nmdc:mga0n895_1032_c1_88_747 | 213 |
| 307 | 3300050512 | nmdc:mga0n895_302748_c1 | nmdc:mga0n895_302748_c1_299_958 | 213 |
| 308 | 3300050513 | nmdc:mga0rr50_1210_c1 | nmdc:mga0rr50_1210_c1_425_1084 | 213 |
| 309 | 3300050513 | nmdc:mga0rr50_2039_c1 | nmdc:mga0rr50_2039_c1_36_695 | 213 |
| 310 | 3300050514 | nmdc:mga08x19_13398_c1 | nmdc:mga08x19_13398_c1_1341_2000 | 213 |
| 311 | 3300050515 | nmdc:mga0a205_45974_c1 | nmdc:mga0a205_45974_c1_2880_3539 | 213 |
| 312 | 3300050515 | nmdc:mga0a205_834_c1 | nmdc:mga0a205_834_c1_14258_14917 | 213 |
| 313 | 3300053141 | Ga0500574_054975 | Ga0500574_054975_118_777 | 213 |
| 314 | 3300005328 | Ga0070676_10582460 | Ga0070676_105824601 | 214 |
| 315 | 3300005329 | Ga0070683_100118762 | Ga0070683_1001187622 | 214 |
| 316 | 3300005337 | Ga0070682_100088725 | Ga0070682_1000887252 | 214 |
| 317 | 3300005339 | Ga0070660_100014237 | Ga0070660_1000142377 | 214 |
| 318 | 3300005344 | Ga0070661_100002482 | Ga0070661_1000024829 | 214 |
| 319 | 3300005345 | Ga0070692_10160889 | Ga0070692_101608892 | 214 |
| 320 | 3300005353 | Ga0070669_100267640 | Ga0070669_1002676402 | 214 |
| 321 | 3300005354 | Ga0070675_100089289 | Ga0070675_1000892893 | 214 |
| 322 | 3300005364 | Ga0070673_100638515 | Ga0070673_1006385151 | 214 |
| 323 | 3300005366 | Ga0070659_100002063 | Ga0070659_1000020636 | 214 |
| 324 | 3300005435 | Ga0070714_100002832 | Ga0070714_1000028328 | 214 |
| 325 | 3300005436 | Ga0070713_100057945 | Ga0070713_1000579452 | 214 |
| 326 | 3300005455 | Ga0070663_100198919 | Ga0070663_1001989192 | 214 |
| 327 | 3300005456 | Ga0070678_100024049 | Ga0070678_1000240492 | 214 |
| 328 | 3300005457 | Ga0070662_100243915 | Ga0070662_1002439152 | 214 |
| 329 | 3300005459 | Ga0068867_100018676 | Ga0068867_1000186763 | 214 |
| 330 | 3300005471 | Ga0070698_100378755 | Ga0070698_1003787551 | 214 |
| 331 | 3300005530 | Ga0070679_100064406 | Ga0070679_1000644064 | 214 |
| 332 | 3300005539 | Ga0068853_100061370 | Ga0068853_1000613704 | 214 |
| 333 | 3300005547 | Ga0070693_100183002 | Ga0070693_1001830022 | 214 |
| 334 | 3300005563 | Ga0068855_100001509 | Ga0068855_1000015098 | 214 |
| 335 | 3300005564 | Ga0070664_100000382 | Ga0070664_10000038229 | 214 |
| 336 | 3300005577 | Ga0068857_100007158 | Ga0068857_1000071586 | 214 |
| 337 | 3300005614 | Ga0068856_100028014 | Ga0068856_1000280142 | 214 |
| 338 | 3300005616 | Ga0068852_100005218 | Ga0068852_1000052184 | 214 |
| 339 | 3300005618 | Ga0068864_100023249 | Ga0068864_1000232493 | 214 |
| 340 | 3300005834 | Ga0068851_10013088 | Ga0068851_100130882 | 214 |
| 341 | 3300005841 | Ga0068863_100521071 | Ga0068863_1005210712 | 214 |
| 342 | 3300005842 | Ga0068858_100066258 | Ga0068858_1000662584 | 214 |
| 343 | 3300005843 | Ga0068860_100130466 | Ga0068860_1001304662 | 214 |
| 344 | 3300009093 | Ga0105240_10002759 | Ga0105240_1000275915 | 214 |
| 345 | 3300009148 | Ga0105243_10191629 | Ga0105243_101916292 | 214 |
| 346 | 3300009174 | Ga0105241_10131169 | Ga0105241_101311692 | 214 |
| 347 | 3300009551 | Ga0105238_10001347 | Ga0105238_100013478 | 214 |
| 348 | 3300013100 | Ga0157373_10107785 | Ga0157373_101077853 | 214 |
| 349 | 3300013104 | Ga0157370_10004298 | Ga0157370_100042985 | 214 |
| 350 | 3300013105 | Ga0157369_10001502 | Ga0157369_1000150226 | 214 |
| 351 | 3300013297 | Ga0157378_10123429 | Ga0157378_101234293 | 214 |
| 352 | 3300013307 | Ga0157372_10003604 | Ga0157372_1000360410 | 214 |
| 353 | 3300014326 | Ga0157380_10423468 | Ga0157380_104234682 | 214 |
| 354 | 3300014968 | Ga0157379_10113398 | Ga0157379_101133983 | 214 |
| 355 | 3300014969 | Ga0157376_10333592 | Ga0157376_103335922 | 214 |
| 356 | 3300025893 | Ga0207682_10129294 | Ga0207682_101292942 | 214 |
| 357 | 3300025907 | Ga0207645_10444735 | Ga0207645_104447351 | 214 |
| 358 | 3300025908 | Ga0207643_10420612 | Ga0207643_104206122 | 214 |
| 359 | 3300025909 | Ga0207705_10048188 | Ga0207705_100481883 | 214 |
| 360 | 3300025911 | Ga0207654_10005566 | Ga0207654_100055667 | 214 |
| 361 | 3300025913 | Ga0207695_10025361 | Ga0207695_100253612 | 214 |
| 362 | 3300025914 | Ga0207671_10419463 | Ga0207671_104194632 | 214 |
| 363 | 3300025916 | Ga0207663_10547930 | Ga0207663_105479302 | 214 |
| 364 | 3300025919 | Ga0207657_10018119 | Ga0207657_100181192 | 214 |
| 365 | 3300025920 | Ga0207649_10005189 | Ga0207649_100051893 | 214 |
| 366 | 3300025920 | Ga0207649_10299954 | Ga0207649_102999541 | 214 |
| 367 | 3300025921 | Ga0207652_10142242 | Ga0207652_101422422 | 214 |
| 368 | 3300025923 | Ga0207681_10520589 | Ga0207681_105205892 | 214 |
| 369 | 3300025924 | Ga0207694_10008391 | Ga0207694_100083918 | 214 |
| 370 | 3300025928 | Ga0207700_10214988 | Ga0207700_102149882 | 214 |
| 371 | 3300025929 | Ga0207664_10273424 | Ga0207664_102734242 | 214 |
| 372 | 3300025932 | Ga0207690_10019497 | Ga0207690_100194975 | 214 |
| 373 | 3300025934 | Ga0207686_10381003 | Ga0207686_103810032 | 214 |
| 374 | 3300025935 | Ga0207709_10187158 | Ga0207709_101871582 | 214 |
| 375 | 3300025936 | Ga0207670_10070093 | Ga0207670_100700933 | 214 |
| 376 | 3300025940 | Ga0207691_10065492 | Ga0207691_100654924 | 214 |
| 377 | 3300025941 | Ga0207711_10485988 | Ga0207711_104859882 | 214 |
| 378 | 3300025942 | Ga0207689_10351373 | Ga0207689_103513732 | 214 |
| 379 | 3300025945 | Ga0207679_10034860 | Ga0207679_100348604 | 214 |
| 380 | 3300025949 | Ga0207667_10004959 | Ga0207667_1000495915 | 214 |
| 381 | 3300025960 | Ga0207651_10407499 | Ga0207651_104074992 | 214 |
| 382 | 3300026023 | Ga0207677_10087387 | Ga0207677_100873872 | 214 |
| 383 | 3300026078 | Ga0207702_10005567 | Ga0207702_100055675 | 214 |
| 384 | 3300026088 | Ga0207641_10353383 | Ga0207641_103533832 | 214 |
| 385 | 3300026088 | Ga0207641_10458493 | Ga0207641_104584932 | 214 |
| 386 | 3300026089 | Ga0207648_10133488 | Ga0207648_101334882 | 214 |
| 387 | 3300026116 | Ga0207674_10002156 | Ga0207674_1000215616 | 214 |
| 388 | 3300026118 | Ga0207675_100086885 | Ga0207675_1000868854 | 214 |
| 389 | 3300026121 | Ga0207683_10011809 | Ga0207683_100118094 | 214 |
| 390 | 3300026142 | Ga0207698_10002040 | Ga0207698_100020403 | 214 |
| 391 | 3300039447 | Ga0436361_0608376 | Ga0436361_0608376_9026_9685 | 214 |
| 392 | iso_pu_bacteria | 2511231002 | 2511242521 | 215 |
| 393 | iso_pu_bacteria | 2513020051 | 2513228662 | 215 |
| 394 | iso_pu_bacteria | 2585427530 | 2585555327 | 215 |
| 395 | iso_pu_bacteria | 2599185214 | 2599623841 | 215 |
| 396 | iso_pu_bacteria | 2599185226 | 2599671540 | 215 |
| 397 | iso_pu_bacteria | 2599185227 | 2599681447 | 215 |
| 398 | iso_pu_bacteria | 2599185229 | 2599693150 | 215 |
| 399 | iso_pu_bacteria | 2643221628 | 2644163304 | 215 |
| 400 | iso_pu_bacteria | 2643221658 | 2644327711 | 215 |
| 401 | iso_pu_bacteria | 2643221672 | 2644400399 | 215 |
| 402 | iso_pu_bacteria | 2738541307 | 2738879459 | 215 |
| 403 | iso_pu_bacteria | 2767802442 | 2770199464 | 215 |
| 404 | iso_pu_bacteria | 2835312727 | 2835313378 | 215 |
| 405 | iso_pu_bacteria | 2841911363 | 2841916640 | 215 |
| 406 | iso_pu_bacteria | 2841917233 | 2841922537 | 215 |
| 407 | iso_pu_bacteria | 2885198086 | 2885204582 | 215 |
| 408 | iso_pu_bacteria | 2885211737 | 2885218235 | 215 |
| 409 | iso_pu_bacteria | 2928070936 | 2928071602 | 215 |
| 410 | iso_pu_bacteria | 2941479691 | 2941482957 | 215 |
| 411 | iso_pu_bacteria | 2945972063 | 2945977358 | 215 |
| 412 | 3300048907 | Ga0496104_0068512 | Ga0496104_0068512_883_1539 | 218 |
| 413 | 3300002987 | JGI25159J45721_1008928 | JGI25159J45721_10089282 | 219 |
| 414 | 3300003187 | JGI25151J46595_10000460 | JGI25151J46595_1000046014 | 219 |
| 415 | 3300003215 | JGI25153J46596_10000228 | JGI25153J46596_1000022821 | 219 |
| 416 | 3300003354 | JGI25160J50197_1004251 | JGI25160J50197_10042516 | 219 |
| 417 | 3300003374 | JGI25161J50226_1001723 | JGI25161J50226_10017236 | 219 |
| 418 | 3300003763 | Ga0055529_1000705 | Ga0055529_10007059 | 219 |
| 419 | 3300003773 | Ga0055537_1000190 | Ga0055537_100019028 | 219 |
| 420 | 3300003781 | Ga0055536_1004906 | Ga0055536_10049068 | 219 |
| 421 | 3300003784 | Ga0055534_1000244 | Ga0055534_10002448 | 219 |
| 422 | 3300003784 | Ga0055534_1010940 | Ga0055534_10109403 | 219 |
| 423 | 3300003790 | Ga0055528_1000244 | Ga0055528_100024428 | 219 |
| 424 | 3300003790 | Ga0055528_1002980 | Ga0055528_10029807 | 219 |
| 425 | 3300003792 | Ga0055540_1000365 | Ga0055540_100036511 | 219 |
| 426 | 3300003792 | Ga0055540_1003214 | Ga0055540_10032148 | 219 |
| 427 | 3300003794 | Ga0055531_10000454 | Ga0055531_1000045431 | 219 |
| 428 | 3300004625 | Ga0055543_1002319 | Ga0055543_10023195 | 219 |
| 429 | 3300005262 | Ga0065165_1003670 | Ga0065165_10036706 | 219 |
| 430 | 3300005262 | Ga0065165_1006190 | Ga0065165_10061905 | 219 |
| 431 | 3300005288 | Ga0065714_10079601 | Ga0065714_100796012 | 219 |
| 432 | 3300005288 | Ga0065714_10128417 | Ga0065714_101284172 | 219 |
| 433 | 3300005327 | Ga0070658_10087738 | Ga0070658_100877382 | 219 |
| 434 | 3300005328 | Ga0070676_10000429 | Ga0070676_100004294 | 219 |
| 435 | 3300005330 | Ga0070690_100213023 | Ga0070690_1002130232 | 219 |
| 436 | 3300005331 | Ga0070670_100227560 | Ga0070670_1002275601 | 219 |
| 437 | 3300005331 | Ga0070670_100579029 | Ga0070670_1005790292 | 219 |
| 438 | 3300005333 | Ga0070677_10000318 | Ga0070677_1000031810 | 219 |
| 439 | 3300005334 | Ga0068869_100011628 | Ga0068869_1000116282 | 219 |
| 440 | 3300005334 | Ga0068869_100014878 | Ga0068869_1000148786 | 219 |
| 441 | 3300005334 | Ga0068869_100035853 | Ga0068869_1000358534 | 219 |
| 442 | 3300005334 | Ga0068869_100279164 | Ga0068869_1002791642 | 219 |
| 443 | 3300005335 | Ga0070666_10001248 | Ga0070666_1000124816 | 219 |
| 444 | 3300005335 | Ga0070666_10021254 | Ga0070666_100212543 | 219 |
| 445 | 3300005335 | Ga0070666_10149192 | Ga0070666_101491921 | 219 |
| 446 | 3300005338 | Ga0068868_100006918 | Ga0068868_1000069185 | 219 |
| 447 | 3300005338 | Ga0068868_100008681 | Ga0068868_1000086814 | 219 |
| 448 | 3300005340 | Ga0070689_100010843 | Ga0070689_1000108432 | 219 |
| 449 | 3300005343 | Ga0070687_100049122 | Ga0070687_1000491222 | 219 |
| 450 | 3300005344 | Ga0070661_100067497 | Ga0070661_1000674972 | 219 |
| 451 | 3300005344 | Ga0070661_100307813 | Ga0070661_1003078132 | 219 |
| 452 | 3300005347 | Ga0070668_100000600 | Ga0070668_10000060018 | 219 |
| 453 | 3300005347 | Ga0070668_100013049 | Ga0070668_1000130495 | 219 |
| 454 | 3300005347 | Ga0070668_100078656 | Ga0070668_1000786563 | 219 |
| 455 | 3300005347 | Ga0070668_100104229 | Ga0070668_1001042293 | 219 |
| 456 | 3300005347 | Ga0070668_100281157 | Ga0070668_1002811571 | 219 |
| 457 | 3300005353 | Ga0070669_100037985 | Ga0070669_1000379852 | 219 |
| 458 | 3300005353 | Ga0070669_100063953 | Ga0070669_1000639533 | 219 |
| 459 | 3300005353 | Ga0070669_100287944 | Ga0070669_1002879442 | 219 |
| 460 | 3300005354 | Ga0070675_100455744 | Ga0070675_1004557441 | 219 |
| 461 | 3300005355 | Ga0070671_100025462 | Ga0070671_1000254624 | 219 |
| 462 | 3300005355 | Ga0070671_100099246 | Ga0070671_1000992464 | 219 |
| 463 | 3300005356 | Ga0070674_100001769 | Ga0070674_1000017696 | 219 |
| 464 | 3300005356 | Ga0070674_100131810 | Ga0070674_1001318102 | 219 |
| 465 | 3300005364 | Ga0070673_100000043 | Ga0070673_10000004329 | 219 |
| 466 | 3300005364 | Ga0070673_100009905 | Ga0070673_1000099052 | 219 |
| 467 | 3300005365 | Ga0070688_100000219 | Ga0070688_10000021916 | 219 |
| 468 | 3300005367 | Ga0070667_100003833 | Ga0070667_10000383313 | 219 |
| 469 | 3300005367 | Ga0070667_100015102 | Ga0070667_1000151027 | 219 |
| 470 | 3300005367 | Ga0070667_100021260 | Ga0070667_1000212605 | 219 |
| 471 | 3300005367 | Ga0070667_100024756 | Ga0070667_1000247565 | 219 |
| 472 | 3300005367 | Ga0070667_100101894 | Ga0070667_1001018943 | 219 |
| 473 | 3300005434 | Ga0070709_10418566 | Ga0070709_104185661 | 219 |
| 474 | 3300005436 | Ga0070713_100041293 | Ga0070713_1000412934 | 219 |
| 475 | 3300005436 | Ga0070713_100044375 | Ga0070713_1000443753 | 219 |
| 476 | 3300005436 | Ga0070713_100125793 | Ga0070713_1001257933 | 219 |
| 477 | 3300005436 | Ga0070713_100618253 | Ga0070713_1006182532 | 219 |
| 478 | 3300005437 | Ga0070710_10030569 | Ga0070710_100305693 | 219 |
| 479 | 3300005439 | Ga0070711_100014390 | Ga0070711_1000143906 | 219 |
| 480 | 3300005439 | Ga0070711_100042541 | Ga0070711_1000425412 | 219 |
| 481 | 3300005439 | Ga0070711_100383736 | Ga0070711_1003837362 | 219 |
| 482 | 3300005445 | Ga0070708_100000053 | Ga0070708_10000005342 | 219 |
| 483 | 3300005445 | Ga0070708_100127942 | Ga0070708_1001279422 | 219 |
| 484 | 3300005445 | Ga0070708_100255356 | Ga0070708_1002553563 | 219 |
| 485 | 3300005445 | Ga0070708_100562992 | Ga0070708_1005629922 | 219 |
| 486 | 3300005445 | Ga0070708_100602538 | Ga0070708_1006025382 | 219 |
| 487 | 3300005455 | Ga0070663_100182206 | Ga0070663_1001822062 | 219 |
| 488 | 3300005456 | Ga0070678_100001872 | Ga0070678_1000018729 | 219 |
| 489 | 3300005456 | Ga0070678_100007077 | Ga0070678_1000070775 | 219 |
| 490 | 3300005457 | Ga0070662_100007746 | Ga0070662_1000077468 | 219 |
| 491 | 3300005457 | Ga0070662_100373797 | Ga0070662_1003737972 | 219 |
| 492 | 3300005459 | Ga0068867_100000983 | Ga0068867_10000098312 | 219 |
| 493 | 3300005459 | Ga0068867_100019770 | Ga0068867_1000197706 | 219 |
| 494 | 3300005459 | Ga0068867_100082898 | Ga0068867_1000828982 | 219 |
| 495 | 3300005459 | Ga0068867_100604302 | Ga0068867_1006043022 | 219 |
| 496 | 3300005466 | Ga0070685_10000897 | Ga0070685_100008976 | 219 |
| 497 | 3300005467 | Ga0070706_100009767 | Ga0070706_1000097672 | 219 |
| 498 | 3300005467 | Ga0070706_100018128 | Ga0070706_1000181287 | 219 |
| 499 | 3300005467 | Ga0070706_100027298 | Ga0070706_1000272984 | 219 |
| 500 | 3300005467 | Ga0070706_100152836 | Ga0070706_1001528361 | 219 |
| 501 | 3300005467 | Ga0070706_100227435 | Ga0070706_1002274352 | 219 |
| 502 | 3300005468 | Ga0070707_100029343 | Ga0070707_1000293434 | 219 |
| 503 | 3300005468 | Ga0070707_100031830 | Ga0070707_1000318303 | 219 |
| 504 | 3300005468 | Ga0070707_100046390 | Ga0070707_1000463904 | 219 |
| 505 | 3300005468 | Ga0070707_100116120 | Ga0070707_1001161202 | 219 |
| 506 | 3300005468 | Ga0070707_100526143 | Ga0070707_1005261432 | 219 |
| 507 | 3300005471 | Ga0070698_100008351 | Ga0070698_1000083513 | 219 |
| 508 | 3300005471 | Ga0070698_100242247 | Ga0070698_1002422472 | 219 |
| 509 | 3300005518 | Ga0070699_100013545 | Ga0070699_1000135454 | 219 |
| 510 | 3300005518 | Ga0070699_100217887 | Ga0070699_1002178872 | 219 |
| 511 | 3300005530 | Ga0070679_100145229 | Ga0070679_1001452293 | 219 |
| 512 | 3300005530 | Ga0070679_100353113 | Ga0070679_1003531132 | 219 |
| 513 | 3300005535 | Ga0070684_100216169 | Ga0070684_1002161692 | 219 |
| 514 | 3300005536 | Ga0070697_100018433 | Ga0070697_1000184336 | 219 |
| 515 | 3300005536 | Ga0070697_100244489 | Ga0070697_1002444892 | 219 |
| 516 | 3300005536 | Ga0070697_100324172 | Ga0070697_1003241722 | 219 |
| 517 | 3300005539 | Ga0068853_100020924 | Ga0068853_1000209242 | 219 |
| 518 | 3300005539 | Ga0068853_100233001 | Ga0068853_1002330012 | 219 |
| 519 | 3300005539 | Ga0068853_100257261 | Ga0068853_1002572612 | 219 |
| 520 | 3300005539 | Ga0068853_100380669 | Ga0068853_1003806692 | 219 |
| 521 | 3300005543 | Ga0070672_100002787 | Ga0070672_1000027877 | 219 |
| 522 | 3300005543 | Ga0070672_100032687 | Ga0070672_1000326875 | 219 |
| 523 | 3300005543 | Ga0070672_100391600 | Ga0070672_1003916002 | 219 |
| 524 | 3300005544 | Ga0070686_100077739 | Ga0070686_1000777392 | 219 |
| 525 | 3300005545 | Ga0070695_100210812 | Ga0070695_1002108122 | 219 |
| 526 | 3300005546 | Ga0070696_100104327 | Ga0070696_1001043272 | 219 |
| 527 | 3300005548 | Ga0070665_100010279 | Ga0070665_1000102799 | 219 |
| 528 | 3300005548 | Ga0070665_100018064 | Ga0070665_1000180645 | 219 |
| 529 | 3300005548 | Ga0070665_100125882 | Ga0070665_1001258823 | 219 |
| 530 | 3300005548 | Ga0070665_100148184 | Ga0070665_1001481843 | 219 |
| 531 | 3300005548 | Ga0070665_100267344 | Ga0070665_1002673442 | 219 |
| 532 | 3300005549 | Ga0070704_100203921 | Ga0070704_1002039212 | 219 |
| 533 | 3300005563 | Ga0068855_100131288 | Ga0068855_1001312883 | 219 |
| 534 | 3300005563 | Ga0068855_100901776 | Ga0068855_1009017762 | 219 |
| 535 | 3300005564 | Ga0070664_100448106 | Ga0070664_1004481062 | 219 |
| 536 | 3300005577 | Ga0068857_100010100 | Ga0068857_1000101003 | 219 |
| 537 | 3300005577 | Ga0068857_100017326 | Ga0068857_1000173265 | 219 |
| 538 | 3300005577 | Ga0068857_100077510 | Ga0068857_1000775103 | 219 |
| 539 | 3300005614 | Ga0068856_100178068 | Ga0068856_1001780683 | 219 |
| 540 | 3300005615 | Ga0070702_100098708 | Ga0070702_1000987083 | 219 |
| 541 | 3300005616 | Ga0068852_100002701 | Ga0068852_1000027016 | 219 |
| 542 | 3300005616 | Ga0068852_100048369 | Ga0068852_1000483693 | 219 |
| 543 | 3300005616 | Ga0068852_100117088 | Ga0068852_1001170883 | 219 |
| 544 | 3300005616 | Ga0068852_100290955 | Ga0068852_1002909552 | 219 |
| 545 | 3300005617 | Ga0068859_100152522 | Ga0068859_1001525223 | 219 |
| 546 | 3300005617 | Ga0068859_100561597 | Ga0068859_1005615972 | 219 |
| 547 | 3300005618 | Ga0068864_100001799 | Ga0068864_10000179914 | 219 |
| 548 | 3300005618 | Ga0068864_100002340 | Ga0068864_1000023403 | 219 |
| 549 | 3300005618 | Ga0068864_100062625 | Ga0068864_1000626252 | 219 |
| 550 | 3300005719 | Ga0068861_100000216 | Ga0068861_10000021620 | 219 |
| 551 | 3300005719 | Ga0068861_100068209 | Ga0068861_1000682092 | 219 |
| 552 | 3300005719 | Ga0068861_100268643 | Ga0068861_1002686431 | 219 |
| 553 | 3300005834 | Ga0068851_10000318 | Ga0068851_100003189 | 219 |
| 554 | 3300005840 | Ga0068870_10040151 | Ga0068870_100401512 | 219 |
| 555 | 3300005841 | Ga0068863_100001833 | Ga0068863_10000183312 | 219 |
| 556 | 3300005841 | Ga0068863_100049794 | Ga0068863_1000497945 | 219 |
| 557 | 3300005841 | Ga0068863_100341123 | Ga0068863_1003411232 | 219 |
| 558 | 3300005841 | Ga0068863_101129285 | Ga0068863_1011292851 | 219 |
| 559 | 3300005842 | Ga0068858_100010655 | Ga0068858_1000106553 | 219 |
| 560 | 3300005842 | Ga0068858_100049069 | Ga0068858_1000490692 | 219 |
| 561 | 3300005842 | Ga0068858_100161174 | Ga0068858_1001611743 | 219 |
| 562 | 3300005842 | Ga0068858_100217391 | Ga0068858_1002173912 | 219 |
| 563 | 3300005843 | Ga0068860_100004954 | Ga0068860_10000495414 | 219 |
| 564 | 3300005843 | Ga0068860_100008957 | Ga0068860_1000089577 | 219 |
| 565 | 3300005843 | Ga0068860_100015761 | Ga0068860_1000157615 | 219 |
| 566 | 3300005843 | Ga0068860_100056596 | Ga0068860_1000565962 | 219 |
| 567 | 3300005843 | Ga0068860_100136251 | Ga0068860_1001362514 | 219 |
| 568 | 3300005843 | Ga0068860_100203376 | Ga0068860_1002033762 | 219 |
| 569 | 3300005844 | Ga0068862_100002123 | Ga0068862_1000021236 | 219 |
| 570 | 3300005844 | Ga0068862_100305463 | Ga0068862_1003054632 | 219 |
| 571 | 3300006028 | Ga0070717_10104550 | Ga0070717_101045503 | 219 |
| 572 | 3300006048 | Ga0075363_100163025 | Ga0075363_1001630252 | 219 |
| 573 | 3300006051 | Ga0075364_10147759 | Ga0075364_101477592 | 219 |
| 574 | 3300006051 | Ga0075364_10422649 | Ga0075364_104226492 | 219 |
| 575 | 3300006058 | Ga0075432_10008595 | Ga0075432_100085955 | 219 |
| 576 | 3300006058 | Ga0075432_10225068 | Ga0075432_102250681 | 219 |
| 577 | 3300006175 | Ga0070712_100012249 | Ga0070712_1000122493 | 219 |
| 578 | 3300006175 | Ga0070712_100054698 | Ga0070712_1000546983 | 219 |
| 579 | 3300006175 | Ga0070712_100203067 | Ga0070712_1002030672 | 219 |
| 580 | 3300006177 | Ga0075362_10003903 | Ga0075362_100039036 | 219 |
| 581 | 3300006177 | Ga0075362_10008343 | Ga0075362_100083434 | 219 |
| 582 | 3300006177 | Ga0075362_10197722 | Ga0075362_101977222 | 219 |
| 583 | 3300006178 | Ga0075367_10066906 | Ga0075367_100669062 | 219 |
| 584 | 3300006186 | Ga0075369_10044743 | Ga0075369_100447433 | 219 |
| 585 | 3300006195 | Ga0075366_10030351 | Ga0075366_100303512 | 219 |
| 586 | 3300006195 | Ga0075366_10081232 | Ga0075366_100812323 | 219 |
| 587 | 3300006195 | Ga0075366_10103685 | Ga0075366_101036852 | 219 |
| 588 | 3300006195 | Ga0075366_10193715 | Ga0075366_101937152 | 219 |
| 589 | 3300006237 | Ga0097621_100003909 | Ga0097621_1000039095 | 219 |
| 590 | 3300006237 | Ga0097621_100011838 | Ga0097621_1000118382 | 219 |
| 591 | 3300006237 | Ga0097621_100196056 | Ga0097621_1001960562 | 219 |
| 592 | 3300006237 | Ga0097621_100540325 | Ga0097621_1005403252 | 219 |
| 593 | 3300006353 | Ga0075370_10013523 | Ga0075370_100135235 | 219 |
| 594 | 3300006353 | Ga0075370_10016809 | Ga0075370_100168093 | 219 |
| 595 | 3300006353 | Ga0075370_10027764 | Ga0075370_100277642 | 219 |
| 596 | 3300006353 | Ga0075370_10030332 | Ga0075370_100303324 | 219 |
| 597 | 3300006353 | Ga0075370_10068530 | Ga0075370_100685303 | 219 |
| 598 | 3300006353 | Ga0075370_10125410 | Ga0075370_101254102 | 219 |
| 599 | 3300006353 | Ga0075370_10192013 | Ga0075370_101920132 | 219 |
| 600 | 3300006353 | Ga0075370_10203835 | Ga0075370_102038352 | 219 |
| 601 | 3300006358 | Ga0068871_100001413 | Ga0068871_1000014133 | 219 |
| 602 | 3300006358 | Ga0068871_100166479 | Ga0068871_1001664792 | 219 |
| 603 | 3300006358 | Ga0068871_100506484 | Ga0068871_1005064842 | 219 |
| 604 | 3300006846 | Ga0075430_100111486 | Ga0075430_1001114863 | 219 |
| 605 | 3300006846 | Ga0075430_100250639 | Ga0075430_1002506392 | 219 |
| 606 | 3300006847 | Ga0075431_100010310 | Ga0075431_1000103106 | 219 |
| 607 | 3300006871 | Ga0075434_100422065 | Ga0075434_1004220652 | 219 |
| 608 | 3300006881 | Ga0068865_100065259 | Ga0068865_1000652593 | 219 |
| 609 | 3300006914 | Ga0075436_100434648 | Ga0075436_1004346481 | 219 |
| 610 | 3300006931 | Ga0097620_100152504 | Ga0097620_1001525043 | 219 |
| 611 | 3300006931 | Ga0097620_100561619 | Ga0097620_1005616192 | 219 |
| 612 | 3300006946 | Ga0079104_1016194 | Ga0079104_10161942 | 219 |
| 613 | 3300006948 | Ga0099826_10000044 | Ga0099826_1000004473 | 219 |
| 614 | 3300007076 | Ga0075435_100039068 | Ga0075435_1000390683 | 219 |
| 615 | 3300007076 | Ga0075435_100641038 | Ga0075435_1006410382 | 219 |
| 616 | 3300009036 | Ga0105244_10000642 | Ga0105244_1000064217 | 219 |
| 617 | 3300009093 | Ga0105240_10102699 | Ga0105240_101026992 | 219 |
| 618 | 3300009093 | Ga0105240_10139138 | Ga0105240_101391383 | 219 |
| 619 | 3300009094 | Ga0111539_10020068 | Ga0111539_100200685 | 219 |
| 620 | 3300009098 | Ga0105245_10001770 | Ga0105245_100017702 | 219 |
| 621 | 3300009101 | Ga0105247_10129505 | Ga0105247_101295052 | 219 |
| 622 | 3300009147 | Ga0114129_10008075 | Ga0114129_1000807510 | 219 |
| 623 | 3300009148 | Ga0105243_10000674 | Ga0105243_1000067437 | 219 |
| 624 | 3300009148 | Ga0105243_10011504 | Ga0105243_100115046 | 219 |
| 625 | 3300009148 | Ga0105243_10416468 | Ga0105243_104164682 | 219 |
| 626 | 3300009174 | Ga0105241_10782368 | Ga0105241_107823681 | 219 |
| 627 | 3300009176 | Ga0105242_10080901 | Ga0105242_100809014 | 219 |
| 628 | 3300009177 | Ga0105248_10124237 | Ga0105248_101242374 | 219 |
| 629 | 3300009177 | Ga0105248_10350385 | Ga0105248_103503852 | 219 |
| 630 | 3300009545 | Ga0105237_10011550 | Ga0105237_100115506 | 219 |
| 631 | 3300009545 | Ga0105237_10150429 | Ga0105237_101504293 | 219 |
| 632 | 3300009545 | Ga0105237_10215267 | Ga0105237_102152672 | 219 |
| 633 | 3300009551 | Ga0105238_10255875 | Ga0105238_102558753 | 219 |
| 634 | 3300009551 | Ga0105238_10467029 | Ga0105238_104670291 | 219 |
| 635 | 3300009551 | Ga0105238_10889391 | Ga0105238_108893912 | 219 |
| 636 | 3300009553 | Ga0105249_10165386 | Ga0105249_101653862 | 219 |
| 637 | 3300009553 | Ga0105249_10442333 | Ga0105249_104423332 | 219 |
| 638 | 3300009553 | Ga0105249_10553627 | Ga0105249_105536272 | 219 |
| 639 | 3300010375 | Ga0105239_10032488 | Ga0105239_100324885 | 219 |
| 640 | 3300010375 | Ga0105239_10154415 | Ga0105239_101544153 | 219 |
| 641 | 3300010375 | Ga0105239_10987921 | Ga0105239_109879212 | 219 |
| 642 | 3300011119 | Ga0105246_10002072 | Ga0105246_100020724 | 219 |
| 643 | 3300011119 | Ga0105246_10126817 | Ga0105246_101268172 | 219 |
| 644 | 3300011119 | Ga0105246_10392241 | Ga0105246_103922412 | 219 |
| 645 | 3300012502 | Ga0157347_1014065 | Ga0157347_10140652 | 219 |
| 646 | 3300013100 | Ga0157373_10002009 | Ga0157373_1000200916 | 219 |
| 647 | 3300013100 | Ga0157373_10109619 | Ga0157373_101096193 | 219 |
| 648 | 3300013100 | Ga0157373_10664144 | Ga0157373_106641442 | 219 |
| 649 | 3300013104 | Ga0157370_10026577 | Ga0157370_100265777 | 219 |
| 650 | 3300013104 | Ga0157370_10324300 | Ga0157370_103243002 | 219 |
| 651 | 3300013105 | Ga0157369_10675773 | Ga0157369_106757732 | 219 |
| 652 | 3300013296 | Ga0157374_10000978 | Ga0157374_1000097810 | 219 |
| 653 | 3300013297 | Ga0157378_10021855 | Ga0157378_100218557 | 219 |
| 654 | 3300013297 | Ga0157378_10084625 | Ga0157378_100846252 | 219 |
| 655 | 3300013297 | Ga0157378_10853989 | Ga0157378_108539892 | 219 |
| 656 | 3300013306 | Ga0163162_10055082 | Ga0163162_100550825 | 219 |
| 657 | 3300013306 | Ga0163162_10093099 | Ga0163162_100930992 | 219 |
| 658 | 3300013306 | Ga0163162_10346748 | Ga0163162_103467482 | 219 |
| 659 | 3300013307 | Ga0157372_10057440 | Ga0157372_100574405 | 219 |
| 660 | 3300013307 | Ga0157372_10100101 | Ga0157372_101001013 | 219 |
| 661 | 3300013307 | Ga0157372_10628573 | Ga0157372_106285732 | 219 |
| 662 | 3300013308 | Ga0157375_10307573 | Ga0157375_103075732 | 219 |
| 663 | 3300014325 | Ga0163163_10001615 | Ga0163163_1000161518 | 219 |
| 664 | 3300014325 | Ga0163163_10050597 | Ga0163163_100505971 | 219 |
| 665 | 3300014497 | Ga0182008_10000794 | Ga0182008_100007945 | 219 |
| 666 | 3300014497 | Ga0182008_10026721 | Ga0182008_100267211 | 219 |
| 667 | 3300014968 | Ga0157379_10000044 | Ga0157379_1000004440 | 219 |
| 668 | 3300014969 | Ga0157376_10042690 | Ga0157376_100426903 | 219 |
| 669 | 3300014969 | Ga0157376_10201250 | Ga0157376_102012502 | 219 |
| 670 | 3300014969 | Ga0157376_10409317 | Ga0157376_104093172 | 219 |
| 671 | 3300014969 | Ga0157376_10834294 | Ga0157376_108342942 | 219 |
| 672 | 3300015261 | Ga0182006_1000690 | Ga0182006_10006906 | 219 |
| 673 | 3300015261 | Ga0182006_1021734 | Ga0182006_10217344 | 219 |
| 674 | 3300015262 | Ga0182007_10000223 | Ga0182007_1000022315 | 219 |
| 675 | 3300015262 | Ga0182007_10035384 | Ga0182007_100353842 | 219 |
| 676 | 3300015683 | Ga0183362_10002 | Ga0183362_1000259 | 219 |
| 677 | 3300017792 | Ga0163161_10015411 | Ga0163161_100154114 | 219 |
| 678 | 3300025228 | Ga0209672_108769 | Ga0209672_1087692 | 219 |
| 679 | 3300025245 | Ga0207425_1003414 | Ga0207425_10034143 | 219 |
| 680 | 3300025245 | Ga0207425_1012591 | Ga0207425_10125912 | 219 |
| 681 | 3300025258 | Ga0209129_1000281 | Ga0209129_100028120 | 219 |
| 682 | 3300025263 | Ga0209565_1000047 | Ga0209565_100004768 | 219 |
| 683 | 3300025263 | Ga0209565_1000278 | Ga0209565_100027822 | 219 |
| 684 | 3300025263 | Ga0209565_1006520 | Ga0209565_10065202 | 219 |
| 685 | 3300025272 | Ga0209455_1002782 | Ga0209455_10027824 | 219 |
| 686 | 3300025273 | Ga0209673_1000079 | Ga0209673_1000079151 | 219 |
| 687 | 3300025273 | Ga0209673_1000693 | Ga0209673_100069320 | 219 |
| 688 | 3300025284 | Ga0209130_1000890 | Ga0209130_10008906 | 219 |
| 689 | 3300025284 | Ga0209130_1003561 | Ga0209130_10035615 | 219 |
| 690 | 3300025291 | Ga0209675_1000046 | Ga0209675_100004668 | 219 |
| 691 | 3300025291 | Ga0209675_1000423 | Ga0209675_100042330 | 219 |
| 692 | 3300025291 | Ga0209675_1010260 | Ga0209675_10102602 | 219 |
| 693 | 3300025292 | Ga0209676_1000383 | Ga0209676_100038345 | 219 |
| 694 | 3300025292 | Ga0209676_1018495 | Ga0209676_10184953 | 219 |
| 695 | 3300025294 | Ga0209025_1001476 | Ga0209025_10014763 | 219 |
| 696 | 3300025294 | Ga0209025_1016419 | Ga0209025_10164193 | 219 |
| 697 | 3300025294 | Ga0209025_1020008 | Ga0209025_10200083 | 219 |
| 698 | 3300025295 | Ga0209564_1002819 | Ga0209564_100281910 | 219 |
| 699 | 3300025297 | Ga0209758_1000665 | Ga0209758_100066521 | 219 |
| 700 | 3300025297 | Ga0209758_1010522 | Ga0209758_10105226 | 219 |
| 701 | 3300025298 | Ga0209050_1065904 | Ga0209050_10659042 | 219 |
| 702 | 3300025302 | Ga0207426_1000076 | Ga0207426_1000076309 | 219 |
| 703 | 3300025302 | Ga0207426_1000591 | Ga0207426_100059120 | 219 |
| 704 | 3300025303 | Ga0209051_1000213 | Ga0209051_100021333 | 219 |
| 705 | 3300025303 | Ga0209051_1000259 | Ga0209051_100025946 | 219 |
| 706 | 3300025304 | Ga0209257_1000116 | Ga0209257_1000116170 | 219 |
| 707 | 3300025315 | Ga0207697_10012348 | Ga0207697_100123484 | 219 |
| 708 | 3300025321 | Ga0207656_10003496 | Ga0207656_100034962 | 219 |
| 709 | 3300025728 | Ga0207655_1001085 | Ga0207655_100108514 | 219 |
| 710 | 3300025893 | Ga0207682_10000397 | Ga0207682_1000039713 | 219 |
| 711 | 3300025898 | Ga0207692_10007269 | Ga0207692_100072692 | 219 |
| 712 | 3300025898 | Ga0207692_10052005 | Ga0207692_100520052 | 219 |
| 713 | 3300025898 | Ga0207692_10203999 | Ga0207692_102039992 | 219 |
| 714 | 3300025901 | Ga0207688_10076615 | Ga0207688_100766152 | 219 |
| 715 | 3300025901 | Ga0207688_10214732 | Ga0207688_102147322 | 219 |
| 716 | 3300025903 | Ga0207680_10011740 | Ga0207680_100117405 | 219 |
| 717 | 3300025903 | Ga0207680_10052629 | Ga0207680_100526292 | 219 |
| 718 | 3300025903 | Ga0207680_10133130 | Ga0207680_101331302 | 219 |
| 719 | 3300025903 | Ga0207680_10390225 | Ga0207680_103902251 | 219 |
| 720 | 3300025905 | Ga0207685_10119946 | Ga0207685_101199463 | 219 |
| 721 | 3300025907 | Ga0207645_10000333 | Ga0207645_100003339 | 219 |
| 722 | 3300025907 | Ga0207645_10083564 | Ga0207645_100835642 | 219 |
| 723 | 3300025908 | Ga0207643_10003574 | Ga0207643_100035742 | 219 |
| 724 | 3300025910 | Ga0207684_10004791 | Ga0207684_1000479114 | 219 |
| 725 | 3300025910 | Ga0207684_10014734 | Ga0207684_100147348 | 219 |
| 726 | 3300025910 | Ga0207684_10122908 | Ga0207684_101229082 | 219 |
| 727 | 3300025910 | Ga0207684_10148320 | Ga0207684_101483202 | 219 |
| 728 | 3300025910 | Ga0207684_10278488 | Ga0207684_102784881 | 219 |
| 729 | 3300025912 | Ga0207707_10209370 | Ga0207707_102093702 | 219 |
| 730 | 3300025913 | Ga0207695_10218284 | Ga0207695_102182842 | 219 |
| 731 | 3300025913 | Ga0207695_10633346 | Ga0207695_106333462 | 219 |
| 732 | 3300025914 | Ga0207671_10046596 | Ga0207671_100465964 | 219 |
| 733 | 3300025914 | Ga0207671_10202855 | Ga0207671_102028552 | 219 |
| 734 | 3300025915 | Ga0207693_10003441 | Ga0207693_100034413 | 219 |
| 735 | 3300025915 | Ga0207693_10003978 | Ga0207693_100039789 | 219 |
| 736 | 3300025915 | Ga0207693_10014543 | Ga0207693_100145439 | 219 |
| 737 | 3300025916 | Ga0207663_10118051 | Ga0207663_101180512 | 219 |
| 738 | 3300025918 | Ga0207662_10096070 | Ga0207662_100960703 | 219 |
| 739 | 3300025920 | Ga0207649_10015006 | Ga0207649_100150062 | 219 |
| 740 | 3300025920 | Ga0207649_10313520 | Ga0207649_103135201 | 219 |
| 741 | 3300025921 | Ga0207652_10174458 | Ga0207652_101744582 | 219 |
| 742 | 3300025921 | Ga0207652_10175441 | Ga0207652_101754411 | 219 |
| 743 | 3300025922 | Ga0207646_10012608 | Ga0207646_100126087 | 219 |
| 744 | 3300025922 | Ga0207646_10025565 | Ga0207646_100255655 | 219 |
| 745 | 3300025922 | Ga0207646_10106522 | Ga0207646_101065222 | 219 |
| 746 | 3300025922 | Ga0207646_10296490 | Ga0207646_102964902 | 219 |
| 747 | 3300025922 | Ga0207646_10323950 | Ga0207646_103239502 | 219 |
| 748 | 3300025922 | Ga0207646_10809448 | Ga0207646_108094482 | 219 |
| 749 | 3300025923 | Ga0207681_10030363 | Ga0207681_100303633 | 219 |
| 750 | 3300025924 | Ga0207694_10281608 | Ga0207694_102816082 | 219 |
| 751 | 3300025925 | Ga0207650_10007114 | Ga0207650_100071143 | 219 |
| 752 | 3300025925 | Ga0207650_10008283 | Ga0207650_100082839 | 219 |
| 753 | 3300025925 | Ga0207650_10111100 | Ga0207650_101111003 | 219 |
| 754 | 3300025925 | Ga0207650_10458637 | Ga0207650_104586372 | 219 |
| 755 | 3300025925 | Ga0207650_10895120 | Ga0207650_108951201 | 219 |
| 756 | 3300025927 | Ga0207687_10000171 | Ga0207687_1000017142 | 219 |
| 757 | 3300025927 | Ga0207687_10392750 | Ga0207687_103927501 | 219 |
| 758 | 3300025931 | Ga0207644_10138658 | Ga0207644_101386583 | 219 |
| 759 | 3300025932 | Ga0207690_10271003 | Ga0207690_102710031 | 219 |
| 760 | 3300025933 | Ga0207706_10004253 | Ga0207706_100042534 | 219 |
| 761 | 3300025933 | Ga0207706_10072570 | Ga0207706_100725704 | 219 |
| 762 | 3300025933 | Ga0207706_10191904 | Ga0207706_101919041 | 219 |
| 763 | 3300025935 | Ga0207709_10000103 | Ga0207709_10000103101 | 219 |
| 764 | 3300025935 | Ga0207709_10001788 | Ga0207709_1000178816 | 219 |
| 765 | 3300025937 | Ga0207669_10008879 | Ga0207669_100088793 | 219 |
| 766 | 3300025938 | Ga0207704_10280220 | Ga0207704_102802202 | 219 |
| 767 | 3300025940 | Ga0207691_10000029 | Ga0207691_1000002972 | 219 |
| 768 | 3300025940 | Ga0207691_10045976 | Ga0207691_100459762 | 219 |
| 769 | 3300025940 | Ga0207691_10052926 | Ga0207691_100529264 | 219 |
| 770 | 3300025940 | Ga0207691_10196630 | Ga0207691_101966302 | 219 |
| 771 | 3300025941 | Ga0207711_10152082 | Ga0207711_101520822 | 219 |
| 772 | 3300025941 | Ga0207711_10249437 | Ga0207711_102494372 | 219 |
| 773 | 3300025942 | Ga0207689_10002193 | Ga0207689_100021933 | 219 |
| 774 | 3300025942 | Ga0207689_10031450 | Ga0207689_100314505 | 219 |
| 775 | 3300025942 | Ga0207689_10072429 | Ga0207689_100724294 | 219 |
| 776 | 3300025942 | Ga0207689_10111987 | Ga0207689_101119872 | 219 |
| 777 | 3300025945 | Ga0207679_10136203 | Ga0207679_101362032 | 219 |
| 778 | 3300025949 | Ga0207667_10534652 | Ga0207667_105346522 | 219 |
| 779 | 3300025949 | Ga0207667_10570797 | Ga0207667_105707972 | 219 |
| 780 | 3300025960 | Ga0207651_10002436 | Ga0207651_100024367 | 219 |
| 781 | 3300025960 | Ga0207651_10307410 | Ga0207651_103074101 | 219 |
| 782 | 3300025961 | Ga0207712_10062931 | Ga0207712_100629313 | 219 |
| 783 | 3300025972 | Ga0207668_10007158 | Ga0207668_100071583 | 219 |
| 784 | 3300025972 | Ga0207668_10025148 | Ga0207668_100251484 | 219 |
| 785 | 3300025972 | Ga0207668_10067618 | Ga0207668_100676182 | 219 |
| 786 | 3300025972 | Ga0207668_10087739 | Ga0207668_100877392 | 219 |
| 787 | 3300025981 | Ga0207640_10030427 | Ga0207640_100304273 | 219 |
| 788 | 3300025986 | Ga0207658_10001631 | Ga0207658_1000163110 | 219 |
| 789 | 3300025986 | Ga0207658_10002140 | Ga0207658_1000214010 | 219 |
| 790 | 3300025986 | Ga0207658_10016053 | Ga0207658_100160533 | 219 |
| 791 | 3300025986 | Ga0207658_10016727 | Ga0207658_100167273 | 219 |
| 792 | 3300025986 | Ga0207658_10489785 | Ga0207658_104897851 | 219 |
| 793 | 3300026023 | Ga0207677_10000370 | Ga0207677_100003707 | 219 |
| 794 | 3300026023 | Ga0207677_10021894 | Ga0207677_100218942 | 219 |
| 795 | 3300026035 | Ga0207703_10000374 | Ga0207703_100003742 | 219 |
| 796 | 3300026035 | Ga0207703_10001245 | Ga0207703_100012456 | 219 |
| 797 | 3300026035 | Ga0207703_10072586 | Ga0207703_100725863 | 219 |
| 798 | 3300026035 | Ga0207703_10398488 | Ga0207703_103984881 | 219 |
| 799 | 3300026041 | Ga0207639_10018496 | Ga0207639_100184963 | 219 |
| 800 | 3300026041 | Ga0207639_10082687 | Ga0207639_100826873 | 219 |
| 801 | 3300026067 | Ga0207678_10256023 | Ga0207678_102560232 | 219 |
| 802 | 3300026078 | Ga0207702_10149349 | Ga0207702_101493493 | 219 |
| 803 | 3300026078 | Ga0207702_10659148 | Ga0207702_106591482 | 219 |
| 804 | 3300026088 | Ga0207641_10013227 | Ga0207641_100132273 | 219 |
| 805 | 3300026088 | Ga0207641_10310403 | Ga0207641_103104032 | 219 |
| 806 | 3300026089 | Ga0207648_10001008 | Ga0207648_1000100812 | 219 |
| 807 | 3300026089 | Ga0207648_10203684 | Ga0207648_102036842 | 219 |
| 808 | 3300026089 | Ga0207648_10315907 | Ga0207648_103159072 | 219 |
| 809 | 3300026095 | Ga0207676_10000054 | Ga0207676_1000005459 | 219 |
| 810 | 3300026095 | Ga0207676_10019308 | Ga0207676_100193084 | 219 |
| 811 | 3300026095 | Ga0207676_10023898 | Ga0207676_100238985 | 219 |
| 812 | 3300026116 | Ga0207674_10016943 | Ga0207674_100169432 | 219 |
| 813 | 3300026116 | Ga0207674_10051844 | Ga0207674_100518445 | 219 |
| 814 | 3300026116 | Ga0207674_10995340 | Ga0207674_109953401 | 219 |
| 815 | 3300026118 | Ga0207675_100000672 | Ga0207675_10000067222 | 219 |
| 816 | 3300026118 | Ga0207675_100057858 | Ga0207675_1000578584 | 219 |
| 817 | 3300026118 | Ga0207675_100131197 | Ga0207675_1001311972 | 219 |
| 818 | 3300026118 | Ga0207675_100323943 | Ga0207675_1003239432 | 219 |
| 819 | 3300026121 | Ga0207683_10000164 | Ga0207683_1000016414 | 219 |
| 820 | 3300026121 | Ga0207683_10015271 | Ga0207683_100152715 | 219 |
| 821 | 3300026121 | Ga0207683_10514382 | Ga0207683_105143822 | 219 |
| 822 | 3300026142 | Ga0207698_10004482 | Ga0207698_100044827 | 219 |
| 823 | 3300026142 | Ga0207698_10052160 | Ga0207698_100521602 | 219 |
| 824 | 3300026142 | Ga0207698_10078526 | Ga0207698_100785264 | 219 |
| 825 | 3300026142 | Ga0207698_10088686 | Ga0207698_100886863 | 219 |
| 826 | 3300026142 | Ga0207698_10713660 | Ga0207698_107136601 | 219 |
| 827 | 3300027312 | Ga0209371_1009416 | Ga0209371_10094163 | 219 |
| 828 | 3300027666 | Ga0209282_1000117 | Ga0209282_100011725 | 219 |
| 829 | 3300027907 | Ga0207428_10018976 | Ga0207428_100189763 | 219 |
| 830 | 3300028379 | Ga0268266_10003312 | Ga0268266_1000331212 | 219 |
| 831 | 3300028379 | Ga0268266_10007280 | Ga0268266_100072804 | 219 |
| 832 | 3300028379 | Ga0268266_10039581 | Ga0268266_100395812 | 219 |
| 833 | 3300028379 | Ga0268266_10118790 | Ga0268266_101187903 | 219 |
| 834 | 3300028380 | Ga0268265_10002148 | Ga0268265_100021487 | 219 |
| 835 | 3300028380 | Ga0268265_10173190 | Ga0268265_101731902 | 219 |
| 836 | 3300028381 | Ga0268264_10001103 | Ga0268264_1000110321 | 219 |
| 837 | 3300028381 | Ga0268264_10008580 | Ga0268264_100085805 | 219 |
| 838 | 3300028381 | Ga0268264_10009544 | Ga0268264_100095446 | 219 |
| 839 | 3300028381 | Ga0268264_10016859 | Ga0268264_100168596 | 219 |
| 840 | 3300028381 | Ga0268264_10087228 | Ga0268264_100872284 | 219 |
| 841 | 3300028786 | Ga0307517_10199229 | Ga0307517_101992292 | 219 |
| 842 | 3300028794 | Ga0307515_10074155 | Ga0307515_100741553 | 219 |
| 843 | 3300028794 | Ga0307515_10133948 | Ga0307515_101339483 | 219 |
| 844 | 3300028794 | Ga0307515_10156065 | Ga0307515_101560652 | 219 |
| 845 | 3300028794 | Ga0307515_10229015 | Ga0307515_102290152 | 219 |
| 846 | 3300028794 | Ga0307515_10376683 | Ga0307515_103766832 | 219 |
| 847 | 3300030500 | Ga0268256_1009978 | Ga0268256_10099783 | 219 |
| 848 | 3300030522 | Ga0307512_10019834 | Ga0307512_100198344 | 219 |
| 849 | 3300031241 | Ga0265325_10040386 | Ga0265325_100403863 | 219 |
| 850 | 3300031249 | Ga0265339_10041942 | Ga0265339_100419423 | 219 |
| 851 | 3300031250 | Ga0265331_10019496 | Ga0265331_100194964 | 219 |
| 852 | 3300031251 | Ga0265327_10052300 | Ga0265327_100523002 | 219 |
| 853 | 3300031456 | Ga0307513_10000090 | Ga0307513_1000009048 | 219 |
| 854 | 3300031507 | Ga0307509_10000157 | Ga0307509_1000015792 | 219 |
| 855 | 3300031548 | Ga0307408_100167064 | Ga0307408_1001670643 | 219 |
| 856 | 3300031595 | Ga0265313_10000408 | Ga0265313_100004085 | 219 |
| 857 | 3300031649 | Ga0307514_10004434 | Ga0307514_1000443411 | 219 |
| 858 | 3300031649 | Ga0307514_10068072 | Ga0307514_100680723 | 219 |
| 859 | 3300031649 | Ga0307514_10255879 | Ga0307514_102558792 | 219 |
| 860 | 3300031711 | Ga0265314_10025397 | Ga0265314_100253974 | 219 |
| 861 | 3300031712 | Ga0265342_10017753 | Ga0265342_100177533 | 219 |
| 862 | 3300031730 | Ga0307516_10083461 | Ga0307516_100834612 | 219 |
| 863 | 3300031730 | Ga0307516_10108644 | Ga0307516_101086442 | 219 |
| 864 | 3300031730 | Ga0307516_10365799 | Ga0307516_103657992 | 219 |
| 865 | 3300031731 | Ga0307405_10506897 | Ga0307405_105068971 | 219 |
| 866 | 3300031838 | Ga0307518_10202859 | Ga0307518_102028592 | 219 |
| 867 | 3300031852 | Ga0307410_10067714 | Ga0307410_100677142 | 219 |
| 868 | 3300031901 | Ga0307406_10237264 | Ga0307406_102372642 | 219 |
| 869 | 3300031903 | Ga0307407_10050849 | Ga0307407_100508492 | 219 |
| 870 | 3300031911 | Ga0307412_10000103 | Ga0307412_1000010363 | 219 |
| 871 | 3300031911 | Ga0307412_10135886 | Ga0307412_101358863 | 219 |
| 872 | 3300032002 | Ga0307416_100302784 | Ga0307416_1003027843 | 219 |
| 873 | 3300033180 | Ga0307510_10003490 | Ga0307510_1000349012 | 219 |
| 874 | 3300033180 | Ga0307510_10050330 | Ga0307510_100503303 | 219 |
| 875 | 3300033180 | Ga0307510_10165550 | Ga0307510_101655502 | 219 |
| 876 | 3300035083 | Ga0373926_0069117 | Ga0373926_0069117_48_707 | 219 |
| 877 | 3300035111 | Ga0373923_0068041 | Ga0373923_0068041_562_1221 | 219 |
| 878 | 3300035116 | Ga0373945_0009050 | Ga0373945_0009050_27_686 | 219 |
| 879 | 3300035116 | Ga0373945_0052026 | Ga0373945_0052026_513_1172 | 219 |
| 880 | 3300035117 | Ga0373953_0011049 | Ga0373953_0011049_430_1089 | 219 |
| 881 | 3300035118 | Ga0373954_0027905 | Ga0373954_0027905_1572_2231 | 219 |
| 882 | 3300035119 | Ga0373956_0082517 | Ga0373956_0082517_715_1374 | 219 |
| 883 | 3300035119 | Ga0373956_0144394 | Ga0373956_0144394_292_951 | 219 |
| 884 | 3300035120 | Ga0373957_0039296 | Ga0373957_0039296_146_805 | 219 |
| 885 | 3300035170 | Ga0373943_0007400 | Ga0373943_0007400_3816_4475 | 219 |
| 886 | 3300035170 | Ga0373943_0019919 | Ga0373943_0019919_1033_1692 | 219 |
| 887 | 3300035171 | Ga0373946_0009476 | Ga0373946_0009476_1504_2163 | 219 |
| 888 | 3300035171 | Ga0373946_0012966 | Ga0373946_0012966_1928_2587 | 219 |
| 889 | 3300035172 | Ga0373955_0090097 | Ga0373955_0090097_990_1649 | 219 |
| 890 | 3300035691 | Ga0373931_0041360 | Ga0373931_0041360_371_1030 | 219 |
| 891 | 3300035691 | Ga0373931_0267013 | Ga0373931_0267013_36_695 | 219 |
| 892 | 3300035692 | Ga0373935_0003835 | Ga0373935_0003835_4150_4809 | 219 |
| 893 | 3300035692 | Ga0373935_0011519 | Ga0373935_0011519_2358_3017 | 219 |
| 894 | 3300035692 | Ga0373935_0074394 | Ga0373935_0074394_250_909 | 219 |
| 895 | 3300035695 | Ga0373927_0008783 | Ga0373927_0008783_4397_5056 | 219 |
| 896 | 3300035695 | Ga0373927_0238663 | Ga0373927_0238663_502_1161 | 219 |
| 897 | 3300035724 | Ga0373933_0073002 | Ga0373933_0073002_592_1251 | 219 |
| 898 | 3300035724 | Ga0373933_0132089 | Ga0373933_0132089_424_1083 | 219 |
| 899 | 3300035725 | Ga0373947_0195196 | Ga0373947_0195196_573_1232 | 219 |
| 900 | 3300036401 | Ga0373937_0005447 | Ga0373937_0005447_4663_5322 | 219 |
| 901 | 3300036401 | Ga0373937_0031765 | Ga0373937_0031765_1429_2088 | 219 |
| 902 | 3300036401 | Ga0373937_0034002 | Ga0373937_0034002_2346_3005 | 219 |
| 903 | 3300037068 | Ga0373925_0005352 | Ga0373925_0005352_4608_5267 | 219 |
| 904 | 3300037068 | Ga0373925_0005721 | Ga0373925_0005721_3198_3857 | 219 |
| 905 | 3300037068 | Ga0373925_0045998 | Ga0373925_0045998_924_1583 | 219 |
| 906 | 3300037068 | Ga0373925_0111746 | Ga0373925_0111746_155_814 | 219 |
| 907 | 3300037312 | Ga0395899_0169155 | Ga0395899_0169155_528_1187 | 219 |
| 908 | 3300037853 | Ga0436364_1272123 | Ga0436364_1272123_484_1143 | 219 |
| 909 | 3300038443 | Ga0395901_0666498 | Ga0395901_0666498_304_963 | 219 |
| 910 | 3300039447 | Ga0436361_0505856 | Ga0436361_0505856_322_981 | 219 |
| 911 | 3300039447 | Ga0436361_1150952 | Ga0436361_1150952_75_734 | 219 |
| 912 | 3300041413 | Ga0439465_0017823 | Ga0439465_0017823_626_1285 | 219 |
| 913 | 3300041453 | Ga0451797_1197028 | Ga0451797_1197028_208_867 | 219 |
| 914 | 3300042012 | Ga0439455_0020293 | Ga0439455_0020293_550_1209 | 219 |
| 915 | 3300044842 | Ga0466957_0518864 | Ga0466957_0518864_50_709 | 219 |
| 916 | 3300045049 | Ga0466959_0024404 | Ga0466959_0024404_3472_4131 | 219 |
| 917 | 3300045976 | Ga0466967_0830168 | Ga0466967_0830168_89_748 | 219 |
| 918 | 3300046453 | Ga0495627_001781 | Ga0495627_001781_9935_10594 | 219 |
| 919 | 3300046453 | Ga0495627_026616 | Ga0495627_026616_365_1024 | 219 |
| 920 | 3300046454 | Ga0495592_0000058 | Ga0495592_0000058_86450_87109 | 219 |
| 921 | 3300046455 | Ga0495603_0024655 | Ga0495603_0024655_927_1586 | 219 |
| 922 | 3300046459 | Ga0495629_0062605 | Ga0495629_0062605_1829_2488 | 219 |
| 923 | 3300046459 | Ga0495629_0189013 | Ga0495629_0189013_610_1269 | 219 |
| 924 | 3300046460 | Ga0495638_0059645 | Ga0495638_0059645_826_1485 | 219 |
| 925 | 3300046462 | Ga0495651_0013472 | Ga0495651_0013472_4728_5387 | 219 |
| 926 | 3300046462 | Ga0495651_0030050 | Ga0495651_0030050_2234_2893 | 219 |
| 927 | 3300046472 | Ga0495580_0027386 | Ga0495580_0027386_2923_3582 | 219 |
| 928 | 3300046472 | Ga0495580_0100726 | Ga0495580_0100726_666_1325 | 219 |
| 929 | 3300046473 | Ga0495582_0006058 | Ga0495582_0006058_5513_6172 | 219 |
| 930 | 3300046475 | Ga0495639_0000527 | Ga0495639_0000527_11840_12499 | 219 |
| 931 | 3300046475 | Ga0495639_0003337 | Ga0495639_0003337_3903_4562 | 219 |
| 932 | 3300046476 | Ga0495662_0014614 | Ga0495662_0014614_1847_2506 | 219 |
| 933 | 3300046499 | Ga0495594_0076572 | Ga0495594_0076572_413_1072 | 219 |
| 934 | 3300046506 | Ga0495583_0135558 | Ga0495583_0135558_250_909 | 219 |
| 935 | 3300046507 | Ga0495606_0120222 | Ga0495606_0120222_691_1350 | 219 |
| 936 | 3300046511 | Ga0495608_0284989 | Ga0495608_0284989_107_766 | 219 |
| 937 | 3300046513 | Ga0495616_0059701 | Ga0495616_0059701_795_1454 | 219 |
| 938 | 3300046514 | Ga0495618_0370786 | Ga0495618_0370786_67_726 | 219 |
| 939 | 3300046515 | Ga0495620_0040968 | Ga0495620_0040968_636_1295 | 219 |
| 940 | 3300046516 | Ga0495628_0043368 | Ga0495628_0043368_1422_2081 | 219 |
| 941 | 3300046517 | Ga0495630_0208614 | Ga0495630_0208614_764_1423 | 219 |
| 942 | 3300046517 | Ga0495630_0210615 | Ga0495630_0210615_694_1353 | 219 |
| 943 | 3300046518 | Ga0495631_0091461 | Ga0495631_0091461_309_968 | 219 |
| 944 | 3300046520 | Ga0495637_0028144 | Ga0495637_0028144_473_1132 | 219 |
| 945 | 3300046530 | Ga0495654_0006581 | Ga0495654_0006581_5832_6491 | 219 |
| 946 | 3300046531 | Ga0495665_0001980 | Ga0495665_0001980_1981_2640 | 219 |
| 947 | 3300046533 | Ga0495640_0045396 | Ga0495640_0045396_764_1423 | 219 |
| 948 | 3300046535 | Ga0495586_0073032 | Ga0495586_0073032_973_1632 | 219 |
| 949 | 3300046536 | Ga0495587_0122264 | Ga0495587_0122264_58_717 | 219 |
| 950 | 3300046538 | Ga0495609_0132502 | Ga0495609_0132502_42_701 | 219 |
| 951 | 3300046542 | Ga0495597_0025222 | Ga0495597_0025222_298_957 | 219 |
| 952 | 3300046543 | Ga0495645_0028657 | Ga0495645_0028657_3284_3943 | 219 |
| 953 | 3300046559 | Ga0495667_0214978 | Ga0495667_0214978_159_818 | 219 |
| 954 | 3300046615 | Ga0495656_0026379 | Ga0495656_0026379_1544_2203 | 219 |
| 955 | 3300046616 | Ga0495668_0172949 | Ga0495668_0172949_50_709 | 219 |
| 956 | 3300046642 | Ga0495634_0099614 | Ga0495634_0099614_1153_1812 | 219 |
| 957 | 3300046660 | Ga0495625_0000044 | Ga0495625_0000044_5330_5989 | 219 |
| 958 | 3300046660 | Ga0495625_0001757 | Ga0495625_0001757_11888_12547 | 219 |
| 959 | 3300046660 | Ga0495625_0044628 | Ga0495625_0044628_1695_2354 | 219 |
| 960 | 3300046660 | Ga0495625_0104581 | Ga0495625_0104581_404_1063 | 219 |
| 961 | 3300046660 | Ga0495625_0300703 | Ga0495625_0300703_224_883 | 219 |
| 962 | 3300046663 | Ga0495635_0047625 | Ga0495635_0047625_829_1488 | 219 |
| 963 | 3300046665 | Ga0495661_0121689 | Ga0495661_0121689_238_897 | 219 |
| 964 | 3300046674 | Ga0495588_0001981 | Ga0495588_0001981_5652_6311 | 219 |
| 965 | 3300046674 | Ga0495588_0013031 | Ga0495588_0013031_2269_2928 | 219 |
| 966 | 3300046679 | Ga0495623_0172121 | Ga0495623_0172121_466_1125 | 219 |
| 967 | 3300046680 | Ga0495646_0060741 | Ga0495646_0060741_1082_1741 | 219 |
| 968 | 3300046680 | Ga0495646_0194311 | Ga0495646_0194311_190_849 | 219 |
| 969 | 3300046681 | Ga0495647_0001991 | Ga0495647_0001991_2399_3058 | 219 |
| 970 | 3300046681 | Ga0495647_0184587 | Ga0495647_0184587_219_878 | 219 |
| 971 | 3300046689 | Ga0495613_0006118 | Ga0495613_0006118_4117_4776 | 219 |
| 972 | 3300046690 | Ga0495624_0126357 | Ga0495624_0126357_183_842 | 219 |
| 973 | 3300046692 | Ga0495671_0028593 | Ga0495671_0028593_599_1258 | 219 |
| 974 | 3300046694 | Ga0495649_0002553 | Ga0495649_0002553_8210_8869 | 219 |
| 975 | 3300047315 | Ga0495581_0020189 | Ga0495581_0020189_1830_2489 | 219 |
| 976 | 3300047315 | Ga0495581_0398255 | Ga0495581_0398255_131_790 | 219 |
| 977 | 3300047319 | Ga0495674_0040879 | Ga0495674_0040879_2775_3434 | 219 |
| 978 | 3300047443 | Ga0495687_001915 | Ga0495687_001915_10435_11094 | 219 |
| 979 | 3300047443 | Ga0495687_002495 | Ga0495687_002495_13249_13908 | 219 |
| 980 | 3300047444 | Ga0495675_0218244 | Ga0495675_0218244_446_1105 | 219 |
| 981 | 3300047471 | Ga0495684_0019515 | Ga0495684_0019515_4227_4886 | 219 |
| 982 | 3300047471 | Ga0495684_0081495 | Ga0495684_0081495_1118_1777 | 219 |
| 983 | 3300047472 | Ga0495686_0000855 | Ga0495686_0000855_20187_20846 | 219 |
| 984 | 3300047472 | Ga0495686_0202994 | Ga0495686_0202994_317_976 | 219 |
| 985 | 3300047673 | Ga0495593_0024422 | Ga0495593_0024422_1781_2440 | 219 |
| 986 | 3300047673 | Ga0495593_0282854 | Ga0495593_0282854_22_681 | 219 |
| 987 | 3300048088 | Ga0495602_0116167 | Ga0495602_0116167_1147_1806 | 219 |
| 988 | 3300048088 | Ga0495602_0443322 | Ga0495602_0443322_204_863 | 219 |
| 989 | 3300048089 | Ga0495614_0019890 | Ga0495614_0019890_1679_2338 | 219 |
| 990 | 3300048903 | Ga0496100_0089520 | Ga0496100_0089520_970_1629 | 219 |
| 991 | 3300048904 | Ga0496101_0010070 | Ga0496101_0010070_3407_4066 | 219 |
| 992 | 3300048905 | Ga0496102_0004685 | Ga0496102_0004685_1821_2480 | 219 |
| 993 | 3300048905 | Ga0496102_0045183 | Ga0496102_0045183_2189_2848 | 219 |
| 994 | 3300048905 | Ga0496102_0245232 | Ga0496102_0245232_586_1245 | 219 |
| 995 | 3300048907 | Ga0496104_0001915 | Ga0496104_0001915_11873_12532 | 219 |
| 996 | 3300048907 | Ga0496104_0313739 | Ga0496104_0313739_768_1427 | 219 |
| 997 | 3300048907 | Ga0496104_0341078 | Ga0496104_0341078_342_1001 | 219 |
| 998 | 3300048907 | Ga0496104_0757074 | Ga0496104_0757074_137_796 | 219 |
| 999 | 3300048908 | Ga0496105_0002495 | Ga0496105_0002495_11036_11695 | 219 |
| 1000 | 3300048908 | Ga0496105_0239951 | Ga0496105_0239951_411_1070 | 219 |
| 1001 | 3300048909 | Ga0496106_0008837 | Ga0496106_0008837_2041_2700 | 219 |
| 1002 | 3300048909 | Ga0496106_0017642 | Ga0496106_0017642_679_1338 | 219 |
| 1003 | 3300048909 | Ga0496106_0112230 | Ga0496106_0112230_583_1242 | 219 |
| 1004 | 3300048909 | Ga0496106_0273791 | Ga0496106_0273791_605_1264 | 219 |
| 1005 | 3300048911 | Ga0496108_0120449 | Ga0496108_0120449_1500_2159 | 219 |
| 1006 | 3300048911 | Ga0496108_0262172 | Ga0496108_0262172_97_756 | 219 |
| 1007 | 3300048912 | Ga0496109_0018574 | Ga0496109_0018574_1107_1766 | 219 |
| 1008 | 3300048912 | Ga0496109_0198905 | Ga0496109_0198905_798_1457 | 219 |
| 1009 | 3300048912 | Ga0496109_0356059 | Ga0496109_0356059_562_1221 | 219 |
| 1010 | 3300048912 | Ga0496109_0491563 | Ga0496109_0491563_75_734 | 219 |
| 1011 | 3300048912 | Ga0496109_0616600 | Ga0496109_0616600_288_947 | 219 |
| 1012 | 3300048913 | Ga0496110_0001550 | Ga0496110_0001550_12616_13275 | 219 |
| 1013 | 3300048914 | Ga0496111_0002155 | Ga0496111_0002155_1184_1843 | 219 |
| 1014 | 3300048915 | Ga0496112_0000484 | Ga0496112_0000484_18505_19164 | 219 |
| 1015 | 3300048915 | Ga0496112_0002564 | Ga0496112_0002564_7137_7796 | 219 |
| 1016 | 3300048916 | Ga0496113_0312122 | Ga0496113_0312122_360_1019 | 219 |
| 1017 | 3300048917 | Ga0496114_0156535 | Ga0496114_0156535_98_757 | 219 |
| 1018 | 3300048917 | Ga0496114_0254961 | Ga0496114_0254961_655_1314 | 219 |
| 1019 | 3300048917 | Ga0496114_0257652 | Ga0496114_0257652_240_899 | 219 |
| 1020 | 3300048918 | Ga0496115_0051529 | Ga0496115_0051529_1147_1806 | 219 |
| 1021 | 3300048918 | Ga0496115_0201079 | Ga0496115_0201079_948_1607 | 219 |
| 1022 | 3300048919 | Ga0496116_0010409 | Ga0496116_0010409_5488_6147 | 219 |
| 1023 | 3300048919 | Ga0496116_0038983 | Ga0496116_0038983_560_1219 | 219 |
| 1024 | 3300048919 | Ga0496116_0079763 | Ga0496116_0079763_707_1366 | 219 |
| 1025 | 3300048920 | Ga0496117_0009415 | Ga0496117_0009415_6243_6902 | 219 |
| 1026 | 3300048920 | Ga0496117_0036187 | Ga0496117_0036187_1573_2232 | 219 |
| 1027 | 3300048920 | Ga0496117_0060047 | Ga0496117_0060047_1216_1875 | 219 |
| 1028 | 3300048921 | Ga0496118_0011374 | Ga0496118_0011374_6824_7483 | 219 |
| 1029 | 3300048921 | Ga0496118_0020167 | Ga0496118_0020167_1251_1910 | 219 |
| 1030 | 3300048922 | Ga0496119_0011498 | Ga0496119_0011498_571_1230 | 219 |
| 1031 | 3300048923 | Ga0496120_0007023 | Ga0496120_0007023_1902_2561 | 219 |
| 1032 | 3300048924 | Ga0496121_0000628 | Ga0496121_0000628_61450_62109 | 219 |
| 1033 | 3300048924 | Ga0496121_0154001 | Ga0496121_0154001_195_854 | 219 |
| 1034 | 3300048925 | Ga0496122_0001687 | Ga0496122_0001687_17722_18381 | 219 |
| 1035 | 3300048925 | Ga0496122_0017137 | Ga0496122_0017137_1123_1782 | 219 |
| 1036 | 3300048925 | Ga0496122_0017870 | Ga0496122_0017870_3487_4146 | 219 |
| 1037 | 3300048926 | Ga0496123_0007576 | Ga0496123_0007576_8381_9040 | 219 |
| 1038 | 3300048926 | Ga0496123_0024177 | Ga0496123_0024177_1318_1977 | 219 |
| 1039 | 3300048926 | Ga0496123_0053452 | Ga0496123_0053452_1117_1776 | 219 |
| 1040 | 3300048926 | Ga0496123_0099931 | Ga0496123_0099931_447_1106 | 219 |
| 1041 | 3300048927 | Ga0496124_0000038 | Ga0496124_0000038_287180_287839 | 219 |
| 1042 | 3300048927 | Ga0496124_0080017 | Ga0496124_0080017_14_673 | 219 |
| 1043 | 3300048927 | Ga0496124_0134848 | Ga0496124_0134848_910_1569 | 219 |
| 1044 | 3300048927 | Ga0496124_0247896 | Ga0496124_0247896_101_760 | 219 |
| 1045 | 3300048928 | Ga0496125_0000101 | Ga0496125_0000101_63691_64350 | 219 |
| 1046 | 3300048928 | Ga0496125_0002468 | Ga0496125_0002468_10932_11591 | 219 |
| 1047 | 3300048929 | Ga0496126_0022852 | Ga0496126_0022852_1156_1815 | 219 |
| 1048 | 3300049460 | Ga0495682_0034033 | Ga0495682_0034033_1075_1734 | 219 |
| 1049 | 3300049569 | Ga0501032_0119629 | Ga0501032_0119629_372_1031 | 219 |
| 1050 | 3300049571 | Ga0501034_0181401 | Ga0501034_0181401_1311_1970 | 219 |
| 1051 | 3300049579 | Ga0501043_0151525 | Ga0501043_0151525_209_868 | 219 |
| 1052 | 3300049585 | Ga0501069_0361892 | Ga0501069_0361892_112_771 | 219 |
| 1053 | 3300049822 | Ga0501035_0005453 | Ga0501035_0005453_3691_4350 | 219 |
| 1054 | 3300049822 | Ga0501035_0017221 | Ga0501035_0017221_5428_6087 | 219 |
| 1055 | 3300049823 | Ga0501044_0000617 | Ga0501044_0000617_30406_31065 | 219 |
| 1056 | 3300050489 | nmdc:mga03683_2310_c1 | nmdc:mga03683_2310_c1_4718_5377 | 219 |
| 1057 | 3300050490 | nmdc:mga03n38_163278_c1 | nmdc:mga03n38_163278_c1_350_1009 | 219 |
| 1058 | 3300050491 | nmdc:mga00v17_142216_c1 | nmdc:mga00v17_142216_c1_816_1475 | 219 |
| 1059 | 3300050491 | nmdc:mga00v17_191249_c1 | nmdc:mga00v17_191249_c1_420_1079 | 219 |
| 1060 | 3300050493 | nmdc:mga0k408_21666_c1 | nmdc:mga0k408_21666_c1_1919_2578 | 219 |
| 1061 | 3300050493 | nmdc:mga0k408_37220_c1 | nmdc:mga0k408_37220_c1_156_815 | 219 |
| 1062 | 3300050493 | nmdc:mga0k408_55853_c2 | nmdc:mga0k408_55853_c2_566_1225 | 219 |
| 1063 | 3300050493 | nmdc:mga0k408_61082_c1 | nmdc:mga0k408_61082_c1_1216_1875 | 219 |
| 1064 | 3300050494 | nmdc:mga06z11_194647_c1 | nmdc:mga06z11_194647_c1_375_1034 | 219 |
| 1065 | 3300050494 | nmdc:mga06z11_47515_c1 | nmdc:mga06z11_47515_c1_184_843 | 219 |
| 1066 | 3300050496 | nmdc:mga07m45_106055_c1 | nmdc:mga07m45_106055_c1_676_1335 | 219 |
| 1067 | 3300050496 | nmdc:mga07m45_112789_c1 | nmdc:mga07m45_112789_c1_561_1220 | 219 |
| 1068 | 3300050496 | nmdc:mga07m45_19464_c1 | nmdc:mga07m45_19464_c1_1683_2342 | 219 |
| 1069 | 3300050496 | nmdc:mga07m45_2222_c1 | nmdc:mga07m45_2222_c1_7160_7819 | 219 |
| 1070 | 3300050496 | nmdc:mga07m45_36348_c1 | nmdc:mga07m45_36348_c1_1737_2396 | 219 |
| 1071 | 3300050496 | nmdc:mga07m45_51032_c1 | nmdc:mga07m45_51032_c1_1176_1835 | 219 |
| 1072 | 3300050496 | nmdc:mga07m45_9406_c1 | nmdc:mga07m45_9406_c1_4102_4761 | 219 |
| 1073 | 3300050507 | nmdc:mga05p37_8884_c1 | nmdc:mga05p37_8884_c1_7938_8597 | 219 |
| 1074 | 3300050509 | nmdc:mga0qj67_154633_c1 | nmdc:mga0qj67_154633_c1_126_785 | 219 |
| 1075 | 3300050510 | nmdc:mga06r32_8090_c1 | nmdc:mga06r32_8090_c1_3944_4603 | 219 |
| 1076 | 3300050511 | nmdc:mga08y16_7489_c2 | nmdc:mga08y16_7489_c2_5983_6642 | 219 |
| 1077 | 3300050512 | nmdc:mga0n895_157502_c1 | nmdc:mga0n895_157502_c1_1391_2050 | 219 |
| 1078 | 3300050513 | nmdc:mga0rr50_1036592_c1 | nmdc:mga0rr50_1036592_c1_29_688 | 219 |
| 1079 | 3300050513 | nmdc:mga0rr50_3745_c1 | nmdc:mga0rr50_3745_c1_7109_7768 | 219 |
| 1080 | 3300050514 | nmdc:mga08x19_115329_c1 | nmdc:mga08x19_115329_c1_1075_1734 | 219 |
| 1081 | 3300050514 | nmdc:mga08x19_385097_c1 | nmdc:mga08x19_385097_c1_80_739 | 219 |
| 1082 | 3300050515 | nmdc:mga0a205_361352_c1 | nmdc:mga0a205_361352_c1_366_1025 | 219 |
| 1083 | 3300050516 | nmdc:mga0sz30_82364_c1 | nmdc:mga0sz30_82364_c1_57_716 | 219 |
| 1084 | 3300053077 | Ga0495601_0169730 | Ga0495601_0169730_293_952 | 219 |
| 1085 | 3300053079 | Ga0500610_0041935 | Ga0500610_0041935_1072_1731 | 219 |
| 1086 | 3300053085 | Ga0495619_0010470 | Ga0495619_0010470_3911_4570 | 219 |
| 1087 | 3300053086 | Ga0500578_0025790 | Ga0500578_0025790_1367_2026 | 219 |
| 1088 | 3300053088 | Ga0500644_0028309 | Ga0500644_0028309_1061_1720 | 219 |
| 1089 | 3300053093 | Ga0500651_0076426 | Ga0500651_0076426_816_1475 | 219 |
| 1090 | 3300053096 | Ga0500641_0011423 | Ga0500641_0011423_127_786 | 219 |
| 1091 | 3300053109 | Ga0500569_035158 | Ga0500569_035158_446_1105 | 219 |
| 1092 | 3300053117 | Ga0500593_000470 | Ga0500593_000470_14355_15014 | 219 |
| 1093 | 3300053117 | Ga0500593_000946 | Ga0500593_000946_4641_5300 | 219 |
| 1094 | 3300053118 | Ga0500594_0003238 | Ga0500594_0003238_1197_1856 | 219 |
| 1095 | 3300053121 | Ga0500607_000025 | Ga0500607_000025_49930_50589 | 219 |
| 1096 | 3300053121 | Ga0500607_036582 | Ga0500607_036582_1619_2278 | 219 |
| 1097 | 3300053122 | Ga0500608_000731 | Ga0500608_000731_6823_7482 | 219 |
| 1098 | 3300053122 | Ga0500608_161797 | Ga0500608_161797_126_785 | 219 |
| 1099 | 3300053123 | Ga0500614_015886 | Ga0500614_015886_453_1112 | 219 |
| 1100 | 3300053129 | Ga0500628_003649 | Ga0500628_003649_623_1282 | 219 |
| 1101 | 3300053130 | Ga0500642_0009522 | Ga0500642_0009522_1008_1667 | 219 |
| 1102 | 3300053131 | Ga0500652_095950 | Ga0500652_095950_547_1206 | 219 |
| 1103 | 3300053134 | Ga0500658_0012428 | Ga0500658_0012428_661_1320 | 219 |
| 1104 | 3300053136 | Ga0500559_0000326 | Ga0500559_0000326_14358_15017 | 219 |
| 1105 | 3300053136 | Ga0500559_0040466 | Ga0500559_0040466_514_1173 | 219 |
| 1106 | 3300053139 | Ga0500568_0095497 | Ga0500568_0095497_28_687 | 219 |
| 1107 | 3300053153 | Ga0500616_0060192 | Ga0500616_0060192_893_1552 | 219 |
| 1108 | 3300053154 | Ga0500619_018760 | Ga0500619_018760_811_1470 | 219 |
| 1109 | 3300053156 | Ga0500622_0004224 | Ga0500622_0004224_5238_5897 | 219 |
| 1110 | 3300053157 | Ga0500624_004850 | Ga0500624_004850_928_1587 | 219 |
| 1111 | 3300053158 | Ga0500627_0039467 | Ga0500627_0039467_966_1625 | 219 |
| 1112 | 3300053177 | Ga0500636_0085747 | Ga0500636_0085747_79_738 | 219 |
| 1113 | 3300053730 | Ga0500645_005314 | Ga0500645_005314_3830_4489 | 219 |
| 1114 | 3300053730 | Ga0500645_006086 | Ga0500645_006086_2982_3641 | 219 |
| 1115 | 3300053739 | Ga0500587_000798 | Ga0500587_000798_3081_3740 | 219 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
33
217
0.91
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8099 | 1 | 214 |
| 4ymu-assembly1.cif.gz_C | crystal structure of an amino acid abc transporter complex with arginines and atps | 0.8032 | 1 | 214 |
| 4jbw-assembly1.cif.gz_F | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7192 | 20 | 160 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.7091 | 11 | 160 |
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.7019 | 6 | 215 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ymsD00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8057 | 1 | 215 | 1.10.3720.10 |
| af_P0AFT2_3_219_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8017 | 6 | 214 | 1.10.3720.10 |
| af_P0AEQ6_1_218_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8009 | 1 | 217 | 1.10.3720.10 |
| 4ymsD00 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.799 | 1 | 215 | 1.10.3720.10 |
| af_P52094_1_222_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.7957 | 8 | 217 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W6XUN9-F1-model_v4 | ABC transporter permease | 0.8717 | 1 | 168 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A4Q0IZF8-F1-model_v4 | deleted | 0.87 | 22 | 167 |
|
| AF-A0A5N8A1F9-F1-model_v4 | Amino acid ABC transporter permease | 0.8682 | 1 | 168 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A1Q4AME9-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.8642 | 1 | 215 |
GO:0006865
GO:0022857 GO:0043190 |
| AF-A0A7Z7YS21-F1-model_v4 | Amino acid ABC transporter permease | 0.8637 | 17 | 158 |
GO:0006865
GO:0015675 GO:0022857 GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar