F490210
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1110 | 389 | 2220 | 229 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100256254|Ga0070714_1002562541 |
| Length | 276 |
| Sequence | MSTPPGKLHDHGKFSALGRVSGLAGPGPGPRFGTAVMTRVLVIDDEEPILRALRINLAAHKYEVSTAVDGASGLAAIARDRPDVVILDLGLPDMDGTEVISGVRGWTSMPIIVLSAWGQESQKVAALDAGADDYVTKPFGMGELLARLRVAVRRASPAPDEPVVVSGDFTVDLAAKRVHRQRDGADVRLTPTEWQLLEVLVRHREKLVTQRQLLAEVWGPEYQTEGNYLRVYMAHLRRKLEPDPSRPRYLVTEPGIGYRFTATGSGDASPPEGRSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 117 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 183 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 184 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 188 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 189 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 194 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 195 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 197 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 199 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 201 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 202 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 208 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 211 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 212 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 213 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 214 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 215 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 216 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 217 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 218 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 219 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 222 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 223 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 224 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 225 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 226 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 228 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 249 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 251 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 252 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 253 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 257 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 265 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 266 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 267 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 268 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 269 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 270 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 271 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 272 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 273 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 274 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 275 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 326 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 327 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 333 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 334 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 335 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 336 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 339 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 340 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 375 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 376 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 377 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 378 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 379 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 380 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 383 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 384 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 385 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 386 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 387 | 2904479285 | Comamonas sediminis 4487 | Isolate | Rhizosphere |
| 388 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 389 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.02 |
| Metatranscriptomes | 1.44 |
| Isolates | 0.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.54 |
| Nodule | 0 |
| Rhizoplane | 6.04 |
| Rhizosphere | 90.63 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070714_100256254 | 3300005435 | Bacteria | 1619 |
| 2 | JGI24735J21928_10093592 | 3300002067 | Bacteria | 862 |
| 3 | JGI24744J21845_10005151 | 3300002077 | Bacteria | 2705 |
| 4 | JGI25406J46586_10006130 | 3300003203 | Bacteria | 5552 |
| 5 | Ga0070658_10006845 | 3300005327 | Bacteria | 9215 |
| 6 | Ga0070658_10023598 | 3300005327 | Bacteria | 4935 |
| 7 | Ga0070658_10064156 | 3300005327 | Bacteria | 2996 |
| 8 | Ga0070658_10257089 | 3300005327 | Bacteria | 1482 |
| 9 | Ga0070658_10283857 | 3300005327 | Bacteria | 1409 |
| 10 | Ga0070676_10104111 | 3300005328 | Bacteria | 1758 |
| 11 | Ga0070676_10452015 | 3300005328 | Bacteria | 903 |
| 12 | Ga0070683_100004571 | 3300005329 | Bacteria | 11420 |
| 13 | Ga0070683_100059709 | 3300005329 | Bacteria | 3543 |
| 14 | Ga0070683_100064566 | 3300005329 | Bacteria | 3408 |
| 15 | Ga0070683_100101131 | 3300005329 | Bacteria | 2714 |
| 16 | Ga0070683_100113133 | 3300005329 | Bacteria | 2561 |
| 17 | Ga0070683_100127961 | 3300005329 | Bacteria | 2402 |
| 18 | Ga0070683_100144915 | 3300005329 | Bacteria | 2250 |
| 19 | Ga0070683_100153307 | 3300005329 | Bacteria | 2185 |
| 20 | Ga0070683_100167567 | 3300005329 | Bacteria | 2085 |
| 21 | Ga0070683_100232294 | 3300005329 | Bacteria | 1753 |
| 22 | Ga0070683_100321577 | 3300005329 | Bacteria | 1472 |
| 23 | Ga0070670_100081101 | 3300005331 | Bacteria | 2788 |
| 24 | Ga0070670_100628995 | 3300005331 | Bacteria | 962 |
| 25 | Ga0068869_100018522 | 3300005334 | Bacteria | 4742 |
| 26 | Ga0068869_100030074 | 3300005334 | Bacteria | 3809 |
| 27 | Ga0070680_100290980 | 3300005336 | Bacteria | 1384 |
| 28 | Ga0070682_100008855 | 3300005337 | Bacteria | 5683 |
| 29 | Ga0070682_100151536 | 3300005337 | Bacteria | 1591 |
| 30 | Ga0070682_100576076 | 3300005337 | Bacteria | 885 |
| 31 | Ga0068868_100004265 | 3300005338 | Bacteria | 10005 |
| 32 | Ga0068868_100024352 | 3300005338 | Bacteria | 4593 |
| 33 | Ga0070660_100019041 | 3300005339 | Bacteria | 5025 |
| 34 | Ga0070660_100027145 | 3300005339 | Bacteria | 4271 |
| 35 | Ga0070660_100129995 | 3300005339 | Bacteria | 2014 |
| 36 | Ga0070660_100397204 | 3300005339 | Bacteria | 1140 |
| 37 | Ga0070689_100408094 | 3300005340 | Bacteria | 1149 |
| 38 | Ga0070689_100564929 | 3300005340 | Bacteria | 982 |
| 39 | Ga0070691_10024889 | 3300005341 | Bacteria | 2785 |
| 40 | Ga0070691_10101628 | 3300005341 | Bacteria | 1428 |
| 41 | Ga0070661_100030787 | 3300005344 | Bacteria | 3878 |
| 42 | Ga0070661_100085981 | 3300005344 | Bacteria | 2324 |
| 43 | Ga0070661_100457680 | 3300005344 | Bacteria | 1016 |
| 44 | Ga0070661_100499430 | 3300005344 | Bacteria | 974 |
| 45 | Ga0070692_10146692 | 3300005345 | Bacteria | 1340 |
| 46 | Ga0070692_10195973 | 3300005345 | Bacteria | 1180 |
| 47 | Ga0070668_100017010 | 3300005347 | Bacteria | 5440 |
| 48 | Ga0070668_100225900 | 3300005347 | Bacteria | 1546 |
| 49 | Ga0070669_100350604 | 3300005353 | Bacteria | 1198 |
| 50 | Ga0070669_100436787 | 3300005353 | Bacteria | 1077 |
| 51 | Ga0070675_100002740 | 3300005354 | Bacteria | 13250 |
| 52 | Ga0070675_100080840 | 3300005354 | Bacteria | 2709 |
| 53 | Ga0070675_100085263 | 3300005354 | Bacteria | 2639 |
| 54 | Ga0070675_100167581 | 3300005354 | Bacteria | 1893 |
| 55 | Ga0070675_100450683 | 3300005354 | Bacteria | 1154 |
| 56 | Ga0070674_100068747 | 3300005356 | Bacteria | 2497 |
| 57 | Ga0070674_100260495 | 3300005356 | Bacteria | 1366 |
| 58 | Ga0070674_100922664 | 3300005356 | Bacteria | 762 |
| 59 | Ga0070673_100117165 | 3300005364 | Bacteria | 2216 |
| 60 | Ga0070688_100287082 | 3300005365 | Bacteria | 1184 |
| 61 | Ga0070659_100037838 | 3300005366 | Bacteria | 3762 |
| 62 | Ga0070659_100112961 | 3300005366 | Bacteria | 2194 |
| 63 | Ga0070659_100155108 | 3300005366 | Bacteria | 1869 |
| 64 | Ga0070709_10003021 | 3300005434 | Bacteria | 9039 |
| 65 | Ga0070709_10028678 | 3300005434 | Bacteria | 3322 |
| 66 | Ga0070709_10039282 | 3300005434 | Bacteria | 2903 |
| 67 | Ga0070709_10040725 | 3300005434 | Bacteria | 2858 |
| 68 | Ga0070709_10067334 | 3300005434 | Bacteria | 2299 |
| 69 | Ga0070709_10112358 | 3300005434 | Bacteria | 1833 |
| 70 | Ga0070714_100000452 | 3300005435 | Bacteria | 29888 |
| 71 | Ga0070714_100001028 | 3300005435 | Bacteria | 19875 |
| 72 | Ga0070714_100005940 | 3300005435 | Bacteria | 9370 |
| 73 | Ga0070714_100005955 | 3300005435 | Bacteria | 9363 |
| 74 | Ga0070714_100082551 | 3300005435 | Bacteria | 2800 |
| 75 | Ga0070714_100083836 | 3300005435 | Bacteria | 2780 |
| 76 | Ga0070714_100276806 | 3300005435 | Bacteria | 1558 |
| 77 | Ga0070713_100007261 | 3300005436 | Bacteria | 7760 |
| 78 | Ga0070713_100010227 | 3300005436 | Bacteria | 6771 |
| 79 | Ga0070713_100024420 | 3300005436 | Bacteria | 4707 |
| 80 | Ga0070713_100037406 | 3300005436 | Bacteria | 3924 |
| 81 | Ga0070713_100065592 | 3300005436 | Bacteria | 3051 |
| 82 | Ga0070713_100147037 | 3300005436 | Bacteria | 2093 |
| 83 | Ga0070713_100280114 | 3300005436 | Bacteria | 1529 |
| 84 | Ga0070713_100292505 | 3300005436 | Bacteria | 1497 |
| 85 | Ga0070713_100330256 | 3300005436 | Bacteria | 1410 |
| 86 | Ga0070710_10008259 | 3300005437 | Bacteria | 5067 |
| 87 | Ga0070710_10018475 | 3300005437 | Bacteria | 3587 |
| 88 | Ga0070710_10082483 | 3300005437 | Bacteria | 1880 |
| 89 | Ga0070710_10088860 | 3300005437 | Bacteria | 1819 |
| 90 | Ga0070710_10184202 | 3300005437 | Bacteria | 1309 |
| 91 | Ga0070701_10006868 | 3300005438 | Bacteria | 4816 |
| 92 | Ga0070701_10025713 | 3300005438 | Bacteria | 2862 |
| 93 | Ga0070711_100021021 | 3300005439 | Bacteria | 4215 |
| 94 | Ga0070711_100032826 | 3300005439 | Bacteria | 3454 |
| 95 | Ga0070711_100043948 | 3300005439 | Bacteria | 3029 |
| 96 | Ga0070705_100076262 | 3300005440 | Bacteria | 2044 |
| 97 | Ga0070705_100123531 | 3300005440 | Bacteria | 1675 |
| 98 | Ga0070700_100009488 | 3300005441 | Bacteria | 5345 |
| 99 | Ga0070700_100033665 | 3300005441 | Bacteria | 3088 |
| 100 | Ga0070700_100278561 | 3300005441 | Bacteria | 1212 |
| 101 | Ga0070708_100534018 | 3300005445 | Bacteria | 1106 |
| 102 | Ga0070663_100026326 | 3300005455 | Bacteria | 3939 |
| 103 | Ga0070663_100055561 | 3300005455 | Bacteria | 2834 |
| 104 | Ga0070663_100085492 | 3300005455 | Bacteria | 2328 |
| 105 | Ga0070663_100233430 | 3300005455 | Bacteria | 1449 |
| 106 | Ga0070663_100331677 | 3300005455 | Bacteria | 1226 |
| 107 | Ga0070678_100015224 | 3300005456 | Bacteria | 4882 |
| 108 | Ga0070678_100096045 | 3300005456 | Bacteria | 2285 |
| 109 | Ga0070678_100224580 | 3300005456 | Bacteria | 1562 |
| 110 | Ga0070662_100063633 | 3300005457 | Bacteria | 2699 |
| 111 | Ga0070681_10009600 | 3300005458 | Bacteria | 9514 |
| 112 | Ga0070681_10313312 | 3300005458 | Bacteria | 1479 |
| 113 | Ga0070681_10419697 | 3300005458 | Bacteria | 1250 |
| 114 | Ga0068867_100007002 | 3300005459 | Bacteria | 7968 |
| 115 | Ga0070685_10043361 | 3300005466 | Bacteria | 2571 |
| 116 | Ga0070685_10060364 | 3300005466 | Bacteria | 2217 |
| 117 | Ga0070685_10064127 | 3300005466 | Bacteria | 2160 |
| 118 | Ga0070685_10391648 | 3300005466 | Bacteria | 960 |
| 119 | Ga0070706_100001048 | 3300005467 | Bacteria | 30008 |
| 120 | Ga0070706_100003836 | 3300005467 | Bacteria | 14695 |
| 121 | Ga0070706_100005036 | 3300005467 | Bacteria | 12629 |
| 122 | Ga0070706_100006933 | 3300005467 | Bacteria | 10691 |
| 123 | Ga0070706_100007675 | 3300005467 | Bacteria | 10090 |
| 124 | Ga0070706_100079469 | 3300005467 | Bacteria | 3035 |
| 125 | Ga0070706_100088284 | 3300005467 | Bacteria | 2875 |
| 126 | Ga0070706_100208006 | 3300005467 | Bacteria | 1827 |
| 127 | Ga0070706_100631577 | 3300005467 | Bacteria | 994 |
| 128 | Ga0070706_100906047 | 3300005467 | Bacteria | 815 |
| 129 | Ga0070707_100000792 | 3300005468 | Bacteria | 31220 |
| 130 | Ga0070707_100023200 | 3300005468 | Bacteria | 5869 |
| 131 | Ga0070707_100029054 | 3300005468 | Bacteria | 5262 |
| 132 | Ga0070707_100035864 | 3300005468 | Bacteria | 4732 |
| 133 | Ga0070707_100045292 | 3300005468 | Bacteria | 4211 |
| 134 | Ga0070707_100120283 | 3300005468 | Bacteria | 2549 |
| 135 | Ga0070707_100121840 | 3300005468 | Bacteria | 2532 |
| 136 | Ga0070707_100233253 | 3300005468 | Bacteria | 1791 |
| 137 | Ga0070707_100372866 | 3300005468 | Bacteria | 1387 |
| 138 | Ga0070698_100006771 | 3300005471 | Bacteria | 12423 |
| 139 | Ga0070698_100008876 | 3300005471 | Bacteria | 10807 |
| 140 | Ga0070698_100011521 | 3300005471 | Bacteria | 9383 |
| 141 | Ga0070698_100037550 | 3300005471 | Bacteria | 4994 |
| 142 | Ga0070698_100038643 | 3300005471 | Bacteria | 4917 |
| 143 | Ga0070698_100076311 | 3300005471 | Bacteria | 3354 |
| 144 | Ga0070698_100077164 | 3300005471 | Bacteria | 3332 |
| 145 | Ga0070698_100118694 | 3300005471 | Bacteria | 2606 |
| 146 | Ga0070698_100222699 | 3300005471 | Bacteria | 1820 |
| 147 | Ga0070698_100322806 | 3300005471 | Bacteria | 1475 |
| 148 | Ga0070699_100001575 | 3300005518 | Bacteria | 20852 |
| 149 | Ga0070699_100002101 | 3300005518 | Bacteria | 18041 |
| 150 | Ga0070699_100068500 | 3300005518 | Bacteria | 3082 |
| 151 | Ga0070699_100321845 | 3300005518 | Bacteria | 1390 |
| 152 | Ga0070699_100529912 | 3300005518 | Bacteria | 1071 |
| 153 | Ga0070699_100703631 | 3300005518 | Bacteria | 923 |
| 154 | Ga0070679_100003755 | 3300005530 | Bacteria | 13929 |
| 155 | Ga0070679_100008909 | 3300005530 | Bacteria | 9470 |
| 156 | Ga0070679_100031308 | 3300005530 | Bacteria | 5254 |
| 157 | Ga0070679_100111734 | 3300005530 | Bacteria | 2719 |
| 158 | Ga0070679_100745761 | 3300005530 | Bacteria | 922 |
| 159 | Ga0070679_100873675 | 3300005530 | Bacteria | 842 |
| 160 | Ga0070684_100019147 | 3300005535 | Bacteria | 5660 |
| 161 | Ga0070684_100019292 | 3300005535 | Bacteria | 5638 |
| 162 | Ga0070684_100158834 | 3300005535 | Bacteria | 2050 |
| 163 | Ga0070684_100200043 | 3300005535 | Bacteria | 1819 |
| 164 | Ga0070684_100230379 | 3300005535 | Bacteria | 1691 |
| 165 | Ga0070684_100743007 | 3300005535 | Bacteria | 916 |
| 166 | Ga0070684_100880707 | 3300005535 | Bacteria | 838 |
| 167 | Ga0070697_100010976 | 3300005536 | Bacteria | 7077 |
| 168 | Ga0070697_100061101 | 3300005536 | Bacteria | 3073 |
| 169 | Ga0068853_100163892 | 3300005539 | Bacteria | 2007 |
| 170 | Ga0068853_100257281 | 3300005539 | Bacteria | 1604 |
| 171 | Ga0070672_100001312 | 3300005543 | Bacteria | 15342 |
| 172 | Ga0070686_100020181 | 3300005544 | Bacteria | 3941 |
| 173 | Ga0070686_100112921 | 3300005544 | Bacteria | 1854 |
| 174 | Ga0070686_100154360 | 3300005544 | Bacteria | 1611 |
| 175 | Ga0070695_100099157 | 3300005545 | Bacteria | 1959 |
| 176 | Ga0070696_100103024 | 3300005546 | Bacteria | 2047 |
| 177 | Ga0070693_100050430 | 3300005547 | Bacteria | 2379 |
| 178 | Ga0070693_100060807 | 3300005547 | Bacteria | 2194 |
| 179 | Ga0070693_100152791 | 3300005547 | Bacteria | 1464 |
| 180 | Ga0070693_100223269 | 3300005547 | Bacteria | 1235 |
| 181 | Ga0070665_100054642 | 3300005548 | Bacteria | 4005 |
| 182 | Ga0070665_100589065 | 3300005548 | Bacteria | 1125 |
| 183 | Ga0068855_100058270 | 3300005563 | Bacteria | 4524 |
| 184 | Ga0068855_100097460 | 3300005563 | Bacteria | 3387 |
| 185 | Ga0070664_100009193 | 3300005564 | Bacteria | 8023 |
| 186 | Ga0070664_100299231 | 3300005564 | Bacteria | 1454 |
| 187 | Ga0070664_100355724 | 3300005564 | Bacteria | 1333 |
| 188 | Ga0070664_100460177 | 3300005564 | Bacteria | 1169 |
| 189 | Ga0070664_100548494 | 3300005564 | Bacteria | 1069 |
| 190 | Ga0068857_100004338 | 3300005577 | Bacteria | 11970 |
| 191 | Ga0068857_100045347 | 3300005577 | Bacteria | 3900 |
| 192 | Ga0068857_100073149 | 3300005577 | Bacteria | 3053 |
| 193 | Ga0068857_100400311 | 3300005577 | Bacteria | 1277 |
| 194 | Ga0068857_100497630 | 3300005577 | Bacteria | 1144 |
| 195 | Ga0068854_100011357 | 3300005578 | Bacteria | 5794 |
| 196 | Ga0068854_100013890 | 3300005578 | Bacteria | 5296 |
| 197 | Ga0068854_100028924 | 3300005578 | Bacteria | 3833 |
| 198 | Ga0068856_100108541 | 3300005614 | Bacteria | 2772 |
| 199 | Ga0068856_100530346 | 3300005614 | Bacteria | 1198 |
| 200 | Ga0070702_100007486 | 3300005615 | Bacteria | 5232 |
| 201 | Ga0070702_100017373 | 3300005615 | Bacteria | 3710 |
| 202 | Ga0070702_100025155 | 3300005615 | Bacteria | 3186 |
| 203 | Ga0070702_100237246 | 3300005615 | Bacteria | 1229 |
| 204 | Ga0070702_100379323 | 3300005615 | Bacteria | 1005 |
| 205 | Ga0068852_100192661 | 3300005616 | Bacteria | 1924 |
| 206 | Ga0068859_100041006 | 3300005617 | Bacteria | 4650 |
| 207 | Ga0068864_100012042 | 3300005618 | Bacteria | 7143 |
| 208 | Ga0068864_100068223 | 3300005618 | Bacteria | 3089 |
| 209 | Ga0068864_100244236 | 3300005618 | Bacteria | 1664 |
| 210 | Ga0068864_100403177 | 3300005618 | Bacteria | 1300 |
| 211 | Ga0068864_100645846 | 3300005618 | Bacteria | 1030 |
| 212 | Ga0068864_101067031 | 3300005618 | Bacteria | 803 |
| 213 | Ga0068866_10071920 | 3300005718 | Bacteria | 1831 |
| 214 | Ga0068866_10092394 | 3300005718 | Bacteria | 1651 |
| 215 | Ga0068861_100014698 | 3300005719 | Bacteria | 5497 |
| 216 | Ga0068861_100069261 | 3300005719 | Bacteria | 2729 |
| 217 | Ga0068851_10114771 | 3300005834 | Bacteria | 1442 |
| 218 | Ga0068870_10007764 | 3300005840 | Bacteria | 4797 |
| 219 | Ga0068870_10068076 | 3300005840 | Bacteria | 1933 |
| 220 | Ga0068863_100092777 | 3300005841 | Bacteria | 2865 |
| 221 | Ga0068863_100853033 | 3300005841 | Bacteria | 910 |
| 222 | Ga0068858_100070389 | 3300005842 | Bacteria | 3243 |
| 223 | Ga0068858_100224105 | 3300005842 | Bacteria | 1781 |
| 224 | Ga0068858_100573081 | 3300005842 | Bacteria | 1094 |
| 225 | Ga0068860_100021498 | 3300005843 | Bacteria | 6247 |
| 226 | Ga0068860_100115439 | 3300005843 | Bacteria | 2568 |
| 227 | Ga0068860_100152796 | 3300005843 | Bacteria | 2223 |
| 228 | Ga0068860_100231940 | 3300005843 | Bacteria | 1794 |
| 229 | Ga0068860_100269611 | 3300005843 | Bacteria | 1661 |
| 230 | Ga0068860_100740566 | 3300005843 | Bacteria | 994 |
| 231 | Ga0068862_100014232 | 3300005844 | Bacteria | 6597 |
| 232 | Ga0068862_100227134 | 3300005844 | Bacteria | 1692 |
| 233 | Ga0068862_100252439 | 3300005844 | Bacteria | 1608 |
| 234 | Ga0081540_1000345 | 3300005983 | Bacteria | 46912 |
| 235 | Ga0081540_1001308 | 3300005983 | Bacteria | 21736 |
| 236 | Ga0081540_1006178 | 3300005983 | Bacteria | 8781 |
| 237 | Ga0081539_10003383 | 3300005985 | Bacteria | 19743 |
| 238 | Ga0081539_10005543 | 3300005985 | Bacteria | 12795 |
| 239 | Ga0081539_10010664 | 3300005985 | Bacteria | 7415 |
| 240 | Ga0081539_10027029 | 3300005985 | Bacteria | 3643 |
| 241 | Ga0081539_10027830 | 3300005985 | Bacteria | 3571 |
| 242 | Ga0081539_10176204 | 3300005985 | Bacteria | 1007 |
| 243 | Ga0070717_10007804 | 3300006028 | Bacteria | 7962 |
| 244 | Ga0070717_10018129 | 3300006028 | Bacteria | 5492 |
| 245 | Ga0070717_10046161 | 3300006028 | Bacteria | 3563 |
| 246 | Ga0070717_10052576 | 3300006028 | Bacteria | 3356 |
| 247 | Ga0070717_10058504 | 3300006028 | Bacteria | 3188 |
| 248 | Ga0070717_10119623 | 3300006028 | Bacteria | 2255 |
| 249 | Ga0070717_10175368 | 3300006028 | Bacteria | 1866 |
| 250 | Ga0070717_10368294 | 3300006028 | Bacteria | 1287 |
| 251 | Ga0070717_10514079 | 3300006028 | Bacteria | 1083 |
| 252 | Ga0070717_10624459 | 3300006028 | Bacteria | 978 |
| 253 | Ga0070715_10001476 | 3300006163 | Bacteria | 6841 |
| 254 | Ga0070715_10050842 | 3300006163 | Bacteria | 1781 |
| 255 | Ga0070715_10179863 | 3300006163 | Bacteria | 1060 |
| 256 | Ga0070716_100001463 | 3300006173 | Bacteria | 10525 |
| 257 | Ga0070716_100019289 | 3300006173 | Bacteria | 3562 |
| 258 | Ga0070716_100076159 | 3300006173 | Bacteria | 1987 |
| 259 | Ga0070712_100071500 | 3300006175 | Bacteria | 2482 |
| 260 | Ga0070712_100260485 | 3300006175 | Bacteria | 1389 |
| 261 | Ga0070712_100266517 | 3300006175 | Bacteria | 1374 |
| 262 | Ga0097621_100215728 | 3300006237 | Bacteria | 1670 |
| 263 | Ga0097621_100311445 | 3300006237 | Bacteria | 1393 |
| 264 | Ga0097621_100627844 | 3300006237 | Bacteria | 984 |
| 265 | Ga0075428_100553200 | 3300006844 | Bacteria | 1230 |
| 266 | Ga0075428_100717706 | 3300006844 | Bacteria | 1065 |
| 267 | Ga0075431_100073239 | 3300006847 | Bacteria | 3534 |
| 268 | Ga0075431_100075900 | 3300006847 | Bacteria | 3468 |
| 269 | Ga0075431_100106830 | 3300006847 | Bacteria | 2888 |
| 270 | Ga0075434_100389538 | 3300006871 | Bacteria | 1414 |
| 271 | Ga0068865_100011812 | 3300006881 | Bacteria | 5476 |
| 272 | Ga0068865_100096507 | 3300006881 | Bacteria | 2156 |
| 273 | Ga0068865_100374407 | 3300006881 | Bacteria | 1160 |
| 274 | Ga0075436_100004827 | 3300006914 | Bacteria | 9266 |
| 275 | Ga0075436_100020931 | 3300006914 | Bacteria | 4486 |
| 276 | Ga0097620_100041008 | 3300006931 | Bacteria | 4650 |
| 277 | Ga0105240_10273382 | 3300009093 | Bacteria | 1944 |
| 278 | Ga0105240_10350751 | 3300009093 | Bacteria | 1674 |
| 279 | Ga0105240_10609138 | 3300009093 | Bacteria | 1201 |
| 280 | Ga0111539_10001402 | 3300009094 | Bacteria | 32087 |
| 281 | Ga0111539_10024563 | 3300009094 | Bacteria | 7392 |
| 282 | Ga0111539_10865089 | 3300009094 | Bacteria | 1052 |
| 283 | Ga0105245_10017866 | 3300009098 | Bacteria | 6193 |
| 284 | Ga0105245_10028596 | 3300009098 | Bacteria | 4919 |
| 285 | Ga0105245_10101497 | 3300009098 | Bacteria | 2663 |
| 286 | Ga0105245_10163393 | 3300009098 | Bacteria | 2114 |
| 287 | Ga0105245_10500369 | 3300009098 | Bacteria | 1231 |
| 288 | Ga0105247_10540866 | 3300009101 | Bacteria | 855 |
| 289 | Ga0114129_10024315 | 3300009147 | Bacteria | 8583 |
| 290 | Ga0114129_10216522 | 3300009147 | Bacteria | 2586 |
| 291 | Ga0114129_10333104 | 3300009147 | Bacteria | 2015 |
| 292 | Ga0105243_10002861 | 3300009148 | Bacteria | 14307 |
| 293 | Ga0105243_10150131 | 3300009148 | Bacteria | 1998 |
| 294 | Ga0105243_10275198 | 3300009148 | Bacteria | 1514 |
| 295 | Ga0105243_10277580 | 3300009148 | Bacteria | 1508 |
| 296 | Ga0105243_10316852 | 3300009148 | Bacteria | 1420 |
| 297 | Ga0105243_10341615 | 3300009148 | Bacteria | 1371 |
| 298 | Ga0105243_10362608 | 3300009148 | Bacteria | 1334 |
| 299 | Ga0105241_10103218 | 3300009174 | Bacteria | 2270 |
| 300 | Ga0105242_10010464 | 3300009176 | Bacteria | 7119 |
| 301 | Ga0105242_10073410 | 3300009176 | Bacteria | 2844 |
| 302 | Ga0105242_10208554 | 3300009176 | Bacteria | 1740 |
| 303 | Ga0105242_11072563 | 3300009176 | Bacteria | 818 |
| 304 | Ga0105248_10109534 | 3300009177 | Bacteria | 3114 |
| 305 | Ga0105248_10604018 | 3300009177 | Bacteria | 1238 |
| 306 | Ga0105238_10049831 | 3300009551 | Bacteria | 4216 |
| 307 | Ga0105238_10119356 | 3300009551 | Bacteria | 2617 |
| 308 | Ga0105238_10159425 | 3300009551 | Bacteria | 2231 |
| 309 | Ga0105238_10229245 | 3300009551 | Bacteria | 1834 |
| 310 | Ga0105238_10291352 | 3300009551 | Bacteria | 1614 |
| 311 | Ga0105249_10016248 | 3300009553 | Bacteria | 6601 |
| 312 | Ga0105249_10130704 | 3300009553 | Bacteria | 2397 |
| 313 | Ga0105249_10169960 | 3300009553 | Bacteria | 2113 |
| 314 | Ga0105249_10697895 | 3300009553 | Bacteria | 1075 |
| 315 | Ga0105239_10109864 | 3300010375 | Bacteria | 3056 |
| 316 | Ga0105239_10130301 | 3300010375 | Bacteria | 2797 |
| 317 | Ga0105239_10201441 | 3300010375 | Bacteria | 2230 |
| 318 | Ga0105239_10238761 | 3300010375 | Bacteria | 2040 |
| 319 | Ga0105246_10032876 | 3300011119 | Bacteria | 3443 |
| 320 | Ga0105246_10093187 | 3300011119 | Bacteria | 2175 |
| 321 | Ga0105246_10095239 | 3300011119 | Bacteria | 2155 |
| 322 | Ga0105246_10919680 | 3300011119 | Bacteria | 786 |
| 323 | Ga0157342_1008389 | 3300012507 | Bacteria | 1022 |
| 324 | Ga0157371_10431412 | 3300013102 | Bacteria | 967 |
| 325 | Ga0157370_10170964 | 3300013104 | Bacteria | 2020 |
| 326 | Ga0157370_10304658 | 3300013104 | Bacteria | 1470 |
| 327 | Ga0157369_10006230 | 3300013105 | Bacteria | 13844 |
| 328 | Ga0157369_10009643 | 3300013105 | Bacteria | 11042 |
| 329 | Ga0157369_10043686 | 3300013105 | Bacteria | 4884 |
| 330 | Ga0157369_10223548 | 3300013105 | Bacteria | 1970 |
| 331 | Ga0157374_10223871 | 3300013296 | Bacteria | 1847 |
| 332 | Ga0157374_10649385 | 3300013296 | Bacteria | 1067 |
| 333 | Ga0157378_10176077 | 3300013297 | Bacteria | 2009 |
| 334 | Ga0157378_10498396 | 3300013297 | Bacteria | 1216 |
| 335 | Ga0163162_10033664 | 3300013306 | Bacteria | 5093 |
| 336 | Ga0163162_10236810 | 3300013306 | Bacteria | 1956 |
| 337 | Ga0163162_10833720 | 3300013306 | Bacteria | 1038 |
| 338 | Ga0157372_10070802 | 3300013307 | Bacteria | 3925 |
| 339 | Ga0157372_10090164 | 3300013307 | Bacteria | 3484 |
| 340 | Ga0157372_10634069 | 3300013307 | Bacteria | 1245 |
| 341 | Ga0157372_10750118 | 3300013307 | Bacteria | 1135 |
| 342 | Ga0157372_10770623 | 3300013307 | Bacteria | 1118 |
| 343 | Ga0157375_10077212 | 3300013308 | Bacteria | 3359 |
| 344 | Ga0157375_10144159 | 3300013308 | Bacteria | 2511 |
| 345 | Ga0157375_10218869 | 3300013308 | Bacteria | 2062 |
| 346 | Ga0163163_10003412 | 3300014325 | Bacteria | 13498 |
| 347 | Ga0163163_10101314 | 3300014325 | Bacteria | 2902 |
| 348 | Ga0163163_10124358 | 3300014325 | Bacteria | 2616 |
| 349 | Ga0163163_10327439 | 3300014325 | Bacteria | 1586 |
| 350 | Ga0163163_10357935 | 3300014325 | Bacteria | 1516 |
| 351 | Ga0157380_10014664 | 3300014326 | Bacteria | 5739 |
| 352 | Ga0157380_10482740 | 3300014326 | Bacteria | 1199 |
| 353 | Ga0157380_10532211 | 3300014326 | Bacteria | 1149 |
| 354 | Ga0157380_10720355 | 3300014326 | Bacteria | 1005 |
| 355 | Ga0157377_10001840 | 3300014745 | Bacteria | 9255 |
| 356 | Ga0157377_10070554 | 3300014745 | Bacteria | 2018 |
| 357 | Ga0157379_10005808 | 3300014968 | Bacteria | 10614 |
| 358 | Ga0157379_10187756 | 3300014968 | Bacteria | 1868 |
| 359 | Ga0157379_10279803 | 3300014968 | Bacteria | 1518 |
| 360 | Ga0157379_10941423 | 3300014968 | Bacteria | 821 |
| 361 | Ga0157376_10025898 | 3300014969 | Bacteria | 4626 |
| 362 | Ga0157376_10116353 | 3300014969 | Bacteria | 2362 |
| 363 | Ga0157376_10154488 | 3300014969 | Bacteria | 2073 |
| 364 | Ga0163161_10052133 | 3300017792 | Bacteria | 2965 |
| 365 | Ga0197907_11154562 | 3300020069 | Bacteria | 798 |
| 366 | Ga0206356_10064106 | 3300020070 | Bacteria | 1258 |
| 367 | Ga0206356_10374739 | 3300020070 | Bacteria | 1315 |
| 368 | Ga0206351_10623328 | 3300020077 | Bacteria | 1113 |
| 369 | Ga0206350_10545162 | 3300020080 | Bacteria | 1169 |
| 370 | Ga0206350_11332998 | 3300020080 | Bacteria | 2318 |
| 371 | Ga0206353_10430810 | 3300020082 | Bacteria | 2728 |
| 372 | Ga0206353_10680297 | 3300020082 | Bacteria | 2431 |
| 373 | Ga0206353_10837455 | 3300020082 | Bacteria | 4788 |
| 374 | Ga0206353_11138628 | 3300020082 | Bacteria | 1790 |
| 375 | Ga0213875_10045485 | 3300021388 | Bacteria | 2060 |
| 376 | Ga0213875_10053546 | 3300021388 | Bacteria | 1890 |
| 377 | Ga0224712_10003657 | 3300022467 | Bacteria | 4032 |
| 378 | Ga0224712_10009872 | 3300022467 | Bacteria | 2896 |
| 379 | Ga0224712_10012296 | 3300022467 | Bacteria | 2687 |
| 380 | Ga0224712_10022462 | 3300022467 | Bacteria | 2175 |
| 381 | Ga0224712_10172980 | 3300022467 | Bacteria | 969 |
| 382 | Ga0224712_10210403 | 3300022467 | Bacteria | 887 |
| 383 | Ga0207697_10076100 | 3300025315 | Bacteria | 1410 |
| 384 | Ga0207656_10105874 | 3300025321 | Bacteria | 1294 |
| 385 | Ga0207692_10001219 | 3300025898 | Bacteria | 9545 |
| 386 | Ga0207692_10048644 | 3300025898 | Bacteria | 2136 |
| 387 | Ga0207692_10231762 | 3300025898 | Bacteria | 1099 |
| 388 | Ga0207692_10379978 | 3300025898 | Bacteria | 877 |
| 389 | Ga0207642_10046425 | 3300025899 | Bacteria | 1935 |
| 390 | Ga0207688_10003336 | 3300025901 | Bacteria | 8774 |
| 391 | Ga0207688_10011417 | 3300025901 | Bacteria | 4836 |
| 392 | Ga0207688_10121591 | 3300025901 | Bacteria | 1524 |
| 393 | Ga0207688_10128231 | 3300025901 | Bacteria | 1485 |
| 394 | Ga0207647_10045140 | 3300025904 | Bacteria | 2750 |
| 395 | Ga0207647_10053383 | 3300025904 | Bacteria | 2491 |
| 396 | Ga0207647_10210887 | 3300025904 | Bacteria | 1122 |
| 397 | Ga0207685_10017954 | 3300025905 | Bacteria | 2300 |
| 398 | Ga0207685_10056915 | 3300025905 | Bacteria | 1532 |
| 399 | Ga0207699_10010674 | 3300025906 | Bacteria | 4619 |
| 400 | Ga0207699_10018548 | 3300025906 | Bacteria | 3689 |
| 401 | Ga0207699_10069684 | 3300025906 | Bacteria | 2145 |
| 402 | Ga0207699_10084580 | 3300025906 | Bacteria | 1976 |
| 403 | Ga0207699_10094201 | 3300025906 | Bacteria | 1886 |
| 404 | Ga0207699_10300896 | 3300025906 | Bacteria | 1120 |
| 405 | Ga0207645_10031739 | 3300025907 | Bacteria | 3397 |
| 406 | Ga0207645_10094505 | 3300025907 | Bacteria | 1924 |
| 407 | Ga0207643_10014808 | 3300025908 | Bacteria | 4241 |
| 408 | Ga0207643_10023975 | 3300025908 | Bacteria | 3367 |
| 409 | Ga0207705_10014311 | 3300025909 | Bacteria | 5709 |
| 410 | Ga0207705_10020113 | 3300025909 | Bacteria | 4775 |
| 411 | Ga0207705_10262640 | 3300025909 | Bacteria | 1318 |
| 412 | Ga0207684_10002703 | 3300025910 | Bacteria | 17712 |
| 413 | Ga0207684_10004377 | 3300025910 | Bacteria | 13330 |
| 414 | Ga0207684_10011882 | 3300025910 | Bacteria | 7590 |
| 415 | Ga0207684_10020585 | 3300025910 | Bacteria | 5637 |
| 416 | Ga0207684_10027199 | 3300025910 | Bacteria | 4876 |
| 417 | Ga0207684_10098696 | 3300025910 | Bacteria | 2494 |
| 418 | Ga0207684_10103864 | 3300025910 | Bacteria | 2430 |
| 419 | Ga0207684_10164710 | 3300025910 | Bacteria | 1910 |
| 420 | Ga0207684_10224693 | 3300025910 | Bacteria | 1620 |
| 421 | Ga0207684_10281699 | 3300025910 | Bacteria | 1433 |
| 422 | Ga0207654_10051541 | 3300025911 | Bacteria | 2369 |
| 423 | Ga0207707_10001352 | 3300025912 | Bacteria | 22855 |
| 424 | Ga0207707_10303303 | 3300025912 | Bacteria | 1381 |
| 425 | Ga0207693_10011242 | 3300025915 | Bacteria | 7246 |
| 426 | Ga0207693_10055473 | 3300025915 | Bacteria | 3109 |
| 427 | Ga0207693_10122229 | 3300025915 | Bacteria | 2045 |
| 428 | Ga0207693_10177362 | 3300025915 | Bacteria | 1677 |
| 429 | Ga0207663_10016400 | 3300025916 | Bacteria | 4107 |
| 430 | Ga0207663_10176131 | 3300025916 | Bacteria | 1523 |
| 431 | Ga0207663_10517600 | 3300025916 | Bacteria | 929 |
| 432 | Ga0207660_10492199 | 3300025917 | Bacteria | 994 |
| 433 | Ga0207662_10039032 | 3300025918 | Bacteria | 2783 |
| 434 | Ga0207657_10013739 | 3300025919 | Bacteria | 7926 |
| 435 | Ga0207657_10028157 | 3300025919 | Bacteria | 5131 |
| 436 | Ga0207657_10735171 | 3300025919 | Bacteria | 765 |
| 437 | Ga0207649_10066986 | 3300025920 | Bacteria | 2278 |
| 438 | Ga0207649_10165670 | 3300025920 | Bacteria | 1535 |
| 439 | Ga0207652_10008724 | 3300025921 | Bacteria | 8160 |
| 440 | Ga0207652_10016769 | 3300025921 | Bacteria | 5985 |
| 441 | Ga0207652_10147526 | 3300025921 | Bacteria | 2106 |
| 442 | Ga0207652_10341302 | 3300025921 | Bacteria | 1352 |
| 443 | Ga0207652_10351540 | 3300025921 | Bacteria | 1330 |
| 444 | Ga0207652_10437911 | 3300025921 | Bacteria | 1178 |
| 445 | Ga0207646_10001043 | 3300025922 | Bacteria | 35345 |
| 446 | Ga0207646_10003277 | 3300025922 | Bacteria | 18442 |
| 447 | Ga0207646_10006902 | 3300025922 | Bacteria | 11663 |
| 448 | Ga0207646_10036661 | 3300025922 | Bacteria | 4426 |
| 449 | Ga0207646_10066969 | 3300025922 | Bacteria | 3206 |
| 450 | Ga0207646_10108168 | 3300025922 | Bacteria | 2494 |
| 451 | Ga0207646_10112799 | 3300025922 | Bacteria | 2440 |
| 452 | Ga0207646_10125319 | 3300025922 | Bacteria | 2309 |
| 453 | Ga0207646_10175844 | 3300025922 | Bacteria | 1933 |
| 454 | Ga0207646_10214371 | 3300025922 | Bacteria | 1739 |
| 455 | Ga0207646_10378277 | 3300025922 | Bacteria | 1279 |
| 456 | Ga0207694_10266117 | 3300025924 | Bacteria | 1405 |
| 457 | Ga0207650_10781202 | 3300025925 | Bacteria | 809 |
| 458 | Ga0207659_10004462 | 3300025926 | Bacteria | 8473 |
| 459 | Ga0207659_10301483 | 3300025926 | Bacteria | 1316 |
| 460 | Ga0207687_10012294 | 3300025927 | Bacteria | 5597 |
| 461 | Ga0207687_10044430 | 3300025927 | Bacteria | 3066 |
| 462 | Ga0207687_10117011 | 3300025927 | Bacteria | 1988 |
| 463 | Ga0207687_10242425 | 3300025927 | Bacteria | 1429 |
| 464 | Ga0207700_10012464 | 3300025928 | Bacteria | 5484 |
| 465 | Ga0207700_10017983 | 3300025928 | Bacteria | 4735 |
| 466 | Ga0207700_10032895 | 3300025928 | Bacteria | 3704 |
| 467 | Ga0207700_10034300 | 3300025928 | Bacteria | 3642 |
| 468 | Ga0207700_10050547 | 3300025928 | Bacteria | 3098 |
| 469 | Ga0207700_10085111 | 3300025928 | Bacteria | 2481 |
| 470 | Ga0207700_10118893 | 3300025928 | Bacteria | 2139 |
| 471 | Ga0207700_10223870 | 3300025928 | Bacteria | 1596 |
| 472 | Ga0207700_10279193 | 3300025928 | Bacteria | 1436 |
| 473 | Ga0207700_10319977 | 3300025928 | Bacteria | 1344 |
| 474 | Ga0207700_10413001 | 3300025928 | Bacteria | 1184 |
| 475 | Ga0207664_10001219 | 3300025929 | Bacteria | 17030 |
| 476 | Ga0207664_10001859 | 3300025929 | Bacteria | 13926 |
| 477 | Ga0207664_10002401 | 3300025929 | Bacteria | 12385 |
| 478 | Ga0207664_10010461 | 3300025929 | Bacteria | 6554 |
| 479 | Ga0207664_10017597 | 3300025929 | Bacteria | 5244 |
| 480 | Ga0207664_10045207 | 3300025929 | Bacteria | 3452 |
| 481 | Ga0207664_10050425 | 3300025929 | Bacteria | 3282 |
| 482 | Ga0207664_10078311 | 3300025929 | Bacteria | 2681 |
| 483 | Ga0207664_10130081 | 3300025929 | Bacteria | 2118 |
| 484 | Ga0207664_10154753 | 3300025929 | Bacteria | 1951 |
| 485 | Ga0207664_10199746 | 3300025929 | Bacteria | 1725 |
| 486 | Ga0207644_10704144 | 3300025931 | Bacteria | 842 |
| 487 | Ga0207690_10262610 | 3300025932 | Bacteria | 1338 |
| 488 | Ga0207706_10101311 | 3300025933 | Bacteria | 2534 |
| 489 | Ga0207706_10188207 | 3300025933 | Bacteria | 1812 |
| 490 | Ga0207686_10199327 | 3300025934 | Bacteria | 1433 |
| 491 | Ga0207686_10233304 | 3300025934 | Bacteria | 1335 |
| 492 | Ga0207709_10021557 | 3300025935 | Bacteria | 3649 |
| 493 | Ga0207709_10040829 | 3300025935 | Bacteria | 2780 |
| 494 | Ga0207709_10049174 | 3300025935 | Bacteria | 2572 |
| 495 | Ga0207709_10056214 | 3300025935 | Bacteria | 2435 |
| 496 | Ga0207670_10076188 | 3300025936 | Bacteria | 2333 |
| 497 | Ga0207669_10050661 | 3300025937 | Bacteria | 2484 |
| 498 | Ga0207669_10199851 | 3300025937 | Bacteria | 1450 |
| 499 | Ga0207669_10354556 | 3300025937 | Bacteria | 1135 |
| 500 | Ga0207704_10060273 | 3300025938 | Bacteria | 2347 |
| 501 | Ga0207704_10676032 | 3300025938 | Bacteria | 852 |
| 502 | Ga0207665_10000937 | 3300025939 | Bacteria | 19776 |
| 503 | Ga0207665_10025697 | 3300025939 | Bacteria | 3886 |
| 504 | Ga0207665_10044338 | 3300025939 | Bacteria | 2976 |
| 505 | Ga0207691_10002759 | 3300025940 | Bacteria | 17117 |
| 506 | Ga0207691_10043103 | 3300025940 | Bacteria | 4159 |
| 507 | Ga0207691_10648383 | 3300025940 | Bacteria | 892 |
| 508 | Ga0207711_10157543 | 3300025941 | Bacteria | 2053 |
| 509 | Ga0207689_10028926 | 3300025942 | Bacteria | 4632 |
| 510 | Ga0207689_10078275 | 3300025942 | Bacteria | 2717 |
| 511 | Ga0207689_10284620 | 3300025942 | Bacteria | 1369 |
| 512 | Ga0207689_10316061 | 3300025942 | Bacteria | 1296 |
| 513 | Ga0207661_10020538 | 3300025944 | Bacteria | 4938 |
| 514 | Ga0207661_10082632 | 3300025944 | Bacteria | 2656 |
| 515 | Ga0207661_10246257 | 3300025944 | Bacteria | 1587 |
| 516 | Ga0207661_10279300 | 3300025944 | Bacteria | 1492 |
| 517 | Ga0207661_10298439 | 3300025944 | Bacteria | 1444 |
| 518 | Ga0207679_10059848 | 3300025945 | Bacteria | 2827 |
| 519 | Ga0207679_10083461 | 3300025945 | Bacteria | 2449 |
| 520 | Ga0207679_10315845 | 3300025945 | Bacteria | 1351 |
| 521 | Ga0207679_10412030 | 3300025945 | Bacteria | 1191 |
| 522 | Ga0207667_10783030 | 3300025949 | Bacteria | 951 |
| 523 | Ga0207651_10447590 | 3300025960 | Bacteria | 1108 |
| 524 | Ga0207712_10041209 | 3300025961 | Bacteria | 3173 |
| 525 | Ga0207712_10455059 | 3300025961 | Bacteria | 1086 |
| 526 | Ga0207668_10818972 | 3300025972 | Bacteria | 825 |
| 527 | Ga0207640_10034135 | 3300025981 | Bacteria | 3172 |
| 528 | Ga0207640_10485021 | 3300025981 | Bacteria | 1026 |
| 529 | Ga0207640_10592054 | 3300025981 | Bacteria | 938 |
| 530 | Ga0207677_10065603 | 3300026023 | Bacteria | 2534 |
| 531 | Ga0207677_10153779 | 3300026023 | Bacteria | 1778 |
| 532 | Ga0207677_10161080 | 3300026023 | Bacteria | 1743 |
| 533 | Ga0207677_10258882 | 3300026023 | Bacteria | 1417 |
| 534 | Ga0207677_10557749 | 3300026023 | Bacteria | 999 |
| 535 | Ga0207677_10645376 | 3300026023 | Bacteria | 934 |
| 536 | Ga0207703_10082642 | 3300026035 | Bacteria | 2681 |
| 537 | Ga0207703_10182944 | 3300026035 | Bacteria | 1850 |
| 538 | Ga0207703_10344111 | 3300026035 | Bacteria | 1371 |
| 539 | Ga0207639_10294704 | 3300026041 | Bacteria | 1432 |
| 540 | Ga0207678_10013263 | 3300026067 | Bacteria | 7232 |
| 541 | Ga0207678_10112010 | 3300026067 | Bacteria | 2328 |
| 542 | Ga0207678_10116286 | 3300026067 | Bacteria | 2282 |
| 543 | Ga0207678_10361747 | 3300026067 | Bacteria | 1252 |
| 544 | Ga0207678_10414828 | 3300026067 | Bacteria | 1167 |
| 545 | Ga0207708_10000171 | 3300026075 | Bacteria | 51434 |
| 546 | Ga0207708_10013641 | 3300026075 | Bacteria | 6070 |
| 547 | Ga0207708_10047624 | 3300026075 | Bacteria | 3263 |
| 548 | Ga0207708_10141025 | 3300026075 | Bacteria | 1891 |
| 549 | Ga0207702_10098834 | 3300026078 | Bacteria | 2572 |
| 550 | Ga0207702_10406511 | 3300026078 | Bacteria | 1314 |
| 551 | Ga0207702_10534781 | 3300026078 | Bacteria | 1145 |
| 552 | Ga0207641_10067667 | 3300026088 | Bacteria | 3061 |
| 553 | Ga0207648_10000926 | 3300026089 | Bacteria | 33052 |
| 554 | Ga0207648_10021225 | 3300026089 | Bacteria | 5838 |
| 555 | Ga0207648_10273380 | 3300026089 | Bacteria | 1510 |
| 556 | Ga0207676_10023529 | 3300026095 | Bacteria | 4547 |
| 557 | Ga0207676_10060211 | 3300026095 | Bacteria | 3002 |
| 558 | Ga0207676_10534115 | 3300026095 | Bacteria | 1118 |
| 559 | Ga0207674_10002791 | 3300026116 | Bacteria | 21738 |
| 560 | Ga0207674_10003072 | 3300026116 | Bacteria | 20651 |
| 561 | Ga0207674_10021296 | 3300026116 | Bacteria | 6986 |
| 562 | Ga0207674_10043441 | 3300026116 | Bacteria | 4634 |
| 563 | Ga0207674_10050070 | 3300026116 | Bacteria | 4269 |
| 564 | Ga0207674_10062060 | 3300026116 | Bacteria | 3775 |
| 565 | Ga0207674_10330823 | 3300026116 | Bacteria | 1473 |
| 566 | Ga0207675_100021690 | 3300026118 | Bacteria | 5978 |
| 567 | Ga0207675_100045873 | 3300026118 | Bacteria | 4082 |
| 568 | Ga0207683_10040527 | 3300026121 | Bacteria | 4065 |
| 569 | Ga0207683_10044001 | 3300026121 | Bacteria | 3902 |
| 570 | Ga0207683_10542743 | 3300026121 | Bacteria | 1075 |
| 571 | Ga0207698_10013511 | 3300026142 | Bacteria | 5390 |
| 572 | Ga0207698_10087552 | 3300026142 | Bacteria | 2537 |
| 573 | Ga0207428_10018301 | 3300027907 | Bacteria | 5986 |
| 574 | Ga0207428_10170260 | 3300027907 | Bacteria | 1650 |
| 575 | Ga0207428_10312454 | 3300027907 | Bacteria | 1162 |
| 576 | Ga0268266_10037281 | 3300028379 | Bacteria | 4143 |
| 577 | Ga0268266_10148443 | 3300028379 | Bacteria | 2111 |
| 578 | Ga0268265_10021593 | 3300028380 | Bacteria | 4513 |
| 579 | Ga0268265_10158734 | 3300028380 | Bacteria | 1918 |
| 580 | Ga0268265_10303887 | 3300028380 | Bacteria | 1438 |
| 581 | Ga0268265_10764455 | 3300028380 | Bacteria | 939 |
| 582 | Ga0268265_10838033 | 3300028380 | Bacteria | 899 |
| 583 | Ga0268264_10015344 | 3300028381 | Bacteria | 6283 |
| 584 | Ga0268264_10016885 | 3300028381 | Bacteria | 5975 |
| 585 | Ga0268264_10102534 | 3300028381 | Bacteria | 2490 |
| 586 | Ga0268264_10147125 | 3300028381 | Bacteria | 2108 |
| 587 | Ga0268264_10223668 | 3300028381 | Bacteria | 1734 |
| 588 | Ga0268264_10732260 | 3300028381 | Bacteria | 984 |
| 589 | Ga0265337_1007835 | 3300028556 | Bacteria | 3957 |
| 590 | Ga0265326_10007791 | 3300028558 | Bacteria | 3263 |
| 591 | Ga0265319_1000101 | 3300028563 | Bacteria | 66582 |
| 592 | Ga0265319_1004032 | 3300028563 | Bacteria | 7433 |
| 593 | Ga0265334_10003352 | 3300028573 | Bacteria | 7312 |
| 594 | Ga0265318_10000112 | 3300028577 | Bacteria | 75202 |
| 595 | Ga0265318_10001261 | 3300028577 | Bacteria | 15307 |
| 596 | Ga0265318_10061405 | 3300028577 | Bacteria | 1400 |
| 597 | Ga0265323_10009626 | 3300028653 | Bacteria | 3938 |
| 598 | Ga0265322_10006720 | 3300028654 | Bacteria | 3379 |
| 599 | Ga0265336_10001704 | 3300028666 | Bacteria | 9695 |
| 600 | Ga0265336_10014619 | 3300028666 | Bacteria | 2595 |
| 601 | Ga0307515_10000042 | 3300028794 | Bacteria | 309141 |
| 602 | Ga0307515_10014744 | 3300028794 | Bacteria | 14459 |
| 603 | Ga0307515_10030070 | 3300028794 | Bacteria | 9144 |
| 604 | Ga0265338_10000743 | 3300028800 | Bacteria | 55581 |
| 605 | Ga0265338_10001346 | 3300028800 | Bacteria | 40029 |
| 606 | Ga0265338_10005011 | 3300028800 | Bacteria | 17505 |
| 607 | Ga0265338_10006911 | 3300028800 | Bacteria | 14280 |
| 608 | Ga0265338_10057494 | 3300028800 | Bacteria | 3440 |
| 609 | Ga0265338_10066202 | 3300028800 | Bacteria | 3128 |
| 610 | Ga0265324_10010807 | 3300029957 | Bacteria | 3501 |
| 611 | Ga0307512_10007084 | 3300030522 | Bacteria | 11176 |
| 612 | Ga0307512_10027813 | 3300030522 | Bacteria | 4968 |
| 613 | Ga0265330_10000056 | 3300031235 | Bacteria | 100283 |
| 614 | Ga0265332_10000050 | 3300031238 | Bacteria | 112449 |
| 615 | Ga0265332_10002184 | 3300031238 | Bacteria | 10071 |
| 616 | Ga0265328_10001238 | 3300031239 | Bacteria | 11839 |
| 617 | Ga0265320_10000115 | 3300031240 | Bacteria | 69750 |
| 618 | Ga0265320_10005115 | 3300031240 | Bacteria | 8473 |
| 619 | Ga0265320_10109686 | 3300031240 | Bacteria | 1265 |
| 620 | Ga0265325_10000326 | 3300031241 | Bacteria | 33654 |
| 621 | Ga0265325_10001667 | 3300031241 | Bacteria | 15409 |
| 622 | Ga0265325_10035966 | 3300031241 | Bacteria | 2626 |
| 623 | Ga0265329_10000048 | 3300031242 | Bacteria | 51268 |
| 624 | Ga0265340_10001141 | 3300031247 | Bacteria | 15183 |
| 625 | Ga0265340_10001852 | 3300031247 | Bacteria | 12068 |
| 626 | Ga0265339_10006545 | 3300031249 | Bacteria | 7634 |
| 627 | Ga0265339_10007679 | 3300031249 | Bacteria | 6938 |
| 628 | Ga0265339_10041381 | 3300031249 | Bacteria | 2558 |
| 629 | Ga0265331_10000335 | 3300031250 | Bacteria | 50304 |
| 630 | Ga0265316_10001199 | 3300031344 | Bacteria | 28027 |
| 631 | Ga0265316_10008688 | 3300031344 | Bacteria | 9401 |
| 632 | Ga0265316_10020583 | 3300031344 | Bacteria | 5613 |
| 633 | Ga0307513_10024342 | 3300031456 | Bacteria | 7044 |
| 634 | Ga0307513_10047902 | 3300031456 | Bacteria | 4645 |
| 635 | Ga0307513_10080092 | 3300031456 | Bacteria | 3370 |
| 636 | Ga0307513_10265934 | 3300031456 | Bacteria | 1501 |
| 637 | Ga0307408_100181523 | 3300031548 | Bacteria | 1688 |
| 638 | Ga0265313_10000009 | 3300031595 | Bacteria | 169607 |
| 639 | Ga0265313_10000187 | 3300031595 | Bacteria | 66087 |
| 640 | Ga0265313_10000383 | 3300031595 | Bacteria | 47643 |
| 641 | Ga0265313_10033580 | 3300031595 | Bacteria | 2605 |
| 642 | Ga0307508_10086037 | 3300031616 | Bacteria | 2727 |
| 643 | Ga0307508_10149401 | 3300031616 | Bacteria | 1941 |
| 644 | Ga0316579_10050303 | 3300031691 | Bacteria | 1949 |
| 645 | Ga0265314_10000430 | 3300031711 | Bacteria | 56257 |
| 646 | Ga0265314_10017800 | 3300031711 | Bacteria | 5567 |
| 647 | Ga0265342_10000333 | 3300031712 | Bacteria | 52702 |
| 648 | Ga0265342_10012657 | 3300031712 | Bacteria | 5707 |
| 649 | Ga0307516_10003947 | 3300031730 | Bacteria | 18653 |
| 650 | Ga0307516_10034399 | 3300031730 | Bacteria | 5092 |
| 651 | Ga0307516_10153774 | 3300031730 | Bacteria | 2058 |
| 652 | Ga0307405_10333712 | 3300031731 | Bacteria | 1163 |
| 653 | Ga0316577_10042918 | 3300031733 | Bacteria | 2530 |
| 654 | Ga0307413_10023726 | 3300031824 | Bacteria | 3329 |
| 655 | Ga0307413_10312890 | 3300031824 | Bacteria | 1196 |
| 656 | Ga0307410_10015091 | 3300031852 | Bacteria | 4571 |
| 657 | Ga0307410_10032568 | 3300031852 | Bacteria | 3356 |
| 658 | Ga0307406_10028625 | 3300031901 | Bacteria | 3368 |
| 659 | Ga0307407_10044263 | 3300031903 | Bacteria | 2507 |
| 660 | Ga0307407_10102867 | 3300031903 | Bacteria | 1777 |
| 661 | Ga0307407_10140691 | 3300031903 | Bacteria | 1556 |
| 662 | Ga0307412_10134797 | 3300031911 | Bacteria | 1800 |
| 663 | Ga0307409_100090877 | 3300031995 | Bacteria | 2500 |
| 664 | Ga0307409_100384215 | 3300031995 | Bacteria | 1336 |
| 665 | Ga0307409_100984808 | 3300031995 | Bacteria | 861 |
| 666 | Ga0307416_100021692 | 3300032002 | Bacteria | 4617 |
| 667 | Ga0307416_100492760 | 3300032002 | Bacteria | 1288 |
| 668 | Ga0307414_10086307 | 3300032004 | Bacteria | 2315 |
| 669 | Ga0307414_10271610 | 3300032004 | Bacteria | 1420 |
| 670 | Ga0307414_10501103 | 3300032004 | Bacteria | 1074 |
| 671 | Ga0307411_10642793 | 3300032005 | Bacteria | 917 |
| 672 | Ga0307415_100002584 | 3300032126 | Bacteria | 9047 |
| 673 | Ga0307415_100035580 | 3300032126 | Bacteria | 3253 |
| 674 | Ga0307415_100489620 | 3300032126 | Bacteria | 1073 |
| 675 | Ga0307507_10147119 | 3300033179 | Bacteria | 1786 |
| 676 | Ga0316214_1002630 | 3300033545 | Bacteria | 2215 |
| 677 | Ga0373938_0044313 | 3300034957 | Bacteria | 998 |
| 678 | Ga0373926_0002315 | 3300035083 | Bacteria | 6025 |
| 679 | Ga0373926_0006977 | 3300035083 | Bacteria | 3756 |
| 680 | Ga0373934_0000101 | 3300035086 | Bacteria | 29995 |
| 681 | Ga0373934_0012313 | 3300035086 | Bacteria | 3229 |
| 682 | Ga0373934_0040878 | 3300035086 | Bacteria | 1829 |
| 683 | Ga0373934_0042417 | 3300035086 | Bacteria | 1797 |
| 684 | Ga0373949_0031357 | 3300035090 | Bacteria | 1267 |
| 685 | Ga0373951_0000271 | 3300035091 | Bacteria | 16583 |
| 686 | Ga0373923_0000967 | 3300035111 | Bacteria | 7719 |
| 687 | Ga0373923_0010902 | 3300035111 | Bacteria | 3320 |
| 688 | Ga0373923_0015587 | 3300035111 | Bacteria | 2871 |
| 689 | Ga0373923_0039155 | 3300035111 | Bacteria | 1946 |
| 690 | Ga0373923_0061499 | 3300035111 | Bacteria | 1596 |
| 691 | Ga0373923_0075589 | 3300035111 | Bacteria | 1453 |
| 692 | Ga0373936_0003980 | 3300035113 | Bacteria | 5568 |
| 693 | Ga0373936_0308040 | 3300035113 | Bacteria | 716 |
| 694 | Ga0373945_0028991 | 3300035116 | Bacteria | 1942 |
| 695 | Ga0373945_0034494 | 3300035116 | Bacteria | 1803 |
| 696 | Ga0373953_0000521 | 3300035117 | Bacteria | 10670 |
| 697 | Ga0373953_0009295 | 3300035117 | Bacteria | 3375 |
| 698 | Ga0373953_0026137 | 3300035117 | Bacteria | 2235 |
| 699 | Ga0373954_0008596 | 3300035118 | Bacteria | 4490 |
| 700 | Ga0373954_0015680 | 3300035118 | Bacteria | 3389 |
| 701 | Ga0373954_0027967 | 3300035118 | Bacteria | 2591 |
| 702 | Ga0373956_0000095 | 3300035119 | Bacteria | 29811 |
| 703 | Ga0373956_0018190 | 3300035119 | Bacteria | 2972 |
| 704 | Ga0373956_0113215 | 3300035119 | Bacteria | 1264 |
| 705 | Ga0373957_0000033 | 3300035120 | Bacteria | 35539 |
| 706 | Ga0373943_0066062 | 3300035170 | Bacteria | 1820 |
| 707 | Ga0373943_0085374 | 3300035170 | Bacteria | 1625 |
| 708 | Ga0373946_0002118 | 3300035171 | Bacteria | 6960 |
| 709 | Ga0373946_0010570 | 3300035171 | Bacteria | 3420 |
| 710 | Ga0373946_0145535 | 3300035171 | Bacteria | 1102 |
| 711 | Ga0373955_0000002 | 3300035172 | Bacteria | 125763 |
| 712 | Ga0373955_0007055 | 3300035172 | Bacteria | 5145 |
| 713 | Ga0373955_0012915 | 3300035172 | Bacteria | 4026 |
| 714 | Ga0373924_0002327 | 3300035410 | Bacteria | 6376 |
| 715 | Ga0373924_0009167 | 3300035410 | Bacteria | 3621 |
| 716 | Ga0373931_0346063 | 3300035691 | Bacteria | 929 |
| 717 | Ga0373935_0000234 | 3300035692 | Bacteria | 27285 |
| 718 | Ga0373935_0045225 | 3300035692 | Bacteria | 2777 |
| 719 | Ga0373935_0192321 | 3300035692 | Bacteria | 1406 |
| 720 | Ga0373935_0206279 | 3300035692 | Bacteria | 1360 |
| 721 | Ga0373927_0254902 | 3300035695 | Bacteria | 1153 |
| 722 | Ga0373933_0000029 | 3300035724 | Bacteria | 86829 |
| 723 | Ga0373933_0012974 | 3300035724 | Bacteria | 4609 |
| 724 | Ga0373933_0024647 | 3300035724 | Bacteria | 3444 |
| 725 | Ga0373933_0033935 | 3300035724 | Bacteria | 2971 |
| 726 | Ga0373933_0137993 | 3300035724 | Bacteria | 1538 |
| 727 | Ga0373933_0198132 | 3300035724 | Bacteria | 1284 |
| 728 | Ga0373947_0000005 | 3300035725 | Bacteria | 225129 |
| 729 | Ga0373947_0134795 | 3300035725 | Bacteria | 1579 |
| 730 | Ga0373937_0000362 | 3300036401 | Bacteria | 42228 |
| 731 | Ga0373937_0004443 | 3300036401 | Bacteria | 11918 |
| 732 | Ga0373937_0095938 | 3300036401 | Bacteria | 2750 |
| 733 | Ga0373937_0243235 | 3300036401 | Bacteria | 1695 |
| 734 | Ga0373937_0330572 | 3300036401 | Bacteria | 1442 |
| 735 | Ga0373937_0448943 | 3300036401 | Bacteria | 1224 |
| 736 | Ga0373937_0472913 | 3300036401 | Bacteria | 1190 |
| 737 | Ga0316584_0019297 | 3300036712 | Bacteria | 4928 |
| 738 | Ga0373925_0000021 | 3300037068 | Bacteria | 162277 |
| 739 | Ga0373925_0199253 | 3300037068 | Bacteria | 1591 |
| 740 | Ga0373925_0221133 | 3300037068 | Bacteria | 1511 |
| 741 | Ga0373925_0475917 | 3300037068 | Bacteria | 1024 |
| 742 | Ga0395900_0003692 | 3300037418 | Bacteria | 16457 |
| 743 | Ga0395900_0407298 | 3300037418 | Bacteria | 1323 |
| 744 | Ga0395898_0042087 | 3300037466 | Bacteria | 4509 |
| 745 | Ga0395898_0150625 | 3300037466 | Bacteria | 2226 |
| 746 | Ga0395898_0974500 | 3300037466 | Bacteria | 784 |
| 747 | Ga0316581_0039286 | 3300037588 | Bacteria | 1440 |
| 748 | Ga0436364_0115602 | 3300037853 | Bacteria | 2288 |
| 749 | Ga0436364_0361850 | 3300037853 | Bacteria | 4047 |
| 750 | Ga0436364_1130152 | 3300037853 | Bacteria | 3129 |
| 751 | Ga0436364_1225860 | 3300037853 | Bacteria | 2715 |
| 752 | Ga0395901_0059328 | 3300038443 | Bacteria | 3981 |
| 753 | Ga0436361_0546799 | 3300039447 | Bacteria | 1419 |
| 754 | Ga0436363_0208428 | 3300039450 | Bacteria | 2554 |
| 755 | Ga0451787_197248 | 3300041441 | Bacteria | 1637 |
| 756 | Ga0451789_0052206 | 3300041443 | Bacteria | 4804 |
| 757 | Ga0451791_1114879 | 3300041451 | Bacteria | 5775 |
| 758 | Ga0451791_1689531 | 3300041451 | Bacteria | 1860 |
| 759 | Ga0451793_0720655 | 3300041452 | Bacteria | 12238 |
| 760 | Ga0451797_0100726 | 3300041453 | Bacteria | 4175 |
| 761 | Ga0451800_0314848 | 3300041459 | Bacteria | 1739 |
| 762 | Ga0451807_0584294 | 3300041486 | Bacteria | 1090 |
| 763 | Ga0451839_0061394 | 3300041496 | Bacteria | 3005 |
| 764 | Ga0451841_0287715 | 3300041498 | Bacteria | 1713 |
| 765 | Ga0451843_0204342 | 3300041509 | Bacteria | 4137 |
| 766 | Ga0466965_0355675 | 3300044683 | Bacteria | 803 |
| 767 | Ga0466966_0085720 | 3300044684 | Bacteria | 1958 |
| 768 | Ga0466961_0105411 | 3300044693 | Bacteria | 1775 |
| 769 | Ga0466963_0076384 | 3300044694 | Bacteria | 2262 |
| 770 | Ga0466964_0222376 | 3300044706 | Bacteria | 917 |
| 771 | Ga0466957_0239841 | 3300044842 | Bacteria | 1202 |
| 772 | Ga0466960_0012595 | 3300044901 | Bacteria | 3575 |
| 773 | Ga0466960_0097893 | 3300044901 | Bacteria | 1506 |
| 774 | Ga0466959_0003301 | 3300045049 | Bacteria | 10527 |
| 775 | Ga0466959_0020862 | 3300045049 | Bacteria | 4828 |
| 776 | Ga0466959_0133545 | 3300045049 | Bacteria | 1758 |
| 777 | Ga0466959_0362030 | 3300045049 | Bacteria | 988 |
| 778 | Ga0466958_0090390 | 3300045836 | Bacteria | 1895 |
| 779 | Ga0466958_0121743 | 3300045836 | Bacteria | 1634 |
| 780 | Ga0466958_0259650 | 3300045836 | Bacteria | 1112 |
| 781 | Ga0466958_0276648 | 3300045836 | Bacteria | 1075 |
| 782 | Ga0466967_0000444 | 3300045976 | Bacteria | 19804 |
| 783 | Ga0466967_0004649 | 3300045976 | Bacteria | 9313 |
| 784 | Ga0466967_0015004 | 3300045976 | Bacteria | 6059 |
| 785 | Ga0466967_0026433 | 3300045976 | Bacteria | 4808 |
| 786 | Ga0466967_0044615 | 3300045976 | Bacteria | 3847 |
| 787 | Ga0466967_0050982 | 3300045976 | Bacteria | 3625 |
| 788 | Ga0466967_0076441 | 3300045976 | Bacteria | 3012 |
| 789 | Ga0466967_0127873 | 3300045976 | Bacteria | 2355 |
| 790 | Ga0466967_0154742 | 3300045976 | Bacteria | 2146 |
| 791 | Ga0466967_0573243 | 3300045976 | Bacteria | 1112 |
| 792 | Ga0466967_0943566 | 3300045976 | Bacteria | 858 |
| 793 | Ga0495592_0000043 | 3300046454 | Bacteria | 122354 |
| 794 | Ga0495592_0008890 | 3300046454 | Bacteria | 7542 |
| 795 | Ga0495592_0040782 | 3300046454 | Bacteria | 3482 |
| 796 | Ga0495592_0100369 | 3300046454 | Bacteria | 2064 |
| 797 | Ga0495592_0135693 | 3300046454 | Bacteria | 1716 |
| 798 | Ga0495592_0232868 | 3300046454 | Bacteria | 1225 |
| 799 | Ga0495603_0042928 | 3300046455 | Bacteria | 2701 |
| 800 | Ga0495629_0005691 | 3300046459 | Bacteria | 9307 |
| 801 | Ga0495629_0091124 | 3300046459 | Bacteria | 2127 |
| 802 | Ga0495629_0217170 | 3300046459 | Bacteria | 1319 |
| 803 | Ga0495641_0001864 | 3300046461 | Bacteria | 17302 |
| 804 | Ga0495651_0000135 | 3300046462 | Bacteria | 54990 |
| 805 | Ga0495651_0003167 | 3300046462 | Bacteria | 12664 |
| 806 | Ga0495651_0006755 | 3300046462 | Bacteria | 8766 |
| 807 | Ga0495651_0021269 | 3300046462 | Bacteria | 5041 |
| 808 | Ga0495651_0028970 | 3300046462 | Bacteria | 4318 |
| 809 | Ga0495651_0055294 | 3300046462 | Bacteria | 3050 |
| 810 | Ga0495653_0000571 | 3300046463 | Bacteria | 28231 |
| 811 | Ga0495653_0012759 | 3300046463 | Bacteria | 6861 |
| 812 | Ga0495653_0063902 | 3300046463 | Bacteria | 2775 |
| 813 | Ga0495653_0132596 | 3300046463 | Bacteria | 1761 |
| 814 | Ga0495653_0179118 | 3300046463 | Bacteria | 1456 |
| 815 | Ga0495653_0299490 | 3300046463 | Bacteria | 1049 |
| 816 | Ga0495580_0015800 | 3300046472 | Bacteria | 5685 |
| 817 | Ga0495582_0212637 | 3300046473 | Bacteria | 1105 |
| 818 | Ga0495582_0296301 | 3300046473 | Bacteria | 929 |
| 819 | Ga0495639_0001668 | 3300046475 | Bacteria | 9874 |
| 820 | Ga0495662_0009182 | 3300046476 | Bacteria | 4853 |
| 821 | Ga0495662_0011201 | 3300046476 | Bacteria | 4383 |
| 822 | Ga0495662_0036057 | 3300046476 | Bacteria | 2387 |
| 823 | Ga0495662_0074460 | 3300046476 | Bacteria | 1647 |
| 824 | Ga0495664_0014805 | 3300046477 | Bacteria | 4428 |
| 825 | Ga0495664_0017439 | 3300046477 | Bacteria | 4104 |
| 826 | Ga0495664_0125390 | 3300046477 | Bacteria | 1553 |
| 827 | Ga0495664_0177147 | 3300046477 | Bacteria | 1293 |
| 828 | Ga0495664_0275579 | 3300046477 | Bacteria | 1016 |
| 829 | Ga0495594_0158565 | 3300046499 | Bacteria | 1286 |
| 830 | Ga0495594_0226331 | 3300046499 | Bacteria | 1066 |
| 831 | Ga0495608_0000016 | 3300046511 | Bacteria | 196738 |
| 832 | Ga0495608_0007773 | 3300046511 | Bacteria | 7551 |
| 833 | Ga0495608_0013563 | 3300046511 | Bacteria | 5652 |
| 834 | Ga0495608_0050860 | 3300046511 | Bacteria | 2748 |
| 835 | Ga0495608_0119179 | 3300046511 | Bacteria | 1693 |
| 836 | Ga0495618_0022655 | 3300046514 | Bacteria | 3880 |
| 837 | Ga0495618_0183018 | 3300046514 | Bacteria | 1331 |
| 838 | Ga0495618_0199061 | 3300046514 | Bacteria | 1268 |
| 839 | Ga0495618_0346335 | 3300046514 | Bacteria | 916 |
| 840 | Ga0495628_0000034 | 3300046516 | Bacteria | 115264 |
| 841 | Ga0495628_0008967 | 3300046516 | Bacteria | 8554 |
| 842 | Ga0495628_0013773 | 3300046516 | Bacteria | 6795 |
| 843 | Ga0495628_0227919 | 3300046516 | Bacteria | 1397 |
| 844 | Ga0495628_0388891 | 3300046516 | Bacteria | 1020 |
| 845 | Ga0495630_0001481 | 3300046517 | Bacteria | 16232 |
| 846 | Ga0495630_0009954 | 3300046517 | Bacteria | 6846 |
| 847 | Ga0495630_0077567 | 3300046517 | Bacteria | 2505 |
| 848 | Ga0495630_0283839 | 3300046517 | Bacteria | 1265 |
| 849 | Ga0495663_0054344 | 3300046525 | Bacteria | 1247 |
| 850 | Ga0495666_0005436 | 3300046526 | Bacteria | 6418 |
| 851 | Ga0495666_0094215 | 3300046526 | Bacteria | 1412 |
| 852 | Ga0495652_0000174 | 3300046529 | Bacteria | 73044 |
| 853 | Ga0495652_0014268 | 3300046529 | Bacteria | 7133 |
| 854 | Ga0495652_0018126 | 3300046529 | Bacteria | 6283 |
| 855 | Ga0495652_0022357 | 3300046529 | Bacteria | 5610 |
| 856 | Ga0495652_0054315 | 3300046529 | Bacteria | 3411 |
| 857 | Ga0495652_0054402 | 3300046529 | Bacteria | 3408 |
| 858 | Ga0495652_0066154 | 3300046529 | Bacteria | 3034 |
| 859 | Ga0495652_0239700 | 3300046529 | Bacteria | 1350 |
| 860 | Ga0495665_0017965 | 3300046531 | Bacteria | 3801 |
| 861 | Ga0495640_0006733 | 3300046533 | Bacteria | 9067 |
| 862 | Ga0495640_0011539 | 3300046533 | Bacteria | 6795 |
| 863 | Ga0495640_0039902 | 3300046533 | Bacteria | 3291 |
| 864 | Ga0495640_0254242 | 3300046533 | Bacteria | 1099 |
| 865 | Ga0495587_0000044 | 3300046536 | Bacteria | 108443 |
| 866 | Ga0495587_0002197 | 3300046536 | Bacteria | 13041 |
| 867 | Ga0495587_0004185 | 3300046536 | Bacteria | 9552 |
| 868 | Ga0495587_0007131 | 3300046536 | Bacteria | 7253 |
| 869 | Ga0495587_0023581 | 3300046536 | Bacteria | 3781 |
| 870 | Ga0495587_0123462 | 3300046536 | Bacteria | 1482 |
| 871 | Ga0495645_0145071 | 3300046543 | Bacteria | 1654 |
| 872 | Ga0495645_0168207 | 3300046543 | Bacteria | 1510 |
| 873 | Ga0495645_0315594 | 3300046543 | Bacteria | 1016 |
| 874 | Ga0495622_0140668 | 3300046557 | Bacteria | 1096 |
| 875 | Ga0495667_0000052 | 3300046559 | Bacteria | 108432 |
| 876 | Ga0495667_0058789 | 3300046559 | Bacteria | 2524 |
| 877 | Ga0495667_0065610 | 3300046559 | Bacteria | 2374 |
| 878 | Ga0495667_0083468 | 3300046559 | Bacteria | 2075 |
| 879 | Ga0495667_0229903 | 3300046559 | Bacteria | 1182 |
| 880 | Ga0495667_0270642 | 3300046559 | Bacteria | 1079 |
| 881 | Ga0495656_0169464 | 3300046615 | Bacteria | 1066 |
| 882 | Ga0495634_0005292 | 3300046642 | Bacteria | 9963 |
| 883 | Ga0495634_0009343 | 3300046642 | Bacteria | 7234 |
| 884 | Ga0495634_0057919 | 3300046642 | Bacteria | 2584 |
| 885 | Ga0495634_0144929 | 3300046642 | Bacteria | 1505 |
| 886 | Ga0495634_0245119 | 3300046642 | Bacteria | 1098 |
| 887 | Ga0495635_0039234 | 3300046663 | Bacteria | 3276 |
| 888 | Ga0495635_0065132 | 3300046663 | Bacteria | 2500 |
| 889 | Ga0495635_0072653 | 3300046663 | Bacteria | 2356 |
| 890 | Ga0495635_0148515 | 3300046663 | Bacteria | 1596 |
| 891 | Ga0495635_0235376 | 3300046663 | Bacteria | 1236 |
| 892 | Ga0495635_0336209 | 3300046663 | Bacteria | 1009 |
| 893 | Ga0495588_0091891 | 3300046674 | Bacteria | 1590 |
| 894 | Ga0495588_0195713 | 3300046674 | Bacteria | 1068 |
| 895 | Ga0495657_0000015 | 3300046675 | Bacteria | 187657 |
| 896 | Ga0495657_0009392 | 3300046675 | Bacteria | 7416 |
| 897 | Ga0495657_0013373 | 3300046675 | Bacteria | 6059 |
| 898 | Ga0495657_0024401 | 3300046675 | Bacteria | 4307 |
| 899 | Ga0495657_0027681 | 3300046675 | Bacteria | 3997 |
| 900 | Ga0495657_0082289 | 3300046675 | Bacteria | 2080 |
| 901 | Ga0495657_0091969 | 3300046675 | Bacteria | 1944 |
| 902 | Ga0495657_0233343 | 3300046675 | Bacteria | 1112 |
| 903 | Ga0495599_0000035 | 3300046678 | Bacteria | 103981 |
| 904 | Ga0495599_0003091 | 3300046678 | Bacteria | 9690 |
| 905 | Ga0495599_0007370 | 3300046678 | Bacteria | 6669 |
| 906 | Ga0495599_0051967 | 3300046678 | Bacteria | 2567 |
| 907 | Ga0495599_0198281 | 3300046678 | Bacteria | 1233 |
| 908 | Ga0495623_0000767 | 3300046679 | Bacteria | 21507 |
| 909 | Ga0495623_0002607 | 3300046679 | Bacteria | 11904 |
| 910 | Ga0495623_0037673 | 3300046679 | Bacteria | 3093 |
| 911 | Ga0495623_0140134 | 3300046679 | Bacteria | 1440 |
| 912 | Ga0495623_0222683 | 3300046679 | Bacteria | 1074 |
| 913 | Ga0495623_0233732 | 3300046679 | Bacteria | 1041 |
| 914 | Ga0495623_0306196 | 3300046679 | Bacteria | 876 |
| 915 | Ga0495646_0002176 | 3300046680 | Bacteria | 11936 |
| 916 | Ga0495646_0014045 | 3300046680 | Bacteria | 5091 |
| 917 | Ga0495646_0040257 | 3300046680 | Bacteria | 2879 |
| 918 | Ga0495646_0382705 | 3300046680 | Bacteria | 733 |
| 919 | Ga0495658_0000676 | 3300046683 | Bacteria | 18454 |
| 920 | Ga0495613_0078282 | 3300046689 | Bacteria | 2405 |
| 921 | Ga0495624_0122064 | 3300046690 | Bacteria | 1599 |
| 922 | Ga0495624_0126680 | 3300046690 | Bacteria | 1567 |
| 923 | Ga0495600_0007475 | 3300046809 | Bacteria | 6688 |
| 924 | Ga0495600_0025656 | 3300046809 | Bacteria | 3798 |
| 925 | Ga0495600_0056237 | 3300046809 | Bacteria | 2570 |
| 926 | Ga0495600_0088286 | 3300046809 | Bacteria | 2023 |
| 927 | Ga0495600_0223031 | 3300046809 | Bacteria | 1205 |
| 928 | Ga0495600_0270490 | 3300046809 | Bacteria | 1078 |
| 929 | Ga0495581_0001515 | 3300047315 | Bacteria | 12943 |
| 930 | Ga0495581_0017534 | 3300047315 | Bacteria | 4159 |
| 931 | Ga0495581_0023897 | 3300047315 | Bacteria | 3542 |
| 932 | Ga0495581_0091086 | 3300047315 | Bacteria | 1769 |
| 933 | Ga0495604_0000048 | 3300047317 | Bacteria | 108810 |
| 934 | Ga0495604_0009246 | 3300047317 | Bacteria | 7801 |
| 935 | Ga0495604_0030548 | 3300047317 | Bacteria | 4278 |
| 936 | Ga0495604_0041434 | 3300047317 | Bacteria | 3611 |
| 937 | Ga0495604_0046676 | 3300047317 | Bacteria | 3378 |
| 938 | Ga0495604_0131706 | 3300047317 | Bacteria | 1796 |
| 939 | Ga0495604_0154282 | 3300047317 | Bacteria | 1628 |
| 940 | Ga0495674_0027236 | 3300047319 | Bacteria | 5224 |
| 941 | Ga0495674_0139615 | 3300047319 | Bacteria | 2037 |
| 942 | Ga0495676_0004969 | 3300047321 | Bacteria | 12194 |
| 943 | Ga0495676_0006692 | 3300047321 | Bacteria | 10614 |
| 944 | Ga0495680_0000069 | 3300047322 | Bacteria | 88766 |
| 945 | Ga0495680_0010239 | 3300047322 | Bacteria | 8372 |
| 946 | Ga0495680_0012666 | 3300047322 | Bacteria | 7406 |
| 947 | Ga0495680_0019087 | 3300047322 | Bacteria | 5802 |
| 948 | Ga0495680_0020724 | 3300047322 | Bacteria | 5521 |
| 949 | Ga0495680_0074021 | 3300047322 | Bacteria | 2587 |
| 950 | Ga0495680_0187849 | 3300047322 | Bacteria | 1487 |
| 951 | Ga0495675_0000685 | 3300047444 | Bacteria | 21288 |
| 952 | Ga0495675_0040750 | 3300047444 | Bacteria | 2960 |
| 953 | Ga0495675_0048135 | 3300047444 | Bacteria | 2712 |
| 954 | Ga0495675_0067482 | 3300047444 | Bacteria | 2260 |
| 955 | Ga0495684_0002558 | 3300047471 | Bacteria | 14475 |
| 956 | Ga0495684_0009605 | 3300047471 | Bacteria | 7458 |
| 957 | Ga0495684_0014538 | 3300047471 | Bacteria | 6059 |
| 958 | Ga0495684_0067033 | 3300047471 | Bacteria | 2729 |
| 959 | Ga0495684_0079004 | 3300047471 | Bacteria | 2497 |
| 960 | Ga0495684_0125480 | 3300047471 | Bacteria | 1931 |
| 961 | Ga0495684_0205211 | 3300047471 | Bacteria | 1452 |
| 962 | Ga0495593_0045862 | 3300047673 | Bacteria | 2331 |
| 963 | Ga0495593_0246927 | 3300047673 | Bacteria | 894 |
| 964 | Ga0495602_0000970 | 3300048088 | Bacteria | 27780 |
| 965 | Ga0495602_0028336 | 3300048088 | Bacteria | 5362 |
| 966 | Ga0495602_0036043 | 3300048088 | Bacteria | 4607 |
| 967 | Ga0495602_0041593 | 3300048088 | Bacteria | 4196 |
| 968 | Ga0495602_0091366 | 3300048088 | Bacteria | 2525 |
| 969 | Ga0495602_0099272 | 3300048088 | Bacteria | 2393 |
| 970 | Ga0495614_0140023 | 3300048089 | Bacteria | 1074 |
| 971 | Ga0496100_0192306 | 3300048903 | Bacteria | 1482 |
| 972 | Ga0496102_0074809 | 3300048905 | Bacteria | 3114 |
| 973 | Ga0496102_0136609 | 3300048905 | Bacteria | 2298 |
| 974 | Ga0496102_0334117 | 3300048905 | Bacteria | 1427 |
| 975 | Ga0496102_0482142 | 3300048905 | Bacteria | 1161 |
| 976 | Ga0496102_0662145 | 3300048905 | Bacteria | 967 |
| 977 | Ga0496103_0053830 | 3300048906 | Bacteria | 2494 |
| 978 | Ga0496104_0000441 | 3300048907 | Bacteria | 36043 |
| 979 | Ga0496104_0005513 | 3300048907 | Bacteria | 11084 |
| 980 | Ga0496104_0007235 | 3300048907 | Bacteria | 9794 |
| 981 | Ga0496104_0012681 | 3300048907 | Bacteria | 7590 |
| 982 | Ga0496105_0031146 | 3300048908 | Bacteria | 4372 |
| 983 | Ga0496105_0085888 | 3300048908 | Bacteria | 2600 |
| 984 | Ga0496106_0334431 | 3300048909 | Bacteria | 1216 |
| 985 | Ga0496106_0370120 | 3300048909 | Bacteria | 1151 |
| 986 | Ga0496106_0666185 | 3300048909 | Bacteria | 831 |
| 987 | Ga0496108_0000748 | 3300048911 | Bacteria | 25330 |
| 988 | Ga0496108_0018581 | 3300048911 | Bacteria | 5694 |
| 989 | Ga0496108_0022231 | 3300048911 | Bacteria | 5215 |
| 990 | Ga0496108_0022533 | 3300048911 | Bacteria | 5179 |
| 991 | Ga0496108_0034966 | 3300048911 | Bacteria | 4175 |
| 992 | Ga0496108_0148646 | 3300048911 | Bacteria | 2021 |
| 993 | Ga0496108_0180850 | 3300048911 | Bacteria | 1826 |
| 994 | Ga0496108_0213929 | 3300048911 | Bacteria | 1673 |
| 995 | Ga0496108_0546456 | 3300048911 | Bacteria | 1011 |
| 996 | Ga0496109_0001743 | 3300048912 | Bacteria | 18151 |
| 997 | Ga0496109_0110366 | 3300048912 | Bacteria | 2557 |
| 998 | Ga0496109_0152282 | 3300048912 | Bacteria | 2165 |
| 999 | Ga0496109_0170111 | 3300048912 | Bacteria | 2044 |
| 1000 | Ga0496109_0207973 | 3300048912 | Bacteria | 1840 |
| 1001 | Ga0496109_0246635 | 3300048912 | Bacteria | 1681 |
| 1002 | Ga0496109_0248074 | 3300048912 | Bacteria | 1676 |
| 1003 | Ga0496109_0458350 | 3300048912 | Bacteria | 1204 |
| 1004 | Ga0496110_0003033 | 3300048913 | Bacteria | 12739 |
| 1005 | Ga0496110_0032286 | 3300048913 | Bacteria | 4521 |
| 1006 | Ga0496110_0059346 | 3300048913 | Bacteria | 3372 |
| 1007 | Ga0496110_0061091 | 3300048913 | Bacteria | 3325 |
| 1008 | Ga0496110_0063852 | 3300048913 | Bacteria | 3254 |
| 1009 | Ga0496110_0158974 | 3300048913 | Bacteria | 2048 |
| 1010 | Ga0496111_0001177 | 3300048914 | Bacteria | 14549 |
| 1011 | Ga0496111_0161411 | 3300048914 | Bacteria | 1664 |
| 1012 | Ga0496111_0368051 | 3300048914 | Bacteria | 1063 |
| 1013 | Ga0496112_0000159 | 3300048915 | Bacteria | 42547 |
| 1014 | Ga0496112_0337142 | 3300048915 | Bacteria | 1451 |
| 1015 | Ga0496112_0412413 | 3300048915 | Bacteria | 1290 |
| 1016 | Ga0496112_0443375 | 3300048915 | Bacteria | 1236 |
| 1017 | Ga0496112_0496972 | 3300048915 | Bacteria | 1155 |
| 1018 | Ga0496112_0751517 | 3300048915 | Bacteria | 901 |
| 1019 | Ga0496113_0051315 | 3300048916 | Bacteria | 3078 |
| 1020 | Ga0496113_0054954 | 3300048916 | Bacteria | 2983 |
| 1021 | Ga0496113_0381641 | 3300048916 | Bacteria | 1131 |
| 1022 | Ga0496113_0710750 | 3300048916 | Bacteria | 801 |
| 1023 | Ga0496114_0088480 | 3300048917 | Bacteria | 2627 |
| 1024 | Ga0496114_0242525 | 3300048917 | Bacteria | 1585 |
| 1025 | Ga0496114_0286236 | 3300048917 | Bacteria | 1454 |
| 1026 | Ga0496114_0681767 | 3300048917 | Bacteria | 902 |
| 1027 | Ga0496115_0106658 | 3300048918 | Bacteria | 2300 |
| 1028 | Ga0496115_0136170 | 3300048918 | Bacteria | 2025 |
| 1029 | Ga0496115_0353438 | 3300048918 | Bacteria | 1198 |
| 1030 | Ga0496119_0083288 | 3300048922 | Bacteria | 1837 |
| 1031 | Ga0496126_0007772 | 3300048929 | Bacteria | 11685 |
| 1032 | Ga0496126_0337260 | 3300048929 | Bacteria | 1236 |
| 1033 | Ga0501031_0066544 | 3300049568 | Bacteria | 2348 |
| 1034 | Ga0501032_0142716 | 3300049569 | Bacteria | 1577 |
| 1035 | Ga0501033_0123128 | 3300049570 | Bacteria | 1881 |
| 1036 | Ga0501033_0299190 | 3300049570 | Bacteria | 1133 |
| 1037 | Ga0501036_0012617 | 3300049572 | Bacteria | 7009 |
| 1038 | Ga0501036_0031750 | 3300049572 | Bacteria | 4463 |
| 1039 | Ga0501036_0419841 | 3300049572 | Bacteria | 1115 |
| 1040 | Ga0501038_0055593 | 3300049574 | Bacteria | 3400 |
| 1041 | Ga0501039_0023712 | 3300049575 | Bacteria | 4710 |
| 1042 | Ga0501039_0183281 | 3300049575 | Bacteria | 1646 |
| 1043 | Ga0501039_0579009 | 3300049575 | Bacteria | 880 |
| 1044 | Ga0501040_0005034 | 3300049576 | Bacteria | 8539 |
| 1045 | Ga0501042_0016519 | 3300049578 | Bacteria | 5068 |
| 1046 | Ga0501042_0053553 | 3300049578 | Bacteria | 2879 |
| 1047 | Ga0501043_0238103 | 3300049579 | Bacteria | 1404 |
| 1048 | Ga0501046_0064009 | 3300049580 | Bacteria | 2871 |
| 1049 | Ga0501047_0024344 | 3300049581 | Bacteria | 5812 |
| 1050 | Ga0501048_0006698 | 3300049582 | Bacteria | 8751 |
| 1051 | Ga0501067_0002370 | 3300049583 | Bacteria | 10435 |
| 1052 | Ga0501067_0217319 | 3300049583 | Bacteria | 1064 |
| 1053 | Ga0501068_0246065 | 3300049584 | Bacteria | 1139 |
| 1054 | Ga0501068_0396983 | 3300049584 | Bacteria | 889 |
| 1055 | Ga0501070_0038435 | 3300049586 | Bacteria | 3993 |
| 1056 | Ga0501071_0004689 | 3300049587 | Bacteria | 8689 |
| 1057 | Ga0501072_0006738 | 3300049588 | Bacteria | 8728 |
| 1058 | Ga0501074_0141438 | 3300049590 | Bacteria | 1721 |
| 1059 | Ga0501076_0038370 | 3300049592 | Bacteria | 3761 |
| 1060 | Ga0501076_0221856 | 3300049592 | Bacteria | 1545 |
| 1061 | Ga0501077_0125451 | 3300049593 | Bacteria | 1627 |
| 1062 | Ga0501079_0024703 | 3300049741 | Bacteria | 4611 |
| 1063 | Ga0501079_0162120 | 3300049741 | Bacteria | 1744 |
| 1064 | Ga0501080_0028140 | 3300049742 | Bacteria | 5226 |
| 1065 | Ga0501080_0044011 | 3300049742 | Bacteria | 4157 |
| 1066 | Ga0501080_0268637 | 3300049742 | Bacteria | 1553 |
| 1067 | Ga0501081_0156214 | 3300049743 | Bacteria | 1641 |
| 1068 | Ga0501081_0443958 | 3300049743 | Bacteria | 963 |
| 1069 | Ga0501035_0036768 | 3300049822 | Bacteria | 4436 |
| 1070 | Ga0501044_0034810 | 3300049823 | Bacteria | 5279 |
| 1071 | Ga0501045_0053012 | 3300049824 | Bacteria | 2963 |
| 1072 | nmdc:mga06r32_562659_c1 | 3300050510 | Bacteria | 1113 |
| 1073 | nmdc:mga06r32_99194_c1 | 3300050510 | Bacteria | 2856 |
| 1074 | nmdc:mga08y16_1241598_c1 | 3300050511 | Bacteria | 714 |
| 1075 | nmdc:mga08y16_14122_c1 | 3300050511 | Bacteria | 8408 |
| 1076 | nmdc:mga08y16_24926_c1 | 3300050511 | Bacteria | 6309 |
| 1077 | nmdc:mga08y16_51474_c1 | 3300050511 | Bacteria | 4309 |
| 1078 | nmdc:mga0rr50_145490_c1 | 3300050513 | Bacteria | 1911 |
| 1079 | nmdc:mga0rr50_316648_c1 | 3300050513 | Bacteria | 1307 |
| 1080 | nmdc:mga0a205_30845_c1 | 3300050515 | Bacteria | 5135 |
| 1081 | Ga0495601_0085937 | 3300053077 | Bacteria | 2021 |
| 1082 | Ga0495601_0144616 | 3300053077 | Bacteria | 1552 |
| 1083 | Ga0495612_0014977 | 3300053078 | Bacteria | 3110 |
| 1084 | Ga0495612_0130935 | 3300053078 | Bacteria | 1083 |
| 1085 | Ga0495595_0000162 | 3300053084 | Bacteria | 26749 |
| 1086 | Ga0495595_0004135 | 3300053084 | Bacteria | 5826 |
| 1087 | Ga0495595_0019979 | 3300053084 | Bacteria | 2911 |
| 1088 | Ga0495595_0032891 | 3300053084 | Bacteria | 2337 |
| 1089 | Ga0495595_0154657 | 3300053084 | Bacteria | 1129 |
| 1090 | Ga0495619_0003428 | 3300053085 | Bacteria | 10234 |
| 1091 | Ga0495619_0256704 | 3300053085 | Bacteria | 1211 |
| 1092 | Ga0495619_0316284 | 3300053085 | Bacteria | 1081 |
| 1093 | Ga0495619_0338068 | 3300053085 | Bacteria | 1042 |
| 1094 | Ga0500651_0084308 | 3300053093 | Bacteria | 1965 |
| 1095 | Ga0500650_0115430 | 3300053098 | Bacteria | 1253 |
| 1096 | Ga0500569_024140 | 3300053109 | Bacteria | 1642 |
| 1097 | Ga0500594_0077090 | 3300053118 | Bacteria | 990 |
| 1098 | Ga0500652_004451 | 3300053131 | Bacteria | 4341 |
| 1099 | Ga0500611_097349 | 3300053727 | Bacteria | 757 |
| 1100 | Ga0501084_0052825 | 3300054114 | Bacteria | 3399 |
| 1101 | Ga0501082_0042883 | 3300060353 | Bacteria | 3899 |
| 1102 | Ga0501082_0448009 | 3300060353 | Bacteria | 1128 |
| 1103 | Ga0466962_0035909 | 3300061719 | Bacteria | 2372 |
| 1104 | Ga0530510_0018293 | 3300061734 | Bacteria | 4968 |
| 1105 | 2558910879 | 2558860112 | Bacteria | 9931328 |
| 1106 | 2623499272 | 2622736605 | Bacteria | 4992138 |
| 1107 | 2870784859 | 2870782633 | Bacteria | 9624083 |
| 1108 | 2904482173 | 2904479285 | Bacteria | 5073931 |
| 1109 | 2946005680 | 2946003308 | Bacteria | 3857229 |
| 1110 | 8054476347 | 8054472261 | Bacteria | 7464355 |
| 1111 | Ga0070714_100256254 | |||
| 1112 | JGI24735J21928_10093592 | |||
| 1113 | JGI24744J21845_10005151 | |||
| 1114 | JGI25406J46586_10006130 | |||
| 1115 | Ga0070658_10006845 | |||
| 1116 | Ga0070658_10023598 | |||
| 1117 | Ga0070658_10064156 | |||
| 1118 | Ga0070658_10257089 | |||
| 1119 | Ga0070658_10283857 | |||
| 1120 | Ga0070676_10104111 | |||
| 1121 | Ga0070676_10452015 | |||
| 1122 | Ga0070683_100004571 | |||
| 1123 | Ga0070683_100059709 | |||
| 1124 | Ga0070683_100064566 | |||
| 1125 | Ga0070683_100101131 | |||
| 1126 | Ga0070683_100113133 | |||
| 1127 | Ga0070683_100127961 | |||
| 1128 | Ga0070683_100144915 | |||
| 1129 | Ga0070683_100153307 | |||
| 1130 | Ga0070683_100167567 | |||
| 1131 | Ga0070683_100232294 | |||
| 1132 | Ga0070683_100321577 | |||
| 1133 | Ga0070670_100081101 | |||
| 1134 | Ga0070670_100628995 | |||
| 1135 | Ga0068869_100018522 | |||
| 1136 | Ga0068869_100030074 | |||
| 1137 | Ga0070680_100290980 | |||
| 1138 | Ga0070682_100008855 | |||
| 1139 | Ga0070682_100151536 | |||
| 1140 | Ga0070682_100576076 | |||
| 1141 | Ga0068868_100004265 | |||
| 1142 | Ga0068868_100024352 | |||
| 1143 | Ga0070660_100019041 | |||
| 1144 | Ga0070660_100027145 | |||
| 1145 | Ga0070660_100129995 | |||
| 1146 | Ga0070660_100397204 | |||
| 1147 | Ga0070689_100408094 | |||
| 1148 | Ga0070689_100564929 | |||
| 1149 | Ga0070691_10024889 | |||
| 1150 | Ga0070691_10101628 | |||
| 1151 | Ga0070661_100030787 | |||
| 1152 | Ga0070661_100085981 | |||
| 1153 | Ga0070661_100457680 | |||
| 1154 | Ga0070661_100499430 | |||
| 1155 | Ga0070692_10146692 | |||
| 1156 | Ga0070692_10195973 | |||
| 1157 | Ga0070668_100017010 | |||
| 1158 | Ga0070668_100225900 | |||
| 1159 | Ga0070669_100350604 | |||
| 1160 | Ga0070669_100436787 | |||
| 1161 | Ga0070675_100002740 | |||
| 1162 | Ga0070675_100080840 | |||
| 1163 | Ga0070675_100085263 | |||
| 1164 | Ga0070675_100167581 | |||
| 1165 | Ga0070675_100450683 | |||
| 1166 | Ga0070674_100068747 | |||
| 1167 | Ga0070674_100260495 | |||
| 1168 | Ga0070674_100922664 | |||
| 1169 | Ga0070673_100117165 | |||
| 1170 | Ga0070688_100287082 | |||
| 1171 | Ga0070659_100037838 | |||
| 1172 | Ga0070659_100112961 | |||
| 1173 | Ga0070659_100155108 | |||
| 1174 | Ga0070709_10003021 | |||
| 1175 | Ga0070709_10028678 | |||
| 1176 | Ga0070709_10039282 | |||
| 1177 | Ga0070709_10040725 | |||
| 1178 | Ga0070709_10067334 | |||
| 1179 | Ga0070709_10112358 | |||
| 1180 | Ga0070714_100000452 | |||
| 1181 | Ga0070714_100001028 | |||
| 1182 | Ga0070714_100005940 | |||
| 1183 | Ga0070714_100005955 | |||
| 1184 | Ga0070714_100082551 | |||
| 1185 | Ga0070714_100083836 | |||
| 1186 | Ga0070714_100276806 | |||
| 1187 | Ga0070713_100007261 | |||
| 1188 | Ga0070713_100010227 | |||
| 1189 | Ga0070713_100024420 | |||
| 1190 | Ga0070713_100037406 | |||
| 1191 | Ga0070713_100065592 | |||
| 1192 | Ga0070713_100147037 | |||
| 1193 | Ga0070713_100280114 | |||
| 1194 | Ga0070713_100292505 | |||
| 1195 | Ga0070713_100330256 | |||
| 1196 | Ga0070710_10008259 | |||
| 1197 | Ga0070710_10018475 | |||
| 1198 | Ga0070710_10082483 | |||
| 1199 | Ga0070710_10088860 | |||
| 1200 | Ga0070710_10184202 | |||
| 1201 | Ga0070701_10006868 | |||
| 1202 | Ga0070701_10025713 | |||
| 1203 | Ga0070711_100021021 | |||
| 1204 | Ga0070711_100032826 | |||
| 1205 | Ga0070711_100043948 | |||
| 1206 | Ga0070705_100076262 | |||
| 1207 | Ga0070705_100123531 | |||
| 1208 | Ga0070700_100009488 | |||
| 1209 | Ga0070700_100033665 | |||
| 1210 | Ga0070700_100278561 | |||
| 1211 | Ga0070708_100534018 | |||
| 1212 | Ga0070663_100026326 | |||
| 1213 | Ga0070663_100055561 | |||
| 1214 | Ga0070663_100085492 | |||
| 1215 | Ga0070663_100233430 | |||
| 1216 | Ga0070663_100331677 | |||
| 1217 | Ga0070678_100015224 | |||
| 1218 | Ga0070678_100096045 | |||
| 1219 | Ga0070678_100224580 | |||
| 1220 | Ga0070662_100063633 | |||
| 1221 | Ga0070681_10009600 | |||
| 1222 | Ga0070681_10313312 | |||
| 1223 | Ga0070681_10419697 | |||
| 1224 | Ga0068867_100007002 | |||
| 1225 | Ga0070685_10043361 | |||
| 1226 | Ga0070685_10060364 | |||
| 1227 | Ga0070685_10064127 | |||
| 1228 | Ga0070685_10391648 | |||
| 1229 | Ga0070706_100001048 | |||
| 1230 | Ga0070706_100003836 | |||
| 1231 | Ga0070706_100005036 | |||
| 1232 | Ga0070706_100006933 | |||
| 1233 | Ga0070706_100007675 | |||
| 1234 | Ga0070706_100079469 | |||
| 1235 | Ga0070706_100088284 | |||
| 1236 | Ga0070706_100208006 | |||
| 1237 | Ga0070706_100631577 | |||
| 1238 | Ga0070706_100906047 | |||
| 1239 | Ga0070707_100000792 | |||
| 1240 | Ga0070707_100023200 | |||
| 1241 | Ga0070707_100029054 | |||
| 1242 | Ga0070707_100035864 | |||
| 1243 | Ga0070707_100045292 | |||
| 1244 | Ga0070707_100120283 | |||
| 1245 | Ga0070707_100121840 | |||
| 1246 | Ga0070707_100233253 | |||
| 1247 | Ga0070707_100372866 | |||
| 1248 | Ga0070698_100006771 | |||
| 1249 | Ga0070698_100008876 | |||
| 1250 | Ga0070698_100011521 | |||
| 1251 | Ga0070698_100037550 | |||
| 1252 | Ga0070698_100038643 | |||
| 1253 | Ga0070698_100076311 | |||
| 1254 | Ga0070698_100077164 | |||
| 1255 | Ga0070698_100118694 | |||
| 1256 | Ga0070698_100222699 | |||
| 1257 | Ga0070698_100322806 | |||
| 1258 | Ga0070699_100001575 | |||
| 1259 | Ga0070699_100002101 | |||
| 1260 | Ga0070699_100068500 | |||
| 1261 | Ga0070699_100321845 | |||
| 1262 | Ga0070699_100529912 | |||
| 1263 | Ga0070699_100703631 | |||
| 1264 | Ga0070679_100003755 | |||
| 1265 | Ga0070679_100008909 | |||
| 1266 | Ga0070679_100031308 | |||
| 1267 | Ga0070679_100111734 | |||
| 1268 | Ga0070679_100745761 | |||
| 1269 | Ga0070679_100873675 | |||
| 1270 | Ga0070684_100019147 | |||
| 1271 | Ga0070684_100019292 | |||
| 1272 | Ga0070684_100158834 | |||
| 1273 | Ga0070684_100200043 | |||
| 1274 | Ga0070684_100230379 | |||
| 1275 | Ga0070684_100743007 | |||
| 1276 | Ga0070684_100880707 | |||
| 1277 | Ga0070697_100010976 | |||
| 1278 | Ga0070697_100061101 | |||
| 1279 | Ga0068853_100163892 | |||
| 1280 | Ga0068853_100257281 | |||
| 1281 | Ga0070672_100001312 | |||
| 1282 | Ga0070686_100020181 | |||
| 1283 | Ga0070686_100112921 | |||
| 1284 | Ga0070686_100154360 | |||
| 1285 | Ga0070695_100099157 | |||
| 1286 | Ga0070696_100103024 | |||
| 1287 | Ga0070693_100050430 | |||
| 1288 | Ga0070693_100060807 | |||
| 1289 | Ga0070693_100152791 | |||
| 1290 | Ga0070693_100223269 | |||
| 1291 | Ga0070665_100054642 | |||
| 1292 | Ga0070665_100589065 | |||
| 1293 | Ga0068855_100058270 | |||
| 1294 | Ga0068855_100097460 | |||
| 1295 | Ga0070664_100009193 | |||
| 1296 | Ga0070664_100299231 | |||
| 1297 | Ga0070664_100355724 | |||
| 1298 | Ga0070664_100460177 | |||
| 1299 | Ga0070664_100548494 | |||
| 1300 | Ga0068857_100004338 | |||
| 1301 | Ga0068857_100045347 | |||
| 1302 | Ga0068857_100073149 | |||
| 1303 | Ga0068857_100400311 | |||
| 1304 | Ga0068857_100497630 | |||
| 1305 | Ga0068854_100011357 | |||
| 1306 | Ga0068854_100013890 | |||
| 1307 | Ga0068854_100028924 | |||
| 1308 | Ga0068856_100108541 | |||
| 1309 | Ga0068856_100530346 | |||
| 1310 | Ga0070702_100007486 | |||
| 1311 | Ga0070702_100017373 | |||
| 1312 | Ga0070702_100025155 | |||
| 1313 | Ga0070702_100237246 | |||
| 1314 | Ga0070702_100379323 | |||
| 1315 | Ga0068852_100192661 | |||
| 1316 | Ga0068859_100041006 | |||
| 1317 | Ga0068864_100012042 | |||
| 1318 | Ga0068864_100068223 | |||
| 1319 | Ga0068864_100244236 | |||
| 1320 | Ga0068864_100403177 | |||
| 1321 | Ga0068864_100645846 | |||
| 1322 | Ga0068864_101067031 | |||
| 1323 | Ga0068866_10071920 | |||
| 1324 | Ga0068866_10092394 | |||
| 1325 | Ga0068861_100014698 | |||
| 1326 | Ga0068861_100069261 | |||
| 1327 | Ga0068851_10114771 | |||
| 1328 | Ga0068870_10007764 | |||
| 1329 | Ga0068870_10068076 | |||
| 1330 | Ga0068863_100092777 | |||
| 1331 | Ga0068863_100853033 | |||
| 1332 | Ga0068858_100070389 | |||
| 1333 | Ga0068858_100224105 | |||
| 1334 | Ga0068858_100573081 | |||
| 1335 | Ga0068860_100021498 | |||
| 1336 | Ga0068860_100115439 | |||
| 1337 | Ga0068860_100152796 | |||
| 1338 | Ga0068860_100231940 | |||
| 1339 | Ga0068860_100269611 | |||
| 1340 | Ga0068860_100740566 | |||
| 1341 | Ga0068862_100014232 | |||
| 1342 | Ga0068862_100227134 | |||
| 1343 | Ga0068862_100252439 | |||
| 1344 | Ga0081540_1000345 | |||
| 1345 | Ga0081540_1001308 | |||
| 1346 | Ga0081540_1006178 | |||
| 1347 | Ga0081539_10003383 | |||
| 1348 | Ga0081539_10005543 | |||
| 1349 | Ga0081539_10010664 | |||
| 1350 | Ga0081539_10027029 | |||
| 1351 | Ga0081539_10027830 | |||
| 1352 | Ga0081539_10176204 | |||
| 1353 | Ga0070717_10007804 | |||
| 1354 | Ga0070717_10018129 | |||
| 1355 | Ga0070717_10046161 | |||
| 1356 | Ga0070717_10052576 | |||
| 1357 | Ga0070717_10058504 | |||
| 1358 | Ga0070717_10119623 | |||
| 1359 | Ga0070717_10175368 | |||
| 1360 | Ga0070717_10368294 | |||
| 1361 | Ga0070717_10514079 | |||
| 1362 | Ga0070717_10624459 | |||
| 1363 | Ga0070715_10001476 | |||
| 1364 | Ga0070715_10050842 | |||
| 1365 | Ga0070715_10179863 | |||
| 1366 | Ga0070716_100001463 | |||
| 1367 | Ga0070716_100019289 | |||
| 1368 | Ga0070716_100076159 | |||
| 1369 | Ga0070712_100071500 | |||
| 1370 | Ga0070712_100260485 | |||
| 1371 | Ga0070712_100266517 | |||
| 1372 | Ga0097621_100215728 | |||
| 1373 | Ga0097621_100311445 | |||
| 1374 | Ga0097621_100627844 | |||
| 1375 | Ga0075428_100553200 | |||
| 1376 | Ga0075428_100717706 | |||
| 1377 | Ga0075431_100073239 | |||
| 1378 | Ga0075431_100075900 | |||
| 1379 | Ga0075431_100106830 | |||
| 1380 | Ga0075434_100389538 | |||
| 1381 | Ga0068865_100011812 | |||
| 1382 | Ga0068865_100096507 | |||
| 1383 | Ga0068865_100374407 | |||
| 1384 | Ga0075436_100004827 | |||
| 1385 | Ga0075436_100020931 | |||
| 1386 | Ga0097620_100041008 | |||
| 1387 | Ga0105240_10273382 | |||
| 1388 | Ga0105240_10350751 | |||
| 1389 | Ga0105240_10609138 | |||
| 1390 | Ga0111539_10001402 | |||
| 1391 | Ga0111539_10024563 | |||
| 1392 | Ga0111539_10865089 | |||
| 1393 | Ga0105245_10017866 | |||
| 1394 | Ga0105245_10028596 | |||
| 1395 | Ga0105245_10101497 | |||
| 1396 | Ga0105245_10163393 | |||
| 1397 | Ga0105245_10500369 | |||
| 1398 | Ga0105247_10540866 | |||
| 1399 | Ga0114129_10024315 | |||
| 1400 | Ga0114129_10216522 | |||
| 1401 | Ga0114129_10333104 | |||
| 1402 | Ga0105243_10002861 | |||
| 1403 | Ga0105243_10150131 | |||
| 1404 | Ga0105243_10275198 | |||
| 1405 | Ga0105243_10277580 | |||
| 1406 | Ga0105243_10316852 | |||
| 1407 | Ga0105243_10341615 | |||
| 1408 | Ga0105243_10362608 | |||
| 1409 | Ga0105241_10103218 | |||
| 1410 | Ga0105242_10010464 | |||
| 1411 | Ga0105242_10073410 | |||
| 1412 | Ga0105242_10208554 | |||
| 1413 | Ga0105242_11072563 | |||
| 1414 | Ga0105248_10109534 | |||
| 1415 | Ga0105248_10604018 | |||
| 1416 | Ga0105238_10049831 | |||
| 1417 | Ga0105238_10119356 | |||
| 1418 | Ga0105238_10159425 | |||
| 1419 | Ga0105238_10229245 | |||
| 1420 | Ga0105238_10291352 | |||
| 1421 | Ga0105249_10016248 | |||
| 1422 | Ga0105249_10130704 | |||
| 1423 | Ga0105249_10169960 | |||
| 1424 | Ga0105249_10697895 | |||
| 1425 | Ga0105239_10109864 | |||
| 1426 | Ga0105239_10130301 | |||
| 1427 | Ga0105239_10201441 | |||
| 1428 | Ga0105239_10238761 | |||
| 1429 | Ga0105246_10032876 | |||
| 1430 | Ga0105246_10093187 | |||
| 1431 | Ga0105246_10095239 | |||
| 1432 | Ga0105246_10919680 | |||
| 1433 | Ga0157342_1008389 | |||
| 1434 | Ga0157371_10431412 | |||
| 1435 | Ga0157370_10170964 | |||
| 1436 | Ga0157370_10304658 | |||
| 1437 | Ga0157369_10006230 | |||
| 1438 | Ga0157369_10009643 | |||
| 1439 | Ga0157369_10043686 | |||
| 1440 | Ga0157369_10223548 | |||
| 1441 | Ga0157374_10223871 | |||
| 1442 | Ga0157374_10649385 | |||
| 1443 | Ga0157378_10176077 | |||
| 1444 | Ga0157378_10498396 | |||
| 1445 | Ga0163162_10033664 | |||
| 1446 | Ga0163162_10236810 | |||
| 1447 | Ga0163162_10833720 | |||
| 1448 | Ga0157372_10070802 | |||
| 1449 | Ga0157372_10090164 | |||
| 1450 | Ga0157372_10634069 | |||
| 1451 | Ga0157372_10750118 | |||
| 1452 | Ga0157372_10770623 | |||
| 1453 | Ga0157375_10077212 | |||
| 1454 | Ga0157375_10144159 | |||
| 1455 | Ga0157375_10218869 | |||
| 1456 | Ga0163163_10003412 | |||
| 1457 | Ga0163163_10101314 | |||
| 1458 | Ga0163163_10124358 | |||
| 1459 | Ga0163163_10327439 | |||
| 1460 | Ga0163163_10357935 | |||
| 1461 | Ga0157380_10014664 | |||
| 1462 | Ga0157380_10482740 | |||
| 1463 | Ga0157380_10532211 | |||
| 1464 | Ga0157380_10720355 | |||
| 1465 | Ga0157377_10001840 | |||
| 1466 | Ga0157377_10070554 | |||
| 1467 | Ga0157379_10005808 | |||
| 1468 | Ga0157379_10187756 | |||
| 1469 | Ga0157379_10279803 | |||
| 1470 | Ga0157379_10941423 | |||
| 1471 | Ga0157376_10025898 | |||
| 1472 | Ga0157376_10116353 | |||
| 1473 | Ga0157376_10154488 | |||
| 1474 | Ga0163161_10052133 | |||
| 1475 | Ga0197907_11154562 | |||
| 1476 | Ga0206356_10064106 | |||
| 1477 | Ga0206356_10374739 | |||
| 1478 | Ga0206351_10623328 | |||
| 1479 | Ga0206350_10545162 | |||
| 1480 | Ga0206350_11332998 | |||
| 1481 | Ga0206353_10430810 | |||
| 1482 | Ga0206353_10680297 | |||
| 1483 | Ga0206353_10837455 | |||
| 1484 | Ga0206353_11138628 | |||
| 1485 | Ga0213875_10045485 | |||
| 1486 | Ga0213875_10053546 | |||
| 1487 | Ga0224712_10003657 | |||
| 1488 | Ga0224712_10009872 | |||
| 1489 | Ga0224712_10012296 | |||
| 1490 | Ga0224712_10022462 | |||
| 1491 | Ga0224712_10172980 | |||
| 1492 | Ga0224712_10210403 | |||
| 1493 | Ga0207697_10076100 | |||
| 1494 | Ga0207656_10105874 | |||
| 1495 | Ga0207692_10001219 | |||
| 1496 | Ga0207692_10048644 | |||
| 1497 | Ga0207692_10231762 | |||
| 1498 | Ga0207692_10379978 | |||
| 1499 | Ga0207642_10046425 | |||
| 1500 | Ga0207688_10003336 | |||
| 1501 | Ga0207688_10011417 | |||
| 1502 | Ga0207688_10121591 | |||
| 1503 | Ga0207688_10128231 | |||
| 1504 | Ga0207647_10045140 | |||
| 1505 | Ga0207647_10053383 | |||
| 1506 | Ga0207647_10210887 | |||
| 1507 | Ga0207685_10017954 | |||
| 1508 | Ga0207685_10056915 | |||
| 1509 | Ga0207699_10010674 | |||
| 1510 | Ga0207699_10018548 | |||
| 1511 | Ga0207699_10069684 | |||
| 1512 | Ga0207699_10084580 | |||
| 1513 | Ga0207699_10094201 | |||
| 1514 | Ga0207699_10300896 | |||
| 1515 | Ga0207645_10031739 | |||
| 1516 | Ga0207645_10094505 | |||
| 1517 | Ga0207643_10014808 | |||
| 1518 | Ga0207643_10023975 | |||
| 1519 | Ga0207705_10014311 | |||
| 1520 | Ga0207705_10020113 | |||
| 1521 | Ga0207705_10262640 | |||
| 1522 | Ga0207684_10002703 | |||
| 1523 | Ga0207684_10004377 | |||
| 1524 | Ga0207684_10011882 | |||
| 1525 | Ga0207684_10020585 | |||
| 1526 | Ga0207684_10027199 | |||
| 1527 | Ga0207684_10098696 | |||
| 1528 | Ga0207684_10103864 | |||
| 1529 | Ga0207684_10164710 | |||
| 1530 | Ga0207684_10224693 | |||
| 1531 | Ga0207684_10281699 | |||
| 1532 | Ga0207654_10051541 | |||
| 1533 | Ga0207707_10001352 | |||
| 1534 | Ga0207707_10303303 | |||
| 1535 | Ga0207693_10011242 | |||
| 1536 | Ga0207693_10055473 | |||
| 1537 | Ga0207693_10122229 | |||
| 1538 | Ga0207693_10177362 | |||
| 1539 | Ga0207663_10016400 | |||
| 1540 | Ga0207663_10176131 | |||
| 1541 | Ga0207663_10517600 | |||
| 1542 | Ga0207660_10492199 | |||
| 1543 | Ga0207662_10039032 | |||
| 1544 | Ga0207657_10013739 | |||
| 1545 | Ga0207657_10028157 | |||
| 1546 | Ga0207657_10735171 | |||
| 1547 | Ga0207649_10066986 | |||
| 1548 | Ga0207649_10165670 | |||
| 1549 | Ga0207652_10008724 | |||
| 1550 | Ga0207652_10016769 | |||
| 1551 | Ga0207652_10147526 | |||
| 1552 | Ga0207652_10341302 | |||
| 1553 | Ga0207652_10351540 | |||
| 1554 | Ga0207652_10437911 | |||
| 1555 | Ga0207646_10001043 | |||
| 1556 | Ga0207646_10003277 | |||
| 1557 | Ga0207646_10006902 | |||
| 1558 | Ga0207646_10036661 | |||
| 1559 | Ga0207646_10066969 | |||
| 1560 | Ga0207646_10108168 | |||
| 1561 | Ga0207646_10112799 | |||
| 1562 | Ga0207646_10125319 | |||
| 1563 | Ga0207646_10175844 | |||
| 1564 | Ga0207646_10214371 | |||
| 1565 | Ga0207646_10378277 | |||
| 1566 | Ga0207694_10266117 | |||
| 1567 | Ga0207650_10781202 | |||
| 1568 | Ga0207659_10004462 | |||
| 1569 | Ga0207659_10301483 | |||
| 1570 | Ga0207687_10012294 | |||
| 1571 | Ga0207687_10044430 | |||
| 1572 | Ga0207687_10117011 | |||
| 1573 | Ga0207687_10242425 | |||
| 1574 | Ga0207700_10012464 | |||
| 1575 | Ga0207700_10017983 | |||
| 1576 | Ga0207700_10032895 | |||
| 1577 | Ga0207700_10034300 | |||
| 1578 | Ga0207700_10050547 | |||
| 1579 | Ga0207700_10085111 | |||
| 1580 | Ga0207700_10118893 | |||
| 1581 | Ga0207700_10223870 | |||
| 1582 | Ga0207700_10279193 | |||
| 1583 | Ga0207700_10319977 | |||
| 1584 | Ga0207700_10413001 | |||
| 1585 | Ga0207664_10001219 | |||
| 1586 | Ga0207664_10001859 | |||
| 1587 | Ga0207664_10002401 | |||
| 1588 | Ga0207664_10010461 | |||
| 1589 | Ga0207664_10017597 | |||
| 1590 | Ga0207664_10045207 | |||
| 1591 | Ga0207664_10050425 | |||
| 1592 | Ga0207664_10078311 | |||
| 1593 | Ga0207664_10130081 | |||
| 1594 | Ga0207664_10154753 | |||
| 1595 | Ga0207664_10199746 | |||
| 1596 | Ga0207644_10704144 | |||
| 1597 | Ga0207690_10262610 | |||
| 1598 | Ga0207706_10101311 | |||
| 1599 | Ga0207706_10188207 | |||
| 1600 | Ga0207686_10199327 | |||
| 1601 | Ga0207686_10233304 | |||
| 1602 | Ga0207709_10021557 | |||
| 1603 | Ga0207709_10040829 | |||
| 1604 | Ga0207709_10049174 | |||
| 1605 | Ga0207709_10056214 | |||
| 1606 | Ga0207670_10076188 | |||
| 1607 | Ga0207669_10050661 | |||
| 1608 | Ga0207669_10199851 | |||
| 1609 | Ga0207669_10354556 | |||
| 1610 | Ga0207704_10060273 | |||
| 1611 | Ga0207704_10676032 | |||
| 1612 | Ga0207665_10000937 | |||
| 1613 | Ga0207665_10025697 | |||
| 1614 | Ga0207665_10044338 | |||
| 1615 | Ga0207691_10002759 | |||
| 1616 | Ga0207691_10043103 | |||
| 1617 | Ga0207691_10648383 | |||
| 1618 | Ga0207711_10157543 | |||
| 1619 | Ga0207689_10028926 | |||
| 1620 | Ga0207689_10078275 | |||
| 1621 | Ga0207689_10284620 | |||
| 1622 | Ga0207689_10316061 | |||
| 1623 | Ga0207661_10020538 | |||
| 1624 | Ga0207661_10082632 | |||
| 1625 | Ga0207661_10246257 | |||
| 1626 | Ga0207661_10279300 | |||
| 1627 | Ga0207661_10298439 | |||
| 1628 | Ga0207679_10059848 | |||
| 1629 | Ga0207679_10083461 | |||
| 1630 | Ga0207679_10315845 | |||
| 1631 | Ga0207679_10412030 | |||
| 1632 | Ga0207667_10783030 | |||
| 1633 | Ga0207651_10447590 | |||
| 1634 | Ga0207712_10041209 | |||
| 1635 | Ga0207712_10455059 | |||
| 1636 | Ga0207668_10818972 | |||
| 1637 | Ga0207640_10034135 | |||
| 1638 | Ga0207640_10485021 | |||
| 1639 | Ga0207640_10592054 | |||
| 1640 | Ga0207677_10065603 | |||
| 1641 | Ga0207677_10153779 | |||
| 1642 | Ga0207677_10161080 | |||
| 1643 | Ga0207677_10258882 | |||
| 1644 | Ga0207677_10557749 | |||
| 1645 | Ga0207677_10645376 | |||
| 1646 | Ga0207703_10082642 | |||
| 1647 | Ga0207703_10182944 | |||
| 1648 | Ga0207703_10344111 | |||
| 1649 | Ga0207639_10294704 | |||
| 1650 | Ga0207678_10013263 | |||
| 1651 | Ga0207678_10112010 | |||
| 1652 | Ga0207678_10116286 | |||
| 1653 | Ga0207678_10361747 | |||
| 1654 | Ga0207678_10414828 | |||
| 1655 | Ga0207708_10000171 | |||
| 1656 | Ga0207708_10013641 | |||
| 1657 | Ga0207708_10047624 | |||
| 1658 | Ga0207708_10141025 | |||
| 1659 | Ga0207702_10098834 | |||
| 1660 | Ga0207702_10406511 | |||
| 1661 | Ga0207702_10534781 | |||
| 1662 | Ga0207641_10067667 | |||
| 1663 | Ga0207648_10000926 | |||
| 1664 | Ga0207648_10021225 | |||
| 1665 | Ga0207648_10273380 | |||
| 1666 | Ga0207676_10023529 | |||
| 1667 | Ga0207676_10060211 | |||
| 1668 | Ga0207676_10534115 | |||
| 1669 | Ga0207674_10002791 | |||
| 1670 | Ga0207674_10003072 | |||
| 1671 | Ga0207674_10021296 | |||
| 1672 | Ga0207674_10043441 | |||
| 1673 | Ga0207674_10050070 | |||
| 1674 | Ga0207674_10062060 | |||
| 1675 | Ga0207674_10330823 | |||
| 1676 | Ga0207675_100021690 | |||
| 1677 | Ga0207675_100045873 | |||
| 1678 | Ga0207683_10040527 | |||
| 1679 | Ga0207683_10044001 | |||
| 1680 | Ga0207683_10542743 | |||
| 1681 | Ga0207698_10013511 | |||
| 1682 | Ga0207698_10087552 | |||
| 1683 | Ga0207428_10018301 | |||
| 1684 | Ga0207428_10170260 | |||
| 1685 | Ga0207428_10312454 | |||
| 1686 | Ga0268266_10037281 | |||
| 1687 | Ga0268266_10148443 | |||
| 1688 | Ga0268265_10021593 | |||
| 1689 | Ga0268265_10158734 | |||
| 1690 | Ga0268265_10303887 | |||
| 1691 | Ga0268265_10764455 | |||
| 1692 | Ga0268265_10838033 | |||
| 1693 | Ga0268264_10015344 | |||
| 1694 | Ga0268264_10016885 | |||
| 1695 | Ga0268264_10102534 | |||
| 1696 | Ga0268264_10147125 | |||
| 1697 | Ga0268264_10223668 | |||
| 1698 | Ga0268264_10732260 | |||
| 1699 | Ga0265337_1007835 | |||
| 1700 | Ga0265326_10007791 | |||
| 1701 | Ga0265319_1000101 | |||
| 1702 | Ga0265319_1004032 | |||
| 1703 | Ga0265334_10003352 | |||
| 1704 | Ga0265318_10000112 | |||
| 1705 | Ga0265318_10001261 | |||
| 1706 | Ga0265318_10061405 | |||
| 1707 | Ga0265323_10009626 | |||
| 1708 | Ga0265322_10006720 | |||
| 1709 | Ga0265336_10001704 | |||
| 1710 | Ga0265336_10014619 | |||
| 1711 | Ga0307515_10000042 | |||
| 1712 | Ga0307515_10014744 | |||
| 1713 | Ga0307515_10030070 | |||
| 1714 | Ga0265338_10000743 | |||
| 1715 | Ga0265338_10001346 | |||
| 1716 | Ga0265338_10005011 | |||
| 1717 | Ga0265338_10006911 | |||
| 1718 | Ga0265338_10057494 | |||
| 1719 | Ga0265338_10066202 | |||
| 1720 | Ga0265324_10010807 | |||
| 1721 | Ga0307512_10007084 | |||
| 1722 | Ga0307512_10027813 | |||
| 1723 | Ga0265330_10000056 | |||
| 1724 | Ga0265332_10000050 | |||
| 1725 | Ga0265332_10002184 | |||
| 1726 | Ga0265328_10001238 | |||
| 1727 | Ga0265320_10000115 | |||
| 1728 | Ga0265320_10005115 | |||
| 1729 | Ga0265320_10109686 | |||
| 1730 | Ga0265325_10000326 | |||
| 1731 | Ga0265325_10001667 | |||
| 1732 | Ga0265325_10035966 | |||
| 1733 | Ga0265329_10000048 | |||
| 1734 | Ga0265340_10001141 | |||
| 1735 | Ga0265340_10001852 | |||
| 1736 | Ga0265339_10006545 | |||
| 1737 | Ga0265339_10007679 | |||
| 1738 | Ga0265339_10041381 | |||
| 1739 | Ga0265331_10000335 | |||
| 1740 | Ga0265316_10001199 | |||
| 1741 | Ga0265316_10008688 | |||
| 1742 | Ga0265316_10020583 | |||
| 1743 | Ga0307513_10024342 | |||
| 1744 | Ga0307513_10047902 | |||
| 1745 | Ga0307513_10080092 | |||
| 1746 | Ga0307513_10265934 | |||
| 1747 | Ga0307408_100181523 | |||
| 1748 | Ga0265313_10000009 | |||
| 1749 | Ga0265313_10000187 | |||
| 1750 | Ga0265313_10000383 | |||
| 1751 | Ga0265313_10033580 | |||
| 1752 | Ga0307508_10086037 | |||
| 1753 | Ga0307508_10149401 | |||
| 1754 | Ga0316579_10050303 | |||
| 1755 | Ga0265314_10000430 | |||
| 1756 | Ga0265314_10017800 | |||
| 1757 | Ga0265342_10000333 | |||
| 1758 | Ga0265342_10012657 | |||
| 1759 | Ga0307516_10003947 | |||
| 1760 | Ga0307516_10034399 | |||
| 1761 | Ga0307516_10153774 | |||
| 1762 | Ga0307405_10333712 | |||
| 1763 | Ga0316577_10042918 | |||
| 1764 | Ga0307413_10023726 | |||
| 1765 | Ga0307413_10312890 | |||
| 1766 | Ga0307410_10015091 | |||
| 1767 | Ga0307410_10032568 | |||
| 1768 | Ga0307406_10028625 | |||
| 1769 | Ga0307407_10044263 | |||
| 1770 | Ga0307407_10102867 | |||
| 1771 | Ga0307407_10140691 | |||
| 1772 | Ga0307412_10134797 | |||
| 1773 | Ga0307409_100090877 | |||
| 1774 | Ga0307409_100384215 | |||
| 1775 | Ga0307409_100984808 | |||
| 1776 | Ga0307416_100021692 | |||
| 1777 | Ga0307416_100492760 | |||
| 1778 | Ga0307414_10086307 | |||
| 1779 | Ga0307414_10271610 | |||
| 1780 | Ga0307414_10501103 | |||
| 1781 | Ga0307411_10642793 | |||
| 1782 | Ga0307415_100002584 | |||
| 1783 | Ga0307415_100035580 | |||
| 1784 | Ga0307415_100489620 | |||
| 1785 | Ga0307507_10147119 | |||
| 1786 | Ga0316214_1002630 | |||
| 1787 | Ga0373938_0044313 | |||
| 1788 | Ga0373926_0002315 | |||
| 1789 | Ga0373926_0006977 | |||
| 1790 | Ga0373934_0000101 | |||
| 1791 | Ga0373934_0012313 | |||
| 1792 | Ga0373934_0040878 | |||
| 1793 | Ga0373934_0042417 | |||
| 1794 | Ga0373949_0031357 | |||
| 1795 | Ga0373951_0000271 | |||
| 1796 | Ga0373923_0000967 | |||
| 1797 | Ga0373923_0010902 | |||
| 1798 | Ga0373923_0015587 | |||
| 1799 | Ga0373923_0039155 | |||
| 1800 | Ga0373923_0061499 | |||
| 1801 | Ga0373923_0075589 | |||
| 1802 | Ga0373936_0003980 | |||
| 1803 | Ga0373936_0308040 | |||
| 1804 | Ga0373945_0028991 | |||
| 1805 | Ga0373945_0034494 | |||
| 1806 | Ga0373953_0000521 | |||
| 1807 | Ga0373953_0009295 | |||
| 1808 | Ga0373953_0026137 | |||
| 1809 | Ga0373954_0008596 | |||
| 1810 | Ga0373954_0015680 | |||
| 1811 | Ga0373954_0027967 | |||
| 1812 | Ga0373956_0000095 | |||
| 1813 | Ga0373956_0018190 | |||
| 1814 | Ga0373956_0113215 | |||
| 1815 | Ga0373957_0000033 | |||
| 1816 | Ga0373943_0066062 | |||
| 1817 | Ga0373943_0085374 | |||
| 1818 | Ga0373946_0002118 | |||
| 1819 | Ga0373946_0010570 | |||
| 1820 | Ga0373946_0145535 | |||
| 1821 | Ga0373955_0000002 | |||
| 1822 | Ga0373955_0007055 | |||
| 1823 | Ga0373955_0012915 | |||
| 1824 | Ga0373924_0002327 | |||
| 1825 | Ga0373924_0009167 | |||
| 1826 | Ga0373931_0346063 | |||
| 1827 | Ga0373935_0000234 | |||
| 1828 | Ga0373935_0045225 | |||
| 1829 | Ga0373935_0192321 | |||
| 1830 | Ga0373935_0206279 | |||
| 1831 | Ga0373927_0254902 | |||
| 1832 | Ga0373933_0000029 | |||
| 1833 | Ga0373933_0012974 | |||
| 1834 | Ga0373933_0024647 | |||
| 1835 | Ga0373933_0033935 | |||
| 1836 | Ga0373933_0137993 | |||
| 1837 | Ga0373933_0198132 | |||
| 1838 | Ga0373947_0000005 | |||
| 1839 | Ga0373947_0134795 | |||
| 1840 | Ga0373937_0000362 | |||
| 1841 | Ga0373937_0004443 | |||
| 1842 | Ga0373937_0095938 | |||
| 1843 | Ga0373937_0243235 | |||
| 1844 | Ga0373937_0330572 | |||
| 1845 | Ga0373937_0448943 | |||
| 1846 | Ga0373937_0472913 | |||
| 1847 | Ga0316584_0019297 | |||
| 1848 | Ga0373925_0000021 | |||
| 1849 | Ga0373925_0199253 | |||
| 1850 | Ga0373925_0221133 | |||
| 1851 | Ga0373925_0475917 | |||
| 1852 | Ga0395900_0003692 | |||
| 1853 | Ga0395900_0407298 | |||
| 1854 | Ga0395898_0042087 | |||
| 1855 | Ga0395898_0150625 | |||
| 1856 | Ga0395898_0974500 | |||
| 1857 | Ga0316581_0039286 | |||
| 1858 | Ga0436364_0115602 | |||
| 1859 | Ga0436364_0361850 | |||
| 1860 | Ga0436364_1130152 | |||
| 1861 | Ga0436364_1225860 | |||
| 1862 | Ga0395901_0059328 | |||
| 1863 | Ga0436361_0546799 | |||
| 1864 | Ga0436363_0208428 | |||
| 1865 | Ga0451787_197248 | |||
| 1866 | Ga0451789_0052206 | |||
| 1867 | Ga0451791_1114879 | |||
| 1868 | Ga0451791_1689531 | |||
| 1869 | Ga0451793_0720655 | |||
| 1870 | Ga0451797_0100726 | |||
| 1871 | Ga0451800_0314848 | |||
| 1872 | Ga0451807_0584294 | |||
| 1873 | Ga0451839_0061394 | |||
| 1874 | Ga0451841_0287715 | |||
| 1875 | Ga0451843_0204342 | |||
| 1876 | Ga0466965_0355675 | |||
| 1877 | Ga0466966_0085720 | |||
| 1878 | Ga0466961_0105411 | |||
| 1879 | Ga0466963_0076384 | |||
| 1880 | Ga0466964_0222376 | |||
| 1881 | Ga0466957_0239841 | |||
| 1882 | Ga0466960_0012595 | |||
| 1883 | Ga0466960_0097893 | |||
| 1884 | Ga0466959_0003301 | |||
| 1885 | Ga0466959_0020862 | |||
| 1886 | Ga0466959_0133545 | |||
| 1887 | Ga0466959_0362030 | |||
| 1888 | Ga0466958_0090390 | |||
| 1889 | Ga0466958_0121743 | |||
| 1890 | Ga0466958_0259650 | |||
| 1891 | Ga0466958_0276648 | |||
| 1892 | Ga0466967_0000444 | |||
| 1893 | Ga0466967_0004649 | |||
| 1894 | Ga0466967_0015004 | |||
| 1895 | Ga0466967_0026433 | |||
| 1896 | Ga0466967_0044615 | |||
| 1897 | Ga0466967_0050982 | |||
| 1898 | Ga0466967_0076441 | |||
| 1899 | Ga0466967_0127873 | |||
| 1900 | Ga0466967_0154742 | |||
| 1901 | Ga0466967_0573243 | |||
| 1902 | Ga0466967_0943566 | |||
| 1903 | Ga0495592_0000043 | |||
| 1904 | Ga0495592_0008890 | |||
| 1905 | Ga0495592_0040782 | |||
| 1906 | Ga0495592_0100369 | |||
| 1907 | Ga0495592_0135693 | |||
| 1908 | Ga0495592_0232868 | |||
| 1909 | Ga0495603_0042928 | |||
| 1910 | Ga0495629_0005691 | |||
| 1911 | Ga0495629_0091124 | |||
| 1912 | Ga0495629_0217170 | |||
| 1913 | Ga0495641_0001864 | |||
| 1914 | Ga0495651_0000135 | |||
| 1915 | Ga0495651_0003167 | |||
| 1916 | Ga0495651_0006755 | |||
| 1917 | Ga0495651_0021269 | |||
| 1918 | Ga0495651_0028970 | |||
| 1919 | Ga0495651_0055294 | |||
| 1920 | Ga0495653_0000571 | |||
| 1921 | Ga0495653_0012759 | |||
| 1922 | Ga0495653_0063902 | |||
| 1923 | Ga0495653_0132596 | |||
| 1924 | Ga0495653_0179118 | |||
| 1925 | Ga0495653_0299490 | |||
| 1926 | Ga0495580_0015800 | |||
| 1927 | Ga0495582_0212637 | |||
| 1928 | Ga0495582_0296301 | |||
| 1929 | Ga0495639_0001668 | |||
| 1930 | Ga0495662_0009182 | |||
| 1931 | Ga0495662_0011201 | |||
| 1932 | Ga0495662_0036057 | |||
| 1933 | Ga0495662_0074460 | |||
| 1934 | Ga0495664_0014805 | |||
| 1935 | Ga0495664_0017439 | |||
| 1936 | Ga0495664_0125390 | |||
| 1937 | Ga0495664_0177147 | |||
| 1938 | Ga0495664_0275579 | |||
| 1939 | Ga0495594_0158565 | |||
| 1940 | Ga0495594_0226331 | |||
| 1941 | Ga0495608_0000016 | |||
| 1942 | Ga0495608_0007773 | |||
| 1943 | Ga0495608_0013563 | |||
| 1944 | Ga0495608_0050860 | |||
| 1945 | Ga0495608_0119179 | |||
| 1946 | Ga0495618_0022655 | |||
| 1947 | Ga0495618_0183018 | |||
| 1948 | Ga0495618_0199061 | |||
| 1949 | Ga0495618_0346335 | |||
| 1950 | Ga0495628_0000034 | |||
| 1951 | Ga0495628_0008967 | |||
| 1952 | Ga0495628_0013773 | |||
| 1953 | Ga0495628_0227919 | |||
| 1954 | Ga0495628_0388891 | |||
| 1955 | Ga0495630_0001481 | |||
| 1956 | Ga0495630_0009954 | |||
| 1957 | Ga0495630_0077567 | |||
| 1958 | Ga0495630_0283839 | |||
| 1959 | Ga0495663_0054344 | |||
| 1960 | Ga0495666_0005436 | |||
| 1961 | Ga0495666_0094215 | |||
| 1962 | Ga0495652_0000174 | |||
| 1963 | Ga0495652_0014268 | |||
| 1964 | Ga0495652_0018126 | |||
| 1965 | Ga0495652_0022357 | |||
| 1966 | Ga0495652_0054315 | |||
| 1967 | Ga0495652_0054402 | |||
| 1968 | Ga0495652_0066154 | |||
| 1969 | Ga0495652_0239700 | |||
| 1970 | Ga0495665_0017965 | |||
| 1971 | Ga0495640_0006733 | |||
| 1972 | Ga0495640_0011539 | |||
| 1973 | Ga0495640_0039902 | |||
| 1974 | Ga0495640_0254242 | |||
| 1975 | Ga0495587_0000044 | |||
| 1976 | Ga0495587_0002197 | |||
| 1977 | Ga0495587_0004185 | |||
| 1978 | Ga0495587_0007131 | |||
| 1979 | Ga0495587_0023581 | |||
| 1980 | Ga0495587_0123462 | |||
| 1981 | Ga0495645_0145071 | |||
| 1982 | Ga0495645_0168207 | |||
| 1983 | Ga0495645_0315594 | |||
| 1984 | Ga0495622_0140668 | |||
| 1985 | Ga0495667_0000052 | |||
| 1986 | Ga0495667_0058789 | |||
| 1987 | Ga0495667_0065610 | |||
| 1988 | Ga0495667_0083468 | |||
| 1989 | Ga0495667_0229903 | |||
| 1990 | Ga0495667_0270642 | |||
| 1991 | Ga0495656_0169464 | |||
| 1992 | Ga0495634_0005292 | |||
| 1993 | Ga0495634_0009343 | |||
| 1994 | Ga0495634_0057919 | |||
| 1995 | Ga0495634_0144929 | |||
| 1996 | Ga0495634_0245119 | |||
| 1997 | Ga0495635_0039234 | |||
| 1998 | Ga0495635_0065132 | |||
| 1999 | Ga0495635_0072653 | |||
| 2000 | Ga0495635_0148515 | |||
| 2001 | Ga0495635_0235376 | |||
| 2002 | Ga0495635_0336209 | |||
| 2003 | Ga0495588_0091891 | |||
| 2004 | Ga0495588_0195713 | |||
| 2005 | Ga0495657_0000015 | |||
| 2006 | Ga0495657_0009392 | |||
| 2007 | Ga0495657_0013373 | |||
| 2008 | Ga0495657_0024401 | |||
| 2009 | Ga0495657_0027681 | |||
| 2010 | Ga0495657_0082289 | |||
| 2011 | Ga0495657_0091969 | |||
| 2012 | Ga0495657_0233343 | |||
| 2013 | Ga0495599_0000035 | |||
| 2014 | Ga0495599_0003091 | |||
| 2015 | Ga0495599_0007370 | |||
| 2016 | Ga0495599_0051967 | |||
| 2017 | Ga0495599_0198281 | |||
| 2018 | Ga0495623_0000767 | |||
| 2019 | Ga0495623_0002607 | |||
| 2020 | Ga0495623_0037673 | |||
| 2021 | Ga0495623_0140134 | |||
| 2022 | Ga0495623_0222683 | |||
| 2023 | Ga0495623_0233732 | |||
| 2024 | Ga0495623_0306196 | |||
| 2025 | Ga0495646_0002176 | |||
| 2026 | Ga0495646_0014045 | |||
| 2027 | Ga0495646_0040257 | |||
| 2028 | Ga0495646_0382705 | |||
| 2029 | Ga0495658_0000676 | |||
| 2030 | Ga0495613_0078282 | |||
| 2031 | Ga0495624_0122064 | |||
| 2032 | Ga0495624_0126680 | |||
| 2033 | Ga0495600_0007475 | |||
| 2034 | Ga0495600_0025656 | |||
| 2035 | Ga0495600_0056237 | |||
| 2036 | Ga0495600_0088286 | |||
| 2037 | Ga0495600_0223031 | |||
| 2038 | Ga0495600_0270490 | |||
| 2039 | Ga0495581_0001515 | |||
| 2040 | Ga0495581_0017534 | |||
| 2041 | Ga0495581_0023897 | |||
| 2042 | Ga0495581_0091086 | |||
| 2043 | Ga0495604_0000048 | |||
| 2044 | Ga0495604_0009246 | |||
| 2045 | Ga0495604_0030548 | |||
| 2046 | Ga0495604_0041434 | |||
| 2047 | Ga0495604_0046676 | |||
| 2048 | Ga0495604_0131706 | |||
| 2049 | Ga0495604_0154282 | |||
| 2050 | Ga0495674_0027236 | |||
| 2051 | Ga0495674_0139615 | |||
| 2052 | Ga0495676_0004969 | |||
| 2053 | Ga0495676_0006692 | |||
| 2054 | Ga0495680_0000069 | |||
| 2055 | Ga0495680_0010239 | |||
| 2056 | Ga0495680_0012666 | |||
| 2057 | Ga0495680_0019087 | |||
| 2058 | Ga0495680_0020724 | |||
| 2059 | Ga0495680_0074021 | |||
| 2060 | Ga0495680_0187849 | |||
| 2061 | Ga0495675_0000685 | |||
| 2062 | Ga0495675_0040750 | |||
| 2063 | Ga0495675_0048135 | |||
| 2064 | Ga0495675_0067482 | |||
| 2065 | Ga0495684_0002558 | |||
| 2066 | Ga0495684_0009605 | |||
| 2067 | Ga0495684_0014538 | |||
| 2068 | Ga0495684_0067033 | |||
| 2069 | Ga0495684_0079004 | |||
| 2070 | Ga0495684_0125480 | |||
| 2071 | Ga0495684_0205211 | |||
| 2072 | Ga0495593_0045862 | |||
| 2073 | Ga0495593_0246927 | |||
| 2074 | Ga0495602_0000970 | |||
| 2075 | Ga0495602_0028336 | |||
| 2076 | Ga0495602_0036043 | |||
| 2077 | Ga0495602_0041593 | |||
| 2078 | Ga0495602_0091366 | |||
| 2079 | Ga0495602_0099272 | |||
| 2080 | Ga0495614_0140023 | |||
| 2081 | Ga0496100_0192306 | |||
| 2082 | Ga0496102_0074809 | |||
| 2083 | Ga0496102_0136609 | |||
| 2084 | Ga0496102_0334117 | |||
| 2085 | Ga0496102_0482142 | |||
| 2086 | Ga0496102_0662145 | |||
| 2087 | Ga0496103_0053830 | |||
| 2088 | Ga0496104_0000441 | |||
| 2089 | Ga0496104_0005513 | |||
| 2090 | Ga0496104_0007235 | |||
| 2091 | Ga0496104_0012681 | |||
| 2092 | Ga0496105_0031146 | |||
| 2093 | Ga0496105_0085888 | |||
| 2094 | Ga0496106_0334431 | |||
| 2095 | Ga0496106_0370120 | |||
| 2096 | Ga0496106_0666185 | |||
| 2097 | Ga0496108_0000748 | |||
| 2098 | Ga0496108_0018581 | |||
| 2099 | Ga0496108_0022231 | |||
| 2100 | Ga0496108_0022533 | |||
| 2101 | Ga0496108_0034966 | |||
| 2102 | Ga0496108_0148646 | |||
| 2103 | Ga0496108_0180850 | |||
| 2104 | Ga0496108_0213929 | |||
| 2105 | Ga0496108_0546456 | |||
| 2106 | Ga0496109_0001743 | |||
| 2107 | Ga0496109_0110366 | |||
| 2108 | Ga0496109_0152282 | |||
| 2109 | Ga0496109_0170111 | |||
| 2110 | Ga0496109_0207973 | |||
| 2111 | Ga0496109_0246635 | |||
| 2112 | Ga0496109_0248074 | |||
| 2113 | Ga0496109_0458350 | |||
| 2114 | Ga0496110_0003033 | |||
| 2115 | Ga0496110_0032286 | |||
| 2116 | Ga0496110_0059346 | |||
| 2117 | Ga0496110_0061091 | |||
| 2118 | Ga0496110_0063852 | |||
| 2119 | Ga0496110_0158974 | |||
| 2120 | Ga0496111_0001177 | |||
| 2121 | Ga0496111_0161411 | |||
| 2122 | Ga0496111_0368051 | |||
| 2123 | Ga0496112_0000159 | |||
| 2124 | Ga0496112_0337142 | |||
| 2125 | Ga0496112_0412413 | |||
| 2126 | Ga0496112_0443375 | |||
| 2127 | Ga0496112_0496972 | |||
| 2128 | Ga0496112_0751517 | |||
| 2129 | Ga0496113_0051315 | |||
| 2130 | Ga0496113_0054954 | |||
| 2131 | Ga0496113_0381641 | |||
| 2132 | Ga0496113_0710750 | |||
| 2133 | Ga0496114_0088480 | |||
| 2134 | Ga0496114_0242525 | |||
| 2135 | Ga0496114_0286236 | |||
| 2136 | Ga0496114_0681767 | |||
| 2137 | Ga0496115_0106658 | |||
| 2138 | Ga0496115_0136170 | |||
| 2139 | Ga0496115_0353438 | |||
| 2140 | Ga0496119_0083288 | |||
| 2141 | Ga0496126_0007772 | |||
| 2142 | Ga0496126_0337260 | |||
| 2143 | Ga0501031_0066544 | |||
| 2144 | Ga0501032_0142716 | |||
| 2145 | Ga0501033_0123128 | |||
| 2146 | Ga0501033_0299190 | |||
| 2147 | Ga0501036_0012617 | |||
| 2148 | Ga0501036_0031750 | |||
| 2149 | Ga0501036_0419841 | |||
| 2150 | Ga0501038_0055593 | |||
| 2151 | Ga0501039_0023712 | |||
| 2152 | Ga0501039_0183281 | |||
| 2153 | Ga0501039_0579009 | |||
| 2154 | Ga0501040_0005034 | |||
| 2155 | Ga0501042_0016519 | |||
| 2156 | Ga0501042_0053553 | |||
| 2157 | Ga0501043_0238103 | |||
| 2158 | Ga0501046_0064009 | |||
| 2159 | Ga0501047_0024344 | |||
| 2160 | Ga0501048_0006698 | |||
| 2161 | Ga0501067_0002370 | |||
| 2162 | Ga0501067_0217319 | |||
| 2163 | Ga0501068_0246065 | |||
| 2164 | Ga0501068_0396983 | |||
| 2165 | Ga0501070_0038435 | |||
| 2166 | Ga0501071_0004689 | |||
| 2167 | Ga0501072_0006738 | |||
| 2168 | Ga0501074_0141438 | |||
| 2169 | Ga0501076_0038370 | |||
| 2170 | Ga0501076_0221856 | |||
| 2171 | Ga0501077_0125451 | |||
| 2172 | Ga0501079_0024703 | |||
| 2173 | Ga0501079_0162120 | |||
| 2174 | Ga0501080_0028140 | |||
| 2175 | Ga0501080_0044011 | |||
| 2176 | Ga0501080_0268637 | |||
| 2177 | Ga0501081_0156214 | |||
| 2178 | Ga0501081_0443958 | |||
| 2179 | Ga0501035_0036768 | |||
| 2180 | Ga0501044_0034810 | |||
| 2181 | Ga0501045_0053012 | |||
| 2182 | nmdc:mga06r32_562659_c1 | |||
| 2183 | nmdc:mga06r32_99194_c1 | |||
| 2184 | nmdc:mga08y16_1241598_c1 | |||
| 2185 | nmdc:mga08y16_14122_c1 | |||
| 2186 | nmdc:mga08y16_24926_c1 | |||
| 2187 | nmdc:mga08y16_51474_c1 | |||
| 2188 | nmdc:mga0rr50_145490_c1 | |||
| 2189 | nmdc:mga0rr50_316648_c1 | |||
| 2190 | nmdc:mga0a205_30845_c1 | |||
| 2191 | Ga0495601_0085937 | |||
| 2192 | Ga0495601_0144616 | |||
| 2193 | Ga0495612_0014977 | |||
| 2194 | Ga0495612_0130935 | |||
| 2195 | Ga0495595_0000162 | |||
| 2196 | Ga0495595_0004135 | |||
| 2197 | Ga0495595_0019979 | |||
| 2198 | Ga0495595_0032891 | |||
| 2199 | Ga0495595_0154657 | |||
| 2200 | Ga0495619_0003428 | |||
| 2201 | Ga0495619_0256704 | |||
| 2202 | Ga0495619_0316284 | |||
| 2203 | Ga0495619_0338068 | |||
| 2204 | Ga0500651_0084308 | |||
| 2205 | Ga0500650_0115430 | |||
| 2206 | Ga0500569_024140 | |||
| 2207 | Ga0500594_0077090 | |||
| 2208 | Ga0500652_004451 | |||
| 2209 | Ga0500611_097349 | |||
| 2210 | Ga0501084_0052825 | |||
| 2211 | Ga0501082_0042883 | |||
| 2212 | Ga0501082_0448009 | |||
| 2213 | Ga0466962_0035909 | |||
| 2214 | Ga0530510_0018293 | |||
| 2215 | 2558910879 | |||
| 2216 | 2623499272 | |||
| 2217 | 2870784859 | |||
| 2218 | 2904482173 | |||
| 2219 | 2946005680 | |||
| 2220 | 8054476347 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9689 | 5 | 120 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9687 | 5 | 120 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9667 | 5 | 120 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9619 | 4 | 121 |
| 2zwm-assembly1.cif.gz_B | crystal structure of yycf receiver domain from bacillus subtilis | 0.9613 | 4 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9964 | 5 | 82 | 3.40.50.2300 |
| af_P21866_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9898 | 4 | 82 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9777 | 4 | 82 | 3.40.50.2300 |
| af_P9WGM1_5_87_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9765 | 1 | 82 | 3.40.50.2300 |
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9716 | 5 | 82 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X9Q292-F1-model_v4 | DNA-binding response regulator | 0.9805 | 128 | 228 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7C1YRM9-F1-model_v4 | Winged helix family transcriptional regulator | 0.967 | 144 | 228 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A0B0H5R4-F1-model_v4 | Response regulator | 0.9663 | 3 | 116 |
GO:0000160
|
| AF-A0A7V2QLS0-F1-model_v4 | Response regulator | 0.9649 | 2 | 119 |
GO:0000160
|
| AF-A0A496VL76-F1-model_v4 | Response regulatory domain-containing protein | 0.9635 | 3 | 119 |
GO:0000160
GO:0016772 |