F490210

General Info

Members Datasets Scaffolds Average Seq Length
1110 389 2220 229

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100256254|Ga0070714_1002562541
Length 276
Sequence MSTPPGKLHDHGKFSALGRVSGLAGPGPGPRFGTAVMTRVLVIDDEEPILRALRINLAAHKYEVSTAVDGASGLAAIARDRPDVVILDLGLPDMDGTEVISGVRGWTSMPIIVLSAWGQESQKVAALDAGADDYVTKPFGMGELLARLRVAVRRASPAPDEPVVVSGDFTVDLAAKRVHRQRDGADVRLTPTEWQLLEVLVRHREKLVTQRQLLAEVWGPEYQTEGNYLRVYMAHLRRKLEPDPSRPRYLVTEPGIGYRFTATGSGDASPPEGRSS

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
183 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
188 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
189 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
193 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
197 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
198 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
201 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
202 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
203 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
211 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
212 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
213 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
214 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
215 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
216 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
217 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
218 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
219 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
222 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
223 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
224 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
225 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
230 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
234 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
235 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
236 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
237 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
238 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
239 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
240 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
241 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
249 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
253 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
257 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
258 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
259 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
260 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
261 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
262 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
263 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
264 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
265 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
266 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
267 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
268 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
269 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
270 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
271 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
272 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
273 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
274 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
275 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
294 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
295 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
301 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
302 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
303 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
304 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
305 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
306 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
307 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
308 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
309 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
314 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
315 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
316 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
317 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
318 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
319 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
320 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
321 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
322 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
323 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
324 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
331 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
332 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
333 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
334 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
335 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
336 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
339 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
355 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
356 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
359 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
360 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
361 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
362 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
366 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
367 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
368 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
369 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
370 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
371 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
372 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
375 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
376 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
377 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
378 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
379 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
380 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
381 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
382 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
383 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
384 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
385 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
386 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
387 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
388 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
389 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 1.44
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.54
Nodule 0
Rhizoplane 6.04
Rhizosphere 90.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100256254 3300005435 Bacteria 1619
2 JGI24735J21928_10093592 3300002067 Bacteria 862
3 JGI24744J21845_10005151 3300002077 Bacteria 2705
4 JGI25406J46586_10006130 3300003203 Bacteria 5552
5 Ga0070658_10006845 3300005327 Bacteria 9215
6 Ga0070658_10023598 3300005327 Bacteria 4935
7 Ga0070658_10064156 3300005327 Bacteria 2996
8 Ga0070658_10257089 3300005327 Bacteria 1482
9 Ga0070658_10283857 3300005327 Bacteria 1409
10 Ga0070676_10104111 3300005328 Bacteria 1758
11 Ga0070676_10452015 3300005328 Bacteria 903
12 Ga0070683_100004571 3300005329 Bacteria 11420
13 Ga0070683_100059709 3300005329 Bacteria 3543
14 Ga0070683_100064566 3300005329 Bacteria 3408
15 Ga0070683_100101131 3300005329 Bacteria 2714
16 Ga0070683_100113133 3300005329 Bacteria 2561
17 Ga0070683_100127961 3300005329 Bacteria 2402
18 Ga0070683_100144915 3300005329 Bacteria 2250
19 Ga0070683_100153307 3300005329 Bacteria 2185
20 Ga0070683_100167567 3300005329 Bacteria 2085
21 Ga0070683_100232294 3300005329 Bacteria 1753
22 Ga0070683_100321577 3300005329 Bacteria 1472
23 Ga0070670_100081101 3300005331 Bacteria 2788
24 Ga0070670_100628995 3300005331 Bacteria 962
25 Ga0068869_100018522 3300005334 Bacteria 4742
26 Ga0068869_100030074 3300005334 Bacteria 3809
27 Ga0070680_100290980 3300005336 Bacteria 1384
28 Ga0070682_100008855 3300005337 Bacteria 5683
29 Ga0070682_100151536 3300005337 Bacteria 1591
30 Ga0070682_100576076 3300005337 Bacteria 885
31 Ga0068868_100004265 3300005338 Bacteria 10005
32 Ga0068868_100024352 3300005338 Bacteria 4593
33 Ga0070660_100019041 3300005339 Bacteria 5025
34 Ga0070660_100027145 3300005339 Bacteria 4271
35 Ga0070660_100129995 3300005339 Bacteria 2014
36 Ga0070660_100397204 3300005339 Bacteria 1140
37 Ga0070689_100408094 3300005340 Bacteria 1149
38 Ga0070689_100564929 3300005340 Bacteria 982
39 Ga0070691_10024889 3300005341 Bacteria 2785
40 Ga0070691_10101628 3300005341 Bacteria 1428
41 Ga0070661_100030787 3300005344 Bacteria 3878
42 Ga0070661_100085981 3300005344 Bacteria 2324
43 Ga0070661_100457680 3300005344 Bacteria 1016
44 Ga0070661_100499430 3300005344 Bacteria 974
45 Ga0070692_10146692 3300005345 Bacteria 1340
46 Ga0070692_10195973 3300005345 Bacteria 1180
47 Ga0070668_100017010 3300005347 Bacteria 5440
48 Ga0070668_100225900 3300005347 Bacteria 1546
49 Ga0070669_100350604 3300005353 Bacteria 1198
50 Ga0070669_100436787 3300005353 Bacteria 1077
51 Ga0070675_100002740 3300005354 Bacteria 13250
52 Ga0070675_100080840 3300005354 Bacteria 2709
53 Ga0070675_100085263 3300005354 Bacteria 2639
54 Ga0070675_100167581 3300005354 Bacteria 1893
55 Ga0070675_100450683 3300005354 Bacteria 1154
56 Ga0070674_100068747 3300005356 Bacteria 2497
57 Ga0070674_100260495 3300005356 Bacteria 1366
58 Ga0070674_100922664 3300005356 Bacteria 762
59 Ga0070673_100117165 3300005364 Bacteria 2216
60 Ga0070688_100287082 3300005365 Bacteria 1184
61 Ga0070659_100037838 3300005366 Bacteria 3762
62 Ga0070659_100112961 3300005366 Bacteria 2194
63 Ga0070659_100155108 3300005366 Bacteria 1869
64 Ga0070709_10003021 3300005434 Bacteria 9039
65 Ga0070709_10028678 3300005434 Bacteria 3322
66 Ga0070709_10039282 3300005434 Bacteria 2903
67 Ga0070709_10040725 3300005434 Bacteria 2858
68 Ga0070709_10067334 3300005434 Bacteria 2299
69 Ga0070709_10112358 3300005434 Bacteria 1833
70 Ga0070714_100000452 3300005435 Bacteria 29888
71 Ga0070714_100001028 3300005435 Bacteria 19875
72 Ga0070714_100005940 3300005435 Bacteria 9370
73 Ga0070714_100005955 3300005435 Bacteria 9363
74 Ga0070714_100082551 3300005435 Bacteria 2800
75 Ga0070714_100083836 3300005435 Bacteria 2780
76 Ga0070714_100276806 3300005435 Bacteria 1558
77 Ga0070713_100007261 3300005436 Bacteria 7760
78 Ga0070713_100010227 3300005436 Bacteria 6771
79 Ga0070713_100024420 3300005436 Bacteria 4707
80 Ga0070713_100037406 3300005436 Bacteria 3924
81 Ga0070713_100065592 3300005436 Bacteria 3051
82 Ga0070713_100147037 3300005436 Bacteria 2093
83 Ga0070713_100280114 3300005436 Bacteria 1529
84 Ga0070713_100292505 3300005436 Bacteria 1497
85 Ga0070713_100330256 3300005436 Bacteria 1410
86 Ga0070710_10008259 3300005437 Bacteria 5067
87 Ga0070710_10018475 3300005437 Bacteria 3587
88 Ga0070710_10082483 3300005437 Bacteria 1880
89 Ga0070710_10088860 3300005437 Bacteria 1819
90 Ga0070710_10184202 3300005437 Bacteria 1309
91 Ga0070701_10006868 3300005438 Bacteria 4816
92 Ga0070701_10025713 3300005438 Bacteria 2862
93 Ga0070711_100021021 3300005439 Bacteria 4215
94 Ga0070711_100032826 3300005439 Bacteria 3454
95 Ga0070711_100043948 3300005439 Bacteria 3029
96 Ga0070705_100076262 3300005440 Bacteria 2044
97 Ga0070705_100123531 3300005440 Bacteria 1675
98 Ga0070700_100009488 3300005441 Bacteria 5345
99 Ga0070700_100033665 3300005441 Bacteria 3088
100 Ga0070700_100278561 3300005441 Bacteria 1212
101 Ga0070708_100534018 3300005445 Bacteria 1106
102 Ga0070663_100026326 3300005455 Bacteria 3939
103 Ga0070663_100055561 3300005455 Bacteria 2834
104 Ga0070663_100085492 3300005455 Bacteria 2328
105 Ga0070663_100233430 3300005455 Bacteria 1449
106 Ga0070663_100331677 3300005455 Bacteria 1226
107 Ga0070678_100015224 3300005456 Bacteria 4882
108 Ga0070678_100096045 3300005456 Bacteria 2285
109 Ga0070678_100224580 3300005456 Bacteria 1562
110 Ga0070662_100063633 3300005457 Bacteria 2699
111 Ga0070681_10009600 3300005458 Bacteria 9514
112 Ga0070681_10313312 3300005458 Bacteria 1479
113 Ga0070681_10419697 3300005458 Bacteria 1250
114 Ga0068867_100007002 3300005459 Bacteria 7968
115 Ga0070685_10043361 3300005466 Bacteria 2571
116 Ga0070685_10060364 3300005466 Bacteria 2217
117 Ga0070685_10064127 3300005466 Bacteria 2160
118 Ga0070685_10391648 3300005466 Bacteria 960
119 Ga0070706_100001048 3300005467 Bacteria 30008
120 Ga0070706_100003836 3300005467 Bacteria 14695
121 Ga0070706_100005036 3300005467 Bacteria 12629
122 Ga0070706_100006933 3300005467 Bacteria 10691
123 Ga0070706_100007675 3300005467 Bacteria 10090
124 Ga0070706_100079469 3300005467 Bacteria 3035
125 Ga0070706_100088284 3300005467 Bacteria 2875
126 Ga0070706_100208006 3300005467 Bacteria 1827
127 Ga0070706_100631577 3300005467 Bacteria 994
128 Ga0070706_100906047 3300005467 Bacteria 815
129 Ga0070707_100000792 3300005468 Bacteria 31220
130 Ga0070707_100023200 3300005468 Bacteria 5869
131 Ga0070707_100029054 3300005468 Bacteria 5262
132 Ga0070707_100035864 3300005468 Bacteria 4732
133 Ga0070707_100045292 3300005468 Bacteria 4211
134 Ga0070707_100120283 3300005468 Bacteria 2549
135 Ga0070707_100121840 3300005468 Bacteria 2532
136 Ga0070707_100233253 3300005468 Bacteria 1791
137 Ga0070707_100372866 3300005468 Bacteria 1387
138 Ga0070698_100006771 3300005471 Bacteria 12423
139 Ga0070698_100008876 3300005471 Bacteria 10807
140 Ga0070698_100011521 3300005471 Bacteria 9383
141 Ga0070698_100037550 3300005471 Bacteria 4994
142 Ga0070698_100038643 3300005471 Bacteria 4917
143 Ga0070698_100076311 3300005471 Bacteria 3354
144 Ga0070698_100077164 3300005471 Bacteria 3332
145 Ga0070698_100118694 3300005471 Bacteria 2606
146 Ga0070698_100222699 3300005471 Bacteria 1820
147 Ga0070698_100322806 3300005471 Bacteria 1475
148 Ga0070699_100001575 3300005518 Bacteria 20852
149 Ga0070699_100002101 3300005518 Bacteria 18041
150 Ga0070699_100068500 3300005518 Bacteria 3082
151 Ga0070699_100321845 3300005518 Bacteria 1390
152 Ga0070699_100529912 3300005518 Bacteria 1071
153 Ga0070699_100703631 3300005518 Bacteria 923
154 Ga0070679_100003755 3300005530 Bacteria 13929
155 Ga0070679_100008909 3300005530 Bacteria 9470
156 Ga0070679_100031308 3300005530 Bacteria 5254
157 Ga0070679_100111734 3300005530 Bacteria 2719
158 Ga0070679_100745761 3300005530 Bacteria 922
159 Ga0070679_100873675 3300005530 Bacteria 842
160 Ga0070684_100019147 3300005535 Bacteria 5660
161 Ga0070684_100019292 3300005535 Bacteria 5638
162 Ga0070684_100158834 3300005535 Bacteria 2050
163 Ga0070684_100200043 3300005535 Bacteria 1819
164 Ga0070684_100230379 3300005535 Bacteria 1691
165 Ga0070684_100743007 3300005535 Bacteria 916
166 Ga0070684_100880707 3300005535 Bacteria 838
167 Ga0070697_100010976 3300005536 Bacteria 7077
168 Ga0070697_100061101 3300005536 Bacteria 3073
169 Ga0068853_100163892 3300005539 Bacteria 2007
170 Ga0068853_100257281 3300005539 Bacteria 1604
171 Ga0070672_100001312 3300005543 Bacteria 15342
172 Ga0070686_100020181 3300005544 Bacteria 3941
173 Ga0070686_100112921 3300005544 Bacteria 1854
174 Ga0070686_100154360 3300005544 Bacteria 1611
175 Ga0070695_100099157 3300005545 Bacteria 1959
176 Ga0070696_100103024 3300005546 Bacteria 2047
177 Ga0070693_100050430 3300005547 Bacteria 2379
178 Ga0070693_100060807 3300005547 Bacteria 2194
179 Ga0070693_100152791 3300005547 Bacteria 1464
180 Ga0070693_100223269 3300005547 Bacteria 1235
181 Ga0070665_100054642 3300005548 Bacteria 4005
182 Ga0070665_100589065 3300005548 Bacteria 1125
183 Ga0068855_100058270 3300005563 Bacteria 4524
184 Ga0068855_100097460 3300005563 Bacteria 3387
185 Ga0070664_100009193 3300005564 Bacteria 8023
186 Ga0070664_100299231 3300005564 Bacteria 1454
187 Ga0070664_100355724 3300005564 Bacteria 1333
188 Ga0070664_100460177 3300005564 Bacteria 1169
189 Ga0070664_100548494 3300005564 Bacteria 1069
190 Ga0068857_100004338 3300005577 Bacteria 11970
191 Ga0068857_100045347 3300005577 Bacteria 3900
192 Ga0068857_100073149 3300005577 Bacteria 3053
193 Ga0068857_100400311 3300005577 Bacteria 1277
194 Ga0068857_100497630 3300005577 Bacteria 1144
195 Ga0068854_100011357 3300005578 Bacteria 5794
196 Ga0068854_100013890 3300005578 Bacteria 5296
197 Ga0068854_100028924 3300005578 Bacteria 3833
198 Ga0068856_100108541 3300005614 Bacteria 2772
199 Ga0068856_100530346 3300005614 Bacteria 1198
200 Ga0070702_100007486 3300005615 Bacteria 5232
201 Ga0070702_100017373 3300005615 Bacteria 3710
202 Ga0070702_100025155 3300005615 Bacteria 3186
203 Ga0070702_100237246 3300005615 Bacteria 1229
204 Ga0070702_100379323 3300005615 Bacteria 1005
205 Ga0068852_100192661 3300005616 Bacteria 1924
206 Ga0068859_100041006 3300005617 Bacteria 4650
207 Ga0068864_100012042 3300005618 Bacteria 7143
208 Ga0068864_100068223 3300005618 Bacteria 3089
209 Ga0068864_100244236 3300005618 Bacteria 1664
210 Ga0068864_100403177 3300005618 Bacteria 1300
211 Ga0068864_100645846 3300005618 Bacteria 1030
212 Ga0068864_101067031 3300005618 Bacteria 803
213 Ga0068866_10071920 3300005718 Bacteria 1831
214 Ga0068866_10092394 3300005718 Bacteria 1651
215 Ga0068861_100014698 3300005719 Bacteria 5497
216 Ga0068861_100069261 3300005719 Bacteria 2729
217 Ga0068851_10114771 3300005834 Bacteria 1442
218 Ga0068870_10007764 3300005840 Bacteria 4797
219 Ga0068870_10068076 3300005840 Bacteria 1933
220 Ga0068863_100092777 3300005841 Bacteria 2865
221 Ga0068863_100853033 3300005841 Bacteria 910
222 Ga0068858_100070389 3300005842 Bacteria 3243
223 Ga0068858_100224105 3300005842 Bacteria 1781
224 Ga0068858_100573081 3300005842 Bacteria 1094
225 Ga0068860_100021498 3300005843 Bacteria 6247
226 Ga0068860_100115439 3300005843 Bacteria 2568
227 Ga0068860_100152796 3300005843 Bacteria 2223
228 Ga0068860_100231940 3300005843 Bacteria 1794
229 Ga0068860_100269611 3300005843 Bacteria 1661
230 Ga0068860_100740566 3300005843 Bacteria 994
231 Ga0068862_100014232 3300005844 Bacteria 6597
232 Ga0068862_100227134 3300005844 Bacteria 1692
233 Ga0068862_100252439 3300005844 Bacteria 1608
234 Ga0081540_1000345 3300005983 Bacteria 46912
235 Ga0081540_1001308 3300005983 Bacteria 21736
236 Ga0081540_1006178 3300005983 Bacteria 8781
237 Ga0081539_10003383 3300005985 Bacteria 19743
238 Ga0081539_10005543 3300005985 Bacteria 12795
239 Ga0081539_10010664 3300005985 Bacteria 7415
240 Ga0081539_10027029 3300005985 Bacteria 3643
241 Ga0081539_10027830 3300005985 Bacteria 3571
242 Ga0081539_10176204 3300005985 Bacteria 1007
243 Ga0070717_10007804 3300006028 Bacteria 7962
244 Ga0070717_10018129 3300006028 Bacteria 5492
245 Ga0070717_10046161 3300006028 Bacteria 3563
246 Ga0070717_10052576 3300006028 Bacteria 3356
247 Ga0070717_10058504 3300006028 Bacteria 3188
248 Ga0070717_10119623 3300006028 Bacteria 2255
249 Ga0070717_10175368 3300006028 Bacteria 1866
250 Ga0070717_10368294 3300006028 Bacteria 1287
251 Ga0070717_10514079 3300006028 Bacteria 1083
252 Ga0070717_10624459 3300006028 Bacteria 978
253 Ga0070715_10001476 3300006163 Bacteria 6841
254 Ga0070715_10050842 3300006163 Bacteria 1781
255 Ga0070715_10179863 3300006163 Bacteria 1060
256 Ga0070716_100001463 3300006173 Bacteria 10525
257 Ga0070716_100019289 3300006173 Bacteria 3562
258 Ga0070716_100076159 3300006173 Bacteria 1987
259 Ga0070712_100071500 3300006175 Bacteria 2482
260 Ga0070712_100260485 3300006175 Bacteria 1389
261 Ga0070712_100266517 3300006175 Bacteria 1374
262 Ga0097621_100215728 3300006237 Bacteria 1670
263 Ga0097621_100311445 3300006237 Bacteria 1393
264 Ga0097621_100627844 3300006237 Bacteria 984
265 Ga0075428_100553200 3300006844 Bacteria 1230
266 Ga0075428_100717706 3300006844 Bacteria 1065
267 Ga0075431_100073239 3300006847 Bacteria 3534
268 Ga0075431_100075900 3300006847 Bacteria 3468
269 Ga0075431_100106830 3300006847 Bacteria 2888
270 Ga0075434_100389538 3300006871 Bacteria 1414
271 Ga0068865_100011812 3300006881 Bacteria 5476
272 Ga0068865_100096507 3300006881 Bacteria 2156
273 Ga0068865_100374407 3300006881 Bacteria 1160
274 Ga0075436_100004827 3300006914 Bacteria 9266
275 Ga0075436_100020931 3300006914 Bacteria 4486
276 Ga0097620_100041008 3300006931 Bacteria 4650
277 Ga0105240_10273382 3300009093 Bacteria 1944
278 Ga0105240_10350751 3300009093 Bacteria 1674
279 Ga0105240_10609138 3300009093 Bacteria 1201
280 Ga0111539_10001402 3300009094 Bacteria 32087
281 Ga0111539_10024563 3300009094 Bacteria 7392
282 Ga0111539_10865089 3300009094 Bacteria 1052
283 Ga0105245_10017866 3300009098 Bacteria 6193
284 Ga0105245_10028596 3300009098 Bacteria 4919
285 Ga0105245_10101497 3300009098 Bacteria 2663
286 Ga0105245_10163393 3300009098 Bacteria 2114
287 Ga0105245_10500369 3300009098 Bacteria 1231
288 Ga0105247_10540866 3300009101 Bacteria 855
289 Ga0114129_10024315 3300009147 Bacteria 8583
290 Ga0114129_10216522 3300009147 Bacteria 2586
291 Ga0114129_10333104 3300009147 Bacteria 2015
292 Ga0105243_10002861 3300009148 Bacteria 14307
293 Ga0105243_10150131 3300009148 Bacteria 1998
294 Ga0105243_10275198 3300009148 Bacteria 1514
295 Ga0105243_10277580 3300009148 Bacteria 1508
296 Ga0105243_10316852 3300009148 Bacteria 1420
297 Ga0105243_10341615 3300009148 Bacteria 1371
298 Ga0105243_10362608 3300009148 Bacteria 1334
299 Ga0105241_10103218 3300009174 Bacteria 2270
300 Ga0105242_10010464 3300009176 Bacteria 7119
301 Ga0105242_10073410 3300009176 Bacteria 2844
302 Ga0105242_10208554 3300009176 Bacteria 1740
303 Ga0105242_11072563 3300009176 Bacteria 818
304 Ga0105248_10109534 3300009177 Bacteria 3114
305 Ga0105248_10604018 3300009177 Bacteria 1238
306 Ga0105238_10049831 3300009551 Bacteria 4216
307 Ga0105238_10119356 3300009551 Bacteria 2617
308 Ga0105238_10159425 3300009551 Bacteria 2231
309 Ga0105238_10229245 3300009551 Bacteria 1834
310 Ga0105238_10291352 3300009551 Bacteria 1614
311 Ga0105249_10016248 3300009553 Bacteria 6601
312 Ga0105249_10130704 3300009553 Bacteria 2397
313 Ga0105249_10169960 3300009553 Bacteria 2113
314 Ga0105249_10697895 3300009553 Bacteria 1075
315 Ga0105239_10109864 3300010375 Bacteria 3056
316 Ga0105239_10130301 3300010375 Bacteria 2797
317 Ga0105239_10201441 3300010375 Bacteria 2230
318 Ga0105239_10238761 3300010375 Bacteria 2040
319 Ga0105246_10032876 3300011119 Bacteria 3443
320 Ga0105246_10093187 3300011119 Bacteria 2175
321 Ga0105246_10095239 3300011119 Bacteria 2155
322 Ga0105246_10919680 3300011119 Bacteria 786
323 Ga0157342_1008389 3300012507 Bacteria 1022
324 Ga0157371_10431412 3300013102 Bacteria 967
325 Ga0157370_10170964 3300013104 Bacteria 2020
326 Ga0157370_10304658 3300013104 Bacteria 1470
327 Ga0157369_10006230 3300013105 Bacteria 13844
328 Ga0157369_10009643 3300013105 Bacteria 11042
329 Ga0157369_10043686 3300013105 Bacteria 4884
330 Ga0157369_10223548 3300013105 Bacteria 1970
331 Ga0157374_10223871 3300013296 Bacteria 1847
332 Ga0157374_10649385 3300013296 Bacteria 1067
333 Ga0157378_10176077 3300013297 Bacteria 2009
334 Ga0157378_10498396 3300013297 Bacteria 1216
335 Ga0163162_10033664 3300013306 Bacteria 5093
336 Ga0163162_10236810 3300013306 Bacteria 1956
337 Ga0163162_10833720 3300013306 Bacteria 1038
338 Ga0157372_10070802 3300013307 Bacteria 3925
339 Ga0157372_10090164 3300013307 Bacteria 3484
340 Ga0157372_10634069 3300013307 Bacteria 1245
341 Ga0157372_10750118 3300013307 Bacteria 1135
342 Ga0157372_10770623 3300013307 Bacteria 1118
343 Ga0157375_10077212 3300013308 Bacteria 3359
344 Ga0157375_10144159 3300013308 Bacteria 2511
345 Ga0157375_10218869 3300013308 Bacteria 2062
346 Ga0163163_10003412 3300014325 Bacteria 13498
347 Ga0163163_10101314 3300014325 Bacteria 2902
348 Ga0163163_10124358 3300014325 Bacteria 2616
349 Ga0163163_10327439 3300014325 Bacteria 1586
350 Ga0163163_10357935 3300014325 Bacteria 1516
351 Ga0157380_10014664 3300014326 Bacteria 5739
352 Ga0157380_10482740 3300014326 Bacteria 1199
353 Ga0157380_10532211 3300014326 Bacteria 1149
354 Ga0157380_10720355 3300014326 Bacteria 1005
355 Ga0157377_10001840 3300014745 Bacteria 9255
356 Ga0157377_10070554 3300014745 Bacteria 2018
357 Ga0157379_10005808 3300014968 Bacteria 10614
358 Ga0157379_10187756 3300014968 Bacteria 1868
359 Ga0157379_10279803 3300014968 Bacteria 1518
360 Ga0157379_10941423 3300014968 Bacteria 821
361 Ga0157376_10025898 3300014969 Bacteria 4626
362 Ga0157376_10116353 3300014969 Bacteria 2362
363 Ga0157376_10154488 3300014969 Bacteria 2073
364 Ga0163161_10052133 3300017792 Bacteria 2965
365 Ga0197907_11154562 3300020069 Bacteria 798
366 Ga0206356_10064106 3300020070 Bacteria 1258
367 Ga0206356_10374739 3300020070 Bacteria 1315
368 Ga0206351_10623328 3300020077 Bacteria 1113
369 Ga0206350_10545162 3300020080 Bacteria 1169
370 Ga0206350_11332998 3300020080 Bacteria 2318
371 Ga0206353_10430810 3300020082 Bacteria 2728
372 Ga0206353_10680297 3300020082 Bacteria 2431
373 Ga0206353_10837455 3300020082 Bacteria 4788
374 Ga0206353_11138628 3300020082 Bacteria 1790
375 Ga0213875_10045485 3300021388 Bacteria 2060
376 Ga0213875_10053546 3300021388 Bacteria 1890
377 Ga0224712_10003657 3300022467 Bacteria 4032
378 Ga0224712_10009872 3300022467 Bacteria 2896
379 Ga0224712_10012296 3300022467 Bacteria 2687
380 Ga0224712_10022462 3300022467 Bacteria 2175
381 Ga0224712_10172980 3300022467 Bacteria 969
382 Ga0224712_10210403 3300022467 Bacteria 887
383 Ga0207697_10076100 3300025315 Bacteria 1410
384 Ga0207656_10105874 3300025321 Bacteria 1294
385 Ga0207692_10001219 3300025898 Bacteria 9545
386 Ga0207692_10048644 3300025898 Bacteria 2136
387 Ga0207692_10231762 3300025898 Bacteria 1099
388 Ga0207692_10379978 3300025898 Bacteria 877
389 Ga0207642_10046425 3300025899 Bacteria 1935
390 Ga0207688_10003336 3300025901 Bacteria 8774
391 Ga0207688_10011417 3300025901 Bacteria 4836
392 Ga0207688_10121591 3300025901 Bacteria 1524
393 Ga0207688_10128231 3300025901 Bacteria 1485
394 Ga0207647_10045140 3300025904 Bacteria 2750
395 Ga0207647_10053383 3300025904 Bacteria 2491
396 Ga0207647_10210887 3300025904 Bacteria 1122
397 Ga0207685_10017954 3300025905 Bacteria 2300
398 Ga0207685_10056915 3300025905 Bacteria 1532
399 Ga0207699_10010674 3300025906 Bacteria 4619
400 Ga0207699_10018548 3300025906 Bacteria 3689
401 Ga0207699_10069684 3300025906 Bacteria 2145
402 Ga0207699_10084580 3300025906 Bacteria 1976
403 Ga0207699_10094201 3300025906 Bacteria 1886
404 Ga0207699_10300896 3300025906 Bacteria 1120
405 Ga0207645_10031739 3300025907 Bacteria 3397
406 Ga0207645_10094505 3300025907 Bacteria 1924
407 Ga0207643_10014808 3300025908 Bacteria 4241
408 Ga0207643_10023975 3300025908 Bacteria 3367
409 Ga0207705_10014311 3300025909 Bacteria 5709
410 Ga0207705_10020113 3300025909 Bacteria 4775
411 Ga0207705_10262640 3300025909 Bacteria 1318
412 Ga0207684_10002703 3300025910 Bacteria 17712
413 Ga0207684_10004377 3300025910 Bacteria 13330
414 Ga0207684_10011882 3300025910 Bacteria 7590
415 Ga0207684_10020585 3300025910 Bacteria 5637
416 Ga0207684_10027199 3300025910 Bacteria 4876
417 Ga0207684_10098696 3300025910 Bacteria 2494
418 Ga0207684_10103864 3300025910 Bacteria 2430
419 Ga0207684_10164710 3300025910 Bacteria 1910
420 Ga0207684_10224693 3300025910 Bacteria 1620
421 Ga0207684_10281699 3300025910 Bacteria 1433
422 Ga0207654_10051541 3300025911 Bacteria 2369
423 Ga0207707_10001352 3300025912 Bacteria 22855
424 Ga0207707_10303303 3300025912 Bacteria 1381
425 Ga0207693_10011242 3300025915 Bacteria 7246
426 Ga0207693_10055473 3300025915 Bacteria 3109
427 Ga0207693_10122229 3300025915 Bacteria 2045
428 Ga0207693_10177362 3300025915 Bacteria 1677
429 Ga0207663_10016400 3300025916 Bacteria 4107
430 Ga0207663_10176131 3300025916 Bacteria 1523
431 Ga0207663_10517600 3300025916 Bacteria 929
432 Ga0207660_10492199 3300025917 Bacteria 994
433 Ga0207662_10039032 3300025918 Bacteria 2783
434 Ga0207657_10013739 3300025919 Bacteria 7926
435 Ga0207657_10028157 3300025919 Bacteria 5131
436 Ga0207657_10735171 3300025919 Bacteria 765
437 Ga0207649_10066986 3300025920 Bacteria 2278
438 Ga0207649_10165670 3300025920 Bacteria 1535
439 Ga0207652_10008724 3300025921 Bacteria 8160
440 Ga0207652_10016769 3300025921 Bacteria 5985
441 Ga0207652_10147526 3300025921 Bacteria 2106
442 Ga0207652_10341302 3300025921 Bacteria 1352
443 Ga0207652_10351540 3300025921 Bacteria 1330
444 Ga0207652_10437911 3300025921 Bacteria 1178
445 Ga0207646_10001043 3300025922 Bacteria 35345
446 Ga0207646_10003277 3300025922 Bacteria 18442
447 Ga0207646_10006902 3300025922 Bacteria 11663
448 Ga0207646_10036661 3300025922 Bacteria 4426
449 Ga0207646_10066969 3300025922 Bacteria 3206
450 Ga0207646_10108168 3300025922 Bacteria 2494
451 Ga0207646_10112799 3300025922 Bacteria 2440
452 Ga0207646_10125319 3300025922 Bacteria 2309
453 Ga0207646_10175844 3300025922 Bacteria 1933
454 Ga0207646_10214371 3300025922 Bacteria 1739
455 Ga0207646_10378277 3300025922 Bacteria 1279
456 Ga0207694_10266117 3300025924 Bacteria 1405
457 Ga0207650_10781202 3300025925 Bacteria 809
458 Ga0207659_10004462 3300025926 Bacteria 8473
459 Ga0207659_10301483 3300025926 Bacteria 1316
460 Ga0207687_10012294 3300025927 Bacteria 5597
461 Ga0207687_10044430 3300025927 Bacteria 3066
462 Ga0207687_10117011 3300025927 Bacteria 1988
463 Ga0207687_10242425 3300025927 Bacteria 1429
464 Ga0207700_10012464 3300025928 Bacteria 5484
465 Ga0207700_10017983 3300025928 Bacteria 4735
466 Ga0207700_10032895 3300025928 Bacteria 3704
467 Ga0207700_10034300 3300025928 Bacteria 3642
468 Ga0207700_10050547 3300025928 Bacteria 3098
469 Ga0207700_10085111 3300025928 Bacteria 2481
470 Ga0207700_10118893 3300025928 Bacteria 2139
471 Ga0207700_10223870 3300025928 Bacteria 1596
472 Ga0207700_10279193 3300025928 Bacteria 1436
473 Ga0207700_10319977 3300025928 Bacteria 1344
474 Ga0207700_10413001 3300025928 Bacteria 1184
475 Ga0207664_10001219 3300025929 Bacteria 17030
476 Ga0207664_10001859 3300025929 Bacteria 13926
477 Ga0207664_10002401 3300025929 Bacteria 12385
478 Ga0207664_10010461 3300025929 Bacteria 6554
479 Ga0207664_10017597 3300025929 Bacteria 5244
480 Ga0207664_10045207 3300025929 Bacteria 3452
481 Ga0207664_10050425 3300025929 Bacteria 3282
482 Ga0207664_10078311 3300025929 Bacteria 2681
483 Ga0207664_10130081 3300025929 Bacteria 2118
484 Ga0207664_10154753 3300025929 Bacteria 1951
485 Ga0207664_10199746 3300025929 Bacteria 1725
486 Ga0207644_10704144 3300025931 Bacteria 842
487 Ga0207690_10262610 3300025932 Bacteria 1338
488 Ga0207706_10101311 3300025933 Bacteria 2534
489 Ga0207706_10188207 3300025933 Bacteria 1812
490 Ga0207686_10199327 3300025934 Bacteria 1433
491 Ga0207686_10233304 3300025934 Bacteria 1335
492 Ga0207709_10021557 3300025935 Bacteria 3649
493 Ga0207709_10040829 3300025935 Bacteria 2780
494 Ga0207709_10049174 3300025935 Bacteria 2572
495 Ga0207709_10056214 3300025935 Bacteria 2435
496 Ga0207670_10076188 3300025936 Bacteria 2333
497 Ga0207669_10050661 3300025937 Bacteria 2484
498 Ga0207669_10199851 3300025937 Bacteria 1450
499 Ga0207669_10354556 3300025937 Bacteria 1135
500 Ga0207704_10060273 3300025938 Bacteria 2347
501 Ga0207704_10676032 3300025938 Bacteria 852
502 Ga0207665_10000937 3300025939 Bacteria 19776
503 Ga0207665_10025697 3300025939 Bacteria 3886
504 Ga0207665_10044338 3300025939 Bacteria 2976
505 Ga0207691_10002759 3300025940 Bacteria 17117
506 Ga0207691_10043103 3300025940 Bacteria 4159
507 Ga0207691_10648383 3300025940 Bacteria 892
508 Ga0207711_10157543 3300025941 Bacteria 2053
509 Ga0207689_10028926 3300025942 Bacteria 4632
510 Ga0207689_10078275 3300025942 Bacteria 2717
511 Ga0207689_10284620 3300025942 Bacteria 1369
512 Ga0207689_10316061 3300025942 Bacteria 1296
513 Ga0207661_10020538 3300025944 Bacteria 4938
514 Ga0207661_10082632 3300025944 Bacteria 2656
515 Ga0207661_10246257 3300025944 Bacteria 1587
516 Ga0207661_10279300 3300025944 Bacteria 1492
517 Ga0207661_10298439 3300025944 Bacteria 1444
518 Ga0207679_10059848 3300025945 Bacteria 2827
519 Ga0207679_10083461 3300025945 Bacteria 2449
520 Ga0207679_10315845 3300025945 Bacteria 1351
521 Ga0207679_10412030 3300025945 Bacteria 1191
522 Ga0207667_10783030 3300025949 Bacteria 951
523 Ga0207651_10447590 3300025960 Bacteria 1108
524 Ga0207712_10041209 3300025961 Bacteria 3173
525 Ga0207712_10455059 3300025961 Bacteria 1086
526 Ga0207668_10818972 3300025972 Bacteria 825
527 Ga0207640_10034135 3300025981 Bacteria 3172
528 Ga0207640_10485021 3300025981 Bacteria 1026
529 Ga0207640_10592054 3300025981 Bacteria 938
530 Ga0207677_10065603 3300026023 Bacteria 2534
531 Ga0207677_10153779 3300026023 Bacteria 1778
532 Ga0207677_10161080 3300026023 Bacteria 1743
533 Ga0207677_10258882 3300026023 Bacteria 1417
534 Ga0207677_10557749 3300026023 Bacteria 999
535 Ga0207677_10645376 3300026023 Bacteria 934
536 Ga0207703_10082642 3300026035 Bacteria 2681
537 Ga0207703_10182944 3300026035 Bacteria 1850
538 Ga0207703_10344111 3300026035 Bacteria 1371
539 Ga0207639_10294704 3300026041 Bacteria 1432
540 Ga0207678_10013263 3300026067 Bacteria 7232
541 Ga0207678_10112010 3300026067 Bacteria 2328
542 Ga0207678_10116286 3300026067 Bacteria 2282
543 Ga0207678_10361747 3300026067 Bacteria 1252
544 Ga0207678_10414828 3300026067 Bacteria 1167
545 Ga0207708_10000171 3300026075 Bacteria 51434
546 Ga0207708_10013641 3300026075 Bacteria 6070
547 Ga0207708_10047624 3300026075 Bacteria 3263
548 Ga0207708_10141025 3300026075 Bacteria 1891
549 Ga0207702_10098834 3300026078 Bacteria 2572
550 Ga0207702_10406511 3300026078 Bacteria 1314
551 Ga0207702_10534781 3300026078 Bacteria 1145
552 Ga0207641_10067667 3300026088 Bacteria 3061
553 Ga0207648_10000926 3300026089 Bacteria 33052
554 Ga0207648_10021225 3300026089 Bacteria 5838
555 Ga0207648_10273380 3300026089 Bacteria 1510
556 Ga0207676_10023529 3300026095 Bacteria 4547
557 Ga0207676_10060211 3300026095 Bacteria 3002
558 Ga0207676_10534115 3300026095 Bacteria 1118
559 Ga0207674_10002791 3300026116 Bacteria 21738
560 Ga0207674_10003072 3300026116 Bacteria 20651
561 Ga0207674_10021296 3300026116 Bacteria 6986
562 Ga0207674_10043441 3300026116 Bacteria 4634
563 Ga0207674_10050070 3300026116 Bacteria 4269
564 Ga0207674_10062060 3300026116 Bacteria 3775
565 Ga0207674_10330823 3300026116 Bacteria 1473
566 Ga0207675_100021690 3300026118 Bacteria 5978
567 Ga0207675_100045873 3300026118 Bacteria 4082
568 Ga0207683_10040527 3300026121 Bacteria 4065
569 Ga0207683_10044001 3300026121 Bacteria 3902
570 Ga0207683_10542743 3300026121 Bacteria 1075
571 Ga0207698_10013511 3300026142 Bacteria 5390
572 Ga0207698_10087552 3300026142 Bacteria 2537
573 Ga0207428_10018301 3300027907 Bacteria 5986
574 Ga0207428_10170260 3300027907 Bacteria 1650
575 Ga0207428_10312454 3300027907 Bacteria 1162
576 Ga0268266_10037281 3300028379 Bacteria 4143
577 Ga0268266_10148443 3300028379 Bacteria 2111
578 Ga0268265_10021593 3300028380 Bacteria 4513
579 Ga0268265_10158734 3300028380 Bacteria 1918
580 Ga0268265_10303887 3300028380 Bacteria 1438
581 Ga0268265_10764455 3300028380 Bacteria 939
582 Ga0268265_10838033 3300028380 Bacteria 899
583 Ga0268264_10015344 3300028381 Bacteria 6283
584 Ga0268264_10016885 3300028381 Bacteria 5975
585 Ga0268264_10102534 3300028381 Bacteria 2490
586 Ga0268264_10147125 3300028381 Bacteria 2108
587 Ga0268264_10223668 3300028381 Bacteria 1734
588 Ga0268264_10732260 3300028381 Bacteria 984
589 Ga0265337_1007835 3300028556 Bacteria 3957
590 Ga0265326_10007791 3300028558 Bacteria 3263
591 Ga0265319_1000101 3300028563 Bacteria 66582
592 Ga0265319_1004032 3300028563 Bacteria 7433
593 Ga0265334_10003352 3300028573 Bacteria 7312
594 Ga0265318_10000112 3300028577 Bacteria 75202
595 Ga0265318_10001261 3300028577 Bacteria 15307
596 Ga0265318_10061405 3300028577 Bacteria 1400
597 Ga0265323_10009626 3300028653 Bacteria 3938
598 Ga0265322_10006720 3300028654 Bacteria 3379
599 Ga0265336_10001704 3300028666 Bacteria 9695
600 Ga0265336_10014619 3300028666 Bacteria 2595
601 Ga0307515_10000042 3300028794 Bacteria 309141
602 Ga0307515_10014744 3300028794 Bacteria 14459
603 Ga0307515_10030070 3300028794 Bacteria 9144
604 Ga0265338_10000743 3300028800 Bacteria 55581
605 Ga0265338_10001346 3300028800 Bacteria 40029
606 Ga0265338_10005011 3300028800 Bacteria 17505
607 Ga0265338_10006911 3300028800 Bacteria 14280
608 Ga0265338_10057494 3300028800 Bacteria 3440
609 Ga0265338_10066202 3300028800 Bacteria 3128
610 Ga0265324_10010807 3300029957 Bacteria 3501
611 Ga0307512_10007084 3300030522 Bacteria 11176
612 Ga0307512_10027813 3300030522 Bacteria 4968
613 Ga0265330_10000056 3300031235 Bacteria 100283
614 Ga0265332_10000050 3300031238 Bacteria 112449
615 Ga0265332_10002184 3300031238 Bacteria 10071
616 Ga0265328_10001238 3300031239 Bacteria 11839
617 Ga0265320_10000115 3300031240 Bacteria 69750
618 Ga0265320_10005115 3300031240 Bacteria 8473
619 Ga0265320_10109686 3300031240 Bacteria 1265
620 Ga0265325_10000326 3300031241 Bacteria 33654
621 Ga0265325_10001667 3300031241 Bacteria 15409
622 Ga0265325_10035966 3300031241 Bacteria 2626
623 Ga0265329_10000048 3300031242 Bacteria 51268
624 Ga0265340_10001141 3300031247 Bacteria 15183
625 Ga0265340_10001852 3300031247 Bacteria 12068
626 Ga0265339_10006545 3300031249 Bacteria 7634
627 Ga0265339_10007679 3300031249 Bacteria 6938
628 Ga0265339_10041381 3300031249 Bacteria 2558
629 Ga0265331_10000335 3300031250 Bacteria 50304
630 Ga0265316_10001199 3300031344 Bacteria 28027
631 Ga0265316_10008688 3300031344 Bacteria 9401
632 Ga0265316_10020583 3300031344 Bacteria 5613
633 Ga0307513_10024342 3300031456 Bacteria 7044
634 Ga0307513_10047902 3300031456 Bacteria 4645
635 Ga0307513_10080092 3300031456 Bacteria 3370
636 Ga0307513_10265934 3300031456 Bacteria 1501
637 Ga0307408_100181523 3300031548 Bacteria 1688
638 Ga0265313_10000009 3300031595 Bacteria 169607
639 Ga0265313_10000187 3300031595 Bacteria 66087
640 Ga0265313_10000383 3300031595 Bacteria 47643
641 Ga0265313_10033580 3300031595 Bacteria 2605
642 Ga0307508_10086037 3300031616 Bacteria 2727
643 Ga0307508_10149401 3300031616 Bacteria 1941
644 Ga0316579_10050303 3300031691 Bacteria 1949
645 Ga0265314_10000430 3300031711 Bacteria 56257
646 Ga0265314_10017800 3300031711 Bacteria 5567
647 Ga0265342_10000333 3300031712 Bacteria 52702
648 Ga0265342_10012657 3300031712 Bacteria 5707
649 Ga0307516_10003947 3300031730 Bacteria 18653
650 Ga0307516_10034399 3300031730 Bacteria 5092
651 Ga0307516_10153774 3300031730 Bacteria 2058
652 Ga0307405_10333712 3300031731 Bacteria 1163
653 Ga0316577_10042918 3300031733 Bacteria 2530
654 Ga0307413_10023726 3300031824 Bacteria 3329
655 Ga0307413_10312890 3300031824 Bacteria 1196
656 Ga0307410_10015091 3300031852 Bacteria 4571
657 Ga0307410_10032568 3300031852 Bacteria 3356
658 Ga0307406_10028625 3300031901 Bacteria 3368
659 Ga0307407_10044263 3300031903 Bacteria 2507
660 Ga0307407_10102867 3300031903 Bacteria 1777
661 Ga0307407_10140691 3300031903 Bacteria 1556
662 Ga0307412_10134797 3300031911 Bacteria 1800
663 Ga0307409_100090877 3300031995 Bacteria 2500
664 Ga0307409_100384215 3300031995 Bacteria 1336
665 Ga0307409_100984808 3300031995 Bacteria 861
666 Ga0307416_100021692 3300032002 Bacteria 4617
667 Ga0307416_100492760 3300032002 Bacteria 1288
668 Ga0307414_10086307 3300032004 Bacteria 2315
669 Ga0307414_10271610 3300032004 Bacteria 1420
670 Ga0307414_10501103 3300032004 Bacteria 1074
671 Ga0307411_10642793 3300032005 Bacteria 917
672 Ga0307415_100002584 3300032126 Bacteria 9047
673 Ga0307415_100035580 3300032126 Bacteria 3253
674 Ga0307415_100489620 3300032126 Bacteria 1073
675 Ga0307507_10147119 3300033179 Bacteria 1786
676 Ga0316214_1002630 3300033545 Bacteria 2215
677 Ga0373938_0044313 3300034957 Bacteria 998
678 Ga0373926_0002315 3300035083 Bacteria 6025
679 Ga0373926_0006977 3300035083 Bacteria 3756
680 Ga0373934_0000101 3300035086 Bacteria 29995
681 Ga0373934_0012313 3300035086 Bacteria 3229
682 Ga0373934_0040878 3300035086 Bacteria 1829
683 Ga0373934_0042417 3300035086 Bacteria 1797
684 Ga0373949_0031357 3300035090 Bacteria 1267
685 Ga0373951_0000271 3300035091 Bacteria 16583
686 Ga0373923_0000967 3300035111 Bacteria 7719
687 Ga0373923_0010902 3300035111 Bacteria 3320
688 Ga0373923_0015587 3300035111 Bacteria 2871
689 Ga0373923_0039155 3300035111 Bacteria 1946
690 Ga0373923_0061499 3300035111 Bacteria 1596
691 Ga0373923_0075589 3300035111 Bacteria 1453
692 Ga0373936_0003980 3300035113 Bacteria 5568
693 Ga0373936_0308040 3300035113 Bacteria 716
694 Ga0373945_0028991 3300035116 Bacteria 1942
695 Ga0373945_0034494 3300035116 Bacteria 1803
696 Ga0373953_0000521 3300035117 Bacteria 10670
697 Ga0373953_0009295 3300035117 Bacteria 3375
698 Ga0373953_0026137 3300035117 Bacteria 2235
699 Ga0373954_0008596 3300035118 Bacteria 4490
700 Ga0373954_0015680 3300035118 Bacteria 3389
701 Ga0373954_0027967 3300035118 Bacteria 2591
702 Ga0373956_0000095 3300035119 Bacteria 29811
703 Ga0373956_0018190 3300035119 Bacteria 2972
704 Ga0373956_0113215 3300035119 Bacteria 1264
705 Ga0373957_0000033 3300035120 Bacteria 35539
706 Ga0373943_0066062 3300035170 Bacteria 1820
707 Ga0373943_0085374 3300035170 Bacteria 1625
708 Ga0373946_0002118 3300035171 Bacteria 6960
709 Ga0373946_0010570 3300035171 Bacteria 3420
710 Ga0373946_0145535 3300035171 Bacteria 1102
711 Ga0373955_0000002 3300035172 Bacteria 125763
712 Ga0373955_0007055 3300035172 Bacteria 5145
713 Ga0373955_0012915 3300035172 Bacteria 4026
714 Ga0373924_0002327 3300035410 Bacteria 6376
715 Ga0373924_0009167 3300035410 Bacteria 3621
716 Ga0373931_0346063 3300035691 Bacteria 929
717 Ga0373935_0000234 3300035692 Bacteria 27285
718 Ga0373935_0045225 3300035692 Bacteria 2777
719 Ga0373935_0192321 3300035692 Bacteria 1406
720 Ga0373935_0206279 3300035692 Bacteria 1360
721 Ga0373927_0254902 3300035695 Bacteria 1153
722 Ga0373933_0000029 3300035724 Bacteria 86829
723 Ga0373933_0012974 3300035724 Bacteria 4609
724 Ga0373933_0024647 3300035724 Bacteria 3444
725 Ga0373933_0033935 3300035724 Bacteria 2971
726 Ga0373933_0137993 3300035724 Bacteria 1538
727 Ga0373933_0198132 3300035724 Bacteria 1284
728 Ga0373947_0000005 3300035725 Bacteria 225129
729 Ga0373947_0134795 3300035725 Bacteria 1579
730 Ga0373937_0000362 3300036401 Bacteria 42228
731 Ga0373937_0004443 3300036401 Bacteria 11918
732 Ga0373937_0095938 3300036401 Bacteria 2750
733 Ga0373937_0243235 3300036401 Bacteria 1695
734 Ga0373937_0330572 3300036401 Bacteria 1442
735 Ga0373937_0448943 3300036401 Bacteria 1224
736 Ga0373937_0472913 3300036401 Bacteria 1190
737 Ga0316584_0019297 3300036712 Bacteria 4928
738 Ga0373925_0000021 3300037068 Bacteria 162277
739 Ga0373925_0199253 3300037068 Bacteria 1591
740 Ga0373925_0221133 3300037068 Bacteria 1511
741 Ga0373925_0475917 3300037068 Bacteria 1024
742 Ga0395900_0003692 3300037418 Bacteria 16457
743 Ga0395900_0407298 3300037418 Bacteria 1323
744 Ga0395898_0042087 3300037466 Bacteria 4509
745 Ga0395898_0150625 3300037466 Bacteria 2226
746 Ga0395898_0974500 3300037466 Bacteria 784
747 Ga0316581_0039286 3300037588 Bacteria 1440
748 Ga0436364_0115602 3300037853 Bacteria 2288
749 Ga0436364_0361850 3300037853 Bacteria 4047
750 Ga0436364_1130152 3300037853 Bacteria 3129
751 Ga0436364_1225860 3300037853 Bacteria 2715
752 Ga0395901_0059328 3300038443 Bacteria 3981
753 Ga0436361_0546799 3300039447 Bacteria 1419
754 Ga0436363_0208428 3300039450 Bacteria 2554
755 Ga0451787_197248 3300041441 Bacteria 1637
756 Ga0451789_0052206 3300041443 Bacteria 4804
757 Ga0451791_1114879 3300041451 Bacteria 5775
758 Ga0451791_1689531 3300041451 Bacteria 1860
759 Ga0451793_0720655 3300041452 Bacteria 12238
760 Ga0451797_0100726 3300041453 Bacteria 4175
761 Ga0451800_0314848 3300041459 Bacteria 1739
762 Ga0451807_0584294 3300041486 Bacteria 1090
763 Ga0451839_0061394 3300041496 Bacteria 3005
764 Ga0451841_0287715 3300041498 Bacteria 1713
765 Ga0451843_0204342 3300041509 Bacteria 4137
766 Ga0466965_0355675 3300044683 Bacteria 803
767 Ga0466966_0085720 3300044684 Bacteria 1958
768 Ga0466961_0105411 3300044693 Bacteria 1775
769 Ga0466963_0076384 3300044694 Bacteria 2262
770 Ga0466964_0222376 3300044706 Bacteria 917
771 Ga0466957_0239841 3300044842 Bacteria 1202
772 Ga0466960_0012595 3300044901 Bacteria 3575
773 Ga0466960_0097893 3300044901 Bacteria 1506
774 Ga0466959_0003301 3300045049 Bacteria 10527
775 Ga0466959_0020862 3300045049 Bacteria 4828
776 Ga0466959_0133545 3300045049 Bacteria 1758
777 Ga0466959_0362030 3300045049 Bacteria 988
778 Ga0466958_0090390 3300045836 Bacteria 1895
779 Ga0466958_0121743 3300045836 Bacteria 1634
780 Ga0466958_0259650 3300045836 Bacteria 1112
781 Ga0466958_0276648 3300045836 Bacteria 1075
782 Ga0466967_0000444 3300045976 Bacteria 19804
783 Ga0466967_0004649 3300045976 Bacteria 9313
784 Ga0466967_0015004 3300045976 Bacteria 6059
785 Ga0466967_0026433 3300045976 Bacteria 4808
786 Ga0466967_0044615 3300045976 Bacteria 3847
787 Ga0466967_0050982 3300045976 Bacteria 3625
788 Ga0466967_0076441 3300045976 Bacteria 3012
789 Ga0466967_0127873 3300045976 Bacteria 2355
790 Ga0466967_0154742 3300045976 Bacteria 2146
791 Ga0466967_0573243 3300045976 Bacteria 1112
792 Ga0466967_0943566 3300045976 Bacteria 858
793 Ga0495592_0000043 3300046454 Bacteria 122354
794 Ga0495592_0008890 3300046454 Bacteria 7542
795 Ga0495592_0040782 3300046454 Bacteria 3482
796 Ga0495592_0100369 3300046454 Bacteria 2064
797 Ga0495592_0135693 3300046454 Bacteria 1716
798 Ga0495592_0232868 3300046454 Bacteria 1225
799 Ga0495603_0042928 3300046455 Bacteria 2701
800 Ga0495629_0005691 3300046459 Bacteria 9307
801 Ga0495629_0091124 3300046459 Bacteria 2127
802 Ga0495629_0217170 3300046459 Bacteria 1319
803 Ga0495641_0001864 3300046461 Bacteria 17302
804 Ga0495651_0000135 3300046462 Bacteria 54990
805 Ga0495651_0003167 3300046462 Bacteria 12664
806 Ga0495651_0006755 3300046462 Bacteria 8766
807 Ga0495651_0021269 3300046462 Bacteria 5041
808 Ga0495651_0028970 3300046462 Bacteria 4318
809 Ga0495651_0055294 3300046462 Bacteria 3050
810 Ga0495653_0000571 3300046463 Bacteria 28231
811 Ga0495653_0012759 3300046463 Bacteria 6861
812 Ga0495653_0063902 3300046463 Bacteria 2775
813 Ga0495653_0132596 3300046463 Bacteria 1761
814 Ga0495653_0179118 3300046463 Bacteria 1456
815 Ga0495653_0299490 3300046463 Bacteria 1049
816 Ga0495580_0015800 3300046472 Bacteria 5685
817 Ga0495582_0212637 3300046473 Bacteria 1105
818 Ga0495582_0296301 3300046473 Bacteria 929
819 Ga0495639_0001668 3300046475 Bacteria 9874
820 Ga0495662_0009182 3300046476 Bacteria 4853
821 Ga0495662_0011201 3300046476 Bacteria 4383
822 Ga0495662_0036057 3300046476 Bacteria 2387
823 Ga0495662_0074460 3300046476 Bacteria 1647
824 Ga0495664_0014805 3300046477 Bacteria 4428
825 Ga0495664_0017439 3300046477 Bacteria 4104
826 Ga0495664_0125390 3300046477 Bacteria 1553
827 Ga0495664_0177147 3300046477 Bacteria 1293
828 Ga0495664_0275579 3300046477 Bacteria 1016
829 Ga0495594_0158565 3300046499 Bacteria 1286
830 Ga0495594_0226331 3300046499 Bacteria 1066
831 Ga0495608_0000016 3300046511 Bacteria 196738
832 Ga0495608_0007773 3300046511 Bacteria 7551
833 Ga0495608_0013563 3300046511 Bacteria 5652
834 Ga0495608_0050860 3300046511 Bacteria 2748
835 Ga0495608_0119179 3300046511 Bacteria 1693
836 Ga0495618_0022655 3300046514 Bacteria 3880
837 Ga0495618_0183018 3300046514 Bacteria 1331
838 Ga0495618_0199061 3300046514 Bacteria 1268
839 Ga0495618_0346335 3300046514 Bacteria 916
840 Ga0495628_0000034 3300046516 Bacteria 115264
841 Ga0495628_0008967 3300046516 Bacteria 8554
842 Ga0495628_0013773 3300046516 Bacteria 6795
843 Ga0495628_0227919 3300046516 Bacteria 1397
844 Ga0495628_0388891 3300046516 Bacteria 1020
845 Ga0495630_0001481 3300046517 Bacteria 16232
846 Ga0495630_0009954 3300046517 Bacteria 6846
847 Ga0495630_0077567 3300046517 Bacteria 2505
848 Ga0495630_0283839 3300046517 Bacteria 1265
849 Ga0495663_0054344 3300046525 Bacteria 1247
850 Ga0495666_0005436 3300046526 Bacteria 6418
851 Ga0495666_0094215 3300046526 Bacteria 1412
852 Ga0495652_0000174 3300046529 Bacteria 73044
853 Ga0495652_0014268 3300046529 Bacteria 7133
854 Ga0495652_0018126 3300046529 Bacteria 6283
855 Ga0495652_0022357 3300046529 Bacteria 5610
856 Ga0495652_0054315 3300046529 Bacteria 3411
857 Ga0495652_0054402 3300046529 Bacteria 3408
858 Ga0495652_0066154 3300046529 Bacteria 3034
859 Ga0495652_0239700 3300046529 Bacteria 1350
860 Ga0495665_0017965 3300046531 Bacteria 3801
861 Ga0495640_0006733 3300046533 Bacteria 9067
862 Ga0495640_0011539 3300046533 Bacteria 6795
863 Ga0495640_0039902 3300046533 Bacteria 3291
864 Ga0495640_0254242 3300046533 Bacteria 1099
865 Ga0495587_0000044 3300046536 Bacteria 108443
866 Ga0495587_0002197 3300046536 Bacteria 13041
867 Ga0495587_0004185 3300046536 Bacteria 9552
868 Ga0495587_0007131 3300046536 Bacteria 7253
869 Ga0495587_0023581 3300046536 Bacteria 3781
870 Ga0495587_0123462 3300046536 Bacteria 1482
871 Ga0495645_0145071 3300046543 Bacteria 1654
872 Ga0495645_0168207 3300046543 Bacteria 1510
873 Ga0495645_0315594 3300046543 Bacteria 1016
874 Ga0495622_0140668 3300046557 Bacteria 1096
875 Ga0495667_0000052 3300046559 Bacteria 108432
876 Ga0495667_0058789 3300046559 Bacteria 2524
877 Ga0495667_0065610 3300046559 Bacteria 2374
878 Ga0495667_0083468 3300046559 Bacteria 2075
879 Ga0495667_0229903 3300046559 Bacteria 1182
880 Ga0495667_0270642 3300046559 Bacteria 1079
881 Ga0495656_0169464 3300046615 Bacteria 1066
882 Ga0495634_0005292 3300046642 Bacteria 9963
883 Ga0495634_0009343 3300046642 Bacteria 7234
884 Ga0495634_0057919 3300046642 Bacteria 2584
885 Ga0495634_0144929 3300046642 Bacteria 1505
886 Ga0495634_0245119 3300046642 Bacteria 1098
887 Ga0495635_0039234 3300046663 Bacteria 3276
888 Ga0495635_0065132 3300046663 Bacteria 2500
889 Ga0495635_0072653 3300046663 Bacteria 2356
890 Ga0495635_0148515 3300046663 Bacteria 1596
891 Ga0495635_0235376 3300046663 Bacteria 1236
892 Ga0495635_0336209 3300046663 Bacteria 1009
893 Ga0495588_0091891 3300046674 Bacteria 1590
894 Ga0495588_0195713 3300046674 Bacteria 1068
895 Ga0495657_0000015 3300046675 Bacteria 187657
896 Ga0495657_0009392 3300046675 Bacteria 7416
897 Ga0495657_0013373 3300046675 Bacteria 6059
898 Ga0495657_0024401 3300046675 Bacteria 4307
899 Ga0495657_0027681 3300046675 Bacteria 3997
900 Ga0495657_0082289 3300046675 Bacteria 2080
901 Ga0495657_0091969 3300046675 Bacteria 1944
902 Ga0495657_0233343 3300046675 Bacteria 1112
903 Ga0495599_0000035 3300046678 Bacteria 103981
904 Ga0495599_0003091 3300046678 Bacteria 9690
905 Ga0495599_0007370 3300046678 Bacteria 6669
906 Ga0495599_0051967 3300046678 Bacteria 2567
907 Ga0495599_0198281 3300046678 Bacteria 1233
908 Ga0495623_0000767 3300046679 Bacteria 21507
909 Ga0495623_0002607 3300046679 Bacteria 11904
910 Ga0495623_0037673 3300046679 Bacteria 3093
911 Ga0495623_0140134 3300046679 Bacteria 1440
912 Ga0495623_0222683 3300046679 Bacteria 1074
913 Ga0495623_0233732 3300046679 Bacteria 1041
914 Ga0495623_0306196 3300046679 Bacteria 876
915 Ga0495646_0002176 3300046680 Bacteria 11936
916 Ga0495646_0014045 3300046680 Bacteria 5091
917 Ga0495646_0040257 3300046680 Bacteria 2879
918 Ga0495646_0382705 3300046680 Bacteria 733
919 Ga0495658_0000676 3300046683 Bacteria 18454
920 Ga0495613_0078282 3300046689 Bacteria 2405
921 Ga0495624_0122064 3300046690 Bacteria 1599
922 Ga0495624_0126680 3300046690 Bacteria 1567
923 Ga0495600_0007475 3300046809 Bacteria 6688
924 Ga0495600_0025656 3300046809 Bacteria 3798
925 Ga0495600_0056237 3300046809 Bacteria 2570
926 Ga0495600_0088286 3300046809 Bacteria 2023
927 Ga0495600_0223031 3300046809 Bacteria 1205
928 Ga0495600_0270490 3300046809 Bacteria 1078
929 Ga0495581_0001515 3300047315 Bacteria 12943
930 Ga0495581_0017534 3300047315 Bacteria 4159
931 Ga0495581_0023897 3300047315 Bacteria 3542
932 Ga0495581_0091086 3300047315 Bacteria 1769
933 Ga0495604_0000048 3300047317 Bacteria 108810
934 Ga0495604_0009246 3300047317 Bacteria 7801
935 Ga0495604_0030548 3300047317 Bacteria 4278
936 Ga0495604_0041434 3300047317 Bacteria 3611
937 Ga0495604_0046676 3300047317 Bacteria 3378
938 Ga0495604_0131706 3300047317 Bacteria 1796
939 Ga0495604_0154282 3300047317 Bacteria 1628
940 Ga0495674_0027236 3300047319 Bacteria 5224
941 Ga0495674_0139615 3300047319 Bacteria 2037
942 Ga0495676_0004969 3300047321 Bacteria 12194
943 Ga0495676_0006692 3300047321 Bacteria 10614
944 Ga0495680_0000069 3300047322 Bacteria 88766
945 Ga0495680_0010239 3300047322 Bacteria 8372
946 Ga0495680_0012666 3300047322 Bacteria 7406
947 Ga0495680_0019087 3300047322 Bacteria 5802
948 Ga0495680_0020724 3300047322 Bacteria 5521
949 Ga0495680_0074021 3300047322 Bacteria 2587
950 Ga0495680_0187849 3300047322 Bacteria 1487
951 Ga0495675_0000685 3300047444 Bacteria 21288
952 Ga0495675_0040750 3300047444 Bacteria 2960
953 Ga0495675_0048135 3300047444 Bacteria 2712
954 Ga0495675_0067482 3300047444 Bacteria 2260
955 Ga0495684_0002558 3300047471 Bacteria 14475
956 Ga0495684_0009605 3300047471 Bacteria 7458
957 Ga0495684_0014538 3300047471 Bacteria 6059
958 Ga0495684_0067033 3300047471 Bacteria 2729
959 Ga0495684_0079004 3300047471 Bacteria 2497
960 Ga0495684_0125480 3300047471 Bacteria 1931
961 Ga0495684_0205211 3300047471 Bacteria 1452
962 Ga0495593_0045862 3300047673 Bacteria 2331
963 Ga0495593_0246927 3300047673 Bacteria 894
964 Ga0495602_0000970 3300048088 Bacteria 27780
965 Ga0495602_0028336 3300048088 Bacteria 5362
966 Ga0495602_0036043 3300048088 Bacteria 4607
967 Ga0495602_0041593 3300048088 Bacteria 4196
968 Ga0495602_0091366 3300048088 Bacteria 2525
969 Ga0495602_0099272 3300048088 Bacteria 2393
970 Ga0495614_0140023 3300048089 Bacteria 1074
971 Ga0496100_0192306 3300048903 Bacteria 1482
972 Ga0496102_0074809 3300048905 Bacteria 3114
973 Ga0496102_0136609 3300048905 Bacteria 2298
974 Ga0496102_0334117 3300048905 Bacteria 1427
975 Ga0496102_0482142 3300048905 Bacteria 1161
976 Ga0496102_0662145 3300048905 Bacteria 967
977 Ga0496103_0053830 3300048906 Bacteria 2494
978 Ga0496104_0000441 3300048907 Bacteria 36043
979 Ga0496104_0005513 3300048907 Bacteria 11084
980 Ga0496104_0007235 3300048907 Bacteria 9794
981 Ga0496104_0012681 3300048907 Bacteria 7590
982 Ga0496105_0031146 3300048908 Bacteria 4372
983 Ga0496105_0085888 3300048908 Bacteria 2600
984 Ga0496106_0334431 3300048909 Bacteria 1216
985 Ga0496106_0370120 3300048909 Bacteria 1151
986 Ga0496106_0666185 3300048909 Bacteria 831
987 Ga0496108_0000748 3300048911 Bacteria 25330
988 Ga0496108_0018581 3300048911 Bacteria 5694
989 Ga0496108_0022231 3300048911 Bacteria 5215
990 Ga0496108_0022533 3300048911 Bacteria 5179
991 Ga0496108_0034966 3300048911 Bacteria 4175
992 Ga0496108_0148646 3300048911 Bacteria 2021
993 Ga0496108_0180850 3300048911 Bacteria 1826
994 Ga0496108_0213929 3300048911 Bacteria 1673
995 Ga0496108_0546456 3300048911 Bacteria 1011
996 Ga0496109_0001743 3300048912 Bacteria 18151
997 Ga0496109_0110366 3300048912 Bacteria 2557
998 Ga0496109_0152282 3300048912 Bacteria 2165
999 Ga0496109_0170111 3300048912 Bacteria 2044
1000 Ga0496109_0207973 3300048912 Bacteria 1840
1001 Ga0496109_0246635 3300048912 Bacteria 1681
1002 Ga0496109_0248074 3300048912 Bacteria 1676
1003 Ga0496109_0458350 3300048912 Bacteria 1204
1004 Ga0496110_0003033 3300048913 Bacteria 12739
1005 Ga0496110_0032286 3300048913 Bacteria 4521
1006 Ga0496110_0059346 3300048913 Bacteria 3372
1007 Ga0496110_0061091 3300048913 Bacteria 3325
1008 Ga0496110_0063852 3300048913 Bacteria 3254
1009 Ga0496110_0158974 3300048913 Bacteria 2048
1010 Ga0496111_0001177 3300048914 Bacteria 14549
1011 Ga0496111_0161411 3300048914 Bacteria 1664
1012 Ga0496111_0368051 3300048914 Bacteria 1063
1013 Ga0496112_0000159 3300048915 Bacteria 42547
1014 Ga0496112_0337142 3300048915 Bacteria 1451
1015 Ga0496112_0412413 3300048915 Bacteria 1290
1016 Ga0496112_0443375 3300048915 Bacteria 1236
1017 Ga0496112_0496972 3300048915 Bacteria 1155
1018 Ga0496112_0751517 3300048915 Bacteria 901
1019 Ga0496113_0051315 3300048916 Bacteria 3078
1020 Ga0496113_0054954 3300048916 Bacteria 2983
1021 Ga0496113_0381641 3300048916 Bacteria 1131
1022 Ga0496113_0710750 3300048916 Bacteria 801
1023 Ga0496114_0088480 3300048917 Bacteria 2627
1024 Ga0496114_0242525 3300048917 Bacteria 1585
1025 Ga0496114_0286236 3300048917 Bacteria 1454
1026 Ga0496114_0681767 3300048917 Bacteria 902
1027 Ga0496115_0106658 3300048918 Bacteria 2300
1028 Ga0496115_0136170 3300048918 Bacteria 2025
1029 Ga0496115_0353438 3300048918 Bacteria 1198
1030 Ga0496119_0083288 3300048922 Bacteria 1837
1031 Ga0496126_0007772 3300048929 Bacteria 11685
1032 Ga0496126_0337260 3300048929 Bacteria 1236
1033 Ga0501031_0066544 3300049568 Bacteria 2348
1034 Ga0501032_0142716 3300049569 Bacteria 1577
1035 Ga0501033_0123128 3300049570 Bacteria 1881
1036 Ga0501033_0299190 3300049570 Bacteria 1133
1037 Ga0501036_0012617 3300049572 Bacteria 7009
1038 Ga0501036_0031750 3300049572 Bacteria 4463
1039 Ga0501036_0419841 3300049572 Bacteria 1115
1040 Ga0501038_0055593 3300049574 Bacteria 3400
1041 Ga0501039_0023712 3300049575 Bacteria 4710
1042 Ga0501039_0183281 3300049575 Bacteria 1646
1043 Ga0501039_0579009 3300049575 Bacteria 880
1044 Ga0501040_0005034 3300049576 Bacteria 8539
1045 Ga0501042_0016519 3300049578 Bacteria 5068
1046 Ga0501042_0053553 3300049578 Bacteria 2879
1047 Ga0501043_0238103 3300049579 Bacteria 1404
1048 Ga0501046_0064009 3300049580 Bacteria 2871
1049 Ga0501047_0024344 3300049581 Bacteria 5812
1050 Ga0501048_0006698 3300049582 Bacteria 8751
1051 Ga0501067_0002370 3300049583 Bacteria 10435
1052 Ga0501067_0217319 3300049583 Bacteria 1064
1053 Ga0501068_0246065 3300049584 Bacteria 1139
1054 Ga0501068_0396983 3300049584 Bacteria 889
1055 Ga0501070_0038435 3300049586 Bacteria 3993
1056 Ga0501071_0004689 3300049587 Bacteria 8689
1057 Ga0501072_0006738 3300049588 Bacteria 8728
1058 Ga0501074_0141438 3300049590 Bacteria 1721
1059 Ga0501076_0038370 3300049592 Bacteria 3761
1060 Ga0501076_0221856 3300049592 Bacteria 1545
1061 Ga0501077_0125451 3300049593 Bacteria 1627
1062 Ga0501079_0024703 3300049741 Bacteria 4611
1063 Ga0501079_0162120 3300049741 Bacteria 1744
1064 Ga0501080_0028140 3300049742 Bacteria 5226
1065 Ga0501080_0044011 3300049742 Bacteria 4157
1066 Ga0501080_0268637 3300049742 Bacteria 1553
1067 Ga0501081_0156214 3300049743 Bacteria 1641
1068 Ga0501081_0443958 3300049743 Bacteria 963
1069 Ga0501035_0036768 3300049822 Bacteria 4436
1070 Ga0501044_0034810 3300049823 Bacteria 5279
1071 Ga0501045_0053012 3300049824 Bacteria 2963
1072 nmdc:mga06r32_562659_c1 3300050510 Bacteria 1113
1073 nmdc:mga06r32_99194_c1 3300050510 Bacteria 2856
1074 nmdc:mga08y16_1241598_c1 3300050511 Bacteria 714
1075 nmdc:mga08y16_14122_c1 3300050511 Bacteria 8408
1076 nmdc:mga08y16_24926_c1 3300050511 Bacteria 6309
1077 nmdc:mga08y16_51474_c1 3300050511 Bacteria 4309
1078 nmdc:mga0rr50_145490_c1 3300050513 Bacteria 1911
1079 nmdc:mga0rr50_316648_c1 3300050513 Bacteria 1307
1080 nmdc:mga0a205_30845_c1 3300050515 Bacteria 5135
1081 Ga0495601_0085937 3300053077 Bacteria 2021
1082 Ga0495601_0144616 3300053077 Bacteria 1552
1083 Ga0495612_0014977 3300053078 Bacteria 3110
1084 Ga0495612_0130935 3300053078 Bacteria 1083
1085 Ga0495595_0000162 3300053084 Bacteria 26749
1086 Ga0495595_0004135 3300053084 Bacteria 5826
1087 Ga0495595_0019979 3300053084 Bacteria 2911
1088 Ga0495595_0032891 3300053084 Bacteria 2337
1089 Ga0495595_0154657 3300053084 Bacteria 1129
1090 Ga0495619_0003428 3300053085 Bacteria 10234
1091 Ga0495619_0256704 3300053085 Bacteria 1211
1092 Ga0495619_0316284 3300053085 Bacteria 1081
1093 Ga0495619_0338068 3300053085 Bacteria 1042
1094 Ga0500651_0084308 3300053093 Bacteria 1965
1095 Ga0500650_0115430 3300053098 Bacteria 1253
1096 Ga0500569_024140 3300053109 Bacteria 1642
1097 Ga0500594_0077090 3300053118 Bacteria 990
1098 Ga0500652_004451 3300053131 Bacteria 4341
1099 Ga0500611_097349 3300053727 Bacteria 757
1100 Ga0501084_0052825 3300054114 Bacteria 3399
1101 Ga0501082_0042883 3300060353 Bacteria 3899
1102 Ga0501082_0448009 3300060353 Bacteria 1128
1103 Ga0466962_0035909 3300061719 Bacteria 2372
1104 Ga0530510_0018293 3300061734 Bacteria 4968
1105 2558910879 2558860112 Bacteria 9931328
1106 2623499272 2622736605 Bacteria 4992138
1107 2870784859 2870782633 Bacteria 9624083
1108 2904482173 2904479285 Bacteria 5073931
1109 2946005680 2946003308 Bacteria 3857229
1110 8054476347 8054472261 Bacteria 7464355
1111 Ga0070714_100256254
1112 JGI24735J21928_10093592
1113 JGI24744J21845_10005151
1114 JGI25406J46586_10006130
1115 Ga0070658_10006845
1116 Ga0070658_10023598
1117 Ga0070658_10064156
1118 Ga0070658_10257089
1119 Ga0070658_10283857
1120 Ga0070676_10104111
1121 Ga0070676_10452015
1122 Ga0070683_100004571
1123 Ga0070683_100059709
1124 Ga0070683_100064566
1125 Ga0070683_100101131
1126 Ga0070683_100113133
1127 Ga0070683_100127961
1128 Ga0070683_100144915
1129 Ga0070683_100153307
1130 Ga0070683_100167567
1131 Ga0070683_100232294
1132 Ga0070683_100321577
1133 Ga0070670_100081101
1134 Ga0070670_100628995
1135 Ga0068869_100018522
1136 Ga0068869_100030074
1137 Ga0070680_100290980
1138 Ga0070682_100008855
1139 Ga0070682_100151536
1140 Ga0070682_100576076
1141 Ga0068868_100004265
1142 Ga0068868_100024352
1143 Ga0070660_100019041
1144 Ga0070660_100027145
1145 Ga0070660_100129995
1146 Ga0070660_100397204
1147 Ga0070689_100408094
1148 Ga0070689_100564929
1149 Ga0070691_10024889
1150 Ga0070691_10101628
1151 Ga0070661_100030787
1152 Ga0070661_100085981
1153 Ga0070661_100457680
1154 Ga0070661_100499430
1155 Ga0070692_10146692
1156 Ga0070692_10195973
1157 Ga0070668_100017010
1158 Ga0070668_100225900
1159 Ga0070669_100350604
1160 Ga0070669_100436787
1161 Ga0070675_100002740
1162 Ga0070675_100080840
1163 Ga0070675_100085263
1164 Ga0070675_100167581
1165 Ga0070675_100450683
1166 Ga0070674_100068747
1167 Ga0070674_100260495
1168 Ga0070674_100922664
1169 Ga0070673_100117165
1170 Ga0070688_100287082
1171 Ga0070659_100037838
1172 Ga0070659_100112961
1173 Ga0070659_100155108
1174 Ga0070709_10003021
1175 Ga0070709_10028678
1176 Ga0070709_10039282
1177 Ga0070709_10040725
1178 Ga0070709_10067334
1179 Ga0070709_10112358
1180 Ga0070714_100000452
1181 Ga0070714_100001028
1182 Ga0070714_100005940
1183 Ga0070714_100005955
1184 Ga0070714_100082551
1185 Ga0070714_100083836
1186 Ga0070714_100276806
1187 Ga0070713_100007261
1188 Ga0070713_100010227
1189 Ga0070713_100024420
1190 Ga0070713_100037406
1191 Ga0070713_100065592
1192 Ga0070713_100147037
1193 Ga0070713_100280114
1194 Ga0070713_100292505
1195 Ga0070713_100330256
1196 Ga0070710_10008259
1197 Ga0070710_10018475
1198 Ga0070710_10082483
1199 Ga0070710_10088860
1200 Ga0070710_10184202
1201 Ga0070701_10006868
1202 Ga0070701_10025713
1203 Ga0070711_100021021
1204 Ga0070711_100032826
1205 Ga0070711_100043948
1206 Ga0070705_100076262
1207 Ga0070705_100123531
1208 Ga0070700_100009488
1209 Ga0070700_100033665
1210 Ga0070700_100278561
1211 Ga0070708_100534018
1212 Ga0070663_100026326
1213 Ga0070663_100055561
1214 Ga0070663_100085492
1215 Ga0070663_100233430
1216 Ga0070663_100331677
1217 Ga0070678_100015224
1218 Ga0070678_100096045
1219 Ga0070678_100224580
1220 Ga0070662_100063633
1221 Ga0070681_10009600
1222 Ga0070681_10313312
1223 Ga0070681_10419697
1224 Ga0068867_100007002
1225 Ga0070685_10043361
1226 Ga0070685_10060364
1227 Ga0070685_10064127
1228 Ga0070685_10391648
1229 Ga0070706_100001048
1230 Ga0070706_100003836
1231 Ga0070706_100005036
1232 Ga0070706_100006933
1233 Ga0070706_100007675
1234 Ga0070706_100079469
1235 Ga0070706_100088284
1236 Ga0070706_100208006
1237 Ga0070706_100631577
1238 Ga0070706_100906047
1239 Ga0070707_100000792
1240 Ga0070707_100023200
1241 Ga0070707_100029054
1242 Ga0070707_100035864
1243 Ga0070707_100045292
1244 Ga0070707_100120283
1245 Ga0070707_100121840
1246 Ga0070707_100233253
1247 Ga0070707_100372866
1248 Ga0070698_100006771
1249 Ga0070698_100008876
1250 Ga0070698_100011521
1251 Ga0070698_100037550
1252 Ga0070698_100038643
1253 Ga0070698_100076311
1254 Ga0070698_100077164
1255 Ga0070698_100118694
1256 Ga0070698_100222699
1257 Ga0070698_100322806
1258 Ga0070699_100001575
1259 Ga0070699_100002101
1260 Ga0070699_100068500
1261 Ga0070699_100321845
1262 Ga0070699_100529912
1263 Ga0070699_100703631
1264 Ga0070679_100003755
1265 Ga0070679_100008909
1266 Ga0070679_100031308
1267 Ga0070679_100111734
1268 Ga0070679_100745761
1269 Ga0070679_100873675
1270 Ga0070684_100019147
1271 Ga0070684_100019292
1272 Ga0070684_100158834
1273 Ga0070684_100200043
1274 Ga0070684_100230379
1275 Ga0070684_100743007
1276 Ga0070684_100880707
1277 Ga0070697_100010976
1278 Ga0070697_100061101
1279 Ga0068853_100163892
1280 Ga0068853_100257281
1281 Ga0070672_100001312
1282 Ga0070686_100020181
1283 Ga0070686_100112921
1284 Ga0070686_100154360
1285 Ga0070695_100099157
1286 Ga0070696_100103024
1287 Ga0070693_100050430
1288 Ga0070693_100060807
1289 Ga0070693_100152791
1290 Ga0070693_100223269
1291 Ga0070665_100054642
1292 Ga0070665_100589065
1293 Ga0068855_100058270
1294 Ga0068855_100097460
1295 Ga0070664_100009193
1296 Ga0070664_100299231
1297 Ga0070664_100355724
1298 Ga0070664_100460177
1299 Ga0070664_100548494
1300 Ga0068857_100004338
1301 Ga0068857_100045347
1302 Ga0068857_100073149
1303 Ga0068857_100400311
1304 Ga0068857_100497630
1305 Ga0068854_100011357
1306 Ga0068854_100013890
1307 Ga0068854_100028924
1308 Ga0068856_100108541
1309 Ga0068856_100530346
1310 Ga0070702_100007486
1311 Ga0070702_100017373
1312 Ga0070702_100025155
1313 Ga0070702_100237246
1314 Ga0070702_100379323
1315 Ga0068852_100192661
1316 Ga0068859_100041006
1317 Ga0068864_100012042
1318 Ga0068864_100068223
1319 Ga0068864_100244236
1320 Ga0068864_100403177
1321 Ga0068864_100645846
1322 Ga0068864_101067031
1323 Ga0068866_10071920
1324 Ga0068866_10092394
1325 Ga0068861_100014698
1326 Ga0068861_100069261
1327 Ga0068851_10114771
1328 Ga0068870_10007764
1329 Ga0068870_10068076
1330 Ga0068863_100092777
1331 Ga0068863_100853033
1332 Ga0068858_100070389
1333 Ga0068858_100224105
1334 Ga0068858_100573081
1335 Ga0068860_100021498
1336 Ga0068860_100115439
1337 Ga0068860_100152796
1338 Ga0068860_100231940
1339 Ga0068860_100269611
1340 Ga0068860_100740566
1341 Ga0068862_100014232
1342 Ga0068862_100227134
1343 Ga0068862_100252439
1344 Ga0081540_1000345
1345 Ga0081540_1001308
1346 Ga0081540_1006178
1347 Ga0081539_10003383
1348 Ga0081539_10005543
1349 Ga0081539_10010664
1350 Ga0081539_10027029
1351 Ga0081539_10027830
1352 Ga0081539_10176204
1353 Ga0070717_10007804
1354 Ga0070717_10018129
1355 Ga0070717_10046161
1356 Ga0070717_10052576
1357 Ga0070717_10058504
1358 Ga0070717_10119623
1359 Ga0070717_10175368
1360 Ga0070717_10368294
1361 Ga0070717_10514079
1362 Ga0070717_10624459
1363 Ga0070715_10001476
1364 Ga0070715_10050842
1365 Ga0070715_10179863
1366 Ga0070716_100001463
1367 Ga0070716_100019289
1368 Ga0070716_100076159
1369 Ga0070712_100071500
1370 Ga0070712_100260485
1371 Ga0070712_100266517
1372 Ga0097621_100215728
1373 Ga0097621_100311445
1374 Ga0097621_100627844
1375 Ga0075428_100553200
1376 Ga0075428_100717706
1377 Ga0075431_100073239
1378 Ga0075431_100075900
1379 Ga0075431_100106830
1380 Ga0075434_100389538
1381 Ga0068865_100011812
1382 Ga0068865_100096507
1383 Ga0068865_100374407
1384 Ga0075436_100004827
1385 Ga0075436_100020931
1386 Ga0097620_100041008
1387 Ga0105240_10273382
1388 Ga0105240_10350751
1389 Ga0105240_10609138
1390 Ga0111539_10001402
1391 Ga0111539_10024563
1392 Ga0111539_10865089
1393 Ga0105245_10017866
1394 Ga0105245_10028596
1395 Ga0105245_10101497
1396 Ga0105245_10163393
1397 Ga0105245_10500369
1398 Ga0105247_10540866
1399 Ga0114129_10024315
1400 Ga0114129_10216522
1401 Ga0114129_10333104
1402 Ga0105243_10002861
1403 Ga0105243_10150131
1404 Ga0105243_10275198
1405 Ga0105243_10277580
1406 Ga0105243_10316852
1407 Ga0105243_10341615
1408 Ga0105243_10362608
1409 Ga0105241_10103218
1410 Ga0105242_10010464
1411 Ga0105242_10073410
1412 Ga0105242_10208554
1413 Ga0105242_11072563
1414 Ga0105248_10109534
1415 Ga0105248_10604018
1416 Ga0105238_10049831
1417 Ga0105238_10119356
1418 Ga0105238_10159425
1419 Ga0105238_10229245
1420 Ga0105238_10291352
1421 Ga0105249_10016248
1422 Ga0105249_10130704
1423 Ga0105249_10169960
1424 Ga0105249_10697895
1425 Ga0105239_10109864
1426 Ga0105239_10130301
1427 Ga0105239_10201441
1428 Ga0105239_10238761
1429 Ga0105246_10032876
1430 Ga0105246_10093187
1431 Ga0105246_10095239
1432 Ga0105246_10919680
1433 Ga0157342_1008389
1434 Ga0157371_10431412
1435 Ga0157370_10170964
1436 Ga0157370_10304658
1437 Ga0157369_10006230
1438 Ga0157369_10009643
1439 Ga0157369_10043686
1440 Ga0157369_10223548
1441 Ga0157374_10223871
1442 Ga0157374_10649385
1443 Ga0157378_10176077
1444 Ga0157378_10498396
1445 Ga0163162_10033664
1446 Ga0163162_10236810
1447 Ga0163162_10833720
1448 Ga0157372_10070802
1449 Ga0157372_10090164
1450 Ga0157372_10634069
1451 Ga0157372_10750118
1452 Ga0157372_10770623
1453 Ga0157375_10077212
1454 Ga0157375_10144159
1455 Ga0157375_10218869
1456 Ga0163163_10003412
1457 Ga0163163_10101314
1458 Ga0163163_10124358
1459 Ga0163163_10327439
1460 Ga0163163_10357935
1461 Ga0157380_10014664
1462 Ga0157380_10482740
1463 Ga0157380_10532211
1464 Ga0157380_10720355
1465 Ga0157377_10001840
1466 Ga0157377_10070554
1467 Ga0157379_10005808
1468 Ga0157379_10187756
1469 Ga0157379_10279803
1470 Ga0157379_10941423
1471 Ga0157376_10025898
1472 Ga0157376_10116353
1473 Ga0157376_10154488
1474 Ga0163161_10052133
1475 Ga0197907_11154562
1476 Ga0206356_10064106
1477 Ga0206356_10374739
1478 Ga0206351_10623328
1479 Ga0206350_10545162
1480 Ga0206350_11332998
1481 Ga0206353_10430810
1482 Ga0206353_10680297
1483 Ga0206353_10837455
1484 Ga0206353_11138628
1485 Ga0213875_10045485
1486 Ga0213875_10053546
1487 Ga0224712_10003657
1488 Ga0224712_10009872
1489 Ga0224712_10012296
1490 Ga0224712_10022462
1491 Ga0224712_10172980
1492 Ga0224712_10210403
1493 Ga0207697_10076100
1494 Ga0207656_10105874
1495 Ga0207692_10001219
1496 Ga0207692_10048644
1497 Ga0207692_10231762
1498 Ga0207692_10379978
1499 Ga0207642_10046425
1500 Ga0207688_10003336
1501 Ga0207688_10011417
1502 Ga0207688_10121591
1503 Ga0207688_10128231
1504 Ga0207647_10045140
1505 Ga0207647_10053383
1506 Ga0207647_10210887
1507 Ga0207685_10017954
1508 Ga0207685_10056915
1509 Ga0207699_10010674
1510 Ga0207699_10018548
1511 Ga0207699_10069684
1512 Ga0207699_10084580
1513 Ga0207699_10094201
1514 Ga0207699_10300896
1515 Ga0207645_10031739
1516 Ga0207645_10094505
1517 Ga0207643_10014808
1518 Ga0207643_10023975
1519 Ga0207705_10014311
1520 Ga0207705_10020113
1521 Ga0207705_10262640
1522 Ga0207684_10002703
1523 Ga0207684_10004377
1524 Ga0207684_10011882
1525 Ga0207684_10020585
1526 Ga0207684_10027199
1527 Ga0207684_10098696
1528 Ga0207684_10103864
1529 Ga0207684_10164710
1530 Ga0207684_10224693
1531 Ga0207684_10281699
1532 Ga0207654_10051541
1533 Ga0207707_10001352
1534 Ga0207707_10303303
1535 Ga0207693_10011242
1536 Ga0207693_10055473
1537 Ga0207693_10122229
1538 Ga0207693_10177362
1539 Ga0207663_10016400
1540 Ga0207663_10176131
1541 Ga0207663_10517600
1542 Ga0207660_10492199
1543 Ga0207662_10039032
1544 Ga0207657_10013739
1545 Ga0207657_10028157
1546 Ga0207657_10735171
1547 Ga0207649_10066986
1548 Ga0207649_10165670
1549 Ga0207652_10008724
1550 Ga0207652_10016769
1551 Ga0207652_10147526
1552 Ga0207652_10341302
1553 Ga0207652_10351540
1554 Ga0207652_10437911
1555 Ga0207646_10001043
1556 Ga0207646_10003277
1557 Ga0207646_10006902
1558 Ga0207646_10036661
1559 Ga0207646_10066969
1560 Ga0207646_10108168
1561 Ga0207646_10112799
1562 Ga0207646_10125319
1563 Ga0207646_10175844
1564 Ga0207646_10214371
1565 Ga0207646_10378277
1566 Ga0207694_10266117
1567 Ga0207650_10781202
1568 Ga0207659_10004462
1569 Ga0207659_10301483
1570 Ga0207687_10012294
1571 Ga0207687_10044430
1572 Ga0207687_10117011
1573 Ga0207687_10242425
1574 Ga0207700_10012464
1575 Ga0207700_10017983
1576 Ga0207700_10032895
1577 Ga0207700_10034300
1578 Ga0207700_10050547
1579 Ga0207700_10085111
1580 Ga0207700_10118893
1581 Ga0207700_10223870
1582 Ga0207700_10279193
1583 Ga0207700_10319977
1584 Ga0207700_10413001
1585 Ga0207664_10001219
1586 Ga0207664_10001859
1587 Ga0207664_10002401
1588 Ga0207664_10010461
1589 Ga0207664_10017597
1590 Ga0207664_10045207
1591 Ga0207664_10050425
1592 Ga0207664_10078311
1593 Ga0207664_10130081
1594 Ga0207664_10154753
1595 Ga0207664_10199746
1596 Ga0207644_10704144
1597 Ga0207690_10262610
1598 Ga0207706_10101311
1599 Ga0207706_10188207
1600 Ga0207686_10199327
1601 Ga0207686_10233304
1602 Ga0207709_10021557
1603 Ga0207709_10040829
1604 Ga0207709_10049174
1605 Ga0207709_10056214
1606 Ga0207670_10076188
1607 Ga0207669_10050661
1608 Ga0207669_10199851
1609 Ga0207669_10354556
1610 Ga0207704_10060273
1611 Ga0207704_10676032
1612 Ga0207665_10000937
1613 Ga0207665_10025697
1614 Ga0207665_10044338
1615 Ga0207691_10002759
1616 Ga0207691_10043103
1617 Ga0207691_10648383
1618 Ga0207711_10157543
1619 Ga0207689_10028926
1620 Ga0207689_10078275
1621 Ga0207689_10284620
1622 Ga0207689_10316061
1623 Ga0207661_10020538
1624 Ga0207661_10082632
1625 Ga0207661_10246257
1626 Ga0207661_10279300
1627 Ga0207661_10298439
1628 Ga0207679_10059848
1629 Ga0207679_10083461
1630 Ga0207679_10315845
1631 Ga0207679_10412030
1632 Ga0207667_10783030
1633 Ga0207651_10447590
1634 Ga0207712_10041209
1635 Ga0207712_10455059
1636 Ga0207668_10818972
1637 Ga0207640_10034135
1638 Ga0207640_10485021
1639 Ga0207640_10592054
1640 Ga0207677_10065603
1641 Ga0207677_10153779
1642 Ga0207677_10161080
1643 Ga0207677_10258882
1644 Ga0207677_10557749
1645 Ga0207677_10645376
1646 Ga0207703_10082642
1647 Ga0207703_10182944
1648 Ga0207703_10344111
1649 Ga0207639_10294704
1650 Ga0207678_10013263
1651 Ga0207678_10112010
1652 Ga0207678_10116286
1653 Ga0207678_10361747
1654 Ga0207678_10414828
1655 Ga0207708_10000171
1656 Ga0207708_10013641
1657 Ga0207708_10047624
1658 Ga0207708_10141025
1659 Ga0207702_10098834
1660 Ga0207702_10406511
1661 Ga0207702_10534781
1662 Ga0207641_10067667
1663 Ga0207648_10000926
1664 Ga0207648_10021225
1665 Ga0207648_10273380
1666 Ga0207676_10023529
1667 Ga0207676_10060211
1668 Ga0207676_10534115
1669 Ga0207674_10002791
1670 Ga0207674_10003072
1671 Ga0207674_10021296
1672 Ga0207674_10043441
1673 Ga0207674_10050070
1674 Ga0207674_10062060
1675 Ga0207674_10330823
1676 Ga0207675_100021690
1677 Ga0207675_100045873
1678 Ga0207683_10040527
1679 Ga0207683_10044001
1680 Ga0207683_10542743
1681 Ga0207698_10013511
1682 Ga0207698_10087552
1683 Ga0207428_10018301
1684 Ga0207428_10170260
1685 Ga0207428_10312454
1686 Ga0268266_10037281
1687 Ga0268266_10148443
1688 Ga0268265_10021593
1689 Ga0268265_10158734
1690 Ga0268265_10303887
1691 Ga0268265_10764455
1692 Ga0268265_10838033
1693 Ga0268264_10015344
1694 Ga0268264_10016885
1695 Ga0268264_10102534
1696 Ga0268264_10147125
1697 Ga0268264_10223668
1698 Ga0268264_10732260
1699 Ga0265337_1007835
1700 Ga0265326_10007791
1701 Ga0265319_1000101
1702 Ga0265319_1004032
1703 Ga0265334_10003352
1704 Ga0265318_10000112
1705 Ga0265318_10001261
1706 Ga0265318_10061405
1707 Ga0265323_10009626
1708 Ga0265322_10006720
1709 Ga0265336_10001704
1710 Ga0265336_10014619
1711 Ga0307515_10000042
1712 Ga0307515_10014744
1713 Ga0307515_10030070
1714 Ga0265338_10000743
1715 Ga0265338_10001346
1716 Ga0265338_10005011
1717 Ga0265338_10006911
1718 Ga0265338_10057494
1719 Ga0265338_10066202
1720 Ga0265324_10010807
1721 Ga0307512_10007084
1722 Ga0307512_10027813
1723 Ga0265330_10000056
1724 Ga0265332_10000050
1725 Ga0265332_10002184
1726 Ga0265328_10001238
1727 Ga0265320_10000115
1728 Ga0265320_10005115
1729 Ga0265320_10109686
1730 Ga0265325_10000326
1731 Ga0265325_10001667
1732 Ga0265325_10035966
1733 Ga0265329_10000048
1734 Ga0265340_10001141
1735 Ga0265340_10001852
1736 Ga0265339_10006545
1737 Ga0265339_10007679
1738 Ga0265339_10041381
1739 Ga0265331_10000335
1740 Ga0265316_10001199
1741 Ga0265316_10008688
1742 Ga0265316_10020583
1743 Ga0307513_10024342
1744 Ga0307513_10047902
1745 Ga0307513_10080092
1746 Ga0307513_10265934
1747 Ga0307408_100181523
1748 Ga0265313_10000009
1749 Ga0265313_10000187
1750 Ga0265313_10000383
1751 Ga0265313_10033580
1752 Ga0307508_10086037
1753 Ga0307508_10149401
1754 Ga0316579_10050303
1755 Ga0265314_10000430
1756 Ga0265314_10017800
1757 Ga0265342_10000333
1758 Ga0265342_10012657
1759 Ga0307516_10003947
1760 Ga0307516_10034399
1761 Ga0307516_10153774
1762 Ga0307405_10333712
1763 Ga0316577_10042918
1764 Ga0307413_10023726
1765 Ga0307413_10312890
1766 Ga0307410_10015091
1767 Ga0307410_10032568
1768 Ga0307406_10028625
1769 Ga0307407_10044263
1770 Ga0307407_10102867
1771 Ga0307407_10140691
1772 Ga0307412_10134797
1773 Ga0307409_100090877
1774 Ga0307409_100384215
1775 Ga0307409_100984808
1776 Ga0307416_100021692
1777 Ga0307416_100492760
1778 Ga0307414_10086307
1779 Ga0307414_10271610
1780 Ga0307414_10501103
1781 Ga0307411_10642793
1782 Ga0307415_100002584
1783 Ga0307415_100035580
1784 Ga0307415_100489620
1785 Ga0307507_10147119
1786 Ga0316214_1002630
1787 Ga0373938_0044313
1788 Ga0373926_0002315
1789 Ga0373926_0006977
1790 Ga0373934_0000101
1791 Ga0373934_0012313
1792 Ga0373934_0040878
1793 Ga0373934_0042417
1794 Ga0373949_0031357
1795 Ga0373951_0000271
1796 Ga0373923_0000967
1797 Ga0373923_0010902
1798 Ga0373923_0015587
1799 Ga0373923_0039155
1800 Ga0373923_0061499
1801 Ga0373923_0075589
1802 Ga0373936_0003980
1803 Ga0373936_0308040
1804 Ga0373945_0028991
1805 Ga0373945_0034494
1806 Ga0373953_0000521
1807 Ga0373953_0009295
1808 Ga0373953_0026137
1809 Ga0373954_0008596
1810 Ga0373954_0015680
1811 Ga0373954_0027967
1812 Ga0373956_0000095
1813 Ga0373956_0018190
1814 Ga0373956_0113215
1815 Ga0373957_0000033
1816 Ga0373943_0066062
1817 Ga0373943_0085374
1818 Ga0373946_0002118
1819 Ga0373946_0010570
1820 Ga0373946_0145535
1821 Ga0373955_0000002
1822 Ga0373955_0007055
1823 Ga0373955_0012915
1824 Ga0373924_0002327
1825 Ga0373924_0009167
1826 Ga0373931_0346063
1827 Ga0373935_0000234
1828 Ga0373935_0045225
1829 Ga0373935_0192321
1830 Ga0373935_0206279
1831 Ga0373927_0254902
1832 Ga0373933_0000029
1833 Ga0373933_0012974
1834 Ga0373933_0024647
1835 Ga0373933_0033935
1836 Ga0373933_0137993
1837 Ga0373933_0198132
1838 Ga0373947_0000005
1839 Ga0373947_0134795
1840 Ga0373937_0000362
1841 Ga0373937_0004443
1842 Ga0373937_0095938
1843 Ga0373937_0243235
1844 Ga0373937_0330572
1845 Ga0373937_0448943
1846 Ga0373937_0472913
1847 Ga0316584_0019297
1848 Ga0373925_0000021
1849 Ga0373925_0199253
1850 Ga0373925_0221133
1851 Ga0373925_0475917
1852 Ga0395900_0003692
1853 Ga0395900_0407298
1854 Ga0395898_0042087
1855 Ga0395898_0150625
1856 Ga0395898_0974500
1857 Ga0316581_0039286
1858 Ga0436364_0115602
1859 Ga0436364_0361850
1860 Ga0436364_1130152
1861 Ga0436364_1225860
1862 Ga0395901_0059328
1863 Ga0436361_0546799
1864 Ga0436363_0208428
1865 Ga0451787_197248
1866 Ga0451789_0052206
1867 Ga0451791_1114879
1868 Ga0451791_1689531
1869 Ga0451793_0720655
1870 Ga0451797_0100726
1871 Ga0451800_0314848
1872 Ga0451807_0584294
1873 Ga0451839_0061394
1874 Ga0451841_0287715
1875 Ga0451843_0204342
1876 Ga0466965_0355675
1877 Ga0466966_0085720
1878 Ga0466961_0105411
1879 Ga0466963_0076384
1880 Ga0466964_0222376
1881 Ga0466957_0239841
1882 Ga0466960_0012595
1883 Ga0466960_0097893
1884 Ga0466959_0003301
1885 Ga0466959_0020862
1886 Ga0466959_0133545
1887 Ga0466959_0362030
1888 Ga0466958_0090390
1889 Ga0466958_0121743
1890 Ga0466958_0259650
1891 Ga0466958_0276648
1892 Ga0466967_0000444
1893 Ga0466967_0004649
1894 Ga0466967_0015004
1895 Ga0466967_0026433
1896 Ga0466967_0044615
1897 Ga0466967_0050982
1898 Ga0466967_0076441
1899 Ga0466967_0127873
1900 Ga0466967_0154742
1901 Ga0466967_0573243
1902 Ga0466967_0943566
1903 Ga0495592_0000043
1904 Ga0495592_0008890
1905 Ga0495592_0040782
1906 Ga0495592_0100369
1907 Ga0495592_0135693
1908 Ga0495592_0232868
1909 Ga0495603_0042928
1910 Ga0495629_0005691
1911 Ga0495629_0091124
1912 Ga0495629_0217170
1913 Ga0495641_0001864
1914 Ga0495651_0000135
1915 Ga0495651_0003167
1916 Ga0495651_0006755
1917 Ga0495651_0021269
1918 Ga0495651_0028970
1919 Ga0495651_0055294
1920 Ga0495653_0000571
1921 Ga0495653_0012759
1922 Ga0495653_0063902
1923 Ga0495653_0132596
1924 Ga0495653_0179118
1925 Ga0495653_0299490
1926 Ga0495580_0015800
1927 Ga0495582_0212637
1928 Ga0495582_0296301
1929 Ga0495639_0001668
1930 Ga0495662_0009182
1931 Ga0495662_0011201
1932 Ga0495662_0036057
1933 Ga0495662_0074460
1934 Ga0495664_0014805
1935 Ga0495664_0017439
1936 Ga0495664_0125390
1937 Ga0495664_0177147
1938 Ga0495664_0275579
1939 Ga0495594_0158565
1940 Ga0495594_0226331
1941 Ga0495608_0000016
1942 Ga0495608_0007773
1943 Ga0495608_0013563
1944 Ga0495608_0050860
1945 Ga0495608_0119179
1946 Ga0495618_0022655
1947 Ga0495618_0183018
1948 Ga0495618_0199061
1949 Ga0495618_0346335
1950 Ga0495628_0000034
1951 Ga0495628_0008967
1952 Ga0495628_0013773
1953 Ga0495628_0227919
1954 Ga0495628_0388891
1955 Ga0495630_0001481
1956 Ga0495630_0009954
1957 Ga0495630_0077567
1958 Ga0495630_0283839
1959 Ga0495663_0054344
1960 Ga0495666_0005436
1961 Ga0495666_0094215
1962 Ga0495652_0000174
1963 Ga0495652_0014268
1964 Ga0495652_0018126
1965 Ga0495652_0022357
1966 Ga0495652_0054315
1967 Ga0495652_0054402
1968 Ga0495652_0066154
1969 Ga0495652_0239700
1970 Ga0495665_0017965
1971 Ga0495640_0006733
1972 Ga0495640_0011539
1973 Ga0495640_0039902
1974 Ga0495640_0254242
1975 Ga0495587_0000044
1976 Ga0495587_0002197
1977 Ga0495587_0004185
1978 Ga0495587_0007131
1979 Ga0495587_0023581
1980 Ga0495587_0123462
1981 Ga0495645_0145071
1982 Ga0495645_0168207
1983 Ga0495645_0315594
1984 Ga0495622_0140668
1985 Ga0495667_0000052
1986 Ga0495667_0058789
1987 Ga0495667_0065610
1988 Ga0495667_0083468
1989 Ga0495667_0229903
1990 Ga0495667_0270642
1991 Ga0495656_0169464
1992 Ga0495634_0005292
1993 Ga0495634_0009343
1994 Ga0495634_0057919
1995 Ga0495634_0144929
1996 Ga0495634_0245119
1997 Ga0495635_0039234
1998 Ga0495635_0065132
1999 Ga0495635_0072653
2000 Ga0495635_0148515
2001 Ga0495635_0235376
2002 Ga0495635_0336209
2003 Ga0495588_0091891
2004 Ga0495588_0195713
2005 Ga0495657_0000015
2006 Ga0495657_0009392
2007 Ga0495657_0013373
2008 Ga0495657_0024401
2009 Ga0495657_0027681
2010 Ga0495657_0082289
2011 Ga0495657_0091969
2012 Ga0495657_0233343
2013 Ga0495599_0000035
2014 Ga0495599_0003091
2015 Ga0495599_0007370
2016 Ga0495599_0051967
2017 Ga0495599_0198281
2018 Ga0495623_0000767
2019 Ga0495623_0002607
2020 Ga0495623_0037673
2021 Ga0495623_0140134
2022 Ga0495623_0222683
2023 Ga0495623_0233732
2024 Ga0495623_0306196
2025 Ga0495646_0002176
2026 Ga0495646_0014045
2027 Ga0495646_0040257
2028 Ga0495646_0382705
2029 Ga0495658_0000676
2030 Ga0495613_0078282
2031 Ga0495624_0122064
2032 Ga0495624_0126680
2033 Ga0495600_0007475
2034 Ga0495600_0025656
2035 Ga0495600_0056237
2036 Ga0495600_0088286
2037 Ga0495600_0223031
2038 Ga0495600_0270490
2039 Ga0495581_0001515
2040 Ga0495581_0017534
2041 Ga0495581_0023897
2042 Ga0495581_0091086
2043 Ga0495604_0000048
2044 Ga0495604_0009246
2045 Ga0495604_0030548
2046 Ga0495604_0041434
2047 Ga0495604_0046676
2048 Ga0495604_0131706
2049 Ga0495604_0154282
2050 Ga0495674_0027236
2051 Ga0495674_0139615
2052 Ga0495676_0004969
2053 Ga0495676_0006692
2054 Ga0495680_0000069
2055 Ga0495680_0010239
2056 Ga0495680_0012666
2057 Ga0495680_0019087
2058 Ga0495680_0020724
2059 Ga0495680_0074021
2060 Ga0495680_0187849
2061 Ga0495675_0000685
2062 Ga0495675_0040750
2063 Ga0495675_0048135
2064 Ga0495675_0067482
2065 Ga0495684_0002558
2066 Ga0495684_0009605
2067 Ga0495684_0014538
2068 Ga0495684_0067033
2069 Ga0495684_0079004
2070 Ga0495684_0125480
2071 Ga0495684_0205211
2072 Ga0495593_0045862
2073 Ga0495593_0246927
2074 Ga0495602_0000970
2075 Ga0495602_0028336
2076 Ga0495602_0036043
2077 Ga0495602_0041593
2078 Ga0495602_0091366
2079 Ga0495602_0099272
2080 Ga0495614_0140023
2081 Ga0496100_0192306
2082 Ga0496102_0074809
2083 Ga0496102_0136609
2084 Ga0496102_0334117
2085 Ga0496102_0482142
2086 Ga0496102_0662145
2087 Ga0496103_0053830
2088 Ga0496104_0000441
2089 Ga0496104_0005513
2090 Ga0496104_0007235
2091 Ga0496104_0012681
2092 Ga0496105_0031146
2093 Ga0496105_0085888
2094 Ga0496106_0334431
2095 Ga0496106_0370120
2096 Ga0496106_0666185
2097 Ga0496108_0000748
2098 Ga0496108_0018581
2099 Ga0496108_0022231
2100 Ga0496108_0022533
2101 Ga0496108_0034966
2102 Ga0496108_0148646
2103 Ga0496108_0180850
2104 Ga0496108_0213929
2105 Ga0496108_0546456
2106 Ga0496109_0001743
2107 Ga0496109_0110366
2108 Ga0496109_0152282
2109 Ga0496109_0170111
2110 Ga0496109_0207973
2111 Ga0496109_0246635
2112 Ga0496109_0248074
2113 Ga0496109_0458350
2114 Ga0496110_0003033
2115 Ga0496110_0032286
2116 Ga0496110_0059346
2117 Ga0496110_0061091
2118 Ga0496110_0063852
2119 Ga0496110_0158974
2120 Ga0496111_0001177
2121 Ga0496111_0161411
2122 Ga0496111_0368051
2123 Ga0496112_0000159
2124 Ga0496112_0337142
2125 Ga0496112_0412413
2126 Ga0496112_0443375
2127 Ga0496112_0496972
2128 Ga0496112_0751517
2129 Ga0496113_0051315
2130 Ga0496113_0054954
2131 Ga0496113_0381641
2132 Ga0496113_0710750
2133 Ga0496114_0088480
2134 Ga0496114_0242525
2135 Ga0496114_0286236
2136 Ga0496114_0681767
2137 Ga0496115_0106658
2138 Ga0496115_0136170
2139 Ga0496115_0353438
2140 Ga0496119_0083288
2141 Ga0496126_0007772
2142 Ga0496126_0337260
2143 Ga0501031_0066544
2144 Ga0501032_0142716
2145 Ga0501033_0123128
2146 Ga0501033_0299190
2147 Ga0501036_0012617
2148 Ga0501036_0031750
2149 Ga0501036_0419841
2150 Ga0501038_0055593
2151 Ga0501039_0023712
2152 Ga0501039_0183281
2153 Ga0501039_0579009
2154 Ga0501040_0005034
2155 Ga0501042_0016519
2156 Ga0501042_0053553
2157 Ga0501043_0238103
2158 Ga0501046_0064009
2159 Ga0501047_0024344
2160 Ga0501048_0006698
2161 Ga0501067_0002370
2162 Ga0501067_0217319
2163 Ga0501068_0246065
2164 Ga0501068_0396983
2165 Ga0501070_0038435
2166 Ga0501071_0004689
2167 Ga0501072_0006738
2168 Ga0501074_0141438
2169 Ga0501076_0038370
2170 Ga0501076_0221856
2171 Ga0501077_0125451
2172 Ga0501079_0024703
2173 Ga0501079_0162120
2174 Ga0501080_0028140
2175 Ga0501080_0044011
2176 Ga0501080_0268637
2177 Ga0501081_0156214
2178 Ga0501081_0443958
2179 Ga0501035_0036768
2180 Ga0501044_0034810
2181 Ga0501045_0053012
2182 nmdc:mga06r32_562659_c1
2183 nmdc:mga06r32_99194_c1
2184 nmdc:mga08y16_1241598_c1
2185 nmdc:mga08y16_14122_c1
2186 nmdc:mga08y16_24926_c1
2187 nmdc:mga08y16_51474_c1
2188 nmdc:mga0rr50_145490_c1
2189 nmdc:mga0rr50_316648_c1
2190 nmdc:mga0a205_30845_c1
2191 Ga0495601_0085937
2192 Ga0495601_0144616
2193 Ga0495612_0014977
2194 Ga0495612_0130935
2195 Ga0495595_0000162
2196 Ga0495595_0004135
2197 Ga0495595_0019979
2198 Ga0495595_0032891
2199 Ga0495595_0154657
2200 Ga0495619_0003428
2201 Ga0495619_0256704
2202 Ga0495619_0316284
2203 Ga0495619_0338068
2204 Ga0500651_0084308
2205 Ga0500650_0115430
2206 Ga0500569_024140
2207 Ga0500594_0077090
2208 Ga0500652_004451
2209 Ga0500611_097349
2210 Ga0501084_0052825
2211 Ga0501082_0042883
2212 Ga0501082_0448009
2213 Ga0466962_0035909
2214 Ga0530510_0018293
2215 2558910879
2216 2623499272
2217 2870784859
2218 2904482173
2219 2946005680
2220 8054476347

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

40

149

0.98

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

184

260

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9689 5 120
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9687 5 120
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9667 5 120
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9619 4 121
2zwm-assembly1.cif.gz_B crystal structure of yycf receiver domain from bacillus subtilis 0.9613 4 120
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9964 5 82 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9898 4 82 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9777 4 82 3.40.50.2300
af_P9WGM1_5_87_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9765 1 82 3.40.50.2300
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9716 5 82 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7X9Q292-F1-model_v4 DNA-binding response regulator 0.9805 128 228 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7C1YRM9-F1-model_v4 Winged helix family transcriptional regulator 0.967 144 228 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A0B0H5R4-F1-model_v4 Response regulator 0.9663 3 116 GO:0000160
AF-A0A7V2QLS0-F1-model_v4 Response regulator 0.9649 2 119 GO:0000160
AF-A0A496VL76-F1-model_v4 Response regulatory domain-containing protein 0.9635 3 119 GO:0000160
GO:0016772

Map