F490178

General Info

Members Datasets Scaffolds Average Seq Length
1108 341 2216 99

Family's Representative Sequence

Representative Sequence 3300003300|Ga0006758J48902_1026128|Ga0006758J48902_10261281
Length 98
Sequence MMSIIIKKPIITEKATAANENGSFAFEVDRKANKLEIKSAVEKMYGVHVVNVRTLTYGGGKSSTKFTNRGVVEQKSRVWKKAIVTVAEGETIDLFNNF

Samples

Sample ID Description Type Environment
1 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
178 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
179 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
184 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
198 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
199 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
200 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
207 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
208 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
209 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
210 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
211 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
212 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
213 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
214 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
215 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
216 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
217 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
218 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
219 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
220 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
221 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
222 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
223 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
224 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
225 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
226 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
227 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
228 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
231 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
263 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
293 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
294 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
295 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
296 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
297 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
298 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
299 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
300 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
301 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
302 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
303 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
304 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
305 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
306 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
307 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
308 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
309 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
310 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
314 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
315 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
316 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
317 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
318 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
319 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
327 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
328 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
329 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
330 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
331 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
332 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
333 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
334 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
335 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
338 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
339 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.97
Metatranscriptomes 9.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 1.26
Rhizosphere 92.42
Stem 0
Stem Tuber 0
Unclassified 7.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006758J48902_1026128 3300003300 Bacteria 713
2 SwRhRL2b_contig_3008347 2162886007 Bacteria 6907
3 JGI24740J21852_10014244 3300001979 Bacteria 2940
4 JGI24743J22301_10055630 3300001991 Bacteria 810
5 JGI24743J22301_10098335 3300001991 Bacteria 629
6 JGI24744J21845_10033386 3300002077 Bacteria 979
7 JGI24744J21845_10053292 3300002077 Bacteria 744
8 JGI24035J26624_1018180 3300002126 Bacteria 731
9 JGI24751J29686_10101010 3300002459 Bacteria 602
10 rootL2_10116652 3300003322 Bacteria 1119
11 rootH1_10165256 3300003323 Bacteria 1164
12 JGI25160J50197_1001095 3300003354 Bacteria 13838
13 Ga0058860_11446600 3300004801 Bacteria 628
14 Ga0065704_10073668 3300005289 Bacteria 6906
15 Ga0065704_10864758 3300005289 Unclassified 505
16 Ga0065712_10002231 3300005290 Bacteria 7385
17 Ga0065712_10027689 3300005290 Bacteria 1632
18 Ga0065712_10071904 3300005290 Bacteria 4987
19 Ga0065712_10309141 3300005290 Unclassified 847
20 Ga0065712_10570103 3300005290 Bacteria 607
21 Ga0065712_10573321 3300005290 Bacteria 605
22 Ga0065712_10581230 3300005290 Bacteria 601
23 Ga0065715_10284656 3300005293 Bacteria 1077
24 Ga0065715_10517905 3300005293 Unclassified 766
25 Ga0065707_10185518 3300005295 Unclassified 1391
26 Ga0065707_10364924 3300005295 Bacteria 898
27 Ga0070658_10016405 3300005327 Bacteria 5927
28 Ga0070658_10052865 3300005327 Bacteria 3295
29 Ga0070658_10503106 3300005327 Bacteria 1047
30 Ga0070658_10513272 3300005327 Bacteria 1036
31 Ga0070658_10621450 3300005327 Bacteria 937
32 Ga0070658_10772366 3300005327 Bacteria 835
33 Ga0070676_10006513 3300005328 Bacteria 6238
34 Ga0070676_10031672 3300005328 Bacteria 3024
35 Ga0070676_10032136 3300005328 Bacteria 3005
36 Ga0070676_10203637 3300005328 Bacteria 1299
37 Ga0070683_100001488 3300005329 Bacteria 18077
38 Ga0070683_100025159 3300005329 Bacteria 5342
39 Ga0070683_100975849 3300005329 Bacteria 813
40 Ga0070683_101938102 3300005329 Unclassified 566
41 Ga0070690_100006100 3300005330 Bacteria 6823
42 Ga0070690_100256936 3300005330 Bacteria 1238
43 Ga0070670_100024841 3300005331 Bacteria 5155
44 Ga0070670_100068133 3300005331 Bacteria 3054
45 Ga0070670_100108356 3300005331 Bacteria 2393
46 Ga0070670_100109804 3300005331 Bacteria 2376
47 Ga0070670_100128199 3300005331 Bacteria 2190
48 Ga0070670_100141351 3300005331 Bacteria 2082
49 Ga0070670_100149270 3300005331 Bacteria 2023
50 Ga0070670_100734964 3300005331 Bacteria 889
51 Ga0070670_101037207 3300005331 Bacteria 746
52 Ga0070670_101683616 3300005331 Bacteria 583
53 Ga0070677_10007599 3300005333 Bacteria 3624
54 Ga0070677_10016481 3300005333 Bacteria 2632
55 Ga0070677_10043990 3300005333 Bacteria 1775
56 Ga0068869_100010127 3300005334 Bacteria 6135
57 Ga0068869_100044651 3300005334 Bacteria 3187
58 Ga0068869_100086467 3300005334 Bacteria 2350
59 Ga0068869_100093571 3300005334 Bacteria 2265
60 Ga0068869_100238893 3300005334 Bacteria 1447
61 Ga0068869_100269398 3300005334 Bacteria 1366
62 Ga0068869_100855269 3300005334 Bacteria 785
63 Ga0070666_10000036 3300005335 Bacteria 119230
64 Ga0070666_10018000 3300005335 Bacteria 4535
65 Ga0070666_10150569 3300005335 Bacteria 1623
66 Ga0070666_10224919 3300005335 Bacteria 1324
67 Ga0070666_10360216 3300005335 Unclassified 1042
68 Ga0070666_11328143 3300005335 Bacteria 537
69 Ga0070666_11436219 3300005335 Bacteria 516
70 Ga0070680_100444354 3300005336 Bacteria 1107
71 Ga0070680_100467387 3300005336 Unclassified 1078
72 Ga0070682_100781403 3300005337 Unclassified 774
73 Ga0068868_100007778 3300005338 Bacteria 7649
74 Ga0068868_100015404 3300005338 Bacteria 5654
75 Ga0068868_100031254 3300005338 Bacteria 4088
76 Ga0068868_100055794 3300005338 Bacteria 3118
77 Ga0068868_100111940 3300005338 Bacteria 2219
78 Ga0068868_100120776 3300005338 Bacteria 2137
79 Ga0068868_100179890 3300005338 Bacteria 1754
80 Ga0068868_100245999 3300005338 Bacteria 1504
81 Ga0068868_100433503 3300005338 Unclassified 1140
82 Ga0068868_101381635 3300005338 Bacteria 656
83 Ga0070660_100218767 3300005339 Bacteria 1548
84 Ga0070660_101112947 3300005339 Unclassified 669
85 Ga0070660_101351378 3300005339 Bacteria 605
86 Ga0070689_100021681 3300005340 Bacteria 4787
87 Ga0070689_100076504 3300005340 Bacteria 2622
88 Ga0070689_100196748 3300005340 Bacteria 1644
89 Ga0070687_100003733 3300005343 Bacteria 5966
90 Ga0070687_100035905 3300005343 Bacteria 2466
91 Ga0070687_100036372 3300005343 Bacteria 2453
92 Ga0070687_100636839 3300005343 Bacteria 737
93 Ga0070687_100898664 3300005343 Bacteria 635
94 Ga0070687_101180761 3300005343 Bacteria 563
95 Ga0070661_100004113 3300005344 Bacteria 10031
96 Ga0070661_100708537 3300005344 Bacteria 821
97 Ga0070661_101763575 3300005344 Unclassified 525
98 Ga0070668_100017989 3300005347 Bacteria 5302
99 Ga0070668_100025286 3300005347 Bacteria 4500
100 Ga0070668_100226019 3300005347 Bacteria 1546
101 Ga0070668_100385802 3300005347 Bacteria 1193
102 Ga0070668_101117215 3300005347 Bacteria 712
103 Ga0070668_101220418 3300005347 Bacteria 682
104 Ga0070669_100002748 3300005353 Bacteria 12690
105 Ga0070669_100024124 3300005353 Bacteria 4359
106 Ga0070669_100685911 3300005353 Bacteria 864
107 Ga0070669_100876720 3300005353 Bacteria 766
108 Ga0070669_101980349 3300005353 Bacteria 509
109 Ga0070675_100018472 3300005354 Bacteria 5550
110 Ga0070675_100027474 3300005354 Bacteria 4571
111 Ga0070675_100090601 3300005354 Bacteria 2561
112 Ga0070675_100129605 3300005354 Bacteria 2148
113 Ga0070675_100143049 3300005354 Bacteria 2046
114 Ga0070675_100182345 3300005354 Bacteria 1816
115 Ga0070675_100449057 3300005354 Unclassified 1156
116 Ga0070675_100580047 3300005354 Unclassified 1016
117 Ga0070675_100610327 3300005354 Bacteria 990
118 Ga0070675_101926560 3300005354 Unclassified 545
119 Ga0070671_100002367 3300005355 Bacteria 14557
120 Ga0070671_100030657 3300005355 Bacteria 4438
121 Ga0070671_100051676 3300005355 Bacteria 3418
122 Ga0070671_100069502 3300005355 Bacteria 2937
123 Ga0070671_100231072 3300005355 Bacteria 1569
124 Ga0070671_100463920 3300005355 Bacteria 1087
125 Ga0070671_101044821 3300005355 Bacteria 717
126 Ga0070674_100085764 3300005356 Bacteria 2260
127 Ga0070674_100141927 3300005356 Bacteria 1803
128 Ga0070674_100142571 3300005356 Bacteria 1800
129 Ga0070674_100728347 3300005356 Bacteria 850
130 Ga0070673_100003757 3300005364 Bacteria 9520
131 Ga0070673_100014827 3300005364 Bacteria 5449
132 Ga0070673_100051881 3300005364 Bacteria 3215
133 Ga0070673_100075958 3300005364 Bacteria 2711
134 Ga0070673_100264445 3300005364 Bacteria 1504
135 Ga0070673_100344753 3300005364 Bacteria 1321
136 Ga0070673_100463534 3300005364 Bacteria 1141
137 Ga0070673_100942301 3300005364 Bacteria 802
138 Ga0070688_100018933 3300005365 Bacteria 3981
139 Ga0070688_100176818 3300005365 Bacteria 1477
140 Ga0070688_100592206 3300005365 Bacteria 848
141 Ga0070688_101412615 3300005365 Bacteria 564
142 Ga0070659_100023726 3300005366 Bacteria 4697
143 Ga0070659_100213818 3300005366 Bacteria 1589
144 Ga0070659_100509157 3300005366 Bacteria 1027
145 Ga0070659_100839154 3300005366 Unclassified 800
146 Ga0070659_101582565 3300005366 Bacteria 585
147 Ga0070667_100001551 3300005367 Bacteria 20596
148 Ga0070667_100004111 3300005367 Bacteria 12319
149 Ga0070667_100176643 3300005367 Bacteria 1887
150 Ga0070667_100255813 3300005367 Bacteria 1567
151 Ga0070667_100730644 3300005367 Bacteria 917
152 Ga0070667_100752615 3300005367 Bacteria 903
153 Ga0070667_100952039 3300005367 Bacteria 800
154 Ga0070667_101004097 3300005367 Unclassified 779
155 Ga0070667_101738477 3300005367 Bacteria 587
156 Ga0070701_10094050 3300005438 Bacteria 1648
157 Ga0070700_100167615 3300005441 Bacteria 1518
158 Ga0070694_100962921 3300005444 Bacteria 707
159 Ga0070663_100099434 3300005455 Bacteria 2168
160 Ga0070663_101542824 3300005455 Bacteria 591
161 Ga0070663_101567215 3300005455 Bacteria 587
162 Ga0070678_100040792 3300005456 Bacteria 3286
163 Ga0070678_100047685 3300005456 Bacteria 3080
164 Ga0070678_100051388 3300005456 Bacteria 2987
165 Ga0070678_100302857 3300005456 Bacteria 1359
166 Ga0070678_100850439 3300005456 Bacteria 831
167 Ga0070678_100897988 3300005456 Bacteria 810
168 Ga0070678_100939312 3300005456 Bacteria 792
169 Ga0070678_101282815 3300005456 Bacteria 681
170 Ga0070678_101503270 3300005456 Bacteria 631
171 Ga0070662_100004284 3300005457 Bacteria 9007
172 Ga0070662_100033746 3300005457 Bacteria 3605
173 Ga0070662_100140628 3300005457 Bacteria 1870
174 Ga0070662_100416202 3300005457 Bacteria 1111
175 Ga0070662_100820712 3300005457 Bacteria 791
176 Ga0070662_100952639 3300005457 Unclassified 734
177 Ga0070681_10134747 3300005458 Bacteria 2401
178 Ga0070681_10639080 3300005458 Unclassified 979
179 Ga0068867_100011837 3300005459 Bacteria 6162
180 Ga0068867_100012130 3300005459 Bacteria 6086
181 Ga0068867_100067838 3300005459 Bacteria 2661
182 Ga0068867_100569397 3300005459 Bacteria 984
183 Ga0068867_100571254 3300005459 Bacteria 982
184 Ga0068867_100708840 3300005459 Unclassified 889
185 Ga0068867_100776836 3300005459 Bacteria 852
186 Ga0068867_100809254 3300005459 Bacteria 836
187 Ga0068867_101043994 3300005459 Unclassified 743
188 Ga0068867_101307042 3300005459 Bacteria 670
189 Ga0070685_10054219 3300005466 Bacteria 2325
190 Ga0070685_10130662 3300005466 Bacteria 1570
191 Ga0070685_10292353 3300005466 Bacteria 1095
192 Ga0070679_100047759 3300005530 Bacteria 4266
193 Ga0070679_100143030 3300005530 Bacteria 2371
194 Ga0070684_100021260 3300005535 Bacteria 5395
195 Ga0070684_100046353 3300005535 Bacteria 3766
196 Ga0070684_100193764 3300005535 Bacteria 1850
197 Ga0070684_101502800 3300005535 Bacteria 635
198 Ga0068853_100104703 3300005539 Bacteria 2505
199 Ga0068853_100107889 3300005539 Bacteria 2469
200 Ga0068853_100233084 3300005539 Bacteria 1685
201 Ga0068853_100413423 3300005539 Unclassified 1264
202 Ga0068853_100476010 3300005539 Unclassified 1177
203 Ga0068853_100521037 3300005539 Bacteria 1124
204 Ga0068853_100713243 3300005539 Bacteria 957
205 Ga0068853_100777143 3300005539 Unclassified 916
206 Ga0068853_100870167 3300005539 Bacteria 865
207 Ga0068853_101195251 3300005539 Bacteria 734
208 Ga0070672_100024315 3300005543 Bacteria 4475
209 Ga0070672_100043706 3300005543 Bacteria 3457
210 Ga0070672_100058329 3300005543 Bacteria 3033
211 Ga0070672_100140671 3300005543 Bacteria 1990
212 Ga0070672_100168509 3300005543 Bacteria 1820
213 Ga0070672_100206540 3300005543 Bacteria 1644
214 Ga0070672_100266877 3300005543 Bacteria 1444
215 Ga0070672_100386054 3300005543 Bacteria 1198
216 Ga0070672_100403174 3300005543 Bacteria 1172
217 Ga0070672_100475521 3300005543 Bacteria 1078
218 Ga0070672_101233852 3300005543 Bacteria 667
219 Ga0070672_101388517 3300005543 Unclassified 628
220 Ga0070686_100018261 3300005544 Bacteria 4112
221 Ga0070686_100456662 3300005544 Bacteria 983
222 Ga0070693_101018167 3300005547 Bacteria 627
223 Ga0070665_100000001 3300005548 Bacteria 1083363
224 Ga0070665_100045444 3300005548 Bacteria 4410
225 Ga0070665_100141768 3300005548 Bacteria 2406
226 Ga0070665_100465756 3300005548 Bacteria 1274
227 Ga0068855_100051562 3300005563 Bacteria 4847
228 Ga0068855_100387372 3300005563 Bacteria 1534
229 Ga0068855_101203178 3300005563 Bacteria 788
230 Ga0068855_102115026 3300005563 Unclassified 567
231 Ga0070664_100084099 3300005564 Bacteria 2746
232 Ga0070664_100138809 3300005564 Bacteria 2139
233 Ga0070664_100298364 3300005564 Bacteria 1456
234 Ga0070664_100601421 3300005564 Bacteria 1020
235 Ga0070664_100966040 3300005564 Bacteria 800
236 Ga0070664_101050047 3300005564 Bacteria 766
237 Ga0070664_101525755 3300005564 Unclassified 632
238 Ga0068857_100040938 3300005577 Bacteria 4107
239 Ga0068857_100081626 3300005577 Bacteria 2887
240 Ga0068857_100119536 3300005577 Bacteria 2372
241 Ga0068857_101626312 3300005577 Bacteria 631
242 Ga0068854_100048602 3300005578 Bacteria 3027
243 Ga0068854_100057516 3300005578 Bacteria 2805
244 Ga0068854_100172563 3300005578 Bacteria 1684
245 Ga0068854_100173312 3300005578 Bacteria 1680
246 Ga0068854_100258297 3300005578 Bacteria 1394
247 Ga0068854_100334396 3300005578 Bacteria 1235
248 Ga0068854_100473774 3300005578 Unclassified 1050
249 Ga0068856_100183027 3300005614 Bacteria 2109
250 Ga0068856_100292741 3300005614 Bacteria 1645
251 Ga0070702_100290266 3300005615 Bacteria 1127
252 Ga0070702_101098828 3300005615 Bacteria 635
253 Ga0068852_100025622 3300005616 Bacteria 4781
254 Ga0068852_100074305 3300005616 Bacteria 2993
255 Ga0068852_100087742 3300005616 Bacteria 2776
256 Ga0068852_100160380 3300005616 Bacteria 2099
257 Ga0068852_100176883 3300005616 Bacteria 2004
258 Ga0068852_100402852 3300005616 Bacteria 1346
259 Ga0068852_100555142 3300005616 Bacteria 1149
260 Ga0068852_100559595 3300005616 Bacteria 1145
261 Ga0068852_100649864 3300005616 Bacteria 1062
262 Ga0068852_101084683 3300005616 Unclassified 821
263 Ga0068852_101555485 3300005616 Bacteria 684
264 Ga0068859_100000037 3300005617 Bacteria 165480
265 Ga0068859_100002491 3300005617 Bacteria 18742
266 Ga0068859_100040242 3300005617 Bacteria 4692
267 Ga0068859_100090094 3300005617 Bacteria 3118
268 Ga0068859_100226291 3300005617 Bacteria 1958
269 Ga0068859_100272899 3300005617 Bacteria 1783
270 Ga0068859_101902345 3300005617 Bacteria 657
271 Ga0068864_100002302 3300005618 Bacteria 15797
272 Ga0068864_100005468 3300005618 Bacteria 10419
273 Ga0068864_100259859 3300005618 Bacteria 1615
274 Ga0068864_102353715 3300005618 Bacteria 539
275 Ga0068866_10069033 3300005718 Bacteria 1860
276 Ga0068866_10226426 3300005718 Bacteria 1131
277 Ga0068861_100006643 3300005719 Bacteria 7895
278 Ga0068861_100051617 3300005719 Bacteria 3122
279 Ga0068861_100121125 3300005719 Bacteria 2111
280 Ga0068861_100205571 3300005719 Bacteria 1656
281 Ga0068851_10026971 3300005834 Bacteria 2828
282 Ga0068851_10072821 3300005834 Bacteria 1781
283 Ga0068851_10115664 3300005834 Bacteria 1437
284 Ga0068851_10208554 3300005834 Bacteria 1093
285 Ga0068851_10424958 3300005834 Unclassified 785
286 Ga0068851_10940785 3300005834 Unclassified 543
287 Ga0068870_10021607 3300005840 Bacteria 3151
288 Ga0068870_10025073 3300005840 Bacteria 2958
289 Ga0068863_100002925 3300005841 Bacteria 16912
290 Ga0068863_100012295 3300005841 Bacteria 8263
291 Ga0068863_100088110 3300005841 Bacteria 2941
292 Ga0068863_100480284 3300005841 Bacteria 1222
293 Ga0068863_100536380 3300005841 Bacteria 1154
294 Ga0068863_100940042 3300005841 Bacteria 866
295 Ga0068863_102051060 3300005841 Unclassified 582
296 Ga0068858_100004320 3300005842 Bacteria 13960
297 Ga0068858_100309206 3300005842 Bacteria 1509
298 Ga0068858_100355242 3300005842 Bacteria 1404
299 Ga0068860_100000097 3300005843 Bacteria 146573
300 Ga0068860_100005547 3300005843 Bacteria 12773
301 Ga0068860_100018429 3300005843 Bacteria 6791
302 Ga0068860_100030843 3300005843 Bacteria 5154
303 Ga0068860_100080452 3300005843 Bacteria 3098
304 Ga0068860_100280934 3300005843 Bacteria 1627
305 Ga0068860_100557473 3300005843 Unclassified 1148
306 Ga0068860_100642466 3300005843 Bacteria 1069
307 Ga0068860_100716166 3300005843 Unclassified 1011
308 Ga0068860_102791755 3300005843 Unclassified 506
309 Ga0068862_100015311 3300005844 Bacteria 6369
310 Ga0068862_100418423 3300005844 Bacteria 1257
311 Ga0068862_100558485 3300005844 Bacteria 1094
312 Ga0068862_100643661 3300005844 Unclassified 1022
313 Ga0068862_101334736 3300005844 Bacteria 719
314 Ga0068862_101652122 3300005844 Bacteria 648
315 Ga0075369_10254845 3300006186 Bacteria 815
316 Ga0075366_10031189 3300006195 Bacteria 3136
317 Ga0075366_10195492 3300006195 Bacteria 1229
318 Ga0075366_10901792 3300006195 Bacteria 551
319 Ga0097621_100031668 3300006237 Bacteria 4198
320 Ga0097621_100096686 3300006237 Bacteria 2478
321 Ga0097621_100522164 3300006237 Bacteria 1078
322 Ga0097621_101210662 3300006237 Bacteria 711
323 Ga0097621_101273636 3300006237 Bacteria 694
324 Ga0097621_101439090 3300006237 Bacteria 653
325 Ga0075370_10048107 3300006353 Bacteria 2416
326 Ga0075370_10236804 3300006353 Bacteria 1081
327 Ga0075370_10302193 3300006353 Bacteria 952
328 Ga0075370_10902394 3300006353 Bacteria 540
329 Ga0068871_100084017 3300006358 Bacteria 2641
330 Ga0068871_100306332 3300006358 Bacteria 1395
331 Ga0068871_100370632 3300006358 Bacteria 1270
332 Ga0068871_100431115 3300006358 Bacteria 1179
333 Ga0068871_100856262 3300006358 Bacteria 840
334 Ga0068871_101093666 3300006358 Bacteria 745
335 Ga0068871_101575444 3300006358 Bacteria 622
336 Ga0068871_101774423 3300006358 Bacteria 586
337 Ga0075428_100140238 3300006844 Bacteria 2628
338 Ga0075428_101738542 3300006844 Bacteria 650
339 Ga0075429_100339821 3300006880 Bacteria 1314
340 Ga0068865_100038915 3300006881 Bacteria 3222
341 Ga0068865_100089701 3300006881 Bacteria 2227
342 Ga0068865_100167631 3300006881 Bacteria 1681
343 Ga0068865_101489453 3300006881 Bacteria 606
344 Ga0097620_100000037 3300006931 Bacteria 165480
345 Ga0097620_100002491 3300006931 Bacteria 18742
346 Ga0097620_100040243 3300006931 Bacteria 4692
347 Ga0097620_100090092 3300006931 Bacteria 3118
348 Ga0097620_100226288 3300006931 Bacteria 1958
349 Ga0097620_100272888 3300006931 Bacteria 1783
350 Ga0097620_101902697 3300006931 Bacteria 657
351 Ga0105251_10238546 3300009011 Bacteria 819
352 Ga0105240_10011002 3300009093 Bacteria 12667
353 Ga0105240_10023972 3300009093 Bacteria 8060
354 Ga0105240_10078219 3300009093 Bacteria 4073
355 Ga0105240_10100052 3300009093 Bacteria 3528
356 Ga0105240_10331805 3300009093 Bacteria 1730
357 Ga0105240_10943101 3300009093 Unclassified 926
358 Ga0105240_11006892 3300009093 Bacteria 891
359 Ga0105240_11357741 3300009093 Bacteria 748
360 Ga0111539_10014550 3300009094 Bacteria 9824
361 Ga0111539_10044551 3300009094 Bacteria 5315
362 Ga0105245_10196069 3300009098 Bacteria 1937
363 Ga0105245_10421275 3300009098 Bacteria 1338
364 Ga0105245_12492681 3300009098 Unclassified 571
365 Ga0105247_10015344 3300009101 Bacteria 4589
366 Ga0114129_10511551 3300009147 Bacteria 1567
367 Ga0105243_13099013 3300009148 Unclassified 503
368 Ga0105241_10007590 3300009174 Bacteria 7975
369 Ga0105241_10014100 3300009174 Bacteria 5856
370 Ga0105241_10037723 3300009174 Bacteria 3640
371 Ga0105241_10265755 3300009174 Bacteria 1459
372 Ga0105241_10629530 3300009174 Bacteria 972
373 Ga0105241_10634974 3300009174 Unclassified 968
374 Ga0105241_10824349 3300009174 Bacteria 856
375 Ga0105241_10849170 3300009174 Bacteria 844
376 Ga0105241_11150865 3300009174 Unclassified 733
377 Ga0105241_11208157 3300009174 Unclassified 716
378 Ga0105241_11829482 3300009174 Bacteria 593
379 Ga0105242_10045717 3300009176 Bacteria 3549
380 Ga0105242_10200555 3300009176 Bacteria 1772
381 Ga0105242_10259499 3300009176 Bacteria 1569
382 Ga0105242_11077188 3300009176 Bacteria 816
383 Ga0105242_11077762 3300009176 Bacteria 816
384 Ga0105248_11592813 3300009177 Bacteria 740
385 Ga0105248_11648581 3300009177 Bacteria 727
386 Ga0105237_10001588 3300009545 Bacteria 29579
387 Ga0105237_10001799 3300009545 Bacteria 27692
388 Ga0105237_10014365 3300009545 Bacteria 8285
389 Ga0105237_10030759 3300009545 Bacteria 5450
390 Ga0105237_10069245 3300009545 Bacteria 3524
391 Ga0105238_10109822 3300009551 Bacteria 2739
392 Ga0105238_10705871 3300009551 Bacteria 1021
393 Ga0105238_11150423 3300009551 Bacteria 800
394 Ga0105238_11180487 3300009551 Bacteria 789
395 Ga0105249_10001080 3300009553 Bacteria 24205
396 Ga0105249_10029956 3300009553 Bacteria 4916
397 Ga0105249_10219506 3300009553 Bacteria 1870
398 Ga0105249_11384925 3300009553 Bacteria 775
399 Ga0105239_10004090 3300010375 Bacteria 17535
400 Ga0105239_10007869 3300010375 Bacteria 12183
401 Ga0105239_10117570 3300010375 Bacteria 2951
402 Ga0105239_10198084 3300010375 Bacteria 2250
403 Ga0105239_10240840 3300010375 Bacteria 2030
404 Ga0105239_10505456 3300010375 Bacteria 1374
405 Ga0105239_10628709 3300010375 Bacteria 1225
406 Ga0105239_10654488 3300010375 Bacteria 1200
407 Ga0105239_10859738 3300010375 Bacteria 1040
408 Ga0105239_11804309 3300010375 Bacteria 709
409 Ga0105239_13621801 3300010375 Bacteria 502
410 Ga0105246_10021096 3300011119 Bacteria 4187
411 Ga0105246_10809389 3300011119 Bacteria 832
412 Ga0157373_10025943 3300013100 Bacteria 4235
413 Ga0157373_10459052 3300013100 Unclassified 917
414 Ga0157373_10764455 3300013100 Bacteria 711
415 Ga0157373_10914537 3300013100 Unclassified 651
416 Ga0157373_11174526 3300013100 Bacteria 578
417 Ga0157371_10023444 3300013102 Bacteria 4513
418 Ga0157371_10024281 3300013102 Bacteria 4429
419 Ga0157371_10054786 3300013102 Bacteria 2831
420 Ga0157371_10054932 3300013102 Bacteria 2827
421 Ga0157371_10054961 3300013102 Bacteria 2826
422 Ga0157371_10212534 3300013102 Bacteria 1388
423 Ga0157371_10389929 3300013102 Bacteria 1018
424 Ga0157371_10401077 3300013102 Bacteria 1003
425 Ga0157371_10633119 3300013102 Bacteria 797
426 Ga0157371_10963758 3300013102 Bacteria 649
427 Ga0157370_10286166 3300013104 Bacteria 1523
428 Ga0157370_10553855 3300013104 Bacteria 1054
429 Ga0157370_10623454 3300013104 Bacteria 987
430 Ga0157370_10816236 3300013104 Unclassified 848
431 Ga0157370_11235191 3300013104 Bacteria 674
432 Ga0157369_10012941 3300013105 Bacteria 9454
433 Ga0157369_10068990 3300013105 Bacteria 3798
434 Ga0157369_10083535 3300013105 Bacteria 3415
435 Ga0157369_10115086 3300013105 Bacteria 2856
436 Ga0157369_10424209 3300013105 Bacteria 1379
437 Ga0157369_10475273 3300013105 Bacteria 1293
438 Ga0157369_10527443 3300013105 Bacteria 1221
439 Ga0157369_12467560 3300013105 Bacteria 526
440 Ga0157374_10000500 3300013296 Bacteria 35513
441 Ga0157374_10008968 3300013296 Bacteria 8573
442 Ga0157374_10121013 3300013296 Bacteria 2526
443 Ga0157374_10126640 3300013296 Bacteria 2469
444 Ga0157374_10229288 3300013296 Bacteria 1824
445 Ga0157374_10270813 3300013296 Bacteria 1674
446 Ga0157374_10498328 3300013296 Bacteria 1222
447 Ga0157374_10535708 3300013296 Bacteria 1178
448 Ga0157374_10706878 3300013296 Unclassified 1021
449 Ga0157378_10021595 3300013297 Bacteria 5661
450 Ga0157378_10076791 3300013297 Bacteria 3010
451 Ga0157378_10131585 3300013297 Bacteria 2316
452 Ga0157378_10246272 3300013297 Bacteria 1710
453 Ga0157378_10526853 3300013297 Bacteria 1184
454 Ga0157378_10593805 3300013297 Unclassified 1118
455 Ga0157378_10813603 3300013297 Bacteria 961
456 Ga0157378_11010441 3300013297 Bacteria 866
457 Ga0157378_11185144 3300013297 Bacteria 803
458 Ga0157378_12484823 3300013297 Bacteria 570
459 Ga0163162_10001189 3300013306 Bacteria 24282
460 Ga0163162_10001595 3300013306 Bacteria 21212
461 Ga0163162_10001867 3300013306 Bacteria 19821
462 Ga0163162_10025579 3300013306 Bacteria 5834
463 Ga0163162_10115627 3300013306 Bacteria 2783
464 Ga0163162_10163494 3300013306 Bacteria 2349
465 Ga0163162_10486635 3300013306 Bacteria 1365
466 Ga0163162_10806314 3300013306 Bacteria 1056
467 Ga0157372_10016323 3300013307 Bacteria 7968
468 Ga0157372_10024284 3300013307 Bacteria 6581
469 Ga0157372_10029769 3300013307 Bacteria 5966
470 Ga0157372_10038201 3300013307 Bacteria 5298
471 Ga0157372_10179557 3300013307 Bacteria 2450
472 Ga0157372_10209283 3300013307 Bacteria 2260
473 Ga0157372_10239188 3300013307 Bacteria 2106
474 Ga0157372_10247490 3300013307 Bacteria 2069
475 Ga0157372_10348328 3300013307 Bacteria 1726
476 Ga0157372_10535402 3300013307 Bacteria 1365
477 Ga0157372_10590069 3300013307 Bacteria 1295
478 Ga0157372_10623253 3300013307 Bacteria 1257
479 Ga0157372_10773148 3300013307 Bacteria 1116
480 Ga0157372_10918512 3300013307 Bacteria 1015
481 Ga0157372_10981587 3300013307 Unclassified 979
482 Ga0157372_11013100 3300013307 Bacteria 962
483 Ga0157372_11410151 3300013307 Bacteria 803
484 Ga0157372_11665603 3300013307 Bacteria 734
485 Ga0157372_11682365 3300013307 Bacteria 730
486 Ga0157372_11982074 3300013307 Bacteria 669
487 Ga0157372_12006511 3300013307 Bacteria 665
488 Ga0157372_12144737 3300013307 Bacteria 642
489 Ga0157375_10012841 3300013308 Bacteria 7438
490 Ga0157375_10082979 3300013308 Bacteria 3249
491 Ga0157375_10090738 3300013308 Bacteria 3115
492 Ga0157375_10094808 3300013308 Bacteria 3054
493 Ga0157375_10095074 3300013308 Bacteria 3050
494 Ga0157375_10153729 3300013308 Bacteria 2438
495 Ga0157375_10208620 3300013308 Bacteria 2110
496 Ga0157375_10226178 3300013308 Bacteria 2030
497 Ga0157375_10376285 3300013308 Bacteria 1587
498 Ga0157375_11255101 3300013308 Bacteria 870
499 Ga0157375_12084896 3300013308 Bacteria 675
500 Ga0163163_10001501 3300014325 Bacteria 19759
501 Ga0163163_10054019 3300014325 Bacteria 3967
502 Ga0163163_10208087 3300014325 Bacteria 2005
503 Ga0163163_10651108 3300014325 Bacteria 1117
504 Ga0163163_11009946 3300014325 Bacteria 895
505 Ga0163163_12430047 3300014325 Bacteria 582
506 Ga0163163_12536167 3300014325 Bacteria 570
507 Ga0157380_10011122 3300014326 Bacteria 6492
508 Ga0157380_10030118 3300014326 Bacteria 4154
509 Ga0157380_10113108 3300014326 Bacteria 2285
510 Ga0157380_10361775 3300014326 Bacteria 1362
511 Ga0157380_12735341 3300014326 Bacteria 560
512 Ga0157380_13437220 3300014326 Unclassified 507
513 Ga0182008_10349774 3300014497 Bacteria 783
514 Ga0157377_10004500 3300014745 Bacteria 6429
515 Ga0157377_10021210 3300014745 Bacteria 3415
516 Ga0157377_10069334 3300014745 Bacteria 2034
517 Ga0157377_10354555 3300014745 Bacteria 985
518 Ga0157377_10579621 3300014745 Unclassified 797
519 Ga0157377_11002115 3300014745 Bacteria 633
520 Ga0157379_10008284 3300014968 Bacteria 9034
521 Ga0157379_10036538 3300014968 Bacteria 4379
522 Ga0157379_10090931 3300014968 Bacteria 2738
523 Ga0157379_10128099 3300014968 Bacteria 2284
524 Ga0157379_10978871 3300014968 Bacteria 806
525 Ga0157376_10013181 3300014969 Bacteria 6160
526 Ga0157376_10232761 3300014969 Bacteria 1712
527 Ga0157376_10438390 3300014969 Bacteria 1271
528 Ga0157376_10858745 3300014969 Bacteria 923
529 Ga0157376_10876601 3300014969 Bacteria 914
530 Ga0157376_11134319 3300014969 Bacteria 808
531 Ga0157376_11584127 3300014969 Bacteria 689
532 Ga0157376_11595799 3300014969 Bacteria 687
533 Ga0157376_12191847 3300014969 Bacteria 591
534 Ga0163161_10013936 3300017792 Bacteria 5599
535 Ga0163161_10076648 3300017792 Bacteria 2454
536 Ga0163161_10185939 3300017792 Bacteria 1595
537 Ga0163161_10191737 3300017792 Bacteria 1572
538 Ga0163161_10201044 3300017792 Bacteria 1535
539 Ga0163161_10574204 3300017792 Bacteria 927
540 Ga0163161_10740107 3300017792 Bacteria 822
541 Ga0206356_11668122 3300020070 Bacteria 643
542 Ga0213876_10007626 3300021384 Bacteria 5875
543 Ga0207426_1000105 3300025302 Bacteria 247269
544 Ga0207697_10008960 3300025315 Bacteria 4344
545 Ga0207697_10045796 3300025315 Bacteria 1801
546 Ga0207697_10258504 3300025315 Bacteria 771
547 Ga0207697_10407196 3300025315 Bacteria 604
548 Ga0207656_10072874 3300025321 Bacteria 1530
549 Ga0207656_10107139 3300025321 Bacteria 1287
550 Ga0207682_10012690 3300025893 Bacteria 3285
551 Ga0207682_10043617 3300025893 Bacteria 1836
552 Ga0207682_10103216 3300025893 Bacteria 1248
553 Ga0207682_10415225 3300025893 Bacteria 636
554 Ga0207642_10049589 3300025899 Bacteria 1888
555 Ga0207642_10101549 3300025899 Bacteria 1445
556 Ga0207642_10308757 3300025899 Bacteria 920
557 Ga0207688_10010099 3300025901 Bacteria 5135
558 Ga0207688_10237702 3300025901 Bacteria 1101
559 Ga0207680_10000051 3300025903 Bacteria 56289
560 Ga0207680_10045258 3300025903 Bacteria 2593
561 Ga0207680_10208839 3300025903 Bacteria 1334
562 Ga0207680_10337949 3300025903 Unclassified 1056
563 Ga0207680_10959422 3300025903 Bacteria 613
564 Ga0207647_10000110 3300025904 Bacteria 62980
565 Ga0207647_10025805 3300025904 Bacteria 3853
566 Ga0207647_10076676 3300025904 Bacteria 2010
567 Ga0207647_10116637 3300025904 Bacteria 1576
568 Ga0207647_10636369 3300025904 Bacteria 586
569 Ga0207645_10002136 3300025907 Bacteria 15798
570 Ga0207645_10044737 3300025907 Bacteria 2832
571 Ga0207645_10072859 3300025907 Bacteria 2199
572 Ga0207645_10093484 3300025907 Bacteria 1935
573 Ga0207645_10163618 3300025907 Bacteria 1456
574 Ga0207643_10001724 3300025908 Bacteria 12262
575 Ga0207643_10006929 3300025908 Bacteria 6076
576 Ga0207705_10014024 3300025909 Bacteria 5776
577 Ga0207705_10081358 3300025909 Bacteria 2361
578 Ga0207705_10088880 3300025909 Bacteria 2260
579 Ga0207705_10176266 3300025909 Bacteria 1612
580 Ga0207705_10732549 3300025909 Unclassified 768
581 Ga0207705_10992843 3300025909 Bacteria 649
582 Ga0207705_11442265 3300025909 Bacteria 522
583 Ga0207654_10000881 3300025911 Bacteria 16661
584 Ga0207654_10002705 3300025911 Bacteria 8996
585 Ga0207654_10080916 3300025911 Bacteria 1955
586 Ga0207654_10382689 3300025911 Bacteria 975
587 Ga0207654_10532596 3300025911 Unclassified 833
588 Ga0207654_10633681 3300025911 Bacteria 765
589 Ga0207654_11366915 3300025911 Unclassified 516
590 Ga0207654_11446234 3300025911 Unclassified 501
591 Ga0207707_10344888 3300025912 Bacteria 1284
592 Ga0207707_10642352 3300025912 Unclassified 895
593 Ga0207695_10000084 3300025913 Bacteria 282392
594 Ga0207695_10004647 3300025913 Bacteria 18602
595 Ga0207695_10026373 3300025913 Bacteria 6486
596 Ga0207695_10079990 3300025913 Bacteria 3311
597 Ga0207695_10105078 3300025913 Bacteria 2812
598 Ga0207671_10003750 3300025914 Bacteria 14958
599 Ga0207671_10004543 3300025914 Bacteria 13186
600 Ga0207671_10007320 3300025914 Bacteria 9585
601 Ga0207671_10032778 3300025914 Bacteria 3865
602 Ga0207671_10355358 3300025914 Bacteria 1162
603 Ga0207662_10047459 3300025918 Bacteria 2543
604 Ga0207662_10061472 3300025918 Bacteria 2255
605 Ga0207662_10092496 3300025918 Bacteria 1862
606 Ga0207662_10996307 3300025918 Bacteria 595
607 Ga0207662_11105997 3300025918 Bacteria 563
608 Ga0207657_10062662 3300025919 Bacteria 3183
609 Ga0207657_10158704 3300025919 Bacteria 1838
610 Ga0207657_10684543 3300025919 Bacteria 797
611 Ga0207657_10787714 3300025919 Bacteria 735
612 Ga0207649_10005479 3300025920 Bacteria 6870
613 Ga0207649_10588025 3300025920 Unclassified 855
614 Ga0207652_10002830 3300025921 Bacteria 14557
615 Ga0207652_10388671 3300025921 Bacteria 1259
616 Ga0207681_10015241 3300025923 Bacteria 4793
617 Ga0207681_10817614 3300025923 Bacteria 779
618 Ga0207681_11644446 3300025923 Unclassified 537
619 Ga0207694_10017481 3300025924 Bacteria 5419
620 Ga0207694_10069133 3300025924 Bacteria 2759
621 Ga0207694_10874935 3300025924 Unclassified 760
622 Ga0207650_10014881 3300025925 Bacteria 5413
623 Ga0207650_10066694 3300025925 Bacteria 2699
624 Ga0207650_10074981 3300025925 Bacteria 2552
625 Ga0207650_10093786 3300025925 Bacteria 2298
626 Ga0207650_10167486 3300025925 Bacteria 1744
627 Ga0207650_10180530 3300025925 Bacteria 1682
628 Ga0207650_10199627 3300025925 Bacteria 1601
629 Ga0207650_10254342 3300025925 Bacteria 1423
630 Ga0207650_10499989 3300025925 Bacteria 1016
631 Ga0207659_10009764 3300025926 Bacteria 6003
632 Ga0207659_10033056 3300025926 Bacteria 3556
633 Ga0207659_10101095 3300025926 Bacteria 2174
634 Ga0207659_10183973 3300025926 Bacteria 1658
635 Ga0207659_10192518 3300025926 Bacteria 1624
636 Ga0207659_10369284 3300025926 Bacteria 1194
637 Ga0207687_10309374 3300025927 Bacteria 1275
638 Ga0207687_11221390 3300025927 Bacteria 646
639 Ga0207644_10012415 3300025931 Bacteria 5658
640 Ga0207644_10021869 3300025931 Bacteria 4361
641 Ga0207644_10024620 3300025931 Bacteria 4134
642 Ga0207644_10076596 3300025931 Bacteria 2461
643 Ga0207644_10912262 3300025931 Bacteria 736
644 Ga0207644_11457609 3300025931 Bacteria 575
645 Ga0207644_11578564 3300025931 Unclassified 550
646 Ga0207690_10035193 3300025932 Bacteria 3233
647 Ga0207690_10633736 3300025932 Bacteria 875
648 Ga0207690_11388566 3300025932 Bacteria 587
649 Ga0207706_10009371 3300025933 Bacteria 8991
650 Ga0207706_10037951 3300025933 Bacteria 4275
651 Ga0207706_10068145 3300025933 Bacteria 3131
652 Ga0207706_10707786 3300025933 Bacteria 860
653 Ga0207686_10149241 3300025934 Bacteria 1625
654 Ga0207670_10154313 3300025936 Bacteria 1707
655 Ga0207670_10196787 3300025936 Bacteria 1529
656 Ga0207670_10760665 3300025936 Bacteria 805
657 Ga0207669_10037398 3300025937 Bacteria 2784
658 Ga0207669_10409607 3300025937 Bacteria 1064
659 Ga0207669_10510496 3300025937 Bacteria 963
660 Ga0207704_10022175 3300025938 Bacteria 3397
661 Ga0207704_10039066 3300025938 Bacteria 2759
662 Ga0207691_10019043 3300025940 Bacteria 6500
663 Ga0207691_10027644 3300025940 Bacteria 5317
664 Ga0207691_10063549 3300025940 Bacteria 3348
665 Ga0207691_10075279 3300025940 Bacteria 3044
666 Ga0207691_10099184 3300025940 Bacteria 2601
667 Ga0207691_10115614 3300025940 Bacteria 2382
668 Ga0207691_10176679 3300025940 Bacteria 1867
669 Ga0207691_10497887 3300025940 Bacteria 1035
670 Ga0207689_10005396 3300025942 Bacteria 11441
671 Ga0207689_10018050 3300025942 Bacteria 5958
672 Ga0207689_10101705 3300025942 Bacteria 2361
673 Ga0207661_10009193 3300025944 Bacteria 7083
674 Ga0207661_10178861 3300025944 Bacteria 1851
675 Ga0207679_10000875 3300025945 Bacteria 19210
676 Ga0207679_10086487 3300025945 Bacteria 2412
677 Ga0207679_10128128 3300025945 Bacteria 2032
678 Ga0207679_10226523 3300025945 Bacteria 1576
679 Ga0207679_10340064 3300025945 Bacteria 1305
680 Ga0207679_10640885 3300025945 Bacteria 960
681 Ga0207679_10651771 3300025945 Bacteria 952
682 Ga0207679_11499122 3300025945 Bacteria 618
683 Ga0207679_11916378 3300025945 Bacteria 540
684 Ga0207667_10073069 3300025949 Bacteria 3564
685 Ga0207667_10181502 3300025949 Bacteria 2161
686 Ga0207667_10329536 3300025949 Bacteria 1559
687 Ga0207667_10387114 3300025949 Bacteria 1424
688 Ga0207667_11069064 3300025949 Bacteria 791
689 Ga0207667_12029358 3300025949 Bacteria 535
690 Ga0207651_10053397 3300025960 Bacteria 2762
691 Ga0207651_10078265 3300025960 Bacteria 2371
692 Ga0207651_10087831 3300025960 Bacteria 2264
693 Ga0207651_10119509 3300025960 Bacteria 1996
694 Ga0207651_10181194 3300025960 Bacteria 1671
695 Ga0207651_10196091 3300025960 Bacteria 1614
696 Ga0207651_10212458 3300025960 Bacteria 1558
697 Ga0207651_10264420 3300025960 Bacteria 1414
698 Ga0207651_10975561 3300025960 Bacteria 757
699 Ga0207651_11102178 3300025960 Bacteria 712
700 Ga0207712_10014683 3300025961 Bacteria 5044
701 Ga0207712_10235773 3300025961 Bacteria 1471
702 Ga0207712_10269554 3300025961 Bacteria 1384
703 Ga0207668_10015084 3300025972 Bacteria 4796
704 Ga0207668_10067188 3300025972 Bacteria 2544
705 Ga0207668_10074644 3300025972 Bacteria 2435
706 Ga0207668_10210505 3300025972 Bacteria 1555
707 Ga0207640_10087024 3300025981 Bacteria 2153
708 Ga0207640_10280232 3300025981 Bacteria 1309
709 Ga0207640_10540948 3300025981 Bacteria 977
710 Ga0207658_10009886 3300025986 Bacteria 6482
711 Ga0207658_10012999 3300025986 Bacteria 5685
712 Ga0207658_10138678 3300025986 Bacteria 1965
713 Ga0207658_10218425 3300025986 Bacteria 1602
714 Ga0207658_10252741 3300025986 Bacteria 1498
715 Ga0207658_10253710 3300025986 Bacteria 1496
716 Ga0207658_10395815 3300025986 Bacteria 1213
717 Ga0207658_10886158 3300025986 Bacteria 812
718 Ga0207658_11423836 3300025986 Bacteria 634
719 Ga0207677_10001082 3300026023 Bacteria 14834
720 Ga0207677_10102638 3300026023 Bacteria 2109
721 Ga0207677_10192183 3300026023 Bacteria 1615
722 Ga0207677_10266804 3300026023 Bacteria 1398
723 Ga0207677_11411684 3300026023 Unclassified 641
724 Ga0207677_11605611 3300026023 Unclassified 602
725 Ga0207703_10012945 3300026035 Bacteria 6502
726 Ga0207703_10548827 3300026035 Bacteria 1089
727 Ga0207639_10036559 3300026041 Bacteria 3640
728 Ga0207639_10060496 3300026041 Bacteria 2922
729 Ga0207639_10061028 3300026041 Bacteria 2910
730 Ga0207639_10138059 3300026041 Bacteria 2028
731 Ga0207639_10338476 3300026041 Bacteria 1341
732 Ga0207639_10524516 3300026041 Bacteria 1085
733 Ga0207639_11093980 3300026041 Bacteria 747
734 Ga0207639_11240194 3300026041 Bacteria 700
735 Ga0207639_11416025 3300026041 Bacteria 652
736 Ga0207639_11747550 3300026041 Bacteria 582
737 Ga0207678_10172372 3300026067 Bacteria 1847
738 Ga0207678_10240347 3300026067 Bacteria 1551
739 Ga0207678_10275303 3300026067 Bacteria 1444
740 Ga0207708_10058905 3300026075 Bacteria 2931
741 Ga0207702_10056726 3300026078 Bacteria 3326
742 Ga0207702_10078102 3300026078 Bacteria 2865
743 Ga0207702_10744068 3300026078 Bacteria 968
744 Ga0207641_10000121 3300026088 Bacteria 114943
745 Ga0207641_10019787 3300026088 Bacteria 5526
746 Ga0207641_10511744 3300026088 Bacteria 1167
747 Ga0207641_10631488 3300026088 Bacteria 1051
748 Ga0207641_10752574 3300026088 Bacteria 962
749 Ga0207648_10014701 3300026089 Bacteria 7223
750 Ga0207648_10014934 3300026089 Bacteria 7157
751 Ga0207648_10027181 3300026089 Bacteria 5081
752 Ga0207648_10120379 3300026089 Bacteria 2308
753 Ga0207648_10218763 3300026089 Bacteria 1692
754 Ga0207648_10303123 3300026089 Bacteria 1433
755 Ga0207648_10323886 3300026089 Unclassified 1385
756 Ga0207648_10731575 3300026089 Bacteria 918
757 Ga0207648_10882974 3300026089 Bacteria 835
758 Ga0207648_11601524 3300026089 Bacteria 612
759 Ga0207676_10003342 3300026095 Bacteria 11375
760 Ga0207676_10015259 3300026095 Bacteria 5540
761 Ga0207676_10183279 3300026095 Bacteria 1835
762 Ga0207676_10624550 3300026095 Bacteria 1037
763 Ga0207676_10632657 3300026095 Bacteria 1031
764 Ga0207676_10656245 3300026095 Bacteria 1013
765 Ga0207674_10070646 3300026116 Bacteria 3510
766 Ga0207674_10094215 3300026116 Bacteria 2981
767 Ga0207674_10164835 3300026116 Bacteria 2170
768 Ga0207674_11436132 3300026116 Bacteria 659
769 Ga0207675_100002059 3300026118 Bacteria 20054
770 Ga0207675_100041609 3300026118 Bacteria 4291
771 Ga0207675_100372847 3300026118 Bacteria 1402
772 Ga0207675_100461349 3300026118 Bacteria 1260
773 Ga0207675_100672746 3300026118 Bacteria 1042
774 Ga0207675_100696468 3300026118 Bacteria 1024
775 Ga0207675_101570973 3300026118 Unclassified 678
776 Ga0207675_102509488 3300026118 Bacteria 526
777 Ga0207675_102534378 3300026118 Bacteria 523
778 Ga0207683_10006890 3300026121 Bacteria 9730
779 Ga0207683_10016244 3300026121 Bacteria 6334
780 Ga0207683_10061446 3300026121 Bacteria 3307
781 Ga0207683_10202465 3300026121 Bacteria 1805
782 Ga0207683_10922637 3300026121 Bacteria 811
783 Ga0207683_11016448 3300026121 Bacteria 769
784 Ga0207683_11152402 3300026121 Bacteria 719
785 Ga0207683_11219598 3300026121 Bacteria 697
786 Ga0207698_10001488 3300026142 Bacteria 13640
787 Ga0207698_10016613 3300026142 Bacteria 4968
788 Ga0207698_10245179 3300026142 Bacteria 1636
789 Ga0207698_10254695 3300026142 Bacteria 1609
790 Ga0207698_10408119 3300026142 Bacteria 1300
791 Ga0207698_10641268 3300026142 Bacteria 1051
792 Ga0207698_10754067 3300026142 Bacteria 972
793 Ga0207698_10859423 3300026142 Bacteria 913
794 Ga0207698_10919830 3300026142 Unclassified 882
795 Ga0207698_12102851 3300026142 Bacteria 578
796 Ga0209996_1077834 3300027395 Bacteria 519
797 Ga0209974_10257701 3300027876 Bacteria 658
798 Ga0207428_10111837 3300027907 Bacteria 2101
799 Ga0207428_10136352 3300027907 Bacteria 1876
800 Ga0268266_10000038 3300028379 Bacteria 325729
801 Ga0268266_10015422 3300028379 Bacteria 6557
802 Ga0268266_10143576 3300028379 Bacteria 2144
803 Ga0268266_10362709 3300028379 Bacteria 1364
804 Ga0268265_10003503 3300028380 Bacteria 11231
805 Ga0268265_10547433 3300028380 Bacteria 1098
806 Ga0268265_11193270 3300028380 Bacteria 758
807 Ga0268265_11806138 3300028380 Bacteria 618
808 Ga0268264_10000167 3300028381 Bacteria 146190
809 Ga0268264_10004870 3300028381 Bacteria 11377
810 Ga0268264_10012086 3300028381 Bacteria 7108
811 Ga0268264_10017339 3300028381 Bacteria 5900
812 Ga0268264_10128293 3300028381 Bacteria 2245
813 Ga0268264_10182798 3300028381 Bacteria 1905
814 Ga0268264_10251911 3300028381 Bacteria 1641
815 Ga0268264_11678735 3300028381 Bacteria 646
816 Ga0307517_10018578 3300028786 Bacteria 8983
817 Ga0307517_10269373 3300028786 Bacteria 981
818 Ga0307517_10306514 3300028786 Bacteria 887
819 Ga0307515_10000469 3300028794 Bacteria 96345
820 Ga0307511_10004717 3300030521 Bacteria 13935
821 Ga0307511_10396782 3300030521 Unclassified 569
822 Ga0307512_10268947 3300030522 Bacteria 828
823 Ga0265327_10000159 3300031251 Bacteria 145537
824 Ga0307513_10103928 3300031456 Bacteria 2856
825 Ga0307509_10079849 3300031507 Bacteria 3385
826 Ga0307509_10113539 3300031507 Bacteria 2706
827 Ga0307509_10344145 3300031507 Bacteria 1217
828 Ga0307509_10407521 3300031507 Bacteria 1064
829 Ga0307408_100426226 3300031548 Bacteria 1145
830 Ga0265313_10067180 3300031595 Bacteria 1660
831 Ga0307508_10002518 3300031616 Bacteria 19301
832 Ga0307508_10529516 3300031616 Bacteria 775
833 Ga0307516_10004268 3300031730 Bacteria 17759
834 Ga0307405_10655250 3300031731 Bacteria 864
835 Ga0307413_10022806 3300031824 Bacteria 3382
836 Ga0307413_10530901 3300031824 Unclassified 951
837 Ga0307410_10035292 3300031852 Bacteria 3246
838 Ga0307410_11164698 3300031852 Bacteria 670
839 Ga0307406_10106862 3300031901 Bacteria 1918
840 Ga0307406_11355197 3300031901 Bacteria 622
841 Ga0307407_10083520 3300031903 Bacteria 1938
842 Ga0307412_10519431 3300031911 Bacteria 995
843 Ga0307409_101269840 3300031995 Unclassified 761
844 Ga0307416_100069247 3300032002 Bacteria 2919
845 Ga0307416_100974098 3300032002 Bacteria 951
846 Ga0307416_102077190 3300032002 Bacteria 670
847 Ga0307414_10105037 3300032004 Bacteria 2135
848 Ga0307414_10215472 3300032004 Bacteria 1573
849 Ga0307414_10476789 3300032004 Bacteria 1100
850 Ga0307414_10485765 3300032004 Bacteria 1090
851 Ga0307414_10726189 3300032004 Unclassified 901
852 Ga0307414_10794241 3300032004 Unclassified 863
853 Ga0307411_11684469 3300032005 Bacteria 587
854 Ga0307415_100025311 3300032126 Bacteria 3721
855 Ga0307415_102332102 3300032126 Bacteria 525
856 Ga0307507_10338473 3300033179 Bacteria 893
857 Ga0373938_0094755 3300034957 Bacteria 743
858 Ga0373962_0367198 3300035242 Bacteria 523
859 Ga0265778_057272 3300036457 Bacteria 541
860 Ga0395899_0702648 3300037312 Bacteria 634
861 Ga0395900_0216632 3300037418 Bacteria 1932
862 Ga0395900_1100609 3300037418 Bacteria 712
863 Ga0395905_0002823 3300037471 Bacteria 19037
864 Ga0395901_0560399 3300038443 Bacteria 1157
865 Ga0436365_0472587 3300039437 Bacteria 3578
866 Ga0436365_0781227 3300039437 Bacteria 11182
867 Ga0436363_0734173 3300039450 Bacteria 3029
868 Ga0436363_1110235 3300039450 Bacteria 859
869 Ga0439436_0042221 3300041404 Bacteria 1304
870 Ga0439439_0161566 3300041406 Bacteria 639
871 Ga0439461_0043177 3300041410 Bacteria 980
872 Ga0451787_080681 3300041441 Bacteria 815
873 Ga0451789_0191907 3300041443 Bacteria 675
874 Ga0451794_28172 3300041446 Unclassified 539
875 Ga0451797_0542401 3300041453 Bacteria 639
876 Ga0451802_0148319 3300041460 Bacteria 607
877 Ga0451804_0798737 3300041463 Bacteria 660
878 Ga0451807_2671209 3300041486 Bacteria 659
879 Ga0451839_1552964 3300041496 Unclassified 566
880 Ga0451847_0938223 3300041503 Bacteria 649
881 Ga0451843_0386673 3300041509 Bacteria 682
882 Ga0451853_0260808 3300041512 Bacteria 722
883 Ga0451853_0354634 3300041512 Bacteria 673
884 Ga0451853_2173213 3300041512 Unclassified 603
885 Ga0451853_2350954 3300041512 Bacteria 658
886 Ga0439449_0017442 3300042007 Bacteria 2696
887 Ga0439457_008270 3300042014 Bacteria 2459
888 Ga0439446_0018535 3300042156 Bacteria 1951
889 Ga0439434_0017713 3300042435 Bacteria 2133
890 Ga0439434_0048470 3300042435 Bacteria 1314
891 Ga0439435_0267835 3300042436 Bacteria 579
892 Ga0451577_0035014 3300042876 Bacteria 4524
893 Ga0466972_0000025 3300044658 Bacteria 186601
894 Ga0466972_0021513 3300044658 Bacteria 3214
895 Ga0466972_0134269 3300044658 Bacteria 1165
896 Ga0466972_0360729 3300044658 Bacteria 680
897 Ga0466965_0187557 3300044683 Bacteria 1093
898 Ga0453684_0003639 3300044712 Bacteria 34251
899 Ga0453684_0046321 3300044712 Bacteria 5784
900 Ga0453684_0755575 3300044712 Bacteria 1052
901 Ga0453684_2573165 3300044712 Bacteria 501
902 Ga0466968_0052503 3300044735 Bacteria 1744
903 Ga0466968_0095953 3300044735 Bacteria 1320
904 Ga0466970_0000933 3300044765 Bacteria 14121
905 Ga0466957_0131367 3300044842 Bacteria 1605
906 Ga0466960_0228251 3300044901 Bacteria 1027
907 Ga0466959_0017683 3300045049 Bacteria 5229
908 Ga0466959_0442562 3300045049 Bacteria 881
909 Ga0466959_0901945 3300045049 Unclassified 590
910 Ga0451576_0110481 3300045051 Bacteria 2861
911 Ga0495629_0815944 3300046459 Bacteria 615
912 Ga0495638_0083984 3300046460 Bacteria 1928
913 Ga0495648_0012032 3300046524 Bacteria 6482
914 Ga0495648_0342523 3300046524 Bacteria 686
915 Ga0495652_0255633 3300046529 Bacteria 1296
916 Ga0495640_0695428 3300046533 Bacteria 610
917 Ga0495611_0130135 3300046648 Bacteria 1174
918 Ga0495625_0132206 3300046660 Bacteria 1690
919 Ga0495625_0273493 3300046660 Bacteria 1089
920 Ga0495649_0091156 3300046694 Bacteria 1625
921 Ga0495649_0581841 3300046694 Bacteria 553
922 Ga0495672_0011267 3300047320 Bacteria 6319
923 Ga0495687_000001 3300047443 Bacteria 1215582
924 Ga0495686_0000004 3300047472 Bacteria 869019
925 Ga0495686_0121135 3300047472 Bacteria 1559
926 Ga0496104_1101758 3300048907 Bacteria 698
927 Ga0496105_1064456 3300048908 Bacteria 602
928 Ga0496108_0158364 3300048911 Bacteria 1956
929 Ga0496108_1780694 3300048911 Bacteria 505
930 Ga0496110_0131071 3300048913 Bacteria 2264
931 Ga0496110_0901907 3300048913 Bacteria 790
932 Ga0496111_0265301 3300048914 Bacteria 1274
933 Ga0501306_005254 3300049127 Bacteria 1478
934 Ga0501306_007098 3300049127 Bacteria 1332
935 Ga0501306_011995 3300049127 Bacteria 1112
936 Ga0501306_015031 3300049127 Unclassified 1027
937 Ga0501306_036894 3300049127 Bacteria 746
938 Ga0501308_000724 3300049128 Bacteria 2316
939 Ga0501308_002471 3300049128 Bacteria 1624
940 Ga0501308_003669 3300049128 Bacteria 1436
941 Ga0501308_025384 3300049128 Bacteria 767
942 Ga0501308_030669 3300049128 Bacteria 720
943 Ga0501309_004409 3300049129 Bacteria 1640
944 Ga0501309_006097 3300049129 Bacteria 1459
945 Ga0501309_029601 3300049129 Bacteria 803
946 Ga0501310_008402 3300049130 Bacteria 1120
947 Ga0501310_017992 3300049130 Bacteria 860
948 Ga0501310_020532 3300049130 Bacteria 821
949 Ga0501310_072876 3300049130 Unclassified 528
950 Ga0501341_03273 3300049131 Bacteria 911
951 Ga0501343_004442 3300049132 Bacteria 1054
952 Ga0501343_008419 3300049132 Bacteria 824
953 Ga0501344_07553 3300049133 Bacteria 639
954 Ga0501304_002005 3300049160 Bacteria 1376
955 Ga0501304_006956 3300049160 Unclassified 923
956 Ga0501305_000918 3300049161 Bacteria 2668
957 Ga0501305_003905 3300049161 Bacteria 1720
958 Ga0501305_014229 3300049161 Unclassified 1111
959 Ga0501305_021427 3300049161 Bacteria 955
960 Ga0501305_038014 3300049161 Bacteria 774
961 Ga0501307_001810 3300049162 Bacteria 1893
962 Ga0501307_006326 3300049162 Bacteria 1275
963 Ga0501307_020375 3300049162 Bacteria 857
964 Ga0501307_036545 3300049162 Bacteria 700
965 Ga0501307_071145 3300049162 Unclassified 555
966 Ga0501297_075382 3300049520 Bacteria 539
967 Ga0501311_002005 3300049527 Bacteria 1884
968 Ga0501311_009005 3300049527 Bacteria 1184
969 Ga0501311_017129 3300049527 Bacteria 951
970 Ga0501311_021215 3300049527 Bacteria 884
971 Ga0501312_003742 3300049528 Bacteria 1751
972 Ga0501312_003877 3300049528 Bacteria 1731
973 Ga0501312_009338 3300049528 Bacteria 1291
974 Ga0501312_021281 3300049528 Bacteria 965
975 Ga0501313_000530 3300049529 Bacteria 2669
976 Ga0501313_004747 3300049529 Bacteria 1409
977 Ga0501313_009702 3300049529 Bacteria 1087
978 Ga0501313_024321 3300049529 Bacteria 762
979 Ga0501314_019095 3300049530 Bacteria 702
980 Ga0501315_004451 3300049531 Bacteria 1466
981 Ga0501315_007467 3300049531 Bacteria 1247
982 Ga0501315_008378 3300049531 Bacteria 1201
983 Ga0501315_011678 3300049531 Bacteria 1076
984 Ga0501315_029348 3300049531 Bacteria 785
985 Ga0501315_032842 3300049531 Bacteria 756
986 Ga0501316_000565 3300049532 Bacteria 2640
987 Ga0501316_010922 3300049532 Bacteria 1040
988 Ga0501316_012207 3300049532 Bacteria 1001
989 Ga0501316_037104 3300049532 Bacteria 669
990 Ga0501316_056265 3300049532 Bacteria 575
991 Ga0501317_017020 3300049533 Bacteria 949
992 Ga0501317_050641 3300049533 Bacteria 659
993 Ga0501317_084668 3300049533 Bacteria 553
994 Ga0501320_002608 3300049536 Bacteria 1456
995 Ga0501320_013151 3300049536 Bacteria 880
996 Ga0501321_003706 3300049537 Bacteria 1418
997 Ga0501321_018127 3300049537 Bacteria 852
998 Ga0501322_027968 3300049538 Bacteria 522
999 Ga0501323_002763 3300049539 Bacteria 1736
1000 Ga0501323_023498 3300049539 Bacteria 828
1001 Ga0501324_035978 3300049540 Bacteria 554
1002 Ga0501325_043579 3300049541 Bacteria 553
1003 Ga0501327_08233 3300049543 Bacteria 660
1004 Ga0501327_17119 3300049543 Bacteria 522
1005 Ga0501327_19234 3300049543 Unclassified 503
1006 Ga0501328_10356 3300049544 Bacteria 526
1007 Ga0501329_05041 3300049545 Bacteria 721
1008 Ga0501329_14524 3300049545 Bacteria 527
1009 Ga0501330_003707 3300049546 Bacteria 923
1010 Ga0501331_14064 3300049547 Bacteria 522
1011 Ga0501332_16924 3300049548 Bacteria 525
1012 Ga0501334_03053 3300049550 Bacteria 1024
1013 Ga0501334_06500 3300049550 Bacteria 790
1014 Ga0501334_20894 3300049550 Bacteria 527
1015 Ga0501335_003049 3300049551 Bacteria 1400
1016 Ga0501335_005666 3300049551 Unclassified 1120
1017 Ga0501335_008277 3300049551 Unclassified 976
1018 Ga0501335_011144 3300049551 Bacteria 876
1019 Ga0501335_021015 3300049551 Bacteria 697
1020 Ga0501335_037599 3300049551 Bacteria 563
1021 Ga0501336_007753 3300049552 Bacteria 820
1022 Ga0501337_003392 3300049553 Bacteria 1011
1023 Ga0501337_005126 3300049553 Bacteria 871
1024 Ga0501337_006563 3300049553 Bacteria 797
1025 Ga0501340_009762 3300049556 Bacteria 696
1026 Ga0501033_0062825 3300049570 Bacteria 2734
1027 Ga0501034_0002020 3300049571 Bacteria 25539
1028 Ga0501034_0282372 3300049571 Bacteria 1599
1029 Ga0501043_0038700 3300049579 Bacteria 3750
1030 Ga0501043_0267933 3300049579 Bacteria 1312
1031 Ga0501047_0845703 3300049581 Unclassified 729
1032 Ga0501070_0230182 3300049586 Bacteria 1519
1033 Ga0501198_012021 3300049649 Bacteria 1297
1034 Ga0501198_020209 3300049649 Bacteria 1054
1035 Ga0501201_002320 3300049651 Bacteria 1742
1036 Ga0501202_000998 3300049652 Bacteria 4375
1037 Ga0501202_009088 3300049652 Bacteria 1820
1038 Ga0501202_024862 3300049652 Bacteria 1217
1039 Ga0501202_194712 3300049652 Bacteria 552
1040 Ga0501207_020378 3300049654 Bacteria 1058
1041 Ga0501216_192811 3300049660 Bacteria 501
1042 Ga0501217_005840 3300049661 Bacteria 2589
1043 Ga0501222_060407 3300049662 Bacteria 573
1044 Ga0501223_003765 3300049663 Bacteria 3276
1045 Ga0501224_006724 3300049664 Bacteria 1669
1046 Ga0501227_171571 3300049665 Bacteria 607
1047 Ga0501235_003091 3300049669 Bacteria 3586
1048 Ga0501235_028546 3300049669 Bacteria 1254
1049 Ga0501242_009393 3300049674 Bacteria 1158
1050 Ga0501242_019701 3300049674 Bacteria 863
1051 Ga0501243_002414 3300049675 Bacteria 2735
1052 Ga0501252_003343 3300049682 Bacteria 1647
1053 Ga0501259_106647 3300049688 Bacteria 649
1054 Ga0501261_001010 3300049690 Bacteria 3458
1055 Ga0501221_088004 3300049704 Bacteria 756
1056 Ga0501221_151874 3300049704 Bacteria 614
1057 Ga0501225_0004957 3300049705 Bacteria 3933
1058 Ga0501225_0014988 3300049705 Bacteria 2163
1059 Ga0501245_018897 3300049708 Bacteria 1063
1060 Ga0501080_0143181 3300049742 Bacteria 2210
1061 Ga0501083_0085302 3300049744 Bacteria 2090
1062 Ga0501083_0810808 3300049744 Unclassified 609
1063 Ga0501232_030337 3300049757 Bacteria 748
1064 Ga0501241_000113 3300049758 Bacteria 17544
1065 Ga0501264_013457 3300049761 Bacteria 811
1066 Ga0501266_037834 3300049763 Bacteria 709
1067 Ga0501268_009295 3300049765 Bacteria 1508
1068 Ga0501270_173804 3300049767 Bacteria 505
1069 Ga0501271_039440 3300049768 Bacteria 611
1070 Ga0501035_0112953 3300049822 Bacteria 2380
1071 Ga0501035_0725096 3300049822 Bacteria 800
1072 Ga0501044_0199920 3300049823 Bacteria 1957
1073 Ga0501212_044539 3300049851 Unclassified 740
1074 Ga0501212_123430 3300049851 Bacteria 504
1075 nmdc:mga03683_410947_c1 3300050489 Bacteria 647
1076 nmdc:mga0k408_12089_c1 3300050493 Bacteria 4714
1077 nmdc:mga0k408_254901_c1 3300050493 Bacteria 1048
1078 nmdc:mga0k408_431124_c1 3300050493 Bacteria 783
1079 nmdc:mga0k408_674576_c1 3300050493 Bacteria 607
1080 nmdc:mga0k408_7017_c1 3300050493 Bacteria 6011
1081 nmdc:mga0k408_9728_c1 3300050493 Bacteria 5190
1082 nmdc:mga07m45_122077_c1 3300050496 Bacteria 1505
1083 nmdc:mga07m45_122395_c1 3300050496 Bacteria 1503
1084 nmdc:mga07m45_219335_c1 3300050496 Bacteria 1106
1085 nmdc:mga07m45_380682_c1 3300050496 Bacteria 819
1086 nmdc:mga08y16_106009_c1 3300050511 Bacteria 2926
1087 nmdc:mga08y16_26169_c1 3300050511 Bacteria 6153
1088 nmdc:mga0sz30_296382_c1 3300050516 Bacteria 721
1089 Ga0500646_0007315 3300053090 Bacteria 2821
1090 Ga0500646_0087139 3300053090 Bacteria 962
1091 Ga0500583_0004184 3300053092 Bacteria 4664
1092 Ga0500651_0300017 3300053093 Bacteria 922
1093 Ga0500641_0061245 3300053096 Bacteria 1567
1094 Ga0500621_155407 3300053126 Bacteria 854
1095 Ga0500628_021680 3300053129 Bacteria 1306
1096 Ga0500628_212728 3300053129 Bacteria 561
1097 Ga0500642_0007688 3300053130 Bacteria 3637
1098 Ga0500642_0429397 3300053130 Unclassified 571
1099 Ga0500655_034538 3300053133 Bacteria 981
1100 Ga0500655_059390 3300053133 Bacteria 769
1101 Ga0500568_0000439 3300053139 Bacteria 31243
1102 Ga0500568_0047775 3300053139 Bacteria 1694
1103 Ga0500588_0064267 3300053146 Bacteria 1185
1104 Ga0500588_0370740 3300053146 Bacteria 545
1105 Ga0500622_0001823 3300053156 Bacteria 16170
1106 Ga0587109_044136 3300059624 Bacteria 894
1107 Ga0587069_054570 3300059642 Bacteria 720
1108 Ga0587079_000249 3300059647 Bacteria 4161
1109 Ga0006758J48902_1026128
1110 SwRhRL2b_contig_3008347
1111 JGI24740J21852_10014244
1112 JGI24743J22301_10055630
1113 JGI24743J22301_10098335
1114 JGI24744J21845_10033386
1115 JGI24744J21845_10053292
1116 JGI24035J26624_1018180
1117 JGI24751J29686_10101010
1118 rootL2_10116652
1119 rootH1_10165256
1120 JGI25160J50197_1001095
1121 Ga0058860_11446600
1122 Ga0065704_10073668
1123 Ga0065704_10864758
1124 Ga0065712_10002231
1125 Ga0065712_10027689
1126 Ga0065712_10071904
1127 Ga0065712_10309141
1128 Ga0065712_10570103
1129 Ga0065712_10573321
1130 Ga0065712_10581230
1131 Ga0065715_10284656
1132 Ga0065715_10517905
1133 Ga0065707_10185518
1134 Ga0065707_10364924
1135 Ga0070658_10016405
1136 Ga0070658_10052865
1137 Ga0070658_10503106
1138 Ga0070658_10513272
1139 Ga0070658_10621450
1140 Ga0070658_10772366
1141 Ga0070676_10006513
1142 Ga0070676_10031672
1143 Ga0070676_10032136
1144 Ga0070676_10203637
1145 Ga0070683_100001488
1146 Ga0070683_100025159
1147 Ga0070683_100975849
1148 Ga0070683_101938102
1149 Ga0070690_100006100
1150 Ga0070690_100256936
1151 Ga0070670_100024841
1152 Ga0070670_100068133
1153 Ga0070670_100108356
1154 Ga0070670_100109804
1155 Ga0070670_100128199
1156 Ga0070670_100141351
1157 Ga0070670_100149270
1158 Ga0070670_100734964
1159 Ga0070670_101037207
1160 Ga0070670_101683616
1161 Ga0070677_10007599
1162 Ga0070677_10016481
1163 Ga0070677_10043990
1164 Ga0068869_100010127
1165 Ga0068869_100044651
1166 Ga0068869_100086467
1167 Ga0068869_100093571
1168 Ga0068869_100238893
1169 Ga0068869_100269398
1170 Ga0068869_100855269
1171 Ga0070666_10000036
1172 Ga0070666_10018000
1173 Ga0070666_10150569
1174 Ga0070666_10224919
1175 Ga0070666_10360216
1176 Ga0070666_11328143
1177 Ga0070666_11436219
1178 Ga0070680_100444354
1179 Ga0070680_100467387
1180 Ga0070682_100781403
1181 Ga0068868_100007778
1182 Ga0068868_100015404
1183 Ga0068868_100031254
1184 Ga0068868_100055794
1185 Ga0068868_100111940
1186 Ga0068868_100120776
1187 Ga0068868_100179890
1188 Ga0068868_100245999
1189 Ga0068868_100433503
1190 Ga0068868_101381635
1191 Ga0070660_100218767
1192 Ga0070660_101112947
1193 Ga0070660_101351378
1194 Ga0070689_100021681
1195 Ga0070689_100076504
1196 Ga0070689_100196748
1197 Ga0070687_100003733
1198 Ga0070687_100035905
1199 Ga0070687_100036372
1200 Ga0070687_100636839
1201 Ga0070687_100898664
1202 Ga0070687_101180761
1203 Ga0070661_100004113
1204 Ga0070661_100708537
1205 Ga0070661_101763575
1206 Ga0070668_100017989
1207 Ga0070668_100025286
1208 Ga0070668_100226019
1209 Ga0070668_100385802
1210 Ga0070668_101117215
1211 Ga0070668_101220418
1212 Ga0070669_100002748
1213 Ga0070669_100024124
1214 Ga0070669_100685911
1215 Ga0070669_100876720
1216 Ga0070669_101980349
1217 Ga0070675_100018472
1218 Ga0070675_100027474
1219 Ga0070675_100090601
1220 Ga0070675_100129605
1221 Ga0070675_100143049
1222 Ga0070675_100182345
1223 Ga0070675_100449057
1224 Ga0070675_100580047
1225 Ga0070675_100610327
1226 Ga0070675_101926560
1227 Ga0070671_100002367
1228 Ga0070671_100030657
1229 Ga0070671_100051676
1230 Ga0070671_100069502
1231 Ga0070671_100231072
1232 Ga0070671_100463920
1233 Ga0070671_101044821
1234 Ga0070674_100085764
1235 Ga0070674_100141927
1236 Ga0070674_100142571
1237 Ga0070674_100728347
1238 Ga0070673_100003757
1239 Ga0070673_100014827
1240 Ga0070673_100051881
1241 Ga0070673_100075958
1242 Ga0070673_100264445
1243 Ga0070673_100344753
1244 Ga0070673_100463534
1245 Ga0070673_100942301
1246 Ga0070688_100018933
1247 Ga0070688_100176818
1248 Ga0070688_100592206
1249 Ga0070688_101412615
1250 Ga0070659_100023726
1251 Ga0070659_100213818
1252 Ga0070659_100509157
1253 Ga0070659_100839154
1254 Ga0070659_101582565
1255 Ga0070667_100001551
1256 Ga0070667_100004111
1257 Ga0070667_100176643
1258 Ga0070667_100255813
1259 Ga0070667_100730644
1260 Ga0070667_100752615
1261 Ga0070667_100952039
1262 Ga0070667_101004097
1263 Ga0070667_101738477
1264 Ga0070701_10094050
1265 Ga0070700_100167615
1266 Ga0070694_100962921
1267 Ga0070663_100099434
1268 Ga0070663_101542824
1269 Ga0070663_101567215
1270 Ga0070678_100040792
1271 Ga0070678_100047685
1272 Ga0070678_100051388
1273 Ga0070678_100302857
1274 Ga0070678_100850439
1275 Ga0070678_100897988
1276 Ga0070678_100939312
1277 Ga0070678_101282815
1278 Ga0070678_101503270
1279 Ga0070662_100004284
1280 Ga0070662_100033746
1281 Ga0070662_100140628
1282 Ga0070662_100416202
1283 Ga0070662_100820712
1284 Ga0070662_100952639
1285 Ga0070681_10134747
1286 Ga0070681_10639080
1287 Ga0068867_100011837
1288 Ga0068867_100012130
1289 Ga0068867_100067838
1290 Ga0068867_100569397
1291 Ga0068867_100571254
1292 Ga0068867_100708840
1293 Ga0068867_100776836
1294 Ga0068867_100809254
1295 Ga0068867_101043994
1296 Ga0068867_101307042
1297 Ga0070685_10054219
1298 Ga0070685_10130662
1299 Ga0070685_10292353
1300 Ga0070679_100047759
1301 Ga0070679_100143030
1302 Ga0070684_100021260
1303 Ga0070684_100046353
1304 Ga0070684_100193764
1305 Ga0070684_101502800
1306 Ga0068853_100104703
1307 Ga0068853_100107889
1308 Ga0068853_100233084
1309 Ga0068853_100413423
1310 Ga0068853_100476010
1311 Ga0068853_100521037
1312 Ga0068853_100713243
1313 Ga0068853_100777143
1314 Ga0068853_100870167
1315 Ga0068853_101195251
1316 Ga0070672_100024315
1317 Ga0070672_100043706
1318 Ga0070672_100058329
1319 Ga0070672_100140671
1320 Ga0070672_100168509
1321 Ga0070672_100206540
1322 Ga0070672_100266877
1323 Ga0070672_100386054
1324 Ga0070672_100403174
1325 Ga0070672_100475521
1326 Ga0070672_101233852
1327 Ga0070672_101388517
1328 Ga0070686_100018261
1329 Ga0070686_100456662
1330 Ga0070693_101018167
1331 Ga0070665_100000001
1332 Ga0070665_100045444
1333 Ga0070665_100141768
1334 Ga0070665_100465756
1335 Ga0068855_100051562
1336 Ga0068855_100387372
1337 Ga0068855_101203178
1338 Ga0068855_102115026
1339 Ga0070664_100084099
1340 Ga0070664_100138809
1341 Ga0070664_100298364
1342 Ga0070664_100601421
1343 Ga0070664_100966040
1344 Ga0070664_101050047
1345 Ga0070664_101525755
1346 Ga0068857_100040938
1347 Ga0068857_100081626
1348 Ga0068857_100119536
1349 Ga0068857_101626312
1350 Ga0068854_100048602
1351 Ga0068854_100057516
1352 Ga0068854_100172563
1353 Ga0068854_100173312
1354 Ga0068854_100258297
1355 Ga0068854_100334396
1356 Ga0068854_100473774
1357 Ga0068856_100183027
1358 Ga0068856_100292741
1359 Ga0070702_100290266
1360 Ga0070702_101098828
1361 Ga0068852_100025622
1362 Ga0068852_100074305
1363 Ga0068852_100087742
1364 Ga0068852_100160380
1365 Ga0068852_100176883
1366 Ga0068852_100402852
1367 Ga0068852_100555142
1368 Ga0068852_100559595
1369 Ga0068852_100649864
1370 Ga0068852_101084683
1371 Ga0068852_101555485
1372 Ga0068859_100000037
1373 Ga0068859_100002491
1374 Ga0068859_100040242
1375 Ga0068859_100090094
1376 Ga0068859_100226291
1377 Ga0068859_100272899
1378 Ga0068859_101902345
1379 Ga0068864_100002302
1380 Ga0068864_100005468
1381 Ga0068864_100259859
1382 Ga0068864_102353715
1383 Ga0068866_10069033
1384 Ga0068866_10226426
1385 Ga0068861_100006643
1386 Ga0068861_100051617
1387 Ga0068861_100121125
1388 Ga0068861_100205571
1389 Ga0068851_10026971
1390 Ga0068851_10072821
1391 Ga0068851_10115664
1392 Ga0068851_10208554
1393 Ga0068851_10424958
1394 Ga0068851_10940785
1395 Ga0068870_10021607
1396 Ga0068870_10025073
1397 Ga0068863_100002925
1398 Ga0068863_100012295
1399 Ga0068863_100088110
1400 Ga0068863_100480284
1401 Ga0068863_100536380
1402 Ga0068863_100940042
1403 Ga0068863_102051060
1404 Ga0068858_100004320
1405 Ga0068858_100309206
1406 Ga0068858_100355242
1407 Ga0068860_100000097
1408 Ga0068860_100005547
1409 Ga0068860_100018429
1410 Ga0068860_100030843
1411 Ga0068860_100080452
1412 Ga0068860_100280934
1413 Ga0068860_100557473
1414 Ga0068860_100642466
1415 Ga0068860_100716166
1416 Ga0068860_102791755
1417 Ga0068862_100015311
1418 Ga0068862_100418423
1419 Ga0068862_100558485
1420 Ga0068862_100643661
1421 Ga0068862_101334736
1422 Ga0068862_101652122
1423 Ga0075369_10254845
1424 Ga0075366_10031189
1425 Ga0075366_10195492
1426 Ga0075366_10901792
1427 Ga0097621_100031668
1428 Ga0097621_100096686
1429 Ga0097621_100522164
1430 Ga0097621_101210662
1431 Ga0097621_101273636
1432 Ga0097621_101439090
1433 Ga0075370_10048107
1434 Ga0075370_10236804
1435 Ga0075370_10302193
1436 Ga0075370_10902394
1437 Ga0068871_100084017
1438 Ga0068871_100306332
1439 Ga0068871_100370632
1440 Ga0068871_100431115
1441 Ga0068871_100856262
1442 Ga0068871_101093666
1443 Ga0068871_101575444
1444 Ga0068871_101774423
1445 Ga0075428_100140238
1446 Ga0075428_101738542
1447 Ga0075429_100339821
1448 Ga0068865_100038915
1449 Ga0068865_100089701
1450 Ga0068865_100167631
1451 Ga0068865_101489453
1452 Ga0097620_100000037
1453 Ga0097620_100002491
1454 Ga0097620_100040243
1455 Ga0097620_100090092
1456 Ga0097620_100226288
1457 Ga0097620_100272888
1458 Ga0097620_101902697
1459 Ga0105251_10238546
1460 Ga0105240_10011002
1461 Ga0105240_10023972
1462 Ga0105240_10078219
1463 Ga0105240_10100052
1464 Ga0105240_10331805
1465 Ga0105240_10943101
1466 Ga0105240_11006892
1467 Ga0105240_11357741
1468 Ga0111539_10014550
1469 Ga0111539_10044551
1470 Ga0105245_10196069
1471 Ga0105245_10421275
1472 Ga0105245_12492681
1473 Ga0105247_10015344
1474 Ga0114129_10511551
1475 Ga0105243_13099013
1476 Ga0105241_10007590
1477 Ga0105241_10014100
1478 Ga0105241_10037723
1479 Ga0105241_10265755
1480 Ga0105241_10629530
1481 Ga0105241_10634974
1482 Ga0105241_10824349
1483 Ga0105241_10849170
1484 Ga0105241_11150865
1485 Ga0105241_11208157
1486 Ga0105241_11829482
1487 Ga0105242_10045717
1488 Ga0105242_10200555
1489 Ga0105242_10259499
1490 Ga0105242_11077188
1491 Ga0105242_11077762
1492 Ga0105248_11592813
1493 Ga0105248_11648581
1494 Ga0105237_10001588
1495 Ga0105237_10001799
1496 Ga0105237_10014365
1497 Ga0105237_10030759
1498 Ga0105237_10069245
1499 Ga0105238_10109822
1500 Ga0105238_10705871
1501 Ga0105238_11150423
1502 Ga0105238_11180487
1503 Ga0105249_10001080
1504 Ga0105249_10029956
1505 Ga0105249_10219506
1506 Ga0105249_11384925
1507 Ga0105239_10004090
1508 Ga0105239_10007869
1509 Ga0105239_10117570
1510 Ga0105239_10198084
1511 Ga0105239_10240840
1512 Ga0105239_10505456
1513 Ga0105239_10628709
1514 Ga0105239_10654488
1515 Ga0105239_10859738
1516 Ga0105239_11804309
1517 Ga0105239_13621801
1518 Ga0105246_10021096
1519 Ga0105246_10809389
1520 Ga0157373_10025943
1521 Ga0157373_10459052
1522 Ga0157373_10764455
1523 Ga0157373_10914537
1524 Ga0157373_11174526
1525 Ga0157371_10023444
1526 Ga0157371_10024281
1527 Ga0157371_10054786
1528 Ga0157371_10054932
1529 Ga0157371_10054961
1530 Ga0157371_10212534
1531 Ga0157371_10389929
1532 Ga0157371_10401077
1533 Ga0157371_10633119
1534 Ga0157371_10963758
1535 Ga0157370_10286166
1536 Ga0157370_10553855
1537 Ga0157370_10623454
1538 Ga0157370_10816236
1539 Ga0157370_11235191
1540 Ga0157369_10012941
1541 Ga0157369_10068990
1542 Ga0157369_10083535
1543 Ga0157369_10115086
1544 Ga0157369_10424209
1545 Ga0157369_10475273
1546 Ga0157369_10527443
1547 Ga0157369_12467560
1548 Ga0157374_10000500
1549 Ga0157374_10008968
1550 Ga0157374_10121013
1551 Ga0157374_10126640
1552 Ga0157374_10229288
1553 Ga0157374_10270813
1554 Ga0157374_10498328
1555 Ga0157374_10535708
1556 Ga0157374_10706878
1557 Ga0157378_10021595
1558 Ga0157378_10076791
1559 Ga0157378_10131585
1560 Ga0157378_10246272
1561 Ga0157378_10526853
1562 Ga0157378_10593805
1563 Ga0157378_10813603
1564 Ga0157378_11010441
1565 Ga0157378_11185144
1566 Ga0157378_12484823
1567 Ga0163162_10001189
1568 Ga0163162_10001595
1569 Ga0163162_10001867
1570 Ga0163162_10025579
1571 Ga0163162_10115627
1572 Ga0163162_10163494
1573 Ga0163162_10486635
1574 Ga0163162_10806314
1575 Ga0157372_10016323
1576 Ga0157372_10024284
1577 Ga0157372_10029769
1578 Ga0157372_10038201
1579 Ga0157372_10179557
1580 Ga0157372_10209283
1581 Ga0157372_10239188
1582 Ga0157372_10247490
1583 Ga0157372_10348328
1584 Ga0157372_10535402
1585 Ga0157372_10590069
1586 Ga0157372_10623253
1587 Ga0157372_10773148
1588 Ga0157372_10918512
1589 Ga0157372_10981587
1590 Ga0157372_11013100
1591 Ga0157372_11410151
1592 Ga0157372_11665603
1593 Ga0157372_11682365
1594 Ga0157372_11982074
1595 Ga0157372_12006511
1596 Ga0157372_12144737
1597 Ga0157375_10012841
1598 Ga0157375_10082979
1599 Ga0157375_10090738
1600 Ga0157375_10094808
1601 Ga0157375_10095074
1602 Ga0157375_10153729
1603 Ga0157375_10208620
1604 Ga0157375_10226178
1605 Ga0157375_10376285
1606 Ga0157375_11255101
1607 Ga0157375_12084896
1608 Ga0163163_10001501
1609 Ga0163163_10054019
1610 Ga0163163_10208087
1611 Ga0163163_10651108
1612 Ga0163163_11009946
1613 Ga0163163_12430047
1614 Ga0163163_12536167
1615 Ga0157380_10011122
1616 Ga0157380_10030118
1617 Ga0157380_10113108
1618 Ga0157380_10361775
1619 Ga0157380_12735341
1620 Ga0157380_13437220
1621 Ga0182008_10349774
1622 Ga0157377_10004500
1623 Ga0157377_10021210
1624 Ga0157377_10069334
1625 Ga0157377_10354555
1626 Ga0157377_10579621
1627 Ga0157377_11002115
1628 Ga0157379_10008284
1629 Ga0157379_10036538
1630 Ga0157379_10090931
1631 Ga0157379_10128099
1632 Ga0157379_10978871
1633 Ga0157376_10013181
1634 Ga0157376_10232761
1635 Ga0157376_10438390
1636 Ga0157376_10858745
1637 Ga0157376_10876601
1638 Ga0157376_11134319
1639 Ga0157376_11584127
1640 Ga0157376_11595799
1641 Ga0157376_12191847
1642 Ga0163161_10013936
1643 Ga0163161_10076648
1644 Ga0163161_10185939
1645 Ga0163161_10191737
1646 Ga0163161_10201044
1647 Ga0163161_10574204
1648 Ga0163161_10740107
1649 Ga0206356_11668122
1650 Ga0213876_10007626
1651 Ga0207426_1000105
1652 Ga0207697_10008960
1653 Ga0207697_10045796
1654 Ga0207697_10258504
1655 Ga0207697_10407196
1656 Ga0207656_10072874
1657 Ga0207656_10107139
1658 Ga0207682_10012690
1659 Ga0207682_10043617
1660 Ga0207682_10103216
1661 Ga0207682_10415225
1662 Ga0207642_10049589
1663 Ga0207642_10101549
1664 Ga0207642_10308757
1665 Ga0207688_10010099
1666 Ga0207688_10237702
1667 Ga0207680_10000051
1668 Ga0207680_10045258
1669 Ga0207680_10208839
1670 Ga0207680_10337949
1671 Ga0207680_10959422
1672 Ga0207647_10000110
1673 Ga0207647_10025805
1674 Ga0207647_10076676
1675 Ga0207647_10116637
1676 Ga0207647_10636369
1677 Ga0207645_10002136
1678 Ga0207645_10044737
1679 Ga0207645_10072859
1680 Ga0207645_10093484
1681 Ga0207645_10163618
1682 Ga0207643_10001724
1683 Ga0207643_10006929
1684 Ga0207705_10014024
1685 Ga0207705_10081358
1686 Ga0207705_10088880
1687 Ga0207705_10176266
1688 Ga0207705_10732549
1689 Ga0207705_10992843
1690 Ga0207705_11442265
1691 Ga0207654_10000881
1692 Ga0207654_10002705
1693 Ga0207654_10080916
1694 Ga0207654_10382689
1695 Ga0207654_10532596
1696 Ga0207654_10633681
1697 Ga0207654_11366915
1698 Ga0207654_11446234
1699 Ga0207707_10344888
1700 Ga0207707_10642352
1701 Ga0207695_10000084
1702 Ga0207695_10004647
1703 Ga0207695_10026373
1704 Ga0207695_10079990
1705 Ga0207695_10105078
1706 Ga0207671_10003750
1707 Ga0207671_10004543
1708 Ga0207671_10007320
1709 Ga0207671_10032778
1710 Ga0207671_10355358
1711 Ga0207662_10047459
1712 Ga0207662_10061472
1713 Ga0207662_10092496
1714 Ga0207662_10996307
1715 Ga0207662_11105997
1716 Ga0207657_10062662
1717 Ga0207657_10158704
1718 Ga0207657_10684543
1719 Ga0207657_10787714
1720 Ga0207649_10005479
1721 Ga0207649_10588025
1722 Ga0207652_10002830
1723 Ga0207652_10388671
1724 Ga0207681_10015241
1725 Ga0207681_10817614
1726 Ga0207681_11644446
1727 Ga0207694_10017481
1728 Ga0207694_10069133
1729 Ga0207694_10874935
1730 Ga0207650_10014881
1731 Ga0207650_10066694
1732 Ga0207650_10074981
1733 Ga0207650_10093786
1734 Ga0207650_10167486
1735 Ga0207650_10180530
1736 Ga0207650_10199627
1737 Ga0207650_10254342
1738 Ga0207650_10499989
1739 Ga0207659_10009764
1740 Ga0207659_10033056
1741 Ga0207659_10101095
1742 Ga0207659_10183973
1743 Ga0207659_10192518
1744 Ga0207659_10369284
1745 Ga0207687_10309374
1746 Ga0207687_11221390
1747 Ga0207644_10012415
1748 Ga0207644_10021869
1749 Ga0207644_10024620
1750 Ga0207644_10076596
1751 Ga0207644_10912262
1752 Ga0207644_11457609
1753 Ga0207644_11578564
1754 Ga0207690_10035193
1755 Ga0207690_10633736
1756 Ga0207690_11388566
1757 Ga0207706_10009371
1758 Ga0207706_10037951
1759 Ga0207706_10068145
1760 Ga0207706_10707786
1761 Ga0207686_10149241
1762 Ga0207670_10154313
1763 Ga0207670_10196787
1764 Ga0207670_10760665
1765 Ga0207669_10037398
1766 Ga0207669_10409607
1767 Ga0207669_10510496
1768 Ga0207704_10022175
1769 Ga0207704_10039066
1770 Ga0207691_10019043
1771 Ga0207691_10027644
1772 Ga0207691_10063549
1773 Ga0207691_10075279
1774 Ga0207691_10099184
1775 Ga0207691_10115614
1776 Ga0207691_10176679
1777 Ga0207691_10497887
1778 Ga0207689_10005396
1779 Ga0207689_10018050
1780 Ga0207689_10101705
1781 Ga0207661_10009193
1782 Ga0207661_10178861
1783 Ga0207679_10000875
1784 Ga0207679_10086487
1785 Ga0207679_10128128
1786 Ga0207679_10226523
1787 Ga0207679_10340064
1788 Ga0207679_10640885
1789 Ga0207679_10651771
1790 Ga0207679_11499122
1791 Ga0207679_11916378
1792 Ga0207667_10073069
1793 Ga0207667_10181502
1794 Ga0207667_10329536
1795 Ga0207667_10387114
1796 Ga0207667_11069064
1797 Ga0207667_12029358
1798 Ga0207651_10053397
1799 Ga0207651_10078265
1800 Ga0207651_10087831
1801 Ga0207651_10119509
1802 Ga0207651_10181194
1803 Ga0207651_10196091
1804 Ga0207651_10212458
1805 Ga0207651_10264420
1806 Ga0207651_10975561
1807 Ga0207651_11102178
1808 Ga0207712_10014683
1809 Ga0207712_10235773
1810 Ga0207712_10269554
1811 Ga0207668_10015084
1812 Ga0207668_10067188
1813 Ga0207668_10074644
1814 Ga0207668_10210505
1815 Ga0207640_10087024
1816 Ga0207640_10280232
1817 Ga0207640_10540948
1818 Ga0207658_10009886
1819 Ga0207658_10012999
1820 Ga0207658_10138678
1821 Ga0207658_10218425
1822 Ga0207658_10252741
1823 Ga0207658_10253710
1824 Ga0207658_10395815
1825 Ga0207658_10886158
1826 Ga0207658_11423836
1827 Ga0207677_10001082
1828 Ga0207677_10102638
1829 Ga0207677_10192183
1830 Ga0207677_10266804
1831 Ga0207677_11411684
1832 Ga0207677_11605611
1833 Ga0207703_10012945
1834 Ga0207703_10548827
1835 Ga0207639_10036559
1836 Ga0207639_10060496
1837 Ga0207639_10061028
1838 Ga0207639_10138059
1839 Ga0207639_10338476
1840 Ga0207639_10524516
1841 Ga0207639_11093980
1842 Ga0207639_11240194
1843 Ga0207639_11416025
1844 Ga0207639_11747550
1845 Ga0207678_10172372
1846 Ga0207678_10240347
1847 Ga0207678_10275303
1848 Ga0207708_10058905
1849 Ga0207702_10056726
1850 Ga0207702_10078102
1851 Ga0207702_10744068
1852 Ga0207641_10000121
1853 Ga0207641_10019787
1854 Ga0207641_10511744
1855 Ga0207641_10631488
1856 Ga0207641_10752574
1857 Ga0207648_10014701
1858 Ga0207648_10014934
1859 Ga0207648_10027181
1860 Ga0207648_10120379
1861 Ga0207648_10218763
1862 Ga0207648_10303123
1863 Ga0207648_10323886
1864 Ga0207648_10731575
1865 Ga0207648_10882974
1866 Ga0207648_11601524
1867 Ga0207676_10003342
1868 Ga0207676_10015259
1869 Ga0207676_10183279
1870 Ga0207676_10624550
1871 Ga0207676_10632657
1872 Ga0207676_10656245
1873 Ga0207674_10070646
1874 Ga0207674_10094215
1875 Ga0207674_10164835
1876 Ga0207674_11436132
1877 Ga0207675_100002059
1878 Ga0207675_100041609
1879 Ga0207675_100372847
1880 Ga0207675_100461349
1881 Ga0207675_100672746
1882 Ga0207675_100696468
1883 Ga0207675_101570973
1884 Ga0207675_102509488
1885 Ga0207675_102534378
1886 Ga0207683_10006890
1887 Ga0207683_10016244
1888 Ga0207683_10061446
1889 Ga0207683_10202465
1890 Ga0207683_10922637
1891 Ga0207683_11016448
1892 Ga0207683_11152402
1893 Ga0207683_11219598
1894 Ga0207698_10001488
1895 Ga0207698_10016613
1896 Ga0207698_10245179
1897 Ga0207698_10254695
1898 Ga0207698_10408119
1899 Ga0207698_10641268
1900 Ga0207698_10754067
1901 Ga0207698_10859423
1902 Ga0207698_10919830
1903 Ga0207698_12102851
1904 Ga0209996_1077834
1905 Ga0209974_10257701
1906 Ga0207428_10111837
1907 Ga0207428_10136352
1908 Ga0268266_10000038
1909 Ga0268266_10015422
1910 Ga0268266_10143576
1911 Ga0268266_10362709
1912 Ga0268265_10003503
1913 Ga0268265_10547433
1914 Ga0268265_11193270
1915 Ga0268265_11806138
1916 Ga0268264_10000167
1917 Ga0268264_10004870
1918 Ga0268264_10012086
1919 Ga0268264_10017339
1920 Ga0268264_10128293
1921 Ga0268264_10182798
1922 Ga0268264_10251911
1923 Ga0268264_11678735
1924 Ga0307517_10018578
1925 Ga0307517_10269373
1926 Ga0307517_10306514
1927 Ga0307515_10000469
1928 Ga0307511_10004717
1929 Ga0307511_10396782
1930 Ga0307512_10268947
1931 Ga0265327_10000159
1932 Ga0307513_10103928
1933 Ga0307509_10079849
1934 Ga0307509_10113539
1935 Ga0307509_10344145
1936 Ga0307509_10407521
1937 Ga0307408_100426226
1938 Ga0265313_10067180
1939 Ga0307508_10002518
1940 Ga0307508_10529516
1941 Ga0307516_10004268
1942 Ga0307405_10655250
1943 Ga0307413_10022806
1944 Ga0307413_10530901
1945 Ga0307410_10035292
1946 Ga0307410_11164698
1947 Ga0307406_10106862
1948 Ga0307406_11355197
1949 Ga0307407_10083520
1950 Ga0307412_10519431
1951 Ga0307409_101269840
1952 Ga0307416_100069247
1953 Ga0307416_100974098
1954 Ga0307416_102077190
1955 Ga0307414_10105037
1956 Ga0307414_10215472
1957 Ga0307414_10476789
1958 Ga0307414_10485765
1959 Ga0307414_10726189
1960 Ga0307414_10794241
1961 Ga0307411_11684469
1962 Ga0307415_100025311
1963 Ga0307415_102332102
1964 Ga0307507_10338473
1965 Ga0373938_0094755
1966 Ga0373962_0367198
1967 Ga0265778_057272
1968 Ga0395899_0702648
1969 Ga0395900_0216632
1970 Ga0395900_1100609
1971 Ga0395905_0002823
1972 Ga0395901_0560399
1973 Ga0436365_0472587
1974 Ga0436365_0781227
1975 Ga0436363_0734173
1976 Ga0436363_1110235
1977 Ga0439436_0042221
1978 Ga0439439_0161566
1979 Ga0439461_0043177
1980 Ga0451787_080681
1981 Ga0451789_0191907
1982 Ga0451794_28172
1983 Ga0451797_0542401
1984 Ga0451802_0148319
1985 Ga0451804_0798737
1986 Ga0451807_2671209
1987 Ga0451839_1552964
1988 Ga0451847_0938223
1989 Ga0451843_0386673
1990 Ga0451853_0260808
1991 Ga0451853_0354634
1992 Ga0451853_2173213
1993 Ga0451853_2350954
1994 Ga0439449_0017442
1995 Ga0439457_008270
1996 Ga0439446_0018535
1997 Ga0439434_0017713
1998 Ga0439434_0048470
1999 Ga0439435_0267835
2000 Ga0451577_0035014
2001 Ga0466972_0000025
2002 Ga0466972_0021513
2003 Ga0466972_0134269
2004 Ga0466972_0360729
2005 Ga0466965_0187557
2006 Ga0453684_0003639
2007 Ga0453684_0046321
2008 Ga0453684_0755575
2009 Ga0453684_2573165
2010 Ga0466968_0052503
2011 Ga0466968_0095953
2012 Ga0466970_0000933
2013 Ga0466957_0131367
2014 Ga0466960_0228251
2015 Ga0466959_0017683
2016 Ga0466959_0442562
2017 Ga0466959_0901945
2018 Ga0451576_0110481
2019 Ga0495629_0815944
2020 Ga0495638_0083984
2021 Ga0495648_0012032
2022 Ga0495648_0342523
2023 Ga0495652_0255633
2024 Ga0495640_0695428
2025 Ga0495611_0130135
2026 Ga0495625_0132206
2027 Ga0495625_0273493
2028 Ga0495649_0091156
2029 Ga0495649_0581841
2030 Ga0495672_0011267
2031 Ga0495687_000001
2032 Ga0495686_0000004
2033 Ga0495686_0121135
2034 Ga0496104_1101758
2035 Ga0496105_1064456
2036 Ga0496108_0158364
2037 Ga0496108_1780694
2038 Ga0496110_0131071
2039 Ga0496110_0901907
2040 Ga0496111_0265301
2041 Ga0501306_005254
2042 Ga0501306_007098
2043 Ga0501306_011995
2044 Ga0501306_015031
2045 Ga0501306_036894
2046 Ga0501308_000724
2047 Ga0501308_002471
2048 Ga0501308_003669
2049 Ga0501308_025384
2050 Ga0501308_030669
2051 Ga0501309_004409
2052 Ga0501309_006097
2053 Ga0501309_029601
2054 Ga0501310_008402
2055 Ga0501310_017992
2056 Ga0501310_020532
2057 Ga0501310_072876
2058 Ga0501341_03273
2059 Ga0501343_004442
2060 Ga0501343_008419
2061 Ga0501344_07553
2062 Ga0501304_002005
2063 Ga0501304_006956
2064 Ga0501305_000918
2065 Ga0501305_003905
2066 Ga0501305_014229
2067 Ga0501305_021427
2068 Ga0501305_038014
2069 Ga0501307_001810
2070 Ga0501307_006326
2071 Ga0501307_020375
2072 Ga0501307_036545
2073 Ga0501307_071145
2074 Ga0501297_075382
2075 Ga0501311_002005
2076 Ga0501311_009005
2077 Ga0501311_017129
2078 Ga0501311_021215
2079 Ga0501312_003742
2080 Ga0501312_003877
2081 Ga0501312_009338
2082 Ga0501312_021281
2083 Ga0501313_000530
2084 Ga0501313_004747
2085 Ga0501313_009702
2086 Ga0501313_024321
2087 Ga0501314_019095
2088 Ga0501315_004451
2089 Ga0501315_007467
2090 Ga0501315_008378
2091 Ga0501315_011678
2092 Ga0501315_029348
2093 Ga0501315_032842
2094 Ga0501316_000565
2095 Ga0501316_010922
2096 Ga0501316_012207
2097 Ga0501316_037104
2098 Ga0501316_056265
2099 Ga0501317_017020
2100 Ga0501317_050641
2101 Ga0501317_084668
2102 Ga0501320_002608
2103 Ga0501320_013151
2104 Ga0501321_003706
2105 Ga0501321_018127
2106 Ga0501322_027968
2107 Ga0501323_002763
2108 Ga0501323_023498
2109 Ga0501324_035978
2110 Ga0501325_043579
2111 Ga0501327_08233
2112 Ga0501327_17119
2113 Ga0501327_19234
2114 Ga0501328_10356
2115 Ga0501329_05041
2116 Ga0501329_14524
2117 Ga0501330_003707
2118 Ga0501331_14064
2119 Ga0501332_16924
2120 Ga0501334_03053
2121 Ga0501334_06500
2122 Ga0501334_20894
2123 Ga0501335_003049
2124 Ga0501335_005666
2125 Ga0501335_008277
2126 Ga0501335_011144
2127 Ga0501335_021015
2128 Ga0501335_037599
2129 Ga0501336_007753
2130 Ga0501337_003392
2131 Ga0501337_005126
2132 Ga0501337_006563
2133 Ga0501340_009762
2134 Ga0501033_0062825
2135 Ga0501034_0002020
2136 Ga0501034_0282372
2137 Ga0501043_0038700
2138 Ga0501043_0267933
2139 Ga0501047_0845703
2140 Ga0501070_0230182
2141 Ga0501198_012021
2142 Ga0501198_020209
2143 Ga0501201_002320
2144 Ga0501202_000998
2145 Ga0501202_009088
2146 Ga0501202_024862
2147 Ga0501202_194712
2148 Ga0501207_020378
2149 Ga0501216_192811
2150 Ga0501217_005840
2151 Ga0501222_060407
2152 Ga0501223_003765
2153 Ga0501224_006724
2154 Ga0501227_171571
2155 Ga0501235_003091
2156 Ga0501235_028546
2157 Ga0501242_009393
2158 Ga0501242_019701
2159 Ga0501243_002414
2160 Ga0501252_003343
2161 Ga0501259_106647
2162 Ga0501261_001010
2163 Ga0501221_088004
2164 Ga0501221_151874
2165 Ga0501225_0004957
2166 Ga0501225_0014988
2167 Ga0501245_018897
2168 Ga0501080_0143181
2169 Ga0501083_0085302
2170 Ga0501083_0810808
2171 Ga0501232_030337
2172 Ga0501241_000113
2173 Ga0501264_013457
2174 Ga0501266_037834
2175 Ga0501268_009295
2176 Ga0501270_173804
2177 Ga0501271_039440
2178 Ga0501035_0112953
2179 Ga0501035_0725096
2180 Ga0501044_0199920
2181 Ga0501212_044539
2182 Ga0501212_123430
2183 nmdc:mga03683_410947_c1
2184 nmdc:mga0k408_12089_c1
2185 nmdc:mga0k408_254901_c1
2186 nmdc:mga0k408_431124_c1
2187 nmdc:mga0k408_674576_c1
2188 nmdc:mga0k408_7017_c1
2189 nmdc:mga0k408_9728_c1
2190 nmdc:mga07m45_122077_c1
2191 nmdc:mga07m45_122395_c1
2192 nmdc:mga07m45_219335_c1
2193 nmdc:mga07m45_380682_c1
2194 nmdc:mga08y16_106009_c1
2195 nmdc:mga08y16_26169_c1
2196 nmdc:mga0sz30_296382_c1
2197 Ga0500646_0007315
2198 Ga0500646_0087139
2199 Ga0500583_0004184
2200 Ga0500651_0300017
2201 Ga0500641_0061245
2202 Ga0500621_155407
2203 Ga0500628_021680
2204 Ga0500628_212728
2205 Ga0500642_0007688
2206 Ga0500642_0429397
2207 Ga0500655_034538
2208 Ga0500655_059390
2209 Ga0500568_0000439
2210 Ga0500568_0047775
2211 Ga0500588_0064267
2212 Ga0500588_0370740
2213 Ga0500622_0001823
2214 Ga0587109_044136
2215 Ga0587069_054570
2216 Ga0587079_000249

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

4

94

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jil-assembly1.cif.gz_T 70s ribosome flavobacterium johnsoniae 0.8929 5 93
7jil-assembly1.cif.gz_T 70s ribosome flavobacterium johnsoniae 0.8735 5 93
4v3p-assembly1.cif.gz_LX the molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes 0.8487 5 90
7r72-assembly1.cif.gz_X state e1 nucleolar 60s ribosome biogenesis intermediate - spb4 local model 0.8442 2 90
6th6-assembly1.cif.gz_BW cryo-em structure of t. kodakarensis 70s ribosome 0.8404 4 90
ID Description Score Start End Superfamily
af_D3ZFK7_36_158_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8512 1 90 3.30.70.330
4qs3X00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.817 1 93 3.30.70.330
3o5hW01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8145 5 88 3.30.70.330
5x8tU01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8145 5 90 3.30.70.330
4ukhK00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8124 2 90 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A4R5UZK0-F1-model_v4 Large ribosomal subunit protein uL23 0.9121 4 95 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2N3IDD6-F1-model_v4 Large ribosomal subunit protein uL23 0.9054 4 98 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7V5GYY9-F1-model_v4 Large ribosomal subunit protein uL23 0.8964 4 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A424SEI0-F1-model_v4 deleted 0.8938 4 95
AF-A0A0G0GY83-F1-model_v4 Large ribosomal subunit protein uL23 0.8927 4 92 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map