F490178
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1108 | 341 | 2216 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300003300|Ga0006758J48902_1026128|Ga0006758J48902_10261281 |
| Length | 98 |
| Sequence | MMSIIIKKPIITEKATAANENGSFAFEVDRKANKLEIKSAVEKMYGVHVVNVRTLTYGGGKSSTKFTNRGVVEQKSRVWKKAIVTVAEGETIDLFNNF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003300 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 109 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 177 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 178 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 179 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 180 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 181 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 182 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 183 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 185 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 186 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 187 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 188 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 189 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 197 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 198 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 199 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 200 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 207 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 208 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 209 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 210 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 213 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 218 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 219 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 220 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 221 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 222 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 223 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 224 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 225 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 226 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 227 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 228 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 231 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 236 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 263 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049544 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 293 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 294 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 295 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 296 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 297 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 298 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 299 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 300 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 301 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 302 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 303 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 305 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 306 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 307 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 308 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 309 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 310 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049757 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control | Metagenome | Rhizosphere |
| 314 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 315 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 316 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 317 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 318 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 319 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 323 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 324 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 325 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 326 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 328 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 329 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 330 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 331 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 332 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 333 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 334 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 335 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 338 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 339 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.97 |
| Metatranscriptomes | 9.03 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.52 |
| Nodule | 0 |
| Rhizoplane | 1.26 |
| Rhizosphere | 92.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0006758J48902_1026128 | 3300003300 | Bacteria | 713 |
| 2 | SwRhRL2b_contig_3008347 | 2162886007 | Bacteria | 6907 |
| 3 | JGI24740J21852_10014244 | 3300001979 | Bacteria | 2940 |
| 4 | JGI24743J22301_10055630 | 3300001991 | Bacteria | 810 |
| 5 | JGI24743J22301_10098335 | 3300001991 | Bacteria | 629 |
| 6 | JGI24744J21845_10033386 | 3300002077 | Bacteria | 979 |
| 7 | JGI24744J21845_10053292 | 3300002077 | Bacteria | 744 |
| 8 | JGI24035J26624_1018180 | 3300002126 | Bacteria | 731 |
| 9 | JGI24751J29686_10101010 | 3300002459 | Bacteria | 602 |
| 10 | rootL2_10116652 | 3300003322 | Bacteria | 1119 |
| 11 | rootH1_10165256 | 3300003323 | Bacteria | 1164 |
| 12 | JGI25160J50197_1001095 | 3300003354 | Bacteria | 13838 |
| 13 | Ga0058860_11446600 | 3300004801 | Bacteria | 628 |
| 14 | Ga0065704_10073668 | 3300005289 | Bacteria | 6906 |
| 15 | Ga0065704_10864758 | 3300005289 | Unclassified | 505 |
| 16 | Ga0065712_10002231 | 3300005290 | Bacteria | 7385 |
| 17 | Ga0065712_10027689 | 3300005290 | Bacteria | 1632 |
| 18 | Ga0065712_10071904 | 3300005290 | Bacteria | 4987 |
| 19 | Ga0065712_10309141 | 3300005290 | Unclassified | 847 |
| 20 | Ga0065712_10570103 | 3300005290 | Bacteria | 607 |
| 21 | Ga0065712_10573321 | 3300005290 | Bacteria | 605 |
| 22 | Ga0065712_10581230 | 3300005290 | Bacteria | 601 |
| 23 | Ga0065715_10284656 | 3300005293 | Bacteria | 1077 |
| 24 | Ga0065715_10517905 | 3300005293 | Unclassified | 766 |
| 25 | Ga0065707_10185518 | 3300005295 | Unclassified | 1391 |
| 26 | Ga0065707_10364924 | 3300005295 | Bacteria | 898 |
| 27 | Ga0070658_10016405 | 3300005327 | Bacteria | 5927 |
| 28 | Ga0070658_10052865 | 3300005327 | Bacteria | 3295 |
| 29 | Ga0070658_10503106 | 3300005327 | Bacteria | 1047 |
| 30 | Ga0070658_10513272 | 3300005327 | Bacteria | 1036 |
| 31 | Ga0070658_10621450 | 3300005327 | Bacteria | 937 |
| 32 | Ga0070658_10772366 | 3300005327 | Bacteria | 835 |
| 33 | Ga0070676_10006513 | 3300005328 | Bacteria | 6238 |
| 34 | Ga0070676_10031672 | 3300005328 | Bacteria | 3024 |
| 35 | Ga0070676_10032136 | 3300005328 | Bacteria | 3005 |
| 36 | Ga0070676_10203637 | 3300005328 | Bacteria | 1299 |
| 37 | Ga0070683_100001488 | 3300005329 | Bacteria | 18077 |
| 38 | Ga0070683_100025159 | 3300005329 | Bacteria | 5342 |
| 39 | Ga0070683_100975849 | 3300005329 | Bacteria | 813 |
| 40 | Ga0070683_101938102 | 3300005329 | Unclassified | 566 |
| 41 | Ga0070690_100006100 | 3300005330 | Bacteria | 6823 |
| 42 | Ga0070690_100256936 | 3300005330 | Bacteria | 1238 |
| 43 | Ga0070670_100024841 | 3300005331 | Bacteria | 5155 |
| 44 | Ga0070670_100068133 | 3300005331 | Bacteria | 3054 |
| 45 | Ga0070670_100108356 | 3300005331 | Bacteria | 2393 |
| 46 | Ga0070670_100109804 | 3300005331 | Bacteria | 2376 |
| 47 | Ga0070670_100128199 | 3300005331 | Bacteria | 2190 |
| 48 | Ga0070670_100141351 | 3300005331 | Bacteria | 2082 |
| 49 | Ga0070670_100149270 | 3300005331 | Bacteria | 2023 |
| 50 | Ga0070670_100734964 | 3300005331 | Bacteria | 889 |
| 51 | Ga0070670_101037207 | 3300005331 | Bacteria | 746 |
| 52 | Ga0070670_101683616 | 3300005331 | Bacteria | 583 |
| 53 | Ga0070677_10007599 | 3300005333 | Bacteria | 3624 |
| 54 | Ga0070677_10016481 | 3300005333 | Bacteria | 2632 |
| 55 | Ga0070677_10043990 | 3300005333 | Bacteria | 1775 |
| 56 | Ga0068869_100010127 | 3300005334 | Bacteria | 6135 |
| 57 | Ga0068869_100044651 | 3300005334 | Bacteria | 3187 |
| 58 | Ga0068869_100086467 | 3300005334 | Bacteria | 2350 |
| 59 | Ga0068869_100093571 | 3300005334 | Bacteria | 2265 |
| 60 | Ga0068869_100238893 | 3300005334 | Bacteria | 1447 |
| 61 | Ga0068869_100269398 | 3300005334 | Bacteria | 1366 |
| 62 | Ga0068869_100855269 | 3300005334 | Bacteria | 785 |
| 63 | Ga0070666_10000036 | 3300005335 | Bacteria | 119230 |
| 64 | Ga0070666_10018000 | 3300005335 | Bacteria | 4535 |
| 65 | Ga0070666_10150569 | 3300005335 | Bacteria | 1623 |
| 66 | Ga0070666_10224919 | 3300005335 | Bacteria | 1324 |
| 67 | Ga0070666_10360216 | 3300005335 | Unclassified | 1042 |
| 68 | Ga0070666_11328143 | 3300005335 | Bacteria | 537 |
| 69 | Ga0070666_11436219 | 3300005335 | Bacteria | 516 |
| 70 | Ga0070680_100444354 | 3300005336 | Bacteria | 1107 |
| 71 | Ga0070680_100467387 | 3300005336 | Unclassified | 1078 |
| 72 | Ga0070682_100781403 | 3300005337 | Unclassified | 774 |
| 73 | Ga0068868_100007778 | 3300005338 | Bacteria | 7649 |
| 74 | Ga0068868_100015404 | 3300005338 | Bacteria | 5654 |
| 75 | Ga0068868_100031254 | 3300005338 | Bacteria | 4088 |
| 76 | Ga0068868_100055794 | 3300005338 | Bacteria | 3118 |
| 77 | Ga0068868_100111940 | 3300005338 | Bacteria | 2219 |
| 78 | Ga0068868_100120776 | 3300005338 | Bacteria | 2137 |
| 79 | Ga0068868_100179890 | 3300005338 | Bacteria | 1754 |
| 80 | Ga0068868_100245999 | 3300005338 | Bacteria | 1504 |
| 81 | Ga0068868_100433503 | 3300005338 | Unclassified | 1140 |
| 82 | Ga0068868_101381635 | 3300005338 | Bacteria | 656 |
| 83 | Ga0070660_100218767 | 3300005339 | Bacteria | 1548 |
| 84 | Ga0070660_101112947 | 3300005339 | Unclassified | 669 |
| 85 | Ga0070660_101351378 | 3300005339 | Bacteria | 605 |
| 86 | Ga0070689_100021681 | 3300005340 | Bacteria | 4787 |
| 87 | Ga0070689_100076504 | 3300005340 | Bacteria | 2622 |
| 88 | Ga0070689_100196748 | 3300005340 | Bacteria | 1644 |
| 89 | Ga0070687_100003733 | 3300005343 | Bacteria | 5966 |
| 90 | Ga0070687_100035905 | 3300005343 | Bacteria | 2466 |
| 91 | Ga0070687_100036372 | 3300005343 | Bacteria | 2453 |
| 92 | Ga0070687_100636839 | 3300005343 | Bacteria | 737 |
| 93 | Ga0070687_100898664 | 3300005343 | Bacteria | 635 |
| 94 | Ga0070687_101180761 | 3300005343 | Bacteria | 563 |
| 95 | Ga0070661_100004113 | 3300005344 | Bacteria | 10031 |
| 96 | Ga0070661_100708537 | 3300005344 | Bacteria | 821 |
| 97 | Ga0070661_101763575 | 3300005344 | Unclassified | 525 |
| 98 | Ga0070668_100017989 | 3300005347 | Bacteria | 5302 |
| 99 | Ga0070668_100025286 | 3300005347 | Bacteria | 4500 |
| 100 | Ga0070668_100226019 | 3300005347 | Bacteria | 1546 |
| 101 | Ga0070668_100385802 | 3300005347 | Bacteria | 1193 |
| 102 | Ga0070668_101117215 | 3300005347 | Bacteria | 712 |
| 103 | Ga0070668_101220418 | 3300005347 | Bacteria | 682 |
| 104 | Ga0070669_100002748 | 3300005353 | Bacteria | 12690 |
| 105 | Ga0070669_100024124 | 3300005353 | Bacteria | 4359 |
| 106 | Ga0070669_100685911 | 3300005353 | Bacteria | 864 |
| 107 | Ga0070669_100876720 | 3300005353 | Bacteria | 766 |
| 108 | Ga0070669_101980349 | 3300005353 | Bacteria | 509 |
| 109 | Ga0070675_100018472 | 3300005354 | Bacteria | 5550 |
| 110 | Ga0070675_100027474 | 3300005354 | Bacteria | 4571 |
| 111 | Ga0070675_100090601 | 3300005354 | Bacteria | 2561 |
| 112 | Ga0070675_100129605 | 3300005354 | Bacteria | 2148 |
| 113 | Ga0070675_100143049 | 3300005354 | Bacteria | 2046 |
| 114 | Ga0070675_100182345 | 3300005354 | Bacteria | 1816 |
| 115 | Ga0070675_100449057 | 3300005354 | Unclassified | 1156 |
| 116 | Ga0070675_100580047 | 3300005354 | Unclassified | 1016 |
| 117 | Ga0070675_100610327 | 3300005354 | Bacteria | 990 |
| 118 | Ga0070675_101926560 | 3300005354 | Unclassified | 545 |
| 119 | Ga0070671_100002367 | 3300005355 | Bacteria | 14557 |
| 120 | Ga0070671_100030657 | 3300005355 | Bacteria | 4438 |
| 121 | Ga0070671_100051676 | 3300005355 | Bacteria | 3418 |
| 122 | Ga0070671_100069502 | 3300005355 | Bacteria | 2937 |
| 123 | Ga0070671_100231072 | 3300005355 | Bacteria | 1569 |
| 124 | Ga0070671_100463920 | 3300005355 | Bacteria | 1087 |
| 125 | Ga0070671_101044821 | 3300005355 | Bacteria | 717 |
| 126 | Ga0070674_100085764 | 3300005356 | Bacteria | 2260 |
| 127 | Ga0070674_100141927 | 3300005356 | Bacteria | 1803 |
| 128 | Ga0070674_100142571 | 3300005356 | Bacteria | 1800 |
| 129 | Ga0070674_100728347 | 3300005356 | Bacteria | 850 |
| 130 | Ga0070673_100003757 | 3300005364 | Bacteria | 9520 |
| 131 | Ga0070673_100014827 | 3300005364 | Bacteria | 5449 |
| 132 | Ga0070673_100051881 | 3300005364 | Bacteria | 3215 |
| 133 | Ga0070673_100075958 | 3300005364 | Bacteria | 2711 |
| 134 | Ga0070673_100264445 | 3300005364 | Bacteria | 1504 |
| 135 | Ga0070673_100344753 | 3300005364 | Bacteria | 1321 |
| 136 | Ga0070673_100463534 | 3300005364 | Bacteria | 1141 |
| 137 | Ga0070673_100942301 | 3300005364 | Bacteria | 802 |
| 138 | Ga0070688_100018933 | 3300005365 | Bacteria | 3981 |
| 139 | Ga0070688_100176818 | 3300005365 | Bacteria | 1477 |
| 140 | Ga0070688_100592206 | 3300005365 | Bacteria | 848 |
| 141 | Ga0070688_101412615 | 3300005365 | Bacteria | 564 |
| 142 | Ga0070659_100023726 | 3300005366 | Bacteria | 4697 |
| 143 | Ga0070659_100213818 | 3300005366 | Bacteria | 1589 |
| 144 | Ga0070659_100509157 | 3300005366 | Bacteria | 1027 |
| 145 | Ga0070659_100839154 | 3300005366 | Unclassified | 800 |
| 146 | Ga0070659_101582565 | 3300005366 | Bacteria | 585 |
| 147 | Ga0070667_100001551 | 3300005367 | Bacteria | 20596 |
| 148 | Ga0070667_100004111 | 3300005367 | Bacteria | 12319 |
| 149 | Ga0070667_100176643 | 3300005367 | Bacteria | 1887 |
| 150 | Ga0070667_100255813 | 3300005367 | Bacteria | 1567 |
| 151 | Ga0070667_100730644 | 3300005367 | Bacteria | 917 |
| 152 | Ga0070667_100752615 | 3300005367 | Bacteria | 903 |
| 153 | Ga0070667_100952039 | 3300005367 | Bacteria | 800 |
| 154 | Ga0070667_101004097 | 3300005367 | Unclassified | 779 |
| 155 | Ga0070667_101738477 | 3300005367 | Bacteria | 587 |
| 156 | Ga0070701_10094050 | 3300005438 | Bacteria | 1648 |
| 157 | Ga0070700_100167615 | 3300005441 | Bacteria | 1518 |
| 158 | Ga0070694_100962921 | 3300005444 | Bacteria | 707 |
| 159 | Ga0070663_100099434 | 3300005455 | Bacteria | 2168 |
| 160 | Ga0070663_101542824 | 3300005455 | Bacteria | 591 |
| 161 | Ga0070663_101567215 | 3300005455 | Bacteria | 587 |
| 162 | Ga0070678_100040792 | 3300005456 | Bacteria | 3286 |
| 163 | Ga0070678_100047685 | 3300005456 | Bacteria | 3080 |
| 164 | Ga0070678_100051388 | 3300005456 | Bacteria | 2987 |
| 165 | Ga0070678_100302857 | 3300005456 | Bacteria | 1359 |
| 166 | Ga0070678_100850439 | 3300005456 | Bacteria | 831 |
| 167 | Ga0070678_100897988 | 3300005456 | Bacteria | 810 |
| 168 | Ga0070678_100939312 | 3300005456 | Bacteria | 792 |
| 169 | Ga0070678_101282815 | 3300005456 | Bacteria | 681 |
| 170 | Ga0070678_101503270 | 3300005456 | Bacteria | 631 |
| 171 | Ga0070662_100004284 | 3300005457 | Bacteria | 9007 |
| 172 | Ga0070662_100033746 | 3300005457 | Bacteria | 3605 |
| 173 | Ga0070662_100140628 | 3300005457 | Bacteria | 1870 |
| 174 | Ga0070662_100416202 | 3300005457 | Bacteria | 1111 |
| 175 | Ga0070662_100820712 | 3300005457 | Bacteria | 791 |
| 176 | Ga0070662_100952639 | 3300005457 | Unclassified | 734 |
| 177 | Ga0070681_10134747 | 3300005458 | Bacteria | 2401 |
| 178 | Ga0070681_10639080 | 3300005458 | Unclassified | 979 |
| 179 | Ga0068867_100011837 | 3300005459 | Bacteria | 6162 |
| 180 | Ga0068867_100012130 | 3300005459 | Bacteria | 6086 |
| 181 | Ga0068867_100067838 | 3300005459 | Bacteria | 2661 |
| 182 | Ga0068867_100569397 | 3300005459 | Bacteria | 984 |
| 183 | Ga0068867_100571254 | 3300005459 | Bacteria | 982 |
| 184 | Ga0068867_100708840 | 3300005459 | Unclassified | 889 |
| 185 | Ga0068867_100776836 | 3300005459 | Bacteria | 852 |
| 186 | Ga0068867_100809254 | 3300005459 | Bacteria | 836 |
| 187 | Ga0068867_101043994 | 3300005459 | Unclassified | 743 |
| 188 | Ga0068867_101307042 | 3300005459 | Bacteria | 670 |
| 189 | Ga0070685_10054219 | 3300005466 | Bacteria | 2325 |
| 190 | Ga0070685_10130662 | 3300005466 | Bacteria | 1570 |
| 191 | Ga0070685_10292353 | 3300005466 | Bacteria | 1095 |
| 192 | Ga0070679_100047759 | 3300005530 | Bacteria | 4266 |
| 193 | Ga0070679_100143030 | 3300005530 | Bacteria | 2371 |
| 194 | Ga0070684_100021260 | 3300005535 | Bacteria | 5395 |
| 195 | Ga0070684_100046353 | 3300005535 | Bacteria | 3766 |
| 196 | Ga0070684_100193764 | 3300005535 | Bacteria | 1850 |
| 197 | Ga0070684_101502800 | 3300005535 | Bacteria | 635 |
| 198 | Ga0068853_100104703 | 3300005539 | Bacteria | 2505 |
| 199 | Ga0068853_100107889 | 3300005539 | Bacteria | 2469 |
| 200 | Ga0068853_100233084 | 3300005539 | Bacteria | 1685 |
| 201 | Ga0068853_100413423 | 3300005539 | Unclassified | 1264 |
| 202 | Ga0068853_100476010 | 3300005539 | Unclassified | 1177 |
| 203 | Ga0068853_100521037 | 3300005539 | Bacteria | 1124 |
| 204 | Ga0068853_100713243 | 3300005539 | Bacteria | 957 |
| 205 | Ga0068853_100777143 | 3300005539 | Unclassified | 916 |
| 206 | Ga0068853_100870167 | 3300005539 | Bacteria | 865 |
| 207 | Ga0068853_101195251 | 3300005539 | Bacteria | 734 |
| 208 | Ga0070672_100024315 | 3300005543 | Bacteria | 4475 |
| 209 | Ga0070672_100043706 | 3300005543 | Bacteria | 3457 |
| 210 | Ga0070672_100058329 | 3300005543 | Bacteria | 3033 |
| 211 | Ga0070672_100140671 | 3300005543 | Bacteria | 1990 |
| 212 | Ga0070672_100168509 | 3300005543 | Bacteria | 1820 |
| 213 | Ga0070672_100206540 | 3300005543 | Bacteria | 1644 |
| 214 | Ga0070672_100266877 | 3300005543 | Bacteria | 1444 |
| 215 | Ga0070672_100386054 | 3300005543 | Bacteria | 1198 |
| 216 | Ga0070672_100403174 | 3300005543 | Bacteria | 1172 |
| 217 | Ga0070672_100475521 | 3300005543 | Bacteria | 1078 |
| 218 | Ga0070672_101233852 | 3300005543 | Bacteria | 667 |
| 219 | Ga0070672_101388517 | 3300005543 | Unclassified | 628 |
| 220 | Ga0070686_100018261 | 3300005544 | Bacteria | 4112 |
| 221 | Ga0070686_100456662 | 3300005544 | Bacteria | 983 |
| 222 | Ga0070693_101018167 | 3300005547 | Bacteria | 627 |
| 223 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 224 | Ga0070665_100045444 | 3300005548 | Bacteria | 4410 |
| 225 | Ga0070665_100141768 | 3300005548 | Bacteria | 2406 |
| 226 | Ga0070665_100465756 | 3300005548 | Bacteria | 1274 |
| 227 | Ga0068855_100051562 | 3300005563 | Bacteria | 4847 |
| 228 | Ga0068855_100387372 | 3300005563 | Bacteria | 1534 |
| 229 | Ga0068855_101203178 | 3300005563 | Bacteria | 788 |
| 230 | Ga0068855_102115026 | 3300005563 | Unclassified | 567 |
| 231 | Ga0070664_100084099 | 3300005564 | Bacteria | 2746 |
| 232 | Ga0070664_100138809 | 3300005564 | Bacteria | 2139 |
| 233 | Ga0070664_100298364 | 3300005564 | Bacteria | 1456 |
| 234 | Ga0070664_100601421 | 3300005564 | Bacteria | 1020 |
| 235 | Ga0070664_100966040 | 3300005564 | Bacteria | 800 |
| 236 | Ga0070664_101050047 | 3300005564 | Bacteria | 766 |
| 237 | Ga0070664_101525755 | 3300005564 | Unclassified | 632 |
| 238 | Ga0068857_100040938 | 3300005577 | Bacteria | 4107 |
| 239 | Ga0068857_100081626 | 3300005577 | Bacteria | 2887 |
| 240 | Ga0068857_100119536 | 3300005577 | Bacteria | 2372 |
| 241 | Ga0068857_101626312 | 3300005577 | Bacteria | 631 |
| 242 | Ga0068854_100048602 | 3300005578 | Bacteria | 3027 |
| 243 | Ga0068854_100057516 | 3300005578 | Bacteria | 2805 |
| 244 | Ga0068854_100172563 | 3300005578 | Bacteria | 1684 |
| 245 | Ga0068854_100173312 | 3300005578 | Bacteria | 1680 |
| 246 | Ga0068854_100258297 | 3300005578 | Bacteria | 1394 |
| 247 | Ga0068854_100334396 | 3300005578 | Bacteria | 1235 |
| 248 | Ga0068854_100473774 | 3300005578 | Unclassified | 1050 |
| 249 | Ga0068856_100183027 | 3300005614 | Bacteria | 2109 |
| 250 | Ga0068856_100292741 | 3300005614 | Bacteria | 1645 |
| 251 | Ga0070702_100290266 | 3300005615 | Bacteria | 1127 |
| 252 | Ga0070702_101098828 | 3300005615 | Bacteria | 635 |
| 253 | Ga0068852_100025622 | 3300005616 | Bacteria | 4781 |
| 254 | Ga0068852_100074305 | 3300005616 | Bacteria | 2993 |
| 255 | Ga0068852_100087742 | 3300005616 | Bacteria | 2776 |
| 256 | Ga0068852_100160380 | 3300005616 | Bacteria | 2099 |
| 257 | Ga0068852_100176883 | 3300005616 | Bacteria | 2004 |
| 258 | Ga0068852_100402852 | 3300005616 | Bacteria | 1346 |
| 259 | Ga0068852_100555142 | 3300005616 | Bacteria | 1149 |
| 260 | Ga0068852_100559595 | 3300005616 | Bacteria | 1145 |
| 261 | Ga0068852_100649864 | 3300005616 | Bacteria | 1062 |
| 262 | Ga0068852_101084683 | 3300005616 | Unclassified | 821 |
| 263 | Ga0068852_101555485 | 3300005616 | Bacteria | 684 |
| 264 | Ga0068859_100000037 | 3300005617 | Bacteria | 165480 |
| 265 | Ga0068859_100002491 | 3300005617 | Bacteria | 18742 |
| 266 | Ga0068859_100040242 | 3300005617 | Bacteria | 4692 |
| 267 | Ga0068859_100090094 | 3300005617 | Bacteria | 3118 |
| 268 | Ga0068859_100226291 | 3300005617 | Bacteria | 1958 |
| 269 | Ga0068859_100272899 | 3300005617 | Bacteria | 1783 |
| 270 | Ga0068859_101902345 | 3300005617 | Bacteria | 657 |
| 271 | Ga0068864_100002302 | 3300005618 | Bacteria | 15797 |
| 272 | Ga0068864_100005468 | 3300005618 | Bacteria | 10419 |
| 273 | Ga0068864_100259859 | 3300005618 | Bacteria | 1615 |
| 274 | Ga0068864_102353715 | 3300005618 | Bacteria | 539 |
| 275 | Ga0068866_10069033 | 3300005718 | Bacteria | 1860 |
| 276 | Ga0068866_10226426 | 3300005718 | Bacteria | 1131 |
| 277 | Ga0068861_100006643 | 3300005719 | Bacteria | 7895 |
| 278 | Ga0068861_100051617 | 3300005719 | Bacteria | 3122 |
| 279 | Ga0068861_100121125 | 3300005719 | Bacteria | 2111 |
| 280 | Ga0068861_100205571 | 3300005719 | Bacteria | 1656 |
| 281 | Ga0068851_10026971 | 3300005834 | Bacteria | 2828 |
| 282 | Ga0068851_10072821 | 3300005834 | Bacteria | 1781 |
| 283 | Ga0068851_10115664 | 3300005834 | Bacteria | 1437 |
| 284 | Ga0068851_10208554 | 3300005834 | Bacteria | 1093 |
| 285 | Ga0068851_10424958 | 3300005834 | Unclassified | 785 |
| 286 | Ga0068851_10940785 | 3300005834 | Unclassified | 543 |
| 287 | Ga0068870_10021607 | 3300005840 | Bacteria | 3151 |
| 288 | Ga0068870_10025073 | 3300005840 | Bacteria | 2958 |
| 289 | Ga0068863_100002925 | 3300005841 | Bacteria | 16912 |
| 290 | Ga0068863_100012295 | 3300005841 | Bacteria | 8263 |
| 291 | Ga0068863_100088110 | 3300005841 | Bacteria | 2941 |
| 292 | Ga0068863_100480284 | 3300005841 | Bacteria | 1222 |
| 293 | Ga0068863_100536380 | 3300005841 | Bacteria | 1154 |
| 294 | Ga0068863_100940042 | 3300005841 | Bacteria | 866 |
| 295 | Ga0068863_102051060 | 3300005841 | Unclassified | 582 |
| 296 | Ga0068858_100004320 | 3300005842 | Bacteria | 13960 |
| 297 | Ga0068858_100309206 | 3300005842 | Bacteria | 1509 |
| 298 | Ga0068858_100355242 | 3300005842 | Bacteria | 1404 |
| 299 | Ga0068860_100000097 | 3300005843 | Bacteria | 146573 |
| 300 | Ga0068860_100005547 | 3300005843 | Bacteria | 12773 |
| 301 | Ga0068860_100018429 | 3300005843 | Bacteria | 6791 |
| 302 | Ga0068860_100030843 | 3300005843 | Bacteria | 5154 |
| 303 | Ga0068860_100080452 | 3300005843 | Bacteria | 3098 |
| 304 | Ga0068860_100280934 | 3300005843 | Bacteria | 1627 |
| 305 | Ga0068860_100557473 | 3300005843 | Unclassified | 1148 |
| 306 | Ga0068860_100642466 | 3300005843 | Bacteria | 1069 |
| 307 | Ga0068860_100716166 | 3300005843 | Unclassified | 1011 |
| 308 | Ga0068860_102791755 | 3300005843 | Unclassified | 506 |
| 309 | Ga0068862_100015311 | 3300005844 | Bacteria | 6369 |
| 310 | Ga0068862_100418423 | 3300005844 | Bacteria | 1257 |
| 311 | Ga0068862_100558485 | 3300005844 | Bacteria | 1094 |
| 312 | Ga0068862_100643661 | 3300005844 | Unclassified | 1022 |
| 313 | Ga0068862_101334736 | 3300005844 | Bacteria | 719 |
| 314 | Ga0068862_101652122 | 3300005844 | Bacteria | 648 |
| 315 | Ga0075369_10254845 | 3300006186 | Bacteria | 815 |
| 316 | Ga0075366_10031189 | 3300006195 | Bacteria | 3136 |
| 317 | Ga0075366_10195492 | 3300006195 | Bacteria | 1229 |
| 318 | Ga0075366_10901792 | 3300006195 | Bacteria | 551 |
| 319 | Ga0097621_100031668 | 3300006237 | Bacteria | 4198 |
| 320 | Ga0097621_100096686 | 3300006237 | Bacteria | 2478 |
| 321 | Ga0097621_100522164 | 3300006237 | Bacteria | 1078 |
| 322 | Ga0097621_101210662 | 3300006237 | Bacteria | 711 |
| 323 | Ga0097621_101273636 | 3300006237 | Bacteria | 694 |
| 324 | Ga0097621_101439090 | 3300006237 | Bacteria | 653 |
| 325 | Ga0075370_10048107 | 3300006353 | Bacteria | 2416 |
| 326 | Ga0075370_10236804 | 3300006353 | Bacteria | 1081 |
| 327 | Ga0075370_10302193 | 3300006353 | Bacteria | 952 |
| 328 | Ga0075370_10902394 | 3300006353 | Bacteria | 540 |
| 329 | Ga0068871_100084017 | 3300006358 | Bacteria | 2641 |
| 330 | Ga0068871_100306332 | 3300006358 | Bacteria | 1395 |
| 331 | Ga0068871_100370632 | 3300006358 | Bacteria | 1270 |
| 332 | Ga0068871_100431115 | 3300006358 | Bacteria | 1179 |
| 333 | Ga0068871_100856262 | 3300006358 | Bacteria | 840 |
| 334 | Ga0068871_101093666 | 3300006358 | Bacteria | 745 |
| 335 | Ga0068871_101575444 | 3300006358 | Bacteria | 622 |
| 336 | Ga0068871_101774423 | 3300006358 | Bacteria | 586 |
| 337 | Ga0075428_100140238 | 3300006844 | Bacteria | 2628 |
| 338 | Ga0075428_101738542 | 3300006844 | Bacteria | 650 |
| 339 | Ga0075429_100339821 | 3300006880 | Bacteria | 1314 |
| 340 | Ga0068865_100038915 | 3300006881 | Bacteria | 3222 |
| 341 | Ga0068865_100089701 | 3300006881 | Bacteria | 2227 |
| 342 | Ga0068865_100167631 | 3300006881 | Bacteria | 1681 |
| 343 | Ga0068865_101489453 | 3300006881 | Bacteria | 606 |
| 344 | Ga0097620_100000037 | 3300006931 | Bacteria | 165480 |
| 345 | Ga0097620_100002491 | 3300006931 | Bacteria | 18742 |
| 346 | Ga0097620_100040243 | 3300006931 | Bacteria | 4692 |
| 347 | Ga0097620_100090092 | 3300006931 | Bacteria | 3118 |
| 348 | Ga0097620_100226288 | 3300006931 | Bacteria | 1958 |
| 349 | Ga0097620_100272888 | 3300006931 | Bacteria | 1783 |
| 350 | Ga0097620_101902697 | 3300006931 | Bacteria | 657 |
| 351 | Ga0105251_10238546 | 3300009011 | Bacteria | 819 |
| 352 | Ga0105240_10011002 | 3300009093 | Bacteria | 12667 |
| 353 | Ga0105240_10023972 | 3300009093 | Bacteria | 8060 |
| 354 | Ga0105240_10078219 | 3300009093 | Bacteria | 4073 |
| 355 | Ga0105240_10100052 | 3300009093 | Bacteria | 3528 |
| 356 | Ga0105240_10331805 | 3300009093 | Bacteria | 1730 |
| 357 | Ga0105240_10943101 | 3300009093 | Unclassified | 926 |
| 358 | Ga0105240_11006892 | 3300009093 | Bacteria | 891 |
| 359 | Ga0105240_11357741 | 3300009093 | Bacteria | 748 |
| 360 | Ga0111539_10014550 | 3300009094 | Bacteria | 9824 |
| 361 | Ga0111539_10044551 | 3300009094 | Bacteria | 5315 |
| 362 | Ga0105245_10196069 | 3300009098 | Bacteria | 1937 |
| 363 | Ga0105245_10421275 | 3300009098 | Bacteria | 1338 |
| 364 | Ga0105245_12492681 | 3300009098 | Unclassified | 571 |
| 365 | Ga0105247_10015344 | 3300009101 | Bacteria | 4589 |
| 366 | Ga0114129_10511551 | 3300009147 | Bacteria | 1567 |
| 367 | Ga0105243_13099013 | 3300009148 | Unclassified | 503 |
| 368 | Ga0105241_10007590 | 3300009174 | Bacteria | 7975 |
| 369 | Ga0105241_10014100 | 3300009174 | Bacteria | 5856 |
| 370 | Ga0105241_10037723 | 3300009174 | Bacteria | 3640 |
| 371 | Ga0105241_10265755 | 3300009174 | Bacteria | 1459 |
| 372 | Ga0105241_10629530 | 3300009174 | Bacteria | 972 |
| 373 | Ga0105241_10634974 | 3300009174 | Unclassified | 968 |
| 374 | Ga0105241_10824349 | 3300009174 | Bacteria | 856 |
| 375 | Ga0105241_10849170 | 3300009174 | Bacteria | 844 |
| 376 | Ga0105241_11150865 | 3300009174 | Unclassified | 733 |
| 377 | Ga0105241_11208157 | 3300009174 | Unclassified | 716 |
| 378 | Ga0105241_11829482 | 3300009174 | Bacteria | 593 |
| 379 | Ga0105242_10045717 | 3300009176 | Bacteria | 3549 |
| 380 | Ga0105242_10200555 | 3300009176 | Bacteria | 1772 |
| 381 | Ga0105242_10259499 | 3300009176 | Bacteria | 1569 |
| 382 | Ga0105242_11077188 | 3300009176 | Bacteria | 816 |
| 383 | Ga0105242_11077762 | 3300009176 | Bacteria | 816 |
| 384 | Ga0105248_11592813 | 3300009177 | Bacteria | 740 |
| 385 | Ga0105248_11648581 | 3300009177 | Bacteria | 727 |
| 386 | Ga0105237_10001588 | 3300009545 | Bacteria | 29579 |
| 387 | Ga0105237_10001799 | 3300009545 | Bacteria | 27692 |
| 388 | Ga0105237_10014365 | 3300009545 | Bacteria | 8285 |
| 389 | Ga0105237_10030759 | 3300009545 | Bacteria | 5450 |
| 390 | Ga0105237_10069245 | 3300009545 | Bacteria | 3524 |
| 391 | Ga0105238_10109822 | 3300009551 | Bacteria | 2739 |
| 392 | Ga0105238_10705871 | 3300009551 | Bacteria | 1021 |
| 393 | Ga0105238_11150423 | 3300009551 | Bacteria | 800 |
| 394 | Ga0105238_11180487 | 3300009551 | Bacteria | 789 |
| 395 | Ga0105249_10001080 | 3300009553 | Bacteria | 24205 |
| 396 | Ga0105249_10029956 | 3300009553 | Bacteria | 4916 |
| 397 | Ga0105249_10219506 | 3300009553 | Bacteria | 1870 |
| 398 | Ga0105249_11384925 | 3300009553 | Bacteria | 775 |
| 399 | Ga0105239_10004090 | 3300010375 | Bacteria | 17535 |
| 400 | Ga0105239_10007869 | 3300010375 | Bacteria | 12183 |
| 401 | Ga0105239_10117570 | 3300010375 | Bacteria | 2951 |
| 402 | Ga0105239_10198084 | 3300010375 | Bacteria | 2250 |
| 403 | Ga0105239_10240840 | 3300010375 | Bacteria | 2030 |
| 404 | Ga0105239_10505456 | 3300010375 | Bacteria | 1374 |
| 405 | Ga0105239_10628709 | 3300010375 | Bacteria | 1225 |
| 406 | Ga0105239_10654488 | 3300010375 | Bacteria | 1200 |
| 407 | Ga0105239_10859738 | 3300010375 | Bacteria | 1040 |
| 408 | Ga0105239_11804309 | 3300010375 | Bacteria | 709 |
| 409 | Ga0105239_13621801 | 3300010375 | Bacteria | 502 |
| 410 | Ga0105246_10021096 | 3300011119 | Bacteria | 4187 |
| 411 | Ga0105246_10809389 | 3300011119 | Bacteria | 832 |
| 412 | Ga0157373_10025943 | 3300013100 | Bacteria | 4235 |
| 413 | Ga0157373_10459052 | 3300013100 | Unclassified | 917 |
| 414 | Ga0157373_10764455 | 3300013100 | Bacteria | 711 |
| 415 | Ga0157373_10914537 | 3300013100 | Unclassified | 651 |
| 416 | Ga0157373_11174526 | 3300013100 | Bacteria | 578 |
| 417 | Ga0157371_10023444 | 3300013102 | Bacteria | 4513 |
| 418 | Ga0157371_10024281 | 3300013102 | Bacteria | 4429 |
| 419 | Ga0157371_10054786 | 3300013102 | Bacteria | 2831 |
| 420 | Ga0157371_10054932 | 3300013102 | Bacteria | 2827 |
| 421 | Ga0157371_10054961 | 3300013102 | Bacteria | 2826 |
| 422 | Ga0157371_10212534 | 3300013102 | Bacteria | 1388 |
| 423 | Ga0157371_10389929 | 3300013102 | Bacteria | 1018 |
| 424 | Ga0157371_10401077 | 3300013102 | Bacteria | 1003 |
| 425 | Ga0157371_10633119 | 3300013102 | Bacteria | 797 |
| 426 | Ga0157371_10963758 | 3300013102 | Bacteria | 649 |
| 427 | Ga0157370_10286166 | 3300013104 | Bacteria | 1523 |
| 428 | Ga0157370_10553855 | 3300013104 | Bacteria | 1054 |
| 429 | Ga0157370_10623454 | 3300013104 | Bacteria | 987 |
| 430 | Ga0157370_10816236 | 3300013104 | Unclassified | 848 |
| 431 | Ga0157370_11235191 | 3300013104 | Bacteria | 674 |
| 432 | Ga0157369_10012941 | 3300013105 | Bacteria | 9454 |
| 433 | Ga0157369_10068990 | 3300013105 | Bacteria | 3798 |
| 434 | Ga0157369_10083535 | 3300013105 | Bacteria | 3415 |
| 435 | Ga0157369_10115086 | 3300013105 | Bacteria | 2856 |
| 436 | Ga0157369_10424209 | 3300013105 | Bacteria | 1379 |
| 437 | Ga0157369_10475273 | 3300013105 | Bacteria | 1293 |
| 438 | Ga0157369_10527443 | 3300013105 | Bacteria | 1221 |
| 439 | Ga0157369_12467560 | 3300013105 | Bacteria | 526 |
| 440 | Ga0157374_10000500 | 3300013296 | Bacteria | 35513 |
| 441 | Ga0157374_10008968 | 3300013296 | Bacteria | 8573 |
| 442 | Ga0157374_10121013 | 3300013296 | Bacteria | 2526 |
| 443 | Ga0157374_10126640 | 3300013296 | Bacteria | 2469 |
| 444 | Ga0157374_10229288 | 3300013296 | Bacteria | 1824 |
| 445 | Ga0157374_10270813 | 3300013296 | Bacteria | 1674 |
| 446 | Ga0157374_10498328 | 3300013296 | Bacteria | 1222 |
| 447 | Ga0157374_10535708 | 3300013296 | Bacteria | 1178 |
| 448 | Ga0157374_10706878 | 3300013296 | Unclassified | 1021 |
| 449 | Ga0157378_10021595 | 3300013297 | Bacteria | 5661 |
| 450 | Ga0157378_10076791 | 3300013297 | Bacteria | 3010 |
| 451 | Ga0157378_10131585 | 3300013297 | Bacteria | 2316 |
| 452 | Ga0157378_10246272 | 3300013297 | Bacteria | 1710 |
| 453 | Ga0157378_10526853 | 3300013297 | Bacteria | 1184 |
| 454 | Ga0157378_10593805 | 3300013297 | Unclassified | 1118 |
| 455 | Ga0157378_10813603 | 3300013297 | Bacteria | 961 |
| 456 | Ga0157378_11010441 | 3300013297 | Bacteria | 866 |
| 457 | Ga0157378_11185144 | 3300013297 | Bacteria | 803 |
| 458 | Ga0157378_12484823 | 3300013297 | Bacteria | 570 |
| 459 | Ga0163162_10001189 | 3300013306 | Bacteria | 24282 |
| 460 | Ga0163162_10001595 | 3300013306 | Bacteria | 21212 |
| 461 | Ga0163162_10001867 | 3300013306 | Bacteria | 19821 |
| 462 | Ga0163162_10025579 | 3300013306 | Bacteria | 5834 |
| 463 | Ga0163162_10115627 | 3300013306 | Bacteria | 2783 |
| 464 | Ga0163162_10163494 | 3300013306 | Bacteria | 2349 |
| 465 | Ga0163162_10486635 | 3300013306 | Bacteria | 1365 |
| 466 | Ga0163162_10806314 | 3300013306 | Bacteria | 1056 |
| 467 | Ga0157372_10016323 | 3300013307 | Bacteria | 7968 |
| 468 | Ga0157372_10024284 | 3300013307 | Bacteria | 6581 |
| 469 | Ga0157372_10029769 | 3300013307 | Bacteria | 5966 |
| 470 | Ga0157372_10038201 | 3300013307 | Bacteria | 5298 |
| 471 | Ga0157372_10179557 | 3300013307 | Bacteria | 2450 |
| 472 | Ga0157372_10209283 | 3300013307 | Bacteria | 2260 |
| 473 | Ga0157372_10239188 | 3300013307 | Bacteria | 2106 |
| 474 | Ga0157372_10247490 | 3300013307 | Bacteria | 2069 |
| 475 | Ga0157372_10348328 | 3300013307 | Bacteria | 1726 |
| 476 | Ga0157372_10535402 | 3300013307 | Bacteria | 1365 |
| 477 | Ga0157372_10590069 | 3300013307 | Bacteria | 1295 |
| 478 | Ga0157372_10623253 | 3300013307 | Bacteria | 1257 |
| 479 | Ga0157372_10773148 | 3300013307 | Bacteria | 1116 |
| 480 | Ga0157372_10918512 | 3300013307 | Bacteria | 1015 |
| 481 | Ga0157372_10981587 | 3300013307 | Unclassified | 979 |
| 482 | Ga0157372_11013100 | 3300013307 | Bacteria | 962 |
| 483 | Ga0157372_11410151 | 3300013307 | Bacteria | 803 |
| 484 | Ga0157372_11665603 | 3300013307 | Bacteria | 734 |
| 485 | Ga0157372_11682365 | 3300013307 | Bacteria | 730 |
| 486 | Ga0157372_11982074 | 3300013307 | Bacteria | 669 |
| 487 | Ga0157372_12006511 | 3300013307 | Bacteria | 665 |
| 488 | Ga0157372_12144737 | 3300013307 | Bacteria | 642 |
| 489 | Ga0157375_10012841 | 3300013308 | Bacteria | 7438 |
| 490 | Ga0157375_10082979 | 3300013308 | Bacteria | 3249 |
| 491 | Ga0157375_10090738 | 3300013308 | Bacteria | 3115 |
| 492 | Ga0157375_10094808 | 3300013308 | Bacteria | 3054 |
| 493 | Ga0157375_10095074 | 3300013308 | Bacteria | 3050 |
| 494 | Ga0157375_10153729 | 3300013308 | Bacteria | 2438 |
| 495 | Ga0157375_10208620 | 3300013308 | Bacteria | 2110 |
| 496 | Ga0157375_10226178 | 3300013308 | Bacteria | 2030 |
| 497 | Ga0157375_10376285 | 3300013308 | Bacteria | 1587 |
| 498 | Ga0157375_11255101 | 3300013308 | Bacteria | 870 |
| 499 | Ga0157375_12084896 | 3300013308 | Bacteria | 675 |
| 500 | Ga0163163_10001501 | 3300014325 | Bacteria | 19759 |
| 501 | Ga0163163_10054019 | 3300014325 | Bacteria | 3967 |
| 502 | Ga0163163_10208087 | 3300014325 | Bacteria | 2005 |
| 503 | Ga0163163_10651108 | 3300014325 | Bacteria | 1117 |
| 504 | Ga0163163_11009946 | 3300014325 | Bacteria | 895 |
| 505 | Ga0163163_12430047 | 3300014325 | Bacteria | 582 |
| 506 | Ga0163163_12536167 | 3300014325 | Bacteria | 570 |
| 507 | Ga0157380_10011122 | 3300014326 | Bacteria | 6492 |
| 508 | Ga0157380_10030118 | 3300014326 | Bacteria | 4154 |
| 509 | Ga0157380_10113108 | 3300014326 | Bacteria | 2285 |
| 510 | Ga0157380_10361775 | 3300014326 | Bacteria | 1362 |
| 511 | Ga0157380_12735341 | 3300014326 | Bacteria | 560 |
| 512 | Ga0157380_13437220 | 3300014326 | Unclassified | 507 |
| 513 | Ga0182008_10349774 | 3300014497 | Bacteria | 783 |
| 514 | Ga0157377_10004500 | 3300014745 | Bacteria | 6429 |
| 515 | Ga0157377_10021210 | 3300014745 | Bacteria | 3415 |
| 516 | Ga0157377_10069334 | 3300014745 | Bacteria | 2034 |
| 517 | Ga0157377_10354555 | 3300014745 | Bacteria | 985 |
| 518 | Ga0157377_10579621 | 3300014745 | Unclassified | 797 |
| 519 | Ga0157377_11002115 | 3300014745 | Bacteria | 633 |
| 520 | Ga0157379_10008284 | 3300014968 | Bacteria | 9034 |
| 521 | Ga0157379_10036538 | 3300014968 | Bacteria | 4379 |
| 522 | Ga0157379_10090931 | 3300014968 | Bacteria | 2738 |
| 523 | Ga0157379_10128099 | 3300014968 | Bacteria | 2284 |
| 524 | Ga0157379_10978871 | 3300014968 | Bacteria | 806 |
| 525 | Ga0157376_10013181 | 3300014969 | Bacteria | 6160 |
| 526 | Ga0157376_10232761 | 3300014969 | Bacteria | 1712 |
| 527 | Ga0157376_10438390 | 3300014969 | Bacteria | 1271 |
| 528 | Ga0157376_10858745 | 3300014969 | Bacteria | 923 |
| 529 | Ga0157376_10876601 | 3300014969 | Bacteria | 914 |
| 530 | Ga0157376_11134319 | 3300014969 | Bacteria | 808 |
| 531 | Ga0157376_11584127 | 3300014969 | Bacteria | 689 |
| 532 | Ga0157376_11595799 | 3300014969 | Bacteria | 687 |
| 533 | Ga0157376_12191847 | 3300014969 | Bacteria | 591 |
| 534 | Ga0163161_10013936 | 3300017792 | Bacteria | 5599 |
| 535 | Ga0163161_10076648 | 3300017792 | Bacteria | 2454 |
| 536 | Ga0163161_10185939 | 3300017792 | Bacteria | 1595 |
| 537 | Ga0163161_10191737 | 3300017792 | Bacteria | 1572 |
| 538 | Ga0163161_10201044 | 3300017792 | Bacteria | 1535 |
| 539 | Ga0163161_10574204 | 3300017792 | Bacteria | 927 |
| 540 | Ga0163161_10740107 | 3300017792 | Bacteria | 822 |
| 541 | Ga0206356_11668122 | 3300020070 | Bacteria | 643 |
| 542 | Ga0213876_10007626 | 3300021384 | Bacteria | 5875 |
| 543 | Ga0207426_1000105 | 3300025302 | Bacteria | 247269 |
| 544 | Ga0207697_10008960 | 3300025315 | Bacteria | 4344 |
| 545 | Ga0207697_10045796 | 3300025315 | Bacteria | 1801 |
| 546 | Ga0207697_10258504 | 3300025315 | Bacteria | 771 |
| 547 | Ga0207697_10407196 | 3300025315 | Bacteria | 604 |
| 548 | Ga0207656_10072874 | 3300025321 | Bacteria | 1530 |
| 549 | Ga0207656_10107139 | 3300025321 | Bacteria | 1287 |
| 550 | Ga0207682_10012690 | 3300025893 | Bacteria | 3285 |
| 551 | Ga0207682_10043617 | 3300025893 | Bacteria | 1836 |
| 552 | Ga0207682_10103216 | 3300025893 | Bacteria | 1248 |
| 553 | Ga0207682_10415225 | 3300025893 | Bacteria | 636 |
| 554 | Ga0207642_10049589 | 3300025899 | Bacteria | 1888 |
| 555 | Ga0207642_10101549 | 3300025899 | Bacteria | 1445 |
| 556 | Ga0207642_10308757 | 3300025899 | Bacteria | 920 |
| 557 | Ga0207688_10010099 | 3300025901 | Bacteria | 5135 |
| 558 | Ga0207688_10237702 | 3300025901 | Bacteria | 1101 |
| 559 | Ga0207680_10000051 | 3300025903 | Bacteria | 56289 |
| 560 | Ga0207680_10045258 | 3300025903 | Bacteria | 2593 |
| 561 | Ga0207680_10208839 | 3300025903 | Bacteria | 1334 |
| 562 | Ga0207680_10337949 | 3300025903 | Unclassified | 1056 |
| 563 | Ga0207680_10959422 | 3300025903 | Bacteria | 613 |
| 564 | Ga0207647_10000110 | 3300025904 | Bacteria | 62980 |
| 565 | Ga0207647_10025805 | 3300025904 | Bacteria | 3853 |
| 566 | Ga0207647_10076676 | 3300025904 | Bacteria | 2010 |
| 567 | Ga0207647_10116637 | 3300025904 | Bacteria | 1576 |
| 568 | Ga0207647_10636369 | 3300025904 | Bacteria | 586 |
| 569 | Ga0207645_10002136 | 3300025907 | Bacteria | 15798 |
| 570 | Ga0207645_10044737 | 3300025907 | Bacteria | 2832 |
| 571 | Ga0207645_10072859 | 3300025907 | Bacteria | 2199 |
| 572 | Ga0207645_10093484 | 3300025907 | Bacteria | 1935 |
| 573 | Ga0207645_10163618 | 3300025907 | Bacteria | 1456 |
| 574 | Ga0207643_10001724 | 3300025908 | Bacteria | 12262 |
| 575 | Ga0207643_10006929 | 3300025908 | Bacteria | 6076 |
| 576 | Ga0207705_10014024 | 3300025909 | Bacteria | 5776 |
| 577 | Ga0207705_10081358 | 3300025909 | Bacteria | 2361 |
| 578 | Ga0207705_10088880 | 3300025909 | Bacteria | 2260 |
| 579 | Ga0207705_10176266 | 3300025909 | Bacteria | 1612 |
| 580 | Ga0207705_10732549 | 3300025909 | Unclassified | 768 |
| 581 | Ga0207705_10992843 | 3300025909 | Bacteria | 649 |
| 582 | Ga0207705_11442265 | 3300025909 | Bacteria | 522 |
| 583 | Ga0207654_10000881 | 3300025911 | Bacteria | 16661 |
| 584 | Ga0207654_10002705 | 3300025911 | Bacteria | 8996 |
| 585 | Ga0207654_10080916 | 3300025911 | Bacteria | 1955 |
| 586 | Ga0207654_10382689 | 3300025911 | Bacteria | 975 |
| 587 | Ga0207654_10532596 | 3300025911 | Unclassified | 833 |
| 588 | Ga0207654_10633681 | 3300025911 | Bacteria | 765 |
| 589 | Ga0207654_11366915 | 3300025911 | Unclassified | 516 |
| 590 | Ga0207654_11446234 | 3300025911 | Unclassified | 501 |
| 591 | Ga0207707_10344888 | 3300025912 | Bacteria | 1284 |
| 592 | Ga0207707_10642352 | 3300025912 | Unclassified | 895 |
| 593 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 594 | Ga0207695_10004647 | 3300025913 | Bacteria | 18602 |
| 595 | Ga0207695_10026373 | 3300025913 | Bacteria | 6486 |
| 596 | Ga0207695_10079990 | 3300025913 | Bacteria | 3311 |
| 597 | Ga0207695_10105078 | 3300025913 | Bacteria | 2812 |
| 598 | Ga0207671_10003750 | 3300025914 | Bacteria | 14958 |
| 599 | Ga0207671_10004543 | 3300025914 | Bacteria | 13186 |
| 600 | Ga0207671_10007320 | 3300025914 | Bacteria | 9585 |
| 601 | Ga0207671_10032778 | 3300025914 | Bacteria | 3865 |
| 602 | Ga0207671_10355358 | 3300025914 | Bacteria | 1162 |
| 603 | Ga0207662_10047459 | 3300025918 | Bacteria | 2543 |
| 604 | Ga0207662_10061472 | 3300025918 | Bacteria | 2255 |
| 605 | Ga0207662_10092496 | 3300025918 | Bacteria | 1862 |
| 606 | Ga0207662_10996307 | 3300025918 | Bacteria | 595 |
| 607 | Ga0207662_11105997 | 3300025918 | Bacteria | 563 |
| 608 | Ga0207657_10062662 | 3300025919 | Bacteria | 3183 |
| 609 | Ga0207657_10158704 | 3300025919 | Bacteria | 1838 |
| 610 | Ga0207657_10684543 | 3300025919 | Bacteria | 797 |
| 611 | Ga0207657_10787714 | 3300025919 | Bacteria | 735 |
| 612 | Ga0207649_10005479 | 3300025920 | Bacteria | 6870 |
| 613 | Ga0207649_10588025 | 3300025920 | Unclassified | 855 |
| 614 | Ga0207652_10002830 | 3300025921 | Bacteria | 14557 |
| 615 | Ga0207652_10388671 | 3300025921 | Bacteria | 1259 |
| 616 | Ga0207681_10015241 | 3300025923 | Bacteria | 4793 |
| 617 | Ga0207681_10817614 | 3300025923 | Bacteria | 779 |
| 618 | Ga0207681_11644446 | 3300025923 | Unclassified | 537 |
| 619 | Ga0207694_10017481 | 3300025924 | Bacteria | 5419 |
| 620 | Ga0207694_10069133 | 3300025924 | Bacteria | 2759 |
| 621 | Ga0207694_10874935 | 3300025924 | Unclassified | 760 |
| 622 | Ga0207650_10014881 | 3300025925 | Bacteria | 5413 |
| 623 | Ga0207650_10066694 | 3300025925 | Bacteria | 2699 |
| 624 | Ga0207650_10074981 | 3300025925 | Bacteria | 2552 |
| 625 | Ga0207650_10093786 | 3300025925 | Bacteria | 2298 |
| 626 | Ga0207650_10167486 | 3300025925 | Bacteria | 1744 |
| 627 | Ga0207650_10180530 | 3300025925 | Bacteria | 1682 |
| 628 | Ga0207650_10199627 | 3300025925 | Bacteria | 1601 |
| 629 | Ga0207650_10254342 | 3300025925 | Bacteria | 1423 |
| 630 | Ga0207650_10499989 | 3300025925 | Bacteria | 1016 |
| 631 | Ga0207659_10009764 | 3300025926 | Bacteria | 6003 |
| 632 | Ga0207659_10033056 | 3300025926 | Bacteria | 3556 |
| 633 | Ga0207659_10101095 | 3300025926 | Bacteria | 2174 |
| 634 | Ga0207659_10183973 | 3300025926 | Bacteria | 1658 |
| 635 | Ga0207659_10192518 | 3300025926 | Bacteria | 1624 |
| 636 | Ga0207659_10369284 | 3300025926 | Bacteria | 1194 |
| 637 | Ga0207687_10309374 | 3300025927 | Bacteria | 1275 |
| 638 | Ga0207687_11221390 | 3300025927 | Bacteria | 646 |
| 639 | Ga0207644_10012415 | 3300025931 | Bacteria | 5658 |
| 640 | Ga0207644_10021869 | 3300025931 | Bacteria | 4361 |
| 641 | Ga0207644_10024620 | 3300025931 | Bacteria | 4134 |
| 642 | Ga0207644_10076596 | 3300025931 | Bacteria | 2461 |
| 643 | Ga0207644_10912262 | 3300025931 | Bacteria | 736 |
| 644 | Ga0207644_11457609 | 3300025931 | Bacteria | 575 |
| 645 | Ga0207644_11578564 | 3300025931 | Unclassified | 550 |
| 646 | Ga0207690_10035193 | 3300025932 | Bacteria | 3233 |
| 647 | Ga0207690_10633736 | 3300025932 | Bacteria | 875 |
| 648 | Ga0207690_11388566 | 3300025932 | Bacteria | 587 |
| 649 | Ga0207706_10009371 | 3300025933 | Bacteria | 8991 |
| 650 | Ga0207706_10037951 | 3300025933 | Bacteria | 4275 |
| 651 | Ga0207706_10068145 | 3300025933 | Bacteria | 3131 |
| 652 | Ga0207706_10707786 | 3300025933 | Bacteria | 860 |
| 653 | Ga0207686_10149241 | 3300025934 | Bacteria | 1625 |
| 654 | Ga0207670_10154313 | 3300025936 | Bacteria | 1707 |
| 655 | Ga0207670_10196787 | 3300025936 | Bacteria | 1529 |
| 656 | Ga0207670_10760665 | 3300025936 | Bacteria | 805 |
| 657 | Ga0207669_10037398 | 3300025937 | Bacteria | 2784 |
| 658 | Ga0207669_10409607 | 3300025937 | Bacteria | 1064 |
| 659 | Ga0207669_10510496 | 3300025937 | Bacteria | 963 |
| 660 | Ga0207704_10022175 | 3300025938 | Bacteria | 3397 |
| 661 | Ga0207704_10039066 | 3300025938 | Bacteria | 2759 |
| 662 | Ga0207691_10019043 | 3300025940 | Bacteria | 6500 |
| 663 | Ga0207691_10027644 | 3300025940 | Bacteria | 5317 |
| 664 | Ga0207691_10063549 | 3300025940 | Bacteria | 3348 |
| 665 | Ga0207691_10075279 | 3300025940 | Bacteria | 3044 |
| 666 | Ga0207691_10099184 | 3300025940 | Bacteria | 2601 |
| 667 | Ga0207691_10115614 | 3300025940 | Bacteria | 2382 |
| 668 | Ga0207691_10176679 | 3300025940 | Bacteria | 1867 |
| 669 | Ga0207691_10497887 | 3300025940 | Bacteria | 1035 |
| 670 | Ga0207689_10005396 | 3300025942 | Bacteria | 11441 |
| 671 | Ga0207689_10018050 | 3300025942 | Bacteria | 5958 |
| 672 | Ga0207689_10101705 | 3300025942 | Bacteria | 2361 |
| 673 | Ga0207661_10009193 | 3300025944 | Bacteria | 7083 |
| 674 | Ga0207661_10178861 | 3300025944 | Bacteria | 1851 |
| 675 | Ga0207679_10000875 | 3300025945 | Bacteria | 19210 |
| 676 | Ga0207679_10086487 | 3300025945 | Bacteria | 2412 |
| 677 | Ga0207679_10128128 | 3300025945 | Bacteria | 2032 |
| 678 | Ga0207679_10226523 | 3300025945 | Bacteria | 1576 |
| 679 | Ga0207679_10340064 | 3300025945 | Bacteria | 1305 |
| 680 | Ga0207679_10640885 | 3300025945 | Bacteria | 960 |
| 681 | Ga0207679_10651771 | 3300025945 | Bacteria | 952 |
| 682 | Ga0207679_11499122 | 3300025945 | Bacteria | 618 |
| 683 | Ga0207679_11916378 | 3300025945 | Bacteria | 540 |
| 684 | Ga0207667_10073069 | 3300025949 | Bacteria | 3564 |
| 685 | Ga0207667_10181502 | 3300025949 | Bacteria | 2161 |
| 686 | Ga0207667_10329536 | 3300025949 | Bacteria | 1559 |
| 687 | Ga0207667_10387114 | 3300025949 | Bacteria | 1424 |
| 688 | Ga0207667_11069064 | 3300025949 | Bacteria | 791 |
| 689 | Ga0207667_12029358 | 3300025949 | Bacteria | 535 |
| 690 | Ga0207651_10053397 | 3300025960 | Bacteria | 2762 |
| 691 | Ga0207651_10078265 | 3300025960 | Bacteria | 2371 |
| 692 | Ga0207651_10087831 | 3300025960 | Bacteria | 2264 |
| 693 | Ga0207651_10119509 | 3300025960 | Bacteria | 1996 |
| 694 | Ga0207651_10181194 | 3300025960 | Bacteria | 1671 |
| 695 | Ga0207651_10196091 | 3300025960 | Bacteria | 1614 |
| 696 | Ga0207651_10212458 | 3300025960 | Bacteria | 1558 |
| 697 | Ga0207651_10264420 | 3300025960 | Bacteria | 1414 |
| 698 | Ga0207651_10975561 | 3300025960 | Bacteria | 757 |
| 699 | Ga0207651_11102178 | 3300025960 | Bacteria | 712 |
| 700 | Ga0207712_10014683 | 3300025961 | Bacteria | 5044 |
| 701 | Ga0207712_10235773 | 3300025961 | Bacteria | 1471 |
| 702 | Ga0207712_10269554 | 3300025961 | Bacteria | 1384 |
| 703 | Ga0207668_10015084 | 3300025972 | Bacteria | 4796 |
| 704 | Ga0207668_10067188 | 3300025972 | Bacteria | 2544 |
| 705 | Ga0207668_10074644 | 3300025972 | Bacteria | 2435 |
| 706 | Ga0207668_10210505 | 3300025972 | Bacteria | 1555 |
| 707 | Ga0207640_10087024 | 3300025981 | Bacteria | 2153 |
| 708 | Ga0207640_10280232 | 3300025981 | Bacteria | 1309 |
| 709 | Ga0207640_10540948 | 3300025981 | Bacteria | 977 |
| 710 | Ga0207658_10009886 | 3300025986 | Bacteria | 6482 |
| 711 | Ga0207658_10012999 | 3300025986 | Bacteria | 5685 |
| 712 | Ga0207658_10138678 | 3300025986 | Bacteria | 1965 |
| 713 | Ga0207658_10218425 | 3300025986 | Bacteria | 1602 |
| 714 | Ga0207658_10252741 | 3300025986 | Bacteria | 1498 |
| 715 | Ga0207658_10253710 | 3300025986 | Bacteria | 1496 |
| 716 | Ga0207658_10395815 | 3300025986 | Bacteria | 1213 |
| 717 | Ga0207658_10886158 | 3300025986 | Bacteria | 812 |
| 718 | Ga0207658_11423836 | 3300025986 | Bacteria | 634 |
| 719 | Ga0207677_10001082 | 3300026023 | Bacteria | 14834 |
| 720 | Ga0207677_10102638 | 3300026023 | Bacteria | 2109 |
| 721 | Ga0207677_10192183 | 3300026023 | Bacteria | 1615 |
| 722 | Ga0207677_10266804 | 3300026023 | Bacteria | 1398 |
| 723 | Ga0207677_11411684 | 3300026023 | Unclassified | 641 |
| 724 | Ga0207677_11605611 | 3300026023 | Unclassified | 602 |
| 725 | Ga0207703_10012945 | 3300026035 | Bacteria | 6502 |
| 726 | Ga0207703_10548827 | 3300026035 | Bacteria | 1089 |
| 727 | Ga0207639_10036559 | 3300026041 | Bacteria | 3640 |
| 728 | Ga0207639_10060496 | 3300026041 | Bacteria | 2922 |
| 729 | Ga0207639_10061028 | 3300026041 | Bacteria | 2910 |
| 730 | Ga0207639_10138059 | 3300026041 | Bacteria | 2028 |
| 731 | Ga0207639_10338476 | 3300026041 | Bacteria | 1341 |
| 732 | Ga0207639_10524516 | 3300026041 | Bacteria | 1085 |
| 733 | Ga0207639_11093980 | 3300026041 | Bacteria | 747 |
| 734 | Ga0207639_11240194 | 3300026041 | Bacteria | 700 |
| 735 | Ga0207639_11416025 | 3300026041 | Bacteria | 652 |
| 736 | Ga0207639_11747550 | 3300026041 | Bacteria | 582 |
| 737 | Ga0207678_10172372 | 3300026067 | Bacteria | 1847 |
| 738 | Ga0207678_10240347 | 3300026067 | Bacteria | 1551 |
| 739 | Ga0207678_10275303 | 3300026067 | Bacteria | 1444 |
| 740 | Ga0207708_10058905 | 3300026075 | Bacteria | 2931 |
| 741 | Ga0207702_10056726 | 3300026078 | Bacteria | 3326 |
| 742 | Ga0207702_10078102 | 3300026078 | Bacteria | 2865 |
| 743 | Ga0207702_10744068 | 3300026078 | Bacteria | 968 |
| 744 | Ga0207641_10000121 | 3300026088 | Bacteria | 114943 |
| 745 | Ga0207641_10019787 | 3300026088 | Bacteria | 5526 |
| 746 | Ga0207641_10511744 | 3300026088 | Bacteria | 1167 |
| 747 | Ga0207641_10631488 | 3300026088 | Bacteria | 1051 |
| 748 | Ga0207641_10752574 | 3300026088 | Bacteria | 962 |
| 749 | Ga0207648_10014701 | 3300026089 | Bacteria | 7223 |
| 750 | Ga0207648_10014934 | 3300026089 | Bacteria | 7157 |
| 751 | Ga0207648_10027181 | 3300026089 | Bacteria | 5081 |
| 752 | Ga0207648_10120379 | 3300026089 | Bacteria | 2308 |
| 753 | Ga0207648_10218763 | 3300026089 | Bacteria | 1692 |
| 754 | Ga0207648_10303123 | 3300026089 | Bacteria | 1433 |
| 755 | Ga0207648_10323886 | 3300026089 | Unclassified | 1385 |
| 756 | Ga0207648_10731575 | 3300026089 | Bacteria | 918 |
| 757 | Ga0207648_10882974 | 3300026089 | Bacteria | 835 |
| 758 | Ga0207648_11601524 | 3300026089 | Bacteria | 612 |
| 759 | Ga0207676_10003342 | 3300026095 | Bacteria | 11375 |
| 760 | Ga0207676_10015259 | 3300026095 | Bacteria | 5540 |
| 761 | Ga0207676_10183279 | 3300026095 | Bacteria | 1835 |
| 762 | Ga0207676_10624550 | 3300026095 | Bacteria | 1037 |
| 763 | Ga0207676_10632657 | 3300026095 | Bacteria | 1031 |
| 764 | Ga0207676_10656245 | 3300026095 | Bacteria | 1013 |
| 765 | Ga0207674_10070646 | 3300026116 | Bacteria | 3510 |
| 766 | Ga0207674_10094215 | 3300026116 | Bacteria | 2981 |
| 767 | Ga0207674_10164835 | 3300026116 | Bacteria | 2170 |
| 768 | Ga0207674_11436132 | 3300026116 | Bacteria | 659 |
| 769 | Ga0207675_100002059 | 3300026118 | Bacteria | 20054 |
| 770 | Ga0207675_100041609 | 3300026118 | Bacteria | 4291 |
| 771 | Ga0207675_100372847 | 3300026118 | Bacteria | 1402 |
| 772 | Ga0207675_100461349 | 3300026118 | Bacteria | 1260 |
| 773 | Ga0207675_100672746 | 3300026118 | Bacteria | 1042 |
| 774 | Ga0207675_100696468 | 3300026118 | Bacteria | 1024 |
| 775 | Ga0207675_101570973 | 3300026118 | Unclassified | 678 |
| 776 | Ga0207675_102509488 | 3300026118 | Bacteria | 526 |
| 777 | Ga0207675_102534378 | 3300026118 | Bacteria | 523 |
| 778 | Ga0207683_10006890 | 3300026121 | Bacteria | 9730 |
| 779 | Ga0207683_10016244 | 3300026121 | Bacteria | 6334 |
| 780 | Ga0207683_10061446 | 3300026121 | Bacteria | 3307 |
| 781 | Ga0207683_10202465 | 3300026121 | Bacteria | 1805 |
| 782 | Ga0207683_10922637 | 3300026121 | Bacteria | 811 |
| 783 | Ga0207683_11016448 | 3300026121 | Bacteria | 769 |
| 784 | Ga0207683_11152402 | 3300026121 | Bacteria | 719 |
| 785 | Ga0207683_11219598 | 3300026121 | Bacteria | 697 |
| 786 | Ga0207698_10001488 | 3300026142 | Bacteria | 13640 |
| 787 | Ga0207698_10016613 | 3300026142 | Bacteria | 4968 |
| 788 | Ga0207698_10245179 | 3300026142 | Bacteria | 1636 |
| 789 | Ga0207698_10254695 | 3300026142 | Bacteria | 1609 |
| 790 | Ga0207698_10408119 | 3300026142 | Bacteria | 1300 |
| 791 | Ga0207698_10641268 | 3300026142 | Bacteria | 1051 |
| 792 | Ga0207698_10754067 | 3300026142 | Bacteria | 972 |
| 793 | Ga0207698_10859423 | 3300026142 | Bacteria | 913 |
| 794 | Ga0207698_10919830 | 3300026142 | Unclassified | 882 |
| 795 | Ga0207698_12102851 | 3300026142 | Bacteria | 578 |
| 796 | Ga0209996_1077834 | 3300027395 | Bacteria | 519 |
| 797 | Ga0209974_10257701 | 3300027876 | Bacteria | 658 |
| 798 | Ga0207428_10111837 | 3300027907 | Bacteria | 2101 |
| 799 | Ga0207428_10136352 | 3300027907 | Bacteria | 1876 |
| 800 | Ga0268266_10000038 | 3300028379 | Bacteria | 325729 |
| 801 | Ga0268266_10015422 | 3300028379 | Bacteria | 6557 |
| 802 | Ga0268266_10143576 | 3300028379 | Bacteria | 2144 |
| 803 | Ga0268266_10362709 | 3300028379 | Bacteria | 1364 |
| 804 | Ga0268265_10003503 | 3300028380 | Bacteria | 11231 |
| 805 | Ga0268265_10547433 | 3300028380 | Bacteria | 1098 |
| 806 | Ga0268265_11193270 | 3300028380 | Bacteria | 758 |
| 807 | Ga0268265_11806138 | 3300028380 | Bacteria | 618 |
| 808 | Ga0268264_10000167 | 3300028381 | Bacteria | 146190 |
| 809 | Ga0268264_10004870 | 3300028381 | Bacteria | 11377 |
| 810 | Ga0268264_10012086 | 3300028381 | Bacteria | 7108 |
| 811 | Ga0268264_10017339 | 3300028381 | Bacteria | 5900 |
| 812 | Ga0268264_10128293 | 3300028381 | Bacteria | 2245 |
| 813 | Ga0268264_10182798 | 3300028381 | Bacteria | 1905 |
| 814 | Ga0268264_10251911 | 3300028381 | Bacteria | 1641 |
| 815 | Ga0268264_11678735 | 3300028381 | Bacteria | 646 |
| 816 | Ga0307517_10018578 | 3300028786 | Bacteria | 8983 |
| 817 | Ga0307517_10269373 | 3300028786 | Bacteria | 981 |
| 818 | Ga0307517_10306514 | 3300028786 | Bacteria | 887 |
| 819 | Ga0307515_10000469 | 3300028794 | Bacteria | 96345 |
| 820 | Ga0307511_10004717 | 3300030521 | Bacteria | 13935 |
| 821 | Ga0307511_10396782 | 3300030521 | Unclassified | 569 |
| 822 | Ga0307512_10268947 | 3300030522 | Bacteria | 828 |
| 823 | Ga0265327_10000159 | 3300031251 | Bacteria | 145537 |
| 824 | Ga0307513_10103928 | 3300031456 | Bacteria | 2856 |
| 825 | Ga0307509_10079849 | 3300031507 | Bacteria | 3385 |
| 826 | Ga0307509_10113539 | 3300031507 | Bacteria | 2706 |
| 827 | Ga0307509_10344145 | 3300031507 | Bacteria | 1217 |
| 828 | Ga0307509_10407521 | 3300031507 | Bacteria | 1064 |
| 829 | Ga0307408_100426226 | 3300031548 | Bacteria | 1145 |
| 830 | Ga0265313_10067180 | 3300031595 | Bacteria | 1660 |
| 831 | Ga0307508_10002518 | 3300031616 | Bacteria | 19301 |
| 832 | Ga0307508_10529516 | 3300031616 | Bacteria | 775 |
| 833 | Ga0307516_10004268 | 3300031730 | Bacteria | 17759 |
| 834 | Ga0307405_10655250 | 3300031731 | Bacteria | 864 |
| 835 | Ga0307413_10022806 | 3300031824 | Bacteria | 3382 |
| 836 | Ga0307413_10530901 | 3300031824 | Unclassified | 951 |
| 837 | Ga0307410_10035292 | 3300031852 | Bacteria | 3246 |
| 838 | Ga0307410_11164698 | 3300031852 | Bacteria | 670 |
| 839 | Ga0307406_10106862 | 3300031901 | Bacteria | 1918 |
| 840 | Ga0307406_11355197 | 3300031901 | Bacteria | 622 |
| 841 | Ga0307407_10083520 | 3300031903 | Bacteria | 1938 |
| 842 | Ga0307412_10519431 | 3300031911 | Bacteria | 995 |
| 843 | Ga0307409_101269840 | 3300031995 | Unclassified | 761 |
| 844 | Ga0307416_100069247 | 3300032002 | Bacteria | 2919 |
| 845 | Ga0307416_100974098 | 3300032002 | Bacteria | 951 |
| 846 | Ga0307416_102077190 | 3300032002 | Bacteria | 670 |
| 847 | Ga0307414_10105037 | 3300032004 | Bacteria | 2135 |
| 848 | Ga0307414_10215472 | 3300032004 | Bacteria | 1573 |
| 849 | Ga0307414_10476789 | 3300032004 | Bacteria | 1100 |
| 850 | Ga0307414_10485765 | 3300032004 | Bacteria | 1090 |
| 851 | Ga0307414_10726189 | 3300032004 | Unclassified | 901 |
| 852 | Ga0307414_10794241 | 3300032004 | Unclassified | 863 |
| 853 | Ga0307411_11684469 | 3300032005 | Bacteria | 587 |
| 854 | Ga0307415_100025311 | 3300032126 | Bacteria | 3721 |
| 855 | Ga0307415_102332102 | 3300032126 | Bacteria | 525 |
| 856 | Ga0307507_10338473 | 3300033179 | Bacteria | 893 |
| 857 | Ga0373938_0094755 | 3300034957 | Bacteria | 743 |
| 858 | Ga0373962_0367198 | 3300035242 | Bacteria | 523 |
| 859 | Ga0265778_057272 | 3300036457 | Bacteria | 541 |
| 860 | Ga0395899_0702648 | 3300037312 | Bacteria | 634 |
| 861 | Ga0395900_0216632 | 3300037418 | Bacteria | 1932 |
| 862 | Ga0395900_1100609 | 3300037418 | Bacteria | 712 |
| 863 | Ga0395905_0002823 | 3300037471 | Bacteria | 19037 |
| 864 | Ga0395901_0560399 | 3300038443 | Bacteria | 1157 |
| 865 | Ga0436365_0472587 | 3300039437 | Bacteria | 3578 |
| 866 | Ga0436365_0781227 | 3300039437 | Bacteria | 11182 |
| 867 | Ga0436363_0734173 | 3300039450 | Bacteria | 3029 |
| 868 | Ga0436363_1110235 | 3300039450 | Bacteria | 859 |
| 869 | Ga0439436_0042221 | 3300041404 | Bacteria | 1304 |
| 870 | Ga0439439_0161566 | 3300041406 | Bacteria | 639 |
| 871 | Ga0439461_0043177 | 3300041410 | Bacteria | 980 |
| 872 | Ga0451787_080681 | 3300041441 | Bacteria | 815 |
| 873 | Ga0451789_0191907 | 3300041443 | Bacteria | 675 |
| 874 | Ga0451794_28172 | 3300041446 | Unclassified | 539 |
| 875 | Ga0451797_0542401 | 3300041453 | Bacteria | 639 |
| 876 | Ga0451802_0148319 | 3300041460 | Bacteria | 607 |
| 877 | Ga0451804_0798737 | 3300041463 | Bacteria | 660 |
| 878 | Ga0451807_2671209 | 3300041486 | Bacteria | 659 |
| 879 | Ga0451839_1552964 | 3300041496 | Unclassified | 566 |
| 880 | Ga0451847_0938223 | 3300041503 | Bacteria | 649 |
| 881 | Ga0451843_0386673 | 3300041509 | Bacteria | 682 |
| 882 | Ga0451853_0260808 | 3300041512 | Bacteria | 722 |
| 883 | Ga0451853_0354634 | 3300041512 | Bacteria | 673 |
| 884 | Ga0451853_2173213 | 3300041512 | Unclassified | 603 |
| 885 | Ga0451853_2350954 | 3300041512 | Bacteria | 658 |
| 886 | Ga0439449_0017442 | 3300042007 | Bacteria | 2696 |
| 887 | Ga0439457_008270 | 3300042014 | Bacteria | 2459 |
| 888 | Ga0439446_0018535 | 3300042156 | Bacteria | 1951 |
| 889 | Ga0439434_0017713 | 3300042435 | Bacteria | 2133 |
| 890 | Ga0439434_0048470 | 3300042435 | Bacteria | 1314 |
| 891 | Ga0439435_0267835 | 3300042436 | Bacteria | 579 |
| 892 | Ga0451577_0035014 | 3300042876 | Bacteria | 4524 |
| 893 | Ga0466972_0000025 | 3300044658 | Bacteria | 186601 |
| 894 | Ga0466972_0021513 | 3300044658 | Bacteria | 3214 |
| 895 | Ga0466972_0134269 | 3300044658 | Bacteria | 1165 |
| 896 | Ga0466972_0360729 | 3300044658 | Bacteria | 680 |
| 897 | Ga0466965_0187557 | 3300044683 | Bacteria | 1093 |
| 898 | Ga0453684_0003639 | 3300044712 | Bacteria | 34251 |
| 899 | Ga0453684_0046321 | 3300044712 | Bacteria | 5784 |
| 900 | Ga0453684_0755575 | 3300044712 | Bacteria | 1052 |
| 901 | Ga0453684_2573165 | 3300044712 | Bacteria | 501 |
| 902 | Ga0466968_0052503 | 3300044735 | Bacteria | 1744 |
| 903 | Ga0466968_0095953 | 3300044735 | Bacteria | 1320 |
| 904 | Ga0466970_0000933 | 3300044765 | Bacteria | 14121 |
| 905 | Ga0466957_0131367 | 3300044842 | Bacteria | 1605 |
| 906 | Ga0466960_0228251 | 3300044901 | Bacteria | 1027 |
| 907 | Ga0466959_0017683 | 3300045049 | Bacteria | 5229 |
| 908 | Ga0466959_0442562 | 3300045049 | Bacteria | 881 |
| 909 | Ga0466959_0901945 | 3300045049 | Unclassified | 590 |
| 910 | Ga0451576_0110481 | 3300045051 | Bacteria | 2861 |
| 911 | Ga0495629_0815944 | 3300046459 | Bacteria | 615 |
| 912 | Ga0495638_0083984 | 3300046460 | Bacteria | 1928 |
| 913 | Ga0495648_0012032 | 3300046524 | Bacteria | 6482 |
| 914 | Ga0495648_0342523 | 3300046524 | Bacteria | 686 |
| 915 | Ga0495652_0255633 | 3300046529 | Bacteria | 1296 |
| 916 | Ga0495640_0695428 | 3300046533 | Bacteria | 610 |
| 917 | Ga0495611_0130135 | 3300046648 | Bacteria | 1174 |
| 918 | Ga0495625_0132206 | 3300046660 | Bacteria | 1690 |
| 919 | Ga0495625_0273493 | 3300046660 | Bacteria | 1089 |
| 920 | Ga0495649_0091156 | 3300046694 | Bacteria | 1625 |
| 921 | Ga0495649_0581841 | 3300046694 | Bacteria | 553 |
| 922 | Ga0495672_0011267 | 3300047320 | Bacteria | 6319 |
| 923 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 924 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 925 | Ga0495686_0121135 | 3300047472 | Bacteria | 1559 |
| 926 | Ga0496104_1101758 | 3300048907 | Bacteria | 698 |
| 927 | Ga0496105_1064456 | 3300048908 | Bacteria | 602 |
| 928 | Ga0496108_0158364 | 3300048911 | Bacteria | 1956 |
| 929 | Ga0496108_1780694 | 3300048911 | Bacteria | 505 |
| 930 | Ga0496110_0131071 | 3300048913 | Bacteria | 2264 |
| 931 | Ga0496110_0901907 | 3300048913 | Bacteria | 790 |
| 932 | Ga0496111_0265301 | 3300048914 | Bacteria | 1274 |
| 933 | Ga0501306_005254 | 3300049127 | Bacteria | 1478 |
| 934 | Ga0501306_007098 | 3300049127 | Bacteria | 1332 |
| 935 | Ga0501306_011995 | 3300049127 | Bacteria | 1112 |
| 936 | Ga0501306_015031 | 3300049127 | Unclassified | 1027 |
| 937 | Ga0501306_036894 | 3300049127 | Bacteria | 746 |
| 938 | Ga0501308_000724 | 3300049128 | Bacteria | 2316 |
| 939 | Ga0501308_002471 | 3300049128 | Bacteria | 1624 |
| 940 | Ga0501308_003669 | 3300049128 | Bacteria | 1436 |
| 941 | Ga0501308_025384 | 3300049128 | Bacteria | 767 |
| 942 | Ga0501308_030669 | 3300049128 | Bacteria | 720 |
| 943 | Ga0501309_004409 | 3300049129 | Bacteria | 1640 |
| 944 | Ga0501309_006097 | 3300049129 | Bacteria | 1459 |
| 945 | Ga0501309_029601 | 3300049129 | Bacteria | 803 |
| 946 | Ga0501310_008402 | 3300049130 | Bacteria | 1120 |
| 947 | Ga0501310_017992 | 3300049130 | Bacteria | 860 |
| 948 | Ga0501310_020532 | 3300049130 | Bacteria | 821 |
| 949 | Ga0501310_072876 | 3300049130 | Unclassified | 528 |
| 950 | Ga0501341_03273 | 3300049131 | Bacteria | 911 |
| 951 | Ga0501343_004442 | 3300049132 | Bacteria | 1054 |
| 952 | Ga0501343_008419 | 3300049132 | Bacteria | 824 |
| 953 | Ga0501344_07553 | 3300049133 | Bacteria | 639 |
| 954 | Ga0501304_002005 | 3300049160 | Bacteria | 1376 |
| 955 | Ga0501304_006956 | 3300049160 | Unclassified | 923 |
| 956 | Ga0501305_000918 | 3300049161 | Bacteria | 2668 |
| 957 | Ga0501305_003905 | 3300049161 | Bacteria | 1720 |
| 958 | Ga0501305_014229 | 3300049161 | Unclassified | 1111 |
| 959 | Ga0501305_021427 | 3300049161 | Bacteria | 955 |
| 960 | Ga0501305_038014 | 3300049161 | Bacteria | 774 |
| 961 | Ga0501307_001810 | 3300049162 | Bacteria | 1893 |
| 962 | Ga0501307_006326 | 3300049162 | Bacteria | 1275 |
| 963 | Ga0501307_020375 | 3300049162 | Bacteria | 857 |
| 964 | Ga0501307_036545 | 3300049162 | Bacteria | 700 |
| 965 | Ga0501307_071145 | 3300049162 | Unclassified | 555 |
| 966 | Ga0501297_075382 | 3300049520 | Bacteria | 539 |
| 967 | Ga0501311_002005 | 3300049527 | Bacteria | 1884 |
| 968 | Ga0501311_009005 | 3300049527 | Bacteria | 1184 |
| 969 | Ga0501311_017129 | 3300049527 | Bacteria | 951 |
| 970 | Ga0501311_021215 | 3300049527 | Bacteria | 884 |
| 971 | Ga0501312_003742 | 3300049528 | Bacteria | 1751 |
| 972 | Ga0501312_003877 | 3300049528 | Bacteria | 1731 |
| 973 | Ga0501312_009338 | 3300049528 | Bacteria | 1291 |
| 974 | Ga0501312_021281 | 3300049528 | Bacteria | 965 |
| 975 | Ga0501313_000530 | 3300049529 | Bacteria | 2669 |
| 976 | Ga0501313_004747 | 3300049529 | Bacteria | 1409 |
| 977 | Ga0501313_009702 | 3300049529 | Bacteria | 1087 |
| 978 | Ga0501313_024321 | 3300049529 | Bacteria | 762 |
| 979 | Ga0501314_019095 | 3300049530 | Bacteria | 702 |
| 980 | Ga0501315_004451 | 3300049531 | Bacteria | 1466 |
| 981 | Ga0501315_007467 | 3300049531 | Bacteria | 1247 |
| 982 | Ga0501315_008378 | 3300049531 | Bacteria | 1201 |
| 983 | Ga0501315_011678 | 3300049531 | Bacteria | 1076 |
| 984 | Ga0501315_029348 | 3300049531 | Bacteria | 785 |
| 985 | Ga0501315_032842 | 3300049531 | Bacteria | 756 |
| 986 | Ga0501316_000565 | 3300049532 | Bacteria | 2640 |
| 987 | Ga0501316_010922 | 3300049532 | Bacteria | 1040 |
| 988 | Ga0501316_012207 | 3300049532 | Bacteria | 1001 |
| 989 | Ga0501316_037104 | 3300049532 | Bacteria | 669 |
| 990 | Ga0501316_056265 | 3300049532 | Bacteria | 575 |
| 991 | Ga0501317_017020 | 3300049533 | Bacteria | 949 |
| 992 | Ga0501317_050641 | 3300049533 | Bacteria | 659 |
| 993 | Ga0501317_084668 | 3300049533 | Bacteria | 553 |
| 994 | Ga0501320_002608 | 3300049536 | Bacteria | 1456 |
| 995 | Ga0501320_013151 | 3300049536 | Bacteria | 880 |
| 996 | Ga0501321_003706 | 3300049537 | Bacteria | 1418 |
| 997 | Ga0501321_018127 | 3300049537 | Bacteria | 852 |
| 998 | Ga0501322_027968 | 3300049538 | Bacteria | 522 |
| 999 | Ga0501323_002763 | 3300049539 | Bacteria | 1736 |
| 1000 | Ga0501323_023498 | 3300049539 | Bacteria | 828 |
| 1001 | Ga0501324_035978 | 3300049540 | Bacteria | 554 |
| 1002 | Ga0501325_043579 | 3300049541 | Bacteria | 553 |
| 1003 | Ga0501327_08233 | 3300049543 | Bacteria | 660 |
| 1004 | Ga0501327_17119 | 3300049543 | Bacteria | 522 |
| 1005 | Ga0501327_19234 | 3300049543 | Unclassified | 503 |
| 1006 | Ga0501328_10356 | 3300049544 | Bacteria | 526 |
| 1007 | Ga0501329_05041 | 3300049545 | Bacteria | 721 |
| 1008 | Ga0501329_14524 | 3300049545 | Bacteria | 527 |
| 1009 | Ga0501330_003707 | 3300049546 | Bacteria | 923 |
| 1010 | Ga0501331_14064 | 3300049547 | Bacteria | 522 |
| 1011 | Ga0501332_16924 | 3300049548 | Bacteria | 525 |
| 1012 | Ga0501334_03053 | 3300049550 | Bacteria | 1024 |
| 1013 | Ga0501334_06500 | 3300049550 | Bacteria | 790 |
| 1014 | Ga0501334_20894 | 3300049550 | Bacteria | 527 |
| 1015 | Ga0501335_003049 | 3300049551 | Bacteria | 1400 |
| 1016 | Ga0501335_005666 | 3300049551 | Unclassified | 1120 |
| 1017 | Ga0501335_008277 | 3300049551 | Unclassified | 976 |
| 1018 | Ga0501335_011144 | 3300049551 | Bacteria | 876 |
| 1019 | Ga0501335_021015 | 3300049551 | Bacteria | 697 |
| 1020 | Ga0501335_037599 | 3300049551 | Bacteria | 563 |
| 1021 | Ga0501336_007753 | 3300049552 | Bacteria | 820 |
| 1022 | Ga0501337_003392 | 3300049553 | Bacteria | 1011 |
| 1023 | Ga0501337_005126 | 3300049553 | Bacteria | 871 |
| 1024 | Ga0501337_006563 | 3300049553 | Bacteria | 797 |
| 1025 | Ga0501340_009762 | 3300049556 | Bacteria | 696 |
| 1026 | Ga0501033_0062825 | 3300049570 | Bacteria | 2734 |
| 1027 | Ga0501034_0002020 | 3300049571 | Bacteria | 25539 |
| 1028 | Ga0501034_0282372 | 3300049571 | Bacteria | 1599 |
| 1029 | Ga0501043_0038700 | 3300049579 | Bacteria | 3750 |
| 1030 | Ga0501043_0267933 | 3300049579 | Bacteria | 1312 |
| 1031 | Ga0501047_0845703 | 3300049581 | Unclassified | 729 |
| 1032 | Ga0501070_0230182 | 3300049586 | Bacteria | 1519 |
| 1033 | Ga0501198_012021 | 3300049649 | Bacteria | 1297 |
| 1034 | Ga0501198_020209 | 3300049649 | Bacteria | 1054 |
| 1035 | Ga0501201_002320 | 3300049651 | Bacteria | 1742 |
| 1036 | Ga0501202_000998 | 3300049652 | Bacteria | 4375 |
| 1037 | Ga0501202_009088 | 3300049652 | Bacteria | 1820 |
| 1038 | Ga0501202_024862 | 3300049652 | Bacteria | 1217 |
| 1039 | Ga0501202_194712 | 3300049652 | Bacteria | 552 |
| 1040 | Ga0501207_020378 | 3300049654 | Bacteria | 1058 |
| 1041 | Ga0501216_192811 | 3300049660 | Bacteria | 501 |
| 1042 | Ga0501217_005840 | 3300049661 | Bacteria | 2589 |
| 1043 | Ga0501222_060407 | 3300049662 | Bacteria | 573 |
| 1044 | Ga0501223_003765 | 3300049663 | Bacteria | 3276 |
| 1045 | Ga0501224_006724 | 3300049664 | Bacteria | 1669 |
| 1046 | Ga0501227_171571 | 3300049665 | Bacteria | 607 |
| 1047 | Ga0501235_003091 | 3300049669 | Bacteria | 3586 |
| 1048 | Ga0501235_028546 | 3300049669 | Bacteria | 1254 |
| 1049 | Ga0501242_009393 | 3300049674 | Bacteria | 1158 |
| 1050 | Ga0501242_019701 | 3300049674 | Bacteria | 863 |
| 1051 | Ga0501243_002414 | 3300049675 | Bacteria | 2735 |
| 1052 | Ga0501252_003343 | 3300049682 | Bacteria | 1647 |
| 1053 | Ga0501259_106647 | 3300049688 | Bacteria | 649 |
| 1054 | Ga0501261_001010 | 3300049690 | Bacteria | 3458 |
| 1055 | Ga0501221_088004 | 3300049704 | Bacteria | 756 |
| 1056 | Ga0501221_151874 | 3300049704 | Bacteria | 614 |
| 1057 | Ga0501225_0004957 | 3300049705 | Bacteria | 3933 |
| 1058 | Ga0501225_0014988 | 3300049705 | Bacteria | 2163 |
| 1059 | Ga0501245_018897 | 3300049708 | Bacteria | 1063 |
| 1060 | Ga0501080_0143181 | 3300049742 | Bacteria | 2210 |
| 1061 | Ga0501083_0085302 | 3300049744 | Bacteria | 2090 |
| 1062 | Ga0501083_0810808 | 3300049744 | Unclassified | 609 |
| 1063 | Ga0501232_030337 | 3300049757 | Bacteria | 748 |
| 1064 | Ga0501241_000113 | 3300049758 | Bacteria | 17544 |
| 1065 | Ga0501264_013457 | 3300049761 | Bacteria | 811 |
| 1066 | Ga0501266_037834 | 3300049763 | Bacteria | 709 |
| 1067 | Ga0501268_009295 | 3300049765 | Bacteria | 1508 |
| 1068 | Ga0501270_173804 | 3300049767 | Bacteria | 505 |
| 1069 | Ga0501271_039440 | 3300049768 | Bacteria | 611 |
| 1070 | Ga0501035_0112953 | 3300049822 | Bacteria | 2380 |
| 1071 | Ga0501035_0725096 | 3300049822 | Bacteria | 800 |
| 1072 | Ga0501044_0199920 | 3300049823 | Bacteria | 1957 |
| 1073 | Ga0501212_044539 | 3300049851 | Unclassified | 740 |
| 1074 | Ga0501212_123430 | 3300049851 | Bacteria | 504 |
| 1075 | nmdc:mga03683_410947_c1 | 3300050489 | Bacteria | 647 |
| 1076 | nmdc:mga0k408_12089_c1 | 3300050493 | Bacteria | 4714 |
| 1077 | nmdc:mga0k408_254901_c1 | 3300050493 | Bacteria | 1048 |
| 1078 | nmdc:mga0k408_431124_c1 | 3300050493 | Bacteria | 783 |
| 1079 | nmdc:mga0k408_674576_c1 | 3300050493 | Bacteria | 607 |
| 1080 | nmdc:mga0k408_7017_c1 | 3300050493 | Bacteria | 6011 |
| 1081 | nmdc:mga0k408_9728_c1 | 3300050493 | Bacteria | 5190 |
| 1082 | nmdc:mga07m45_122077_c1 | 3300050496 | Bacteria | 1505 |
| 1083 | nmdc:mga07m45_122395_c1 | 3300050496 | Bacteria | 1503 |
| 1084 | nmdc:mga07m45_219335_c1 | 3300050496 | Bacteria | 1106 |
| 1085 | nmdc:mga07m45_380682_c1 | 3300050496 | Bacteria | 819 |
| 1086 | nmdc:mga08y16_106009_c1 | 3300050511 | Bacteria | 2926 |
| 1087 | nmdc:mga08y16_26169_c1 | 3300050511 | Bacteria | 6153 |
| 1088 | nmdc:mga0sz30_296382_c1 | 3300050516 | Bacteria | 721 |
| 1089 | Ga0500646_0007315 | 3300053090 | Bacteria | 2821 |
| 1090 | Ga0500646_0087139 | 3300053090 | Bacteria | 962 |
| 1091 | Ga0500583_0004184 | 3300053092 | Bacteria | 4664 |
| 1092 | Ga0500651_0300017 | 3300053093 | Bacteria | 922 |
| 1093 | Ga0500641_0061245 | 3300053096 | Bacteria | 1567 |
| 1094 | Ga0500621_155407 | 3300053126 | Bacteria | 854 |
| 1095 | Ga0500628_021680 | 3300053129 | Bacteria | 1306 |
| 1096 | Ga0500628_212728 | 3300053129 | Bacteria | 561 |
| 1097 | Ga0500642_0007688 | 3300053130 | Bacteria | 3637 |
| 1098 | Ga0500642_0429397 | 3300053130 | Unclassified | 571 |
| 1099 | Ga0500655_034538 | 3300053133 | Bacteria | 981 |
| 1100 | Ga0500655_059390 | 3300053133 | Bacteria | 769 |
| 1101 | Ga0500568_0000439 | 3300053139 | Bacteria | 31243 |
| 1102 | Ga0500568_0047775 | 3300053139 | Bacteria | 1694 |
| 1103 | Ga0500588_0064267 | 3300053146 | Bacteria | 1185 |
| 1104 | Ga0500588_0370740 | 3300053146 | Bacteria | 545 |
| 1105 | Ga0500622_0001823 | 3300053156 | Bacteria | 16170 |
| 1106 | Ga0587109_044136 | 3300059624 | Bacteria | 894 |
| 1107 | Ga0587069_054570 | 3300059642 | Bacteria | 720 |
| 1108 | Ga0587079_000249 | 3300059647 | Bacteria | 4161 |
| 1109 | Ga0006758J48902_1026128 | |||
| 1110 | SwRhRL2b_contig_3008347 | |||
| 1111 | JGI24740J21852_10014244 | |||
| 1112 | JGI24743J22301_10055630 | |||
| 1113 | JGI24743J22301_10098335 | |||
| 1114 | JGI24744J21845_10033386 | |||
| 1115 | JGI24744J21845_10053292 | |||
| 1116 | JGI24035J26624_1018180 | |||
| 1117 | JGI24751J29686_10101010 | |||
| 1118 | rootL2_10116652 | |||
| 1119 | rootH1_10165256 | |||
| 1120 | JGI25160J50197_1001095 | |||
| 1121 | Ga0058860_11446600 | |||
| 1122 | Ga0065704_10073668 | |||
| 1123 | Ga0065704_10864758 | |||
| 1124 | Ga0065712_10002231 | |||
| 1125 | Ga0065712_10027689 | |||
| 1126 | Ga0065712_10071904 | |||
| 1127 | Ga0065712_10309141 | |||
| 1128 | Ga0065712_10570103 | |||
| 1129 | Ga0065712_10573321 | |||
| 1130 | Ga0065712_10581230 | |||
| 1131 | Ga0065715_10284656 | |||
| 1132 | Ga0065715_10517905 | |||
| 1133 | Ga0065707_10185518 | |||
| 1134 | Ga0065707_10364924 | |||
| 1135 | Ga0070658_10016405 | |||
| 1136 | Ga0070658_10052865 | |||
| 1137 | Ga0070658_10503106 | |||
| 1138 | Ga0070658_10513272 | |||
| 1139 | Ga0070658_10621450 | |||
| 1140 | Ga0070658_10772366 | |||
| 1141 | Ga0070676_10006513 | |||
| 1142 | Ga0070676_10031672 | |||
| 1143 | Ga0070676_10032136 | |||
| 1144 | Ga0070676_10203637 | |||
| 1145 | Ga0070683_100001488 | |||
| 1146 | Ga0070683_100025159 | |||
| 1147 | Ga0070683_100975849 | |||
| 1148 | Ga0070683_101938102 | |||
| 1149 | Ga0070690_100006100 | |||
| 1150 | Ga0070690_100256936 | |||
| 1151 | Ga0070670_100024841 | |||
| 1152 | Ga0070670_100068133 | |||
| 1153 | Ga0070670_100108356 | |||
| 1154 | Ga0070670_100109804 | |||
| 1155 | Ga0070670_100128199 | |||
| 1156 | Ga0070670_100141351 | |||
| 1157 | Ga0070670_100149270 | |||
| 1158 | Ga0070670_100734964 | |||
| 1159 | Ga0070670_101037207 | |||
| 1160 | Ga0070670_101683616 | |||
| 1161 | Ga0070677_10007599 | |||
| 1162 | Ga0070677_10016481 | |||
| 1163 | Ga0070677_10043990 | |||
| 1164 | Ga0068869_100010127 | |||
| 1165 | Ga0068869_100044651 | |||
| 1166 | Ga0068869_100086467 | |||
| 1167 | Ga0068869_100093571 | |||
| 1168 | Ga0068869_100238893 | |||
| 1169 | Ga0068869_100269398 | |||
| 1170 | Ga0068869_100855269 | |||
| 1171 | Ga0070666_10000036 | |||
| 1172 | Ga0070666_10018000 | |||
| 1173 | Ga0070666_10150569 | |||
| 1174 | Ga0070666_10224919 | |||
| 1175 | Ga0070666_10360216 | |||
| 1176 | Ga0070666_11328143 | |||
| 1177 | Ga0070666_11436219 | |||
| 1178 | Ga0070680_100444354 | |||
| 1179 | Ga0070680_100467387 | |||
| 1180 | Ga0070682_100781403 | |||
| 1181 | Ga0068868_100007778 | |||
| 1182 | Ga0068868_100015404 | |||
| 1183 | Ga0068868_100031254 | |||
| 1184 | Ga0068868_100055794 | |||
| 1185 | Ga0068868_100111940 | |||
| 1186 | Ga0068868_100120776 | |||
| 1187 | Ga0068868_100179890 | |||
| 1188 | Ga0068868_100245999 | |||
| 1189 | Ga0068868_100433503 | |||
| 1190 | Ga0068868_101381635 | |||
| 1191 | Ga0070660_100218767 | |||
| 1192 | Ga0070660_101112947 | |||
| 1193 | Ga0070660_101351378 | |||
| 1194 | Ga0070689_100021681 | |||
| 1195 | Ga0070689_100076504 | |||
| 1196 | Ga0070689_100196748 | |||
| 1197 | Ga0070687_100003733 | |||
| 1198 | Ga0070687_100035905 | |||
| 1199 | Ga0070687_100036372 | |||
| 1200 | Ga0070687_100636839 | |||
| 1201 | Ga0070687_100898664 | |||
| 1202 | Ga0070687_101180761 | |||
| 1203 | Ga0070661_100004113 | |||
| 1204 | Ga0070661_100708537 | |||
| 1205 | Ga0070661_101763575 | |||
| 1206 | Ga0070668_100017989 | |||
| 1207 | Ga0070668_100025286 | |||
| 1208 | Ga0070668_100226019 | |||
| 1209 | Ga0070668_100385802 | |||
| 1210 | Ga0070668_101117215 | |||
| 1211 | Ga0070668_101220418 | |||
| 1212 | Ga0070669_100002748 | |||
| 1213 | Ga0070669_100024124 | |||
| 1214 | Ga0070669_100685911 | |||
| 1215 | Ga0070669_100876720 | |||
| 1216 | Ga0070669_101980349 | |||
| 1217 | Ga0070675_100018472 | |||
| 1218 | Ga0070675_100027474 | |||
| 1219 | Ga0070675_100090601 | |||
| 1220 | Ga0070675_100129605 | |||
| 1221 | Ga0070675_100143049 | |||
| 1222 | Ga0070675_100182345 | |||
| 1223 | Ga0070675_100449057 | |||
| 1224 | Ga0070675_100580047 | |||
| 1225 | Ga0070675_100610327 | |||
| 1226 | Ga0070675_101926560 | |||
| 1227 | Ga0070671_100002367 | |||
| 1228 | Ga0070671_100030657 | |||
| 1229 | Ga0070671_100051676 | |||
| 1230 | Ga0070671_100069502 | |||
| 1231 | Ga0070671_100231072 | |||
| 1232 | Ga0070671_100463920 | |||
| 1233 | Ga0070671_101044821 | |||
| 1234 | Ga0070674_100085764 | |||
| 1235 | Ga0070674_100141927 | |||
| 1236 | Ga0070674_100142571 | |||
| 1237 | Ga0070674_100728347 | |||
| 1238 | Ga0070673_100003757 | |||
| 1239 | Ga0070673_100014827 | |||
| 1240 | Ga0070673_100051881 | |||
| 1241 | Ga0070673_100075958 | |||
| 1242 | Ga0070673_100264445 | |||
| 1243 | Ga0070673_100344753 | |||
| 1244 | Ga0070673_100463534 | |||
| 1245 | Ga0070673_100942301 | |||
| 1246 | Ga0070688_100018933 | |||
| 1247 | Ga0070688_100176818 | |||
| 1248 | Ga0070688_100592206 | |||
| 1249 | Ga0070688_101412615 | |||
| 1250 | Ga0070659_100023726 | |||
| 1251 | Ga0070659_100213818 | |||
| 1252 | Ga0070659_100509157 | |||
| 1253 | Ga0070659_100839154 | |||
| 1254 | Ga0070659_101582565 | |||
| 1255 | Ga0070667_100001551 | |||
| 1256 | Ga0070667_100004111 | |||
| 1257 | Ga0070667_100176643 | |||
| 1258 | Ga0070667_100255813 | |||
| 1259 | Ga0070667_100730644 | |||
| 1260 | Ga0070667_100752615 | |||
| 1261 | Ga0070667_100952039 | |||
| 1262 | Ga0070667_101004097 | |||
| 1263 | Ga0070667_101738477 | |||
| 1264 | Ga0070701_10094050 | |||
| 1265 | Ga0070700_100167615 | |||
| 1266 | Ga0070694_100962921 | |||
| 1267 | Ga0070663_100099434 | |||
| 1268 | Ga0070663_101542824 | |||
| 1269 | Ga0070663_101567215 | |||
| 1270 | Ga0070678_100040792 | |||
| 1271 | Ga0070678_100047685 | |||
| 1272 | Ga0070678_100051388 | |||
| 1273 | Ga0070678_100302857 | |||
| 1274 | Ga0070678_100850439 | |||
| 1275 | Ga0070678_100897988 | |||
| 1276 | Ga0070678_100939312 | |||
| 1277 | Ga0070678_101282815 | |||
| 1278 | Ga0070678_101503270 | |||
| 1279 | Ga0070662_100004284 | |||
| 1280 | Ga0070662_100033746 | |||
| 1281 | Ga0070662_100140628 | |||
| 1282 | Ga0070662_100416202 | |||
| 1283 | Ga0070662_100820712 | |||
| 1284 | Ga0070662_100952639 | |||
| 1285 | Ga0070681_10134747 | |||
| 1286 | Ga0070681_10639080 | |||
| 1287 | Ga0068867_100011837 | |||
| 1288 | Ga0068867_100012130 | |||
| 1289 | Ga0068867_100067838 | |||
| 1290 | Ga0068867_100569397 | |||
| 1291 | Ga0068867_100571254 | |||
| 1292 | Ga0068867_100708840 | |||
| 1293 | Ga0068867_100776836 | |||
| 1294 | Ga0068867_100809254 | |||
| 1295 | Ga0068867_101043994 | |||
| 1296 | Ga0068867_101307042 | |||
| 1297 | Ga0070685_10054219 | |||
| 1298 | Ga0070685_10130662 | |||
| 1299 | Ga0070685_10292353 | |||
| 1300 | Ga0070679_100047759 | |||
| 1301 | Ga0070679_100143030 | |||
| 1302 | Ga0070684_100021260 | |||
| 1303 | Ga0070684_100046353 | |||
| 1304 | Ga0070684_100193764 | |||
| 1305 | Ga0070684_101502800 | |||
| 1306 | Ga0068853_100104703 | |||
| 1307 | Ga0068853_100107889 | |||
| 1308 | Ga0068853_100233084 | |||
| 1309 | Ga0068853_100413423 | |||
| 1310 | Ga0068853_100476010 | |||
| 1311 | Ga0068853_100521037 | |||
| 1312 | Ga0068853_100713243 | |||
| 1313 | Ga0068853_100777143 | |||
| 1314 | Ga0068853_100870167 | |||
| 1315 | Ga0068853_101195251 | |||
| 1316 | Ga0070672_100024315 | |||
| 1317 | Ga0070672_100043706 | |||
| 1318 | Ga0070672_100058329 | |||
| 1319 | Ga0070672_100140671 | |||
| 1320 | Ga0070672_100168509 | |||
| 1321 | Ga0070672_100206540 | |||
| 1322 | Ga0070672_100266877 | |||
| 1323 | Ga0070672_100386054 | |||
| 1324 | Ga0070672_100403174 | |||
| 1325 | Ga0070672_100475521 | |||
| 1326 | Ga0070672_101233852 | |||
| 1327 | Ga0070672_101388517 | |||
| 1328 | Ga0070686_100018261 | |||
| 1329 | Ga0070686_100456662 | |||
| 1330 | Ga0070693_101018167 | |||
| 1331 | Ga0070665_100000001 | |||
| 1332 | Ga0070665_100045444 | |||
| 1333 | Ga0070665_100141768 | |||
| 1334 | Ga0070665_100465756 | |||
| 1335 | Ga0068855_100051562 | |||
| 1336 | Ga0068855_100387372 | |||
| 1337 | Ga0068855_101203178 | |||
| 1338 | Ga0068855_102115026 | |||
| 1339 | Ga0070664_100084099 | |||
| 1340 | Ga0070664_100138809 | |||
| 1341 | Ga0070664_100298364 | |||
| 1342 | Ga0070664_100601421 | |||
| 1343 | Ga0070664_100966040 | |||
| 1344 | Ga0070664_101050047 | |||
| 1345 | Ga0070664_101525755 | |||
| 1346 | Ga0068857_100040938 | |||
| 1347 | Ga0068857_100081626 | |||
| 1348 | Ga0068857_100119536 | |||
| 1349 | Ga0068857_101626312 | |||
| 1350 | Ga0068854_100048602 | |||
| 1351 | Ga0068854_100057516 | |||
| 1352 | Ga0068854_100172563 | |||
| 1353 | Ga0068854_100173312 | |||
| 1354 | Ga0068854_100258297 | |||
| 1355 | Ga0068854_100334396 | |||
| 1356 | Ga0068854_100473774 | |||
| 1357 | Ga0068856_100183027 | |||
| 1358 | Ga0068856_100292741 | |||
| 1359 | Ga0070702_100290266 | |||
| 1360 | Ga0070702_101098828 | |||
| 1361 | Ga0068852_100025622 | |||
| 1362 | Ga0068852_100074305 | |||
| 1363 | Ga0068852_100087742 | |||
| 1364 | Ga0068852_100160380 | |||
| 1365 | Ga0068852_100176883 | |||
| 1366 | Ga0068852_100402852 | |||
| 1367 | Ga0068852_100555142 | |||
| 1368 | Ga0068852_100559595 | |||
| 1369 | Ga0068852_100649864 | |||
| 1370 | Ga0068852_101084683 | |||
| 1371 | Ga0068852_101555485 | |||
| 1372 | Ga0068859_100000037 | |||
| 1373 | Ga0068859_100002491 | |||
| 1374 | Ga0068859_100040242 | |||
| 1375 | Ga0068859_100090094 | |||
| 1376 | Ga0068859_100226291 | |||
| 1377 | Ga0068859_100272899 | |||
| 1378 | Ga0068859_101902345 | |||
| 1379 | Ga0068864_100002302 | |||
| 1380 | Ga0068864_100005468 | |||
| 1381 | Ga0068864_100259859 | |||
| 1382 | Ga0068864_102353715 | |||
| 1383 | Ga0068866_10069033 | |||
| 1384 | Ga0068866_10226426 | |||
| 1385 | Ga0068861_100006643 | |||
| 1386 | Ga0068861_100051617 | |||
| 1387 | Ga0068861_100121125 | |||
| 1388 | Ga0068861_100205571 | |||
| 1389 | Ga0068851_10026971 | |||
| 1390 | Ga0068851_10072821 | |||
| 1391 | Ga0068851_10115664 | |||
| 1392 | Ga0068851_10208554 | |||
| 1393 | Ga0068851_10424958 | |||
| 1394 | Ga0068851_10940785 | |||
| 1395 | Ga0068870_10021607 | |||
| 1396 | Ga0068870_10025073 | |||
| 1397 | Ga0068863_100002925 | |||
| 1398 | Ga0068863_100012295 | |||
| 1399 | Ga0068863_100088110 | |||
| 1400 | Ga0068863_100480284 | |||
| 1401 | Ga0068863_100536380 | |||
| 1402 | Ga0068863_100940042 | |||
| 1403 | Ga0068863_102051060 | |||
| 1404 | Ga0068858_100004320 | |||
| 1405 | Ga0068858_100309206 | |||
| 1406 | Ga0068858_100355242 | |||
| 1407 | Ga0068860_100000097 | |||
| 1408 | Ga0068860_100005547 | |||
| 1409 | Ga0068860_100018429 | |||
| 1410 | Ga0068860_100030843 | |||
| 1411 | Ga0068860_100080452 | |||
| 1412 | Ga0068860_100280934 | |||
| 1413 | Ga0068860_100557473 | |||
| 1414 | Ga0068860_100642466 | |||
| 1415 | Ga0068860_100716166 | |||
| 1416 | Ga0068860_102791755 | |||
| 1417 | Ga0068862_100015311 | |||
| 1418 | Ga0068862_100418423 | |||
| 1419 | Ga0068862_100558485 | |||
| 1420 | Ga0068862_100643661 | |||
| 1421 | Ga0068862_101334736 | |||
| 1422 | Ga0068862_101652122 | |||
| 1423 | Ga0075369_10254845 | |||
| 1424 | Ga0075366_10031189 | |||
| 1425 | Ga0075366_10195492 | |||
| 1426 | Ga0075366_10901792 | |||
| 1427 | Ga0097621_100031668 | |||
| 1428 | Ga0097621_100096686 | |||
| 1429 | Ga0097621_100522164 | |||
| 1430 | Ga0097621_101210662 | |||
| 1431 | Ga0097621_101273636 | |||
| 1432 | Ga0097621_101439090 | |||
| 1433 | Ga0075370_10048107 | |||
| 1434 | Ga0075370_10236804 | |||
| 1435 | Ga0075370_10302193 | |||
| 1436 | Ga0075370_10902394 | |||
| 1437 | Ga0068871_100084017 | |||
| 1438 | Ga0068871_100306332 | |||
| 1439 | Ga0068871_100370632 | |||
| 1440 | Ga0068871_100431115 | |||
| 1441 | Ga0068871_100856262 | |||
| 1442 | Ga0068871_101093666 | |||
| 1443 | Ga0068871_101575444 | |||
| 1444 | Ga0068871_101774423 | |||
| 1445 | Ga0075428_100140238 | |||
| 1446 | Ga0075428_101738542 | |||
| 1447 | Ga0075429_100339821 | |||
| 1448 | Ga0068865_100038915 | |||
| 1449 | Ga0068865_100089701 | |||
| 1450 | Ga0068865_100167631 | |||
| 1451 | Ga0068865_101489453 | |||
| 1452 | Ga0097620_100000037 | |||
| 1453 | Ga0097620_100002491 | |||
| 1454 | Ga0097620_100040243 | |||
| 1455 | Ga0097620_100090092 | |||
| 1456 | Ga0097620_100226288 | |||
| 1457 | Ga0097620_100272888 | |||
| 1458 | Ga0097620_101902697 | |||
| 1459 | Ga0105251_10238546 | |||
| 1460 | Ga0105240_10011002 | |||
| 1461 | Ga0105240_10023972 | |||
| 1462 | Ga0105240_10078219 | |||
| 1463 | Ga0105240_10100052 | |||
| 1464 | Ga0105240_10331805 | |||
| 1465 | Ga0105240_10943101 | |||
| 1466 | Ga0105240_11006892 | |||
| 1467 | Ga0105240_11357741 | |||
| 1468 | Ga0111539_10014550 | |||
| 1469 | Ga0111539_10044551 | |||
| 1470 | Ga0105245_10196069 | |||
| 1471 | Ga0105245_10421275 | |||
| 1472 | Ga0105245_12492681 | |||
| 1473 | Ga0105247_10015344 | |||
| 1474 | Ga0114129_10511551 | |||
| 1475 | Ga0105243_13099013 | |||
| 1476 | Ga0105241_10007590 | |||
| 1477 | Ga0105241_10014100 | |||
| 1478 | Ga0105241_10037723 | |||
| 1479 | Ga0105241_10265755 | |||
| 1480 | Ga0105241_10629530 | |||
| 1481 | Ga0105241_10634974 | |||
| 1482 | Ga0105241_10824349 | |||
| 1483 | Ga0105241_10849170 | |||
| 1484 | Ga0105241_11150865 | |||
| 1485 | Ga0105241_11208157 | |||
| 1486 | Ga0105241_11829482 | |||
| 1487 | Ga0105242_10045717 | |||
| 1488 | Ga0105242_10200555 | |||
| 1489 | Ga0105242_10259499 | |||
| 1490 | Ga0105242_11077188 | |||
| 1491 | Ga0105242_11077762 | |||
| 1492 | Ga0105248_11592813 | |||
| 1493 | Ga0105248_11648581 | |||
| 1494 | Ga0105237_10001588 | |||
| 1495 | Ga0105237_10001799 | |||
| 1496 | Ga0105237_10014365 | |||
| 1497 | Ga0105237_10030759 | |||
| 1498 | Ga0105237_10069245 | |||
| 1499 | Ga0105238_10109822 | |||
| 1500 | Ga0105238_10705871 | |||
| 1501 | Ga0105238_11150423 | |||
| 1502 | Ga0105238_11180487 | |||
| 1503 | Ga0105249_10001080 | |||
| 1504 | Ga0105249_10029956 | |||
| 1505 | Ga0105249_10219506 | |||
| 1506 | Ga0105249_11384925 | |||
| 1507 | Ga0105239_10004090 | |||
| 1508 | Ga0105239_10007869 | |||
| 1509 | Ga0105239_10117570 | |||
| 1510 | Ga0105239_10198084 | |||
| 1511 | Ga0105239_10240840 | |||
| 1512 | Ga0105239_10505456 | |||
| 1513 | Ga0105239_10628709 | |||
| 1514 | Ga0105239_10654488 | |||
| 1515 | Ga0105239_10859738 | |||
| 1516 | Ga0105239_11804309 | |||
| 1517 | Ga0105239_13621801 | |||
| 1518 | Ga0105246_10021096 | |||
| 1519 | Ga0105246_10809389 | |||
| 1520 | Ga0157373_10025943 | |||
| 1521 | Ga0157373_10459052 | |||
| 1522 | Ga0157373_10764455 | |||
| 1523 | Ga0157373_10914537 | |||
| 1524 | Ga0157373_11174526 | |||
| 1525 | Ga0157371_10023444 | |||
| 1526 | Ga0157371_10024281 | |||
| 1527 | Ga0157371_10054786 | |||
| 1528 | Ga0157371_10054932 | |||
| 1529 | Ga0157371_10054961 | |||
| 1530 | Ga0157371_10212534 | |||
| 1531 | Ga0157371_10389929 | |||
| 1532 | Ga0157371_10401077 | |||
| 1533 | Ga0157371_10633119 | |||
| 1534 | Ga0157371_10963758 | |||
| 1535 | Ga0157370_10286166 | |||
| 1536 | Ga0157370_10553855 | |||
| 1537 | Ga0157370_10623454 | |||
| 1538 | Ga0157370_10816236 | |||
| 1539 | Ga0157370_11235191 | |||
| 1540 | Ga0157369_10012941 | |||
| 1541 | Ga0157369_10068990 | |||
| 1542 | Ga0157369_10083535 | |||
| 1543 | Ga0157369_10115086 | |||
| 1544 | Ga0157369_10424209 | |||
| 1545 | Ga0157369_10475273 | |||
| 1546 | Ga0157369_10527443 | |||
| 1547 | Ga0157369_12467560 | |||
| 1548 | Ga0157374_10000500 | |||
| 1549 | Ga0157374_10008968 | |||
| 1550 | Ga0157374_10121013 | |||
| 1551 | Ga0157374_10126640 | |||
| 1552 | Ga0157374_10229288 | |||
| 1553 | Ga0157374_10270813 | |||
| 1554 | Ga0157374_10498328 | |||
| 1555 | Ga0157374_10535708 | |||
| 1556 | Ga0157374_10706878 | |||
| 1557 | Ga0157378_10021595 | |||
| 1558 | Ga0157378_10076791 | |||
| 1559 | Ga0157378_10131585 | |||
| 1560 | Ga0157378_10246272 | |||
| 1561 | Ga0157378_10526853 | |||
| 1562 | Ga0157378_10593805 | |||
| 1563 | Ga0157378_10813603 | |||
| 1564 | Ga0157378_11010441 | |||
| 1565 | Ga0157378_11185144 | |||
| 1566 | Ga0157378_12484823 | |||
| 1567 | Ga0163162_10001189 | |||
| 1568 | Ga0163162_10001595 | |||
| 1569 | Ga0163162_10001867 | |||
| 1570 | Ga0163162_10025579 | |||
| 1571 | Ga0163162_10115627 | |||
| 1572 | Ga0163162_10163494 | |||
| 1573 | Ga0163162_10486635 | |||
| 1574 | Ga0163162_10806314 | |||
| 1575 | Ga0157372_10016323 | |||
| 1576 | Ga0157372_10024284 | |||
| 1577 | Ga0157372_10029769 | |||
| 1578 | Ga0157372_10038201 | |||
| 1579 | Ga0157372_10179557 | |||
| 1580 | Ga0157372_10209283 | |||
| 1581 | Ga0157372_10239188 | |||
| 1582 | Ga0157372_10247490 | |||
| 1583 | Ga0157372_10348328 | |||
| 1584 | Ga0157372_10535402 | |||
| 1585 | Ga0157372_10590069 | |||
| 1586 | Ga0157372_10623253 | |||
| 1587 | Ga0157372_10773148 | |||
| 1588 | Ga0157372_10918512 | |||
| 1589 | Ga0157372_10981587 | |||
| 1590 | Ga0157372_11013100 | |||
| 1591 | Ga0157372_11410151 | |||
| 1592 | Ga0157372_11665603 | |||
| 1593 | Ga0157372_11682365 | |||
| 1594 | Ga0157372_11982074 | |||
| 1595 | Ga0157372_12006511 | |||
| 1596 | Ga0157372_12144737 | |||
| 1597 | Ga0157375_10012841 | |||
| 1598 | Ga0157375_10082979 | |||
| 1599 | Ga0157375_10090738 | |||
| 1600 | Ga0157375_10094808 | |||
| 1601 | Ga0157375_10095074 | |||
| 1602 | Ga0157375_10153729 | |||
| 1603 | Ga0157375_10208620 | |||
| 1604 | Ga0157375_10226178 | |||
| 1605 | Ga0157375_10376285 | |||
| 1606 | Ga0157375_11255101 | |||
| 1607 | Ga0157375_12084896 | |||
| 1608 | Ga0163163_10001501 | |||
| 1609 | Ga0163163_10054019 | |||
| 1610 | Ga0163163_10208087 | |||
| 1611 | Ga0163163_10651108 | |||
| 1612 | Ga0163163_11009946 | |||
| 1613 | Ga0163163_12430047 | |||
| 1614 | Ga0163163_12536167 | |||
| 1615 | Ga0157380_10011122 | |||
| 1616 | Ga0157380_10030118 | |||
| 1617 | Ga0157380_10113108 | |||
| 1618 | Ga0157380_10361775 | |||
| 1619 | Ga0157380_12735341 | |||
| 1620 | Ga0157380_13437220 | |||
| 1621 | Ga0182008_10349774 | |||
| 1622 | Ga0157377_10004500 | |||
| 1623 | Ga0157377_10021210 | |||
| 1624 | Ga0157377_10069334 | |||
| 1625 | Ga0157377_10354555 | |||
| 1626 | Ga0157377_10579621 | |||
| 1627 | Ga0157377_11002115 | |||
| 1628 | Ga0157379_10008284 | |||
| 1629 | Ga0157379_10036538 | |||
| 1630 | Ga0157379_10090931 | |||
| 1631 | Ga0157379_10128099 | |||
| 1632 | Ga0157379_10978871 | |||
| 1633 | Ga0157376_10013181 | |||
| 1634 | Ga0157376_10232761 | |||
| 1635 | Ga0157376_10438390 | |||
| 1636 | Ga0157376_10858745 | |||
| 1637 | Ga0157376_10876601 | |||
| 1638 | Ga0157376_11134319 | |||
| 1639 | Ga0157376_11584127 | |||
| 1640 | Ga0157376_11595799 | |||
| 1641 | Ga0157376_12191847 | |||
| 1642 | Ga0163161_10013936 | |||
| 1643 | Ga0163161_10076648 | |||
| 1644 | Ga0163161_10185939 | |||
| 1645 | Ga0163161_10191737 | |||
| 1646 | Ga0163161_10201044 | |||
| 1647 | Ga0163161_10574204 | |||
| 1648 | Ga0163161_10740107 | |||
| 1649 | Ga0206356_11668122 | |||
| 1650 | Ga0213876_10007626 | |||
| 1651 | Ga0207426_1000105 | |||
| 1652 | Ga0207697_10008960 | |||
| 1653 | Ga0207697_10045796 | |||
| 1654 | Ga0207697_10258504 | |||
| 1655 | Ga0207697_10407196 | |||
| 1656 | Ga0207656_10072874 | |||
| 1657 | Ga0207656_10107139 | |||
| 1658 | Ga0207682_10012690 | |||
| 1659 | Ga0207682_10043617 | |||
| 1660 | Ga0207682_10103216 | |||
| 1661 | Ga0207682_10415225 | |||
| 1662 | Ga0207642_10049589 | |||
| 1663 | Ga0207642_10101549 | |||
| 1664 | Ga0207642_10308757 | |||
| 1665 | Ga0207688_10010099 | |||
| 1666 | Ga0207688_10237702 | |||
| 1667 | Ga0207680_10000051 | |||
| 1668 | Ga0207680_10045258 | |||
| 1669 | Ga0207680_10208839 | |||
| 1670 | Ga0207680_10337949 | |||
| 1671 | Ga0207680_10959422 | |||
| 1672 | Ga0207647_10000110 | |||
| 1673 | Ga0207647_10025805 | |||
| 1674 | Ga0207647_10076676 | |||
| 1675 | Ga0207647_10116637 | |||
| 1676 | Ga0207647_10636369 | |||
| 1677 | Ga0207645_10002136 | |||
| 1678 | Ga0207645_10044737 | |||
| 1679 | Ga0207645_10072859 | |||
| 1680 | Ga0207645_10093484 | |||
| 1681 | Ga0207645_10163618 | |||
| 1682 | Ga0207643_10001724 | |||
| 1683 | Ga0207643_10006929 | |||
| 1684 | Ga0207705_10014024 | |||
| 1685 | Ga0207705_10081358 | |||
| 1686 | Ga0207705_10088880 | |||
| 1687 | Ga0207705_10176266 | |||
| 1688 | Ga0207705_10732549 | |||
| 1689 | Ga0207705_10992843 | |||
| 1690 | Ga0207705_11442265 | |||
| 1691 | Ga0207654_10000881 | |||
| 1692 | Ga0207654_10002705 | |||
| 1693 | Ga0207654_10080916 | |||
| 1694 | Ga0207654_10382689 | |||
| 1695 | Ga0207654_10532596 | |||
| 1696 | Ga0207654_10633681 | |||
| 1697 | Ga0207654_11366915 | |||
| 1698 | Ga0207654_11446234 | |||
| 1699 | Ga0207707_10344888 | |||
| 1700 | Ga0207707_10642352 | |||
| 1701 | Ga0207695_10000084 | |||
| 1702 | Ga0207695_10004647 | |||
| 1703 | Ga0207695_10026373 | |||
| 1704 | Ga0207695_10079990 | |||
| 1705 | Ga0207695_10105078 | |||
| 1706 | Ga0207671_10003750 | |||
| 1707 | Ga0207671_10004543 | |||
| 1708 | Ga0207671_10007320 | |||
| 1709 | Ga0207671_10032778 | |||
| 1710 | Ga0207671_10355358 | |||
| 1711 | Ga0207662_10047459 | |||
| 1712 | Ga0207662_10061472 | |||
| 1713 | Ga0207662_10092496 | |||
| 1714 | Ga0207662_10996307 | |||
| 1715 | Ga0207662_11105997 | |||
| 1716 | Ga0207657_10062662 | |||
| 1717 | Ga0207657_10158704 | |||
| 1718 | Ga0207657_10684543 | |||
| 1719 | Ga0207657_10787714 | |||
| 1720 | Ga0207649_10005479 | |||
| 1721 | Ga0207649_10588025 | |||
| 1722 | Ga0207652_10002830 | |||
| 1723 | Ga0207652_10388671 | |||
| 1724 | Ga0207681_10015241 | |||
| 1725 | Ga0207681_10817614 | |||
| 1726 | Ga0207681_11644446 | |||
| 1727 | Ga0207694_10017481 | |||
| 1728 | Ga0207694_10069133 | |||
| 1729 | Ga0207694_10874935 | |||
| 1730 | Ga0207650_10014881 | |||
| 1731 | Ga0207650_10066694 | |||
| 1732 | Ga0207650_10074981 | |||
| 1733 | Ga0207650_10093786 | |||
| 1734 | Ga0207650_10167486 | |||
| 1735 | Ga0207650_10180530 | |||
| 1736 | Ga0207650_10199627 | |||
| 1737 | Ga0207650_10254342 | |||
| 1738 | Ga0207650_10499989 | |||
| 1739 | Ga0207659_10009764 | |||
| 1740 | Ga0207659_10033056 | |||
| 1741 | Ga0207659_10101095 | |||
| 1742 | Ga0207659_10183973 | |||
| 1743 | Ga0207659_10192518 | |||
| 1744 | Ga0207659_10369284 | |||
| 1745 | Ga0207687_10309374 | |||
| 1746 | Ga0207687_11221390 | |||
| 1747 | Ga0207644_10012415 | |||
| 1748 | Ga0207644_10021869 | |||
| 1749 | Ga0207644_10024620 | |||
| 1750 | Ga0207644_10076596 | |||
| 1751 | Ga0207644_10912262 | |||
| 1752 | Ga0207644_11457609 | |||
| 1753 | Ga0207644_11578564 | |||
| 1754 | Ga0207690_10035193 | |||
| 1755 | Ga0207690_10633736 | |||
| 1756 | Ga0207690_11388566 | |||
| 1757 | Ga0207706_10009371 | |||
| 1758 | Ga0207706_10037951 | |||
| 1759 | Ga0207706_10068145 | |||
| 1760 | Ga0207706_10707786 | |||
| 1761 | Ga0207686_10149241 | |||
| 1762 | Ga0207670_10154313 | |||
| 1763 | Ga0207670_10196787 | |||
| 1764 | Ga0207670_10760665 | |||
| 1765 | Ga0207669_10037398 | |||
| 1766 | Ga0207669_10409607 | |||
| 1767 | Ga0207669_10510496 | |||
| 1768 | Ga0207704_10022175 | |||
| 1769 | Ga0207704_10039066 | |||
| 1770 | Ga0207691_10019043 | |||
| 1771 | Ga0207691_10027644 | |||
| 1772 | Ga0207691_10063549 | |||
| 1773 | Ga0207691_10075279 | |||
| 1774 | Ga0207691_10099184 | |||
| 1775 | Ga0207691_10115614 | |||
| 1776 | Ga0207691_10176679 | |||
| 1777 | Ga0207691_10497887 | |||
| 1778 | Ga0207689_10005396 | |||
| 1779 | Ga0207689_10018050 | |||
| 1780 | Ga0207689_10101705 | |||
| 1781 | Ga0207661_10009193 | |||
| 1782 | Ga0207661_10178861 | |||
| 1783 | Ga0207679_10000875 | |||
| 1784 | Ga0207679_10086487 | |||
| 1785 | Ga0207679_10128128 | |||
| 1786 | Ga0207679_10226523 | |||
| 1787 | Ga0207679_10340064 | |||
| 1788 | Ga0207679_10640885 | |||
| 1789 | Ga0207679_10651771 | |||
| 1790 | Ga0207679_11499122 | |||
| 1791 | Ga0207679_11916378 | |||
| 1792 | Ga0207667_10073069 | |||
| 1793 | Ga0207667_10181502 | |||
| 1794 | Ga0207667_10329536 | |||
| 1795 | Ga0207667_10387114 | |||
| 1796 | Ga0207667_11069064 | |||
| 1797 | Ga0207667_12029358 | |||
| 1798 | Ga0207651_10053397 | |||
| 1799 | Ga0207651_10078265 | |||
| 1800 | Ga0207651_10087831 | |||
| 1801 | Ga0207651_10119509 | |||
| 1802 | Ga0207651_10181194 | |||
| 1803 | Ga0207651_10196091 | |||
| 1804 | Ga0207651_10212458 | |||
| 1805 | Ga0207651_10264420 | |||
| 1806 | Ga0207651_10975561 | |||
| 1807 | Ga0207651_11102178 | |||
| 1808 | Ga0207712_10014683 | |||
| 1809 | Ga0207712_10235773 | |||
| 1810 | Ga0207712_10269554 | |||
| 1811 | Ga0207668_10015084 | |||
| 1812 | Ga0207668_10067188 | |||
| 1813 | Ga0207668_10074644 | |||
| 1814 | Ga0207668_10210505 | |||
| 1815 | Ga0207640_10087024 | |||
| 1816 | Ga0207640_10280232 | |||
| 1817 | Ga0207640_10540948 | |||
| 1818 | Ga0207658_10009886 | |||
| 1819 | Ga0207658_10012999 | |||
| 1820 | Ga0207658_10138678 | |||
| 1821 | Ga0207658_10218425 | |||
| 1822 | Ga0207658_10252741 | |||
| 1823 | Ga0207658_10253710 | |||
| 1824 | Ga0207658_10395815 | |||
| 1825 | Ga0207658_10886158 | |||
| 1826 | Ga0207658_11423836 | |||
| 1827 | Ga0207677_10001082 | |||
| 1828 | Ga0207677_10102638 | |||
| 1829 | Ga0207677_10192183 | |||
| 1830 | Ga0207677_10266804 | |||
| 1831 | Ga0207677_11411684 | |||
| 1832 | Ga0207677_11605611 | |||
| 1833 | Ga0207703_10012945 | |||
| 1834 | Ga0207703_10548827 | |||
| 1835 | Ga0207639_10036559 | |||
| 1836 | Ga0207639_10060496 | |||
| 1837 | Ga0207639_10061028 | |||
| 1838 | Ga0207639_10138059 | |||
| 1839 | Ga0207639_10338476 | |||
| 1840 | Ga0207639_10524516 | |||
| 1841 | Ga0207639_11093980 | |||
| 1842 | Ga0207639_11240194 | |||
| 1843 | Ga0207639_11416025 | |||
| 1844 | Ga0207639_11747550 | |||
| 1845 | Ga0207678_10172372 | |||
| 1846 | Ga0207678_10240347 | |||
| 1847 | Ga0207678_10275303 | |||
| 1848 | Ga0207708_10058905 | |||
| 1849 | Ga0207702_10056726 | |||
| 1850 | Ga0207702_10078102 | |||
| 1851 | Ga0207702_10744068 | |||
| 1852 | Ga0207641_10000121 | |||
| 1853 | Ga0207641_10019787 | |||
| 1854 | Ga0207641_10511744 | |||
| 1855 | Ga0207641_10631488 | |||
| 1856 | Ga0207641_10752574 | |||
| 1857 | Ga0207648_10014701 | |||
| 1858 | Ga0207648_10014934 | |||
| 1859 | Ga0207648_10027181 | |||
| 1860 | Ga0207648_10120379 | |||
| 1861 | Ga0207648_10218763 | |||
| 1862 | Ga0207648_10303123 | |||
| 1863 | Ga0207648_10323886 | |||
| 1864 | Ga0207648_10731575 | |||
| 1865 | Ga0207648_10882974 | |||
| 1866 | Ga0207648_11601524 | |||
| 1867 | Ga0207676_10003342 | |||
| 1868 | Ga0207676_10015259 | |||
| 1869 | Ga0207676_10183279 | |||
| 1870 | Ga0207676_10624550 | |||
| 1871 | Ga0207676_10632657 | |||
| 1872 | Ga0207676_10656245 | |||
| 1873 | Ga0207674_10070646 | |||
| 1874 | Ga0207674_10094215 | |||
| 1875 | Ga0207674_10164835 | |||
| 1876 | Ga0207674_11436132 | |||
| 1877 | Ga0207675_100002059 | |||
| 1878 | Ga0207675_100041609 | |||
| 1879 | Ga0207675_100372847 | |||
| 1880 | Ga0207675_100461349 | |||
| 1881 | Ga0207675_100672746 | |||
| 1882 | Ga0207675_100696468 | |||
| 1883 | Ga0207675_101570973 | |||
| 1884 | Ga0207675_102509488 | |||
| 1885 | Ga0207675_102534378 | |||
| 1886 | Ga0207683_10006890 | |||
| 1887 | Ga0207683_10016244 | |||
| 1888 | Ga0207683_10061446 | |||
| 1889 | Ga0207683_10202465 | |||
| 1890 | Ga0207683_10922637 | |||
| 1891 | Ga0207683_11016448 | |||
| 1892 | Ga0207683_11152402 | |||
| 1893 | Ga0207683_11219598 | |||
| 1894 | Ga0207698_10001488 | |||
| 1895 | Ga0207698_10016613 | |||
| 1896 | Ga0207698_10245179 | |||
| 1897 | Ga0207698_10254695 | |||
| 1898 | Ga0207698_10408119 | |||
| 1899 | Ga0207698_10641268 | |||
| 1900 | Ga0207698_10754067 | |||
| 1901 | Ga0207698_10859423 | |||
| 1902 | Ga0207698_10919830 | |||
| 1903 | Ga0207698_12102851 | |||
| 1904 | Ga0209996_1077834 | |||
| 1905 | Ga0209974_10257701 | |||
| 1906 | Ga0207428_10111837 | |||
| 1907 | Ga0207428_10136352 | |||
| 1908 | Ga0268266_10000038 | |||
| 1909 | Ga0268266_10015422 | |||
| 1910 | Ga0268266_10143576 | |||
| 1911 | Ga0268266_10362709 | |||
| 1912 | Ga0268265_10003503 | |||
| 1913 | Ga0268265_10547433 | |||
| 1914 | Ga0268265_11193270 | |||
| 1915 | Ga0268265_11806138 | |||
| 1916 | Ga0268264_10000167 | |||
| 1917 | Ga0268264_10004870 | |||
| 1918 | Ga0268264_10012086 | |||
| 1919 | Ga0268264_10017339 | |||
| 1920 | Ga0268264_10128293 | |||
| 1921 | Ga0268264_10182798 | |||
| 1922 | Ga0268264_10251911 | |||
| 1923 | Ga0268264_11678735 | |||
| 1924 | Ga0307517_10018578 | |||
| 1925 | Ga0307517_10269373 | |||
| 1926 | Ga0307517_10306514 | |||
| 1927 | Ga0307515_10000469 | |||
| 1928 | Ga0307511_10004717 | |||
| 1929 | Ga0307511_10396782 | |||
| 1930 | Ga0307512_10268947 | |||
| 1931 | Ga0265327_10000159 | |||
| 1932 | Ga0307513_10103928 | |||
| 1933 | Ga0307509_10079849 | |||
| 1934 | Ga0307509_10113539 | |||
| 1935 | Ga0307509_10344145 | |||
| 1936 | Ga0307509_10407521 | |||
| 1937 | Ga0307408_100426226 | |||
| 1938 | Ga0265313_10067180 | |||
| 1939 | Ga0307508_10002518 | |||
| 1940 | Ga0307508_10529516 | |||
| 1941 | Ga0307516_10004268 | |||
| 1942 | Ga0307405_10655250 | |||
| 1943 | Ga0307413_10022806 | |||
| 1944 | Ga0307413_10530901 | |||
| 1945 | Ga0307410_10035292 | |||
| 1946 | Ga0307410_11164698 | |||
| 1947 | Ga0307406_10106862 | |||
| 1948 | Ga0307406_11355197 | |||
| 1949 | Ga0307407_10083520 | |||
| 1950 | Ga0307412_10519431 | |||
| 1951 | Ga0307409_101269840 | |||
| 1952 | Ga0307416_100069247 | |||
| 1953 | Ga0307416_100974098 | |||
| 1954 | Ga0307416_102077190 | |||
| 1955 | Ga0307414_10105037 | |||
| 1956 | Ga0307414_10215472 | |||
| 1957 | Ga0307414_10476789 | |||
| 1958 | Ga0307414_10485765 | |||
| 1959 | Ga0307414_10726189 | |||
| 1960 | Ga0307414_10794241 | |||
| 1961 | Ga0307411_11684469 | |||
| 1962 | Ga0307415_100025311 | |||
| 1963 | Ga0307415_102332102 | |||
| 1964 | Ga0307507_10338473 | |||
| 1965 | Ga0373938_0094755 | |||
| 1966 | Ga0373962_0367198 | |||
| 1967 | Ga0265778_057272 | |||
| 1968 | Ga0395899_0702648 | |||
| 1969 | Ga0395900_0216632 | |||
| 1970 | Ga0395900_1100609 | |||
| 1971 | Ga0395905_0002823 | |||
| 1972 | Ga0395901_0560399 | |||
| 1973 | Ga0436365_0472587 | |||
| 1974 | Ga0436365_0781227 | |||
| 1975 | Ga0436363_0734173 | |||
| 1976 | Ga0436363_1110235 | |||
| 1977 | Ga0439436_0042221 | |||
| 1978 | Ga0439439_0161566 | |||
| 1979 | Ga0439461_0043177 | |||
| 1980 | Ga0451787_080681 | |||
| 1981 | Ga0451789_0191907 | |||
| 1982 | Ga0451794_28172 | |||
| 1983 | Ga0451797_0542401 | |||
| 1984 | Ga0451802_0148319 | |||
| 1985 | Ga0451804_0798737 | |||
| 1986 | Ga0451807_2671209 | |||
| 1987 | Ga0451839_1552964 | |||
| 1988 | Ga0451847_0938223 | |||
| 1989 | Ga0451843_0386673 | |||
| 1990 | Ga0451853_0260808 | |||
| 1991 | Ga0451853_0354634 | |||
| 1992 | Ga0451853_2173213 | |||
| 1993 | Ga0451853_2350954 | |||
| 1994 | Ga0439449_0017442 | |||
| 1995 | Ga0439457_008270 | |||
| 1996 | Ga0439446_0018535 | |||
| 1997 | Ga0439434_0017713 | |||
| 1998 | Ga0439434_0048470 | |||
| 1999 | Ga0439435_0267835 | |||
| 2000 | Ga0451577_0035014 | |||
| 2001 | Ga0466972_0000025 | |||
| 2002 | Ga0466972_0021513 | |||
| 2003 | Ga0466972_0134269 | |||
| 2004 | Ga0466972_0360729 | |||
| 2005 | Ga0466965_0187557 | |||
| 2006 | Ga0453684_0003639 | |||
| 2007 | Ga0453684_0046321 | |||
| 2008 | Ga0453684_0755575 | |||
| 2009 | Ga0453684_2573165 | |||
| 2010 | Ga0466968_0052503 | |||
| 2011 | Ga0466968_0095953 | |||
| 2012 | Ga0466970_0000933 | |||
| 2013 | Ga0466957_0131367 | |||
| 2014 | Ga0466960_0228251 | |||
| 2015 | Ga0466959_0017683 | |||
| 2016 | Ga0466959_0442562 | |||
| 2017 | Ga0466959_0901945 | |||
| 2018 | Ga0451576_0110481 | |||
| 2019 | Ga0495629_0815944 | |||
| 2020 | Ga0495638_0083984 | |||
| 2021 | Ga0495648_0012032 | |||
| 2022 | Ga0495648_0342523 | |||
| 2023 | Ga0495652_0255633 | |||
| 2024 | Ga0495640_0695428 | |||
| 2025 | Ga0495611_0130135 | |||
| 2026 | Ga0495625_0132206 | |||
| 2027 | Ga0495625_0273493 | |||
| 2028 | Ga0495649_0091156 | |||
| 2029 | Ga0495649_0581841 | |||
| 2030 | Ga0495672_0011267 | |||
| 2031 | Ga0495687_000001 | |||
| 2032 | Ga0495686_0000004 | |||
| 2033 | Ga0495686_0121135 | |||
| 2034 | Ga0496104_1101758 | |||
| 2035 | Ga0496105_1064456 | |||
| 2036 | Ga0496108_0158364 | |||
| 2037 | Ga0496108_1780694 | |||
| 2038 | Ga0496110_0131071 | |||
| 2039 | Ga0496110_0901907 | |||
| 2040 | Ga0496111_0265301 | |||
| 2041 | Ga0501306_005254 | |||
| 2042 | Ga0501306_007098 | |||
| 2043 | Ga0501306_011995 | |||
| 2044 | Ga0501306_015031 | |||
| 2045 | Ga0501306_036894 | |||
| 2046 | Ga0501308_000724 | |||
| 2047 | Ga0501308_002471 | |||
| 2048 | Ga0501308_003669 | |||
| 2049 | Ga0501308_025384 | |||
| 2050 | Ga0501308_030669 | |||
| 2051 | Ga0501309_004409 | |||
| 2052 | Ga0501309_006097 | |||
| 2053 | Ga0501309_029601 | |||
| 2054 | Ga0501310_008402 | |||
| 2055 | Ga0501310_017992 | |||
| 2056 | Ga0501310_020532 | |||
| 2057 | Ga0501310_072876 | |||
| 2058 | Ga0501341_03273 | |||
| 2059 | Ga0501343_004442 | |||
| 2060 | Ga0501343_008419 | |||
| 2061 | Ga0501344_07553 | |||
| 2062 | Ga0501304_002005 | |||
| 2063 | Ga0501304_006956 | |||
| 2064 | Ga0501305_000918 | |||
| 2065 | Ga0501305_003905 | |||
| 2066 | Ga0501305_014229 | |||
| 2067 | Ga0501305_021427 | |||
| 2068 | Ga0501305_038014 | |||
| 2069 | Ga0501307_001810 | |||
| 2070 | Ga0501307_006326 | |||
| 2071 | Ga0501307_020375 | |||
| 2072 | Ga0501307_036545 | |||
| 2073 | Ga0501307_071145 | |||
| 2074 | Ga0501297_075382 | |||
| 2075 | Ga0501311_002005 | |||
| 2076 | Ga0501311_009005 | |||
| 2077 | Ga0501311_017129 | |||
| 2078 | Ga0501311_021215 | |||
| 2079 | Ga0501312_003742 | |||
| 2080 | Ga0501312_003877 | |||
| 2081 | Ga0501312_009338 | |||
| 2082 | Ga0501312_021281 | |||
| 2083 | Ga0501313_000530 | |||
| 2084 | Ga0501313_004747 | |||
| 2085 | Ga0501313_009702 | |||
| 2086 | Ga0501313_024321 | |||
| 2087 | Ga0501314_019095 | |||
| 2088 | Ga0501315_004451 | |||
| 2089 | Ga0501315_007467 | |||
| 2090 | Ga0501315_008378 | |||
| 2091 | Ga0501315_011678 | |||
| 2092 | Ga0501315_029348 | |||
| 2093 | Ga0501315_032842 | |||
| 2094 | Ga0501316_000565 | |||
| 2095 | Ga0501316_010922 | |||
| 2096 | Ga0501316_012207 | |||
| 2097 | Ga0501316_037104 | |||
| 2098 | Ga0501316_056265 | |||
| 2099 | Ga0501317_017020 | |||
| 2100 | Ga0501317_050641 | |||
| 2101 | Ga0501317_084668 | |||
| 2102 | Ga0501320_002608 | |||
| 2103 | Ga0501320_013151 | |||
| 2104 | Ga0501321_003706 | |||
| 2105 | Ga0501321_018127 | |||
| 2106 | Ga0501322_027968 | |||
| 2107 | Ga0501323_002763 | |||
| 2108 | Ga0501323_023498 | |||
| 2109 | Ga0501324_035978 | |||
| 2110 | Ga0501325_043579 | |||
| 2111 | Ga0501327_08233 | |||
| 2112 | Ga0501327_17119 | |||
| 2113 | Ga0501327_19234 | |||
| 2114 | Ga0501328_10356 | |||
| 2115 | Ga0501329_05041 | |||
| 2116 | Ga0501329_14524 | |||
| 2117 | Ga0501330_003707 | |||
| 2118 | Ga0501331_14064 | |||
| 2119 | Ga0501332_16924 | |||
| 2120 | Ga0501334_03053 | |||
| 2121 | Ga0501334_06500 | |||
| 2122 | Ga0501334_20894 | |||
| 2123 | Ga0501335_003049 | |||
| 2124 | Ga0501335_005666 | |||
| 2125 | Ga0501335_008277 | |||
| 2126 | Ga0501335_011144 | |||
| 2127 | Ga0501335_021015 | |||
| 2128 | Ga0501335_037599 | |||
| 2129 | Ga0501336_007753 | |||
| 2130 | Ga0501337_003392 | |||
| 2131 | Ga0501337_005126 | |||
| 2132 | Ga0501337_006563 | |||
| 2133 | Ga0501340_009762 | |||
| 2134 | Ga0501033_0062825 | |||
| 2135 | Ga0501034_0002020 | |||
| 2136 | Ga0501034_0282372 | |||
| 2137 | Ga0501043_0038700 | |||
| 2138 | Ga0501043_0267933 | |||
| 2139 | Ga0501047_0845703 | |||
| 2140 | Ga0501070_0230182 | |||
| 2141 | Ga0501198_012021 | |||
| 2142 | Ga0501198_020209 | |||
| 2143 | Ga0501201_002320 | |||
| 2144 | Ga0501202_000998 | |||
| 2145 | Ga0501202_009088 | |||
| 2146 | Ga0501202_024862 | |||
| 2147 | Ga0501202_194712 | |||
| 2148 | Ga0501207_020378 | |||
| 2149 | Ga0501216_192811 | |||
| 2150 | Ga0501217_005840 | |||
| 2151 | Ga0501222_060407 | |||
| 2152 | Ga0501223_003765 | |||
| 2153 | Ga0501224_006724 | |||
| 2154 | Ga0501227_171571 | |||
| 2155 | Ga0501235_003091 | |||
| 2156 | Ga0501235_028546 | |||
| 2157 | Ga0501242_009393 | |||
| 2158 | Ga0501242_019701 | |||
| 2159 | Ga0501243_002414 | |||
| 2160 | Ga0501252_003343 | |||
| 2161 | Ga0501259_106647 | |||
| 2162 | Ga0501261_001010 | |||
| 2163 | Ga0501221_088004 | |||
| 2164 | Ga0501221_151874 | |||
| 2165 | Ga0501225_0004957 | |||
| 2166 | Ga0501225_0014988 | |||
| 2167 | Ga0501245_018897 | |||
| 2168 | Ga0501080_0143181 | |||
| 2169 | Ga0501083_0085302 | |||
| 2170 | Ga0501083_0810808 | |||
| 2171 | Ga0501232_030337 | |||
| 2172 | Ga0501241_000113 | |||
| 2173 | Ga0501264_013457 | |||
| 2174 | Ga0501266_037834 | |||
| 2175 | Ga0501268_009295 | |||
| 2176 | Ga0501270_173804 | |||
| 2177 | Ga0501271_039440 | |||
| 2178 | Ga0501035_0112953 | |||
| 2179 | Ga0501035_0725096 | |||
| 2180 | Ga0501044_0199920 | |||
| 2181 | Ga0501212_044539 | |||
| 2182 | Ga0501212_123430 | |||
| 2183 | nmdc:mga03683_410947_c1 | |||
| 2184 | nmdc:mga0k408_12089_c1 | |||
| 2185 | nmdc:mga0k408_254901_c1 | |||
| 2186 | nmdc:mga0k408_431124_c1 | |||
| 2187 | nmdc:mga0k408_674576_c1 | |||
| 2188 | nmdc:mga0k408_7017_c1 | |||
| 2189 | nmdc:mga0k408_9728_c1 | |||
| 2190 | nmdc:mga07m45_122077_c1 | |||
| 2191 | nmdc:mga07m45_122395_c1 | |||
| 2192 | nmdc:mga07m45_219335_c1 | |||
| 2193 | nmdc:mga07m45_380682_c1 | |||
| 2194 | nmdc:mga08y16_106009_c1 | |||
| 2195 | nmdc:mga08y16_26169_c1 | |||
| 2196 | nmdc:mga0sz30_296382_c1 | |||
| 2197 | Ga0500646_0007315 | |||
| 2198 | Ga0500646_0087139 | |||
| 2199 | Ga0500583_0004184 | |||
| 2200 | Ga0500651_0300017 | |||
| 2201 | Ga0500641_0061245 | |||
| 2202 | Ga0500621_155407 | |||
| 2203 | Ga0500628_021680 | |||
| 2204 | Ga0500628_212728 | |||
| 2205 | Ga0500642_0007688 | |||
| 2206 | Ga0500642_0429397 | |||
| 2207 | Ga0500655_034538 | |||
| 2208 | Ga0500655_059390 | |||
| 2209 | Ga0500568_0000439 | |||
| 2210 | Ga0500568_0047775 | |||
| 2211 | Ga0500588_0064267 | |||
| 2212 | Ga0500588_0370740 | |||
| 2213 | Ga0500622_0001823 | |||
| 2214 | Ga0587109_044136 | |||
| 2215 | Ga0587069_054570 | |||
| 2216 | Ga0587079_000249 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jil-assembly1.cif.gz_T | 70s ribosome flavobacterium johnsoniae | 0.8929 | 5 | 93 |
| 7jil-assembly1.cif.gz_T | 70s ribosome flavobacterium johnsoniae | 0.8735 | 5 | 93 |
| 4v3p-assembly1.cif.gz_LX | the molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes | 0.8487 | 5 | 90 |
| 7r72-assembly1.cif.gz_X | state e1 nucleolar 60s ribosome biogenesis intermediate - spb4 local model | 0.8442 | 2 | 90 |
| 6th6-assembly1.cif.gz_BW | cryo-em structure of t. kodakarensis 70s ribosome | 0.8404 | 4 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_D3ZFK7_36_158_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8512 | 1 | 90 | 3.30.70.330 |
| 4qs3X00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.817 | 1 | 93 | 3.30.70.330 |
| 3o5hW01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8145 | 5 | 88 | 3.30.70.330 |
| 5x8tU01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8145 | 5 | 90 | 3.30.70.330 |
| 4ukhK00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8124 | 2 | 90 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R5UZK0-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9121 | 4 | 95 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2N3IDD6-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9054 | 4 | 98 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7V5GYY9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.8964 | 4 | 94 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A424SEI0-F1-model_v4 | deleted | 0.8938 | 4 | 95 |
|
| AF-A0A0G0GY83-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.8927 | 4 | 92 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |