F490024
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1098 | 675 | 845 | 501 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0011689|Ga0496115_0011689_4364_6031 |
| Length | 555 |
| Sequence | MTRIAVGGFLHETNTFAPTKATYDAFVHGGGWPRMEVGAKVLKTLRHINVGLAGFIEAAEAEGWELVPTIFTAATPSAHVTRDAYERIAKVMIDGISAAGRLDAVYLDLHGAMVTEHLDDGEGEILKRVRKVIGTDPPLVASLDLHANVTPEMVEHADALIAYRTYPHVDMADTGRAVARHLALMLKTKQRFAKAFRQLPFLIPISWQCTNDEPTKGIYQKLAAMESDAVPTLSFAPGFPAADFRDCGPSVFAYGKTQADADAATDKLAALIESHENDFDGRIFTPDEGVRHAMELARTASKPIIIADTQDNPGAGGDSDTTGMLRALVRNKAKRAATGVIYDPASAKAAHAAGXXXSVTLALGGKSGIPGDAPYKEAFIVERLSDGQFVAPGPYYGGRDMDMGPSACLRIGDVRVVVSSHKAQLADQSMYRYVGIEPIEQAILVNKSSVHFRADFEPIAERLLICAAPGAMPAGPPHCHGRDCVRASASSRTVPPSSPRPNHVQRLLQPDKIKCPTSTASKASPTNSPRSVGICTRIPRSASRKSARPGSSPTS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 15 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 16 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 27 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 28 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 29 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 30 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 31 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 32 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 33 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 34 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 35 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 36 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 37 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 38 | 2791355199 | |||
| 39 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 40 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 41 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 42 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 43 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 44 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 45 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 46 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 47 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 48 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 49 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 50 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 51 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 52 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 53 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 54 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 55 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 56 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 57 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 58 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 59 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 60 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 61 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 62 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 63 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 64 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 65 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 66 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 67 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 68 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 69 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 70 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 71 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 72 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 73 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 74 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 75 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 76 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 77 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 78 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 79 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 80 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 81 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 82 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 83 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 84 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 85 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 86 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 87 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 88 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 89 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 90 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 91 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 92 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 93 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 94 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 95 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 96 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 97 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 98 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 99 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 100 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 101 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 102 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 103 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 104 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 105 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 106 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 107 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 108 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 109 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 110 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 111 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 112 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 113 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 114 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 115 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 116 | 2904699407 | |||
| 117 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 118 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 119 | 2906610324 | |||
| 120 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 121 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 122 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 123 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 124 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 125 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 126 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 127 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 128 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 129 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 130 | 2922368715 | |||
| 131 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 132 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 133 | 2922425934 | |||
| 134 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 135 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 136 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 137 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 138 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 139 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 140 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 141 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 142 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 143 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 144 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 145 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 146 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 147 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 148 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 149 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 150 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 151 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 152 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 153 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 154 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 155 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 156 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 157 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 158 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 159 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 160 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 161 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 162 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 163 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 164 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 165 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 166 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 167 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 168 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 169 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 170 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 171 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 172 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 173 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 174 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 175 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 176 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 177 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 178 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 179 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 180 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 181 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 182 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 183 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 184 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 185 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 186 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 187 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 188 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 189 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 190 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 191 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 192 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 193 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 194 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 195 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 196 | 2941479691 | |||
| 197 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 198 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 199 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 200 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 201 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 202 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 203 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 204 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 205 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 206 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 207 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 208 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 209 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 210 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 211 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 212 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 213 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 214 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 215 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 216 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 217 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 218 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 219 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 220 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 221 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 222 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 223 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 224 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 226 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 227 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 228 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 229 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 230 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 239 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 241 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 242 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 246 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 247 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 248 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 249 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 250 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 251 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 252 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 254 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 257 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 259 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 260 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 261 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 262 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 263 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 264 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 265 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 266 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 267 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 268 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 269 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 270 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 271 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 273 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 274 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 275 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 276 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 277 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 278 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 279 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 280 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 281 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 283 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 284 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 285 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 287 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 288 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 289 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 290 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 291 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 292 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 293 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 294 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 295 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 296 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 297 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 298 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 299 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 300 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 301 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 302 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 303 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 304 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 305 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 306 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 307 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 308 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 309 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 310 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 311 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 312 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 313 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 314 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 315 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 316 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 317 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 318 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 319 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 320 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 321 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 322 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 323 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 324 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 325 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 326 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 327 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 328 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 329 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 331 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 332 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 333 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 334 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 335 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 336 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 337 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 338 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 339 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 340 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 342 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 343 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 345 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 346 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 347 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 348 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 349 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 350 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 351 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 352 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 353 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 355 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 382 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 384 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 385 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 386 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 390 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 391 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 392 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 393 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 394 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 395 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 396 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 397 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 398 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 399 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 400 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 401 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 402 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 403 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 404 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 405 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 406 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 407 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 408 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 409 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 410 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 411 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 412 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 413 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 414 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 415 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 416 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 417 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 418 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 419 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 420 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 421 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 422 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 423 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 424 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 425 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 426 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 427 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 428 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 429 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 430 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 431 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 432 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 433 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 434 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 435 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 436 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 437 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 438 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 439 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 440 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 441 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 442 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 443 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 444 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 445 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 446 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 447 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 456 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 457 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 458 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 459 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 460 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 462 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 463 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 464 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 465 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 466 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 467 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 468 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 469 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 470 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 471 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 472 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 473 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 474 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 475 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 476 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 477 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 478 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 479 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 480 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 481 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 482 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 483 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 484 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 485 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 530 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 531 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 532 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 533 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 534 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 535 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 536 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 537 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 538 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 539 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 540 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 541 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 542 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 543 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 544 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 545 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 546 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 547 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 548 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 549 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 550 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 551 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 552 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 553 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 554 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 555 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 556 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 559 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 560 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 561 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 562 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 563 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 564 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 565 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 566 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 567 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 568 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 569 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 570 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 571 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 572 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 573 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 574 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 577 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 578 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 579 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 580 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 582 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 583 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 584 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 585 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 586 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 587 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 588 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 589 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 590 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 591 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 592 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 593 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 596 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 597 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 599 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 600 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 601 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 602 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 603 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 604 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 605 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 606 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 607 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 608 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 609 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 610 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 611 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 612 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 613 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 614 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 615 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 616 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 617 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 618 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 619 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 620 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 621 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 622 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 623 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 624 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 625 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 626 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 627 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 628 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 629 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 630 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 631 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 632 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 633 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 634 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 635 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 636 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 637 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 638 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 639 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 640 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 641 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 642 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 643 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 644 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 645 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 646 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 647 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 648 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 649 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 650 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 651 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 652 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 653 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 654 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 655 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 656 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 657 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 658 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 659 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 660 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 661 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 662 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 663 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 664 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 665 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 666 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 667 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 668 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 669 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 670 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
| 671 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 672 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 673 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 674 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 675 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 77.31 |
| Metatranscriptomes | 0 |
| Isolates | 22.69 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.36 |
| Bulb | 0 |
| Endosphere | 11.57 |
| Nodule | 16.39 |
| Rhizoplane | 3.37 |
| Rhizosphere | 55.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24744J21845_10011354 | 3300002077 | Bacteria | 1822 |
| 2 | JGI25151J46595_10011809 | 3300003187 | Bacteria | 4001 |
| 3 | JGI25406J46586_10000169 | 3300003203 | Bacteria | 29128 |
| 4 | JGI25406J46586_10000649 | 3300003203 | Bacteria | 16248 |
| 5 | JGI25406J46586_10001342 | 3300003203 | Bacteria | 11588 |
| 6 | JGI25153J46596_10001707 | 3300003215 | Bacteria | 13020 |
| 7 | JGI25153J46596_10004084 | 3300003215 | Bacteria | 7939 |
| 8 | JGI25153J46596_10010236 | 3300003215 | Bacteria | 4260 |
| 9 | JGI25153J46596_10022212 | 3300003215 | Bacteria | 2345 |
| 10 | JGI25160J50197_1002568 | 3300003354 | Bacteria | 8395 |
| 11 | JGI25160J50197_1004939 | 3300003354 | Bacteria | 5664 |
| 12 | JGI25160J50197_1008493 | 3300003354 | Bacteria | 3908 |
| 13 | JGI25404J52841_10001451 | 3300003659 | Bacteria | 4168 |
| 14 | Ga0055531_10002184 | 3300003794 | Bacteria | 13342 |
| 15 | Ga0065165_1002008 | 3300005262 | Bacteria | 19054 |
| 16 | Ga0065165_1003321 | 3300005262 | Bacteria | 11502 |
| 17 | Ga0065165_1007524 | 3300005262 | Bacteria | 5326 |
| 18 | Ga0070683_100011469 | 3300005329 | Bacteria | 7664 |
| 19 | Ga0070683_100044792 | 3300005329 | Bacteria | 4082 |
| 20 | Ga0070683_100049783 | 3300005329 | Bacteria | 3876 |
| 21 | Ga0070670_100004805 | 3300005331 | Bacteria | 11344 |
| 22 | Ga0070670_100136636 | 3300005331 | Bacteria | 2118 |
| 23 | Ga0070677_10001495 | 3300005333 | Bacteria | 7392 |
| 24 | Ga0068869_100014332 | 3300005334 | Bacteria | 5293 |
| 25 | Ga0068869_100129333 | 3300005334 | Bacteria | 1939 |
| 26 | Ga0070680_100037772 | 3300005336 | Bacteria | 3903 |
| 27 | Ga0070680_100046107 | 3300005336 | Bacteria | 3545 |
| 28 | Ga0070680_100058029 | 3300005336 | Bacteria | 3165 |
| 29 | Ga0068868_100013364 | 3300005338 | Bacteria | 6021 |
| 30 | Ga0068868_100020908 | 3300005338 | Bacteria | 4926 |
| 31 | Ga0068868_100038322 | 3300005338 | Bacteria | 3720 |
| 32 | Ga0070660_100088939 | 3300005339 | Bacteria | 2433 |
| 33 | Ga0070661_100078355 | 3300005344 | Bacteria | 2437 |
| 34 | Ga0070668_100032035 | 3300005347 | Bacteria | 4000 |
| 35 | Ga0070668_100074431 | 3300005347 | Bacteria | 2649 |
| 36 | Ga0070668_100113213 | 3300005347 | Bacteria | 2161 |
| 37 | Ga0070668_100177948 | 3300005347 | Bacteria | 1736 |
| 38 | Ga0070669_100060185 | 3300005353 | Bacteria | 2790 |
| 39 | Ga0070675_100007548 | 3300005354 | Bacteria | 8409 |
| 40 | Ga0070671_100023332 | 3300005355 | Bacteria | 5063 |
| 41 | Ga0070671_100105789 | 3300005355 | Bacteria | 2362 |
| 42 | Ga0070674_100038097 | 3300005356 | Bacteria | 3238 |
| 43 | Ga0070674_100053339 | 3300005356 | Bacteria | 2791 |
| 44 | Ga0070673_100002260 | 3300005364 | Bacteria | 11678 |
| 45 | Ga0070667_100018417 | 3300005367 | Bacteria | 5791 |
| 46 | Ga0070667_100108652 | 3300005367 | Bacteria | 2403 |
| 47 | Ga0070709_10005063 | 3300005434 | Bacteria | 7123 |
| 48 | Ga0070709_10067655 | 3300005434 | Bacteria | 2294 |
| 49 | Ga0070714_100022534 | 3300005435 | Bacteria | 5165 |
| 50 | Ga0070713_100002066 | 3300005436 | Bacteria | 12979 |
| 51 | Ga0070713_100004489 | 3300005436 | Bacteria | 9384 |
| 52 | Ga0070713_100029836 | 3300005436 | Bacteria | 4324 |
| 53 | Ga0070710_10024959 | 3300005437 | Bacteria | 3159 |
| 54 | Ga0070711_100005920 | 3300005439 | Bacteria | 7341 |
| 55 | Ga0070663_100015939 | 3300005455 | Bacteria | 4865 |
| 56 | Ga0070663_100081614 | 3300005455 | Bacteria | 2377 |
| 57 | Ga0070663_100087085 | 3300005455 | Bacteria | 2308 |
| 58 | Ga0070678_100003016 | 3300005456 | Bacteria | 9329 |
| 59 | Ga0070678_100008476 | 3300005456 | Bacteria | 6158 |
| 60 | Ga0070678_100052451 | 3300005456 | Bacteria | 2962 |
| 61 | Ga0070678_100166723 | 3300005456 | Bacteria | 1790 |
| 62 | Ga0070681_10015109 | 3300005458 | Bacteria | 7679 |
| 63 | Ga0070681_10034264 | 3300005458 | Bacteria | 5099 |
| 64 | Ga0068867_100003767 | 3300005459 | Bacteria | 10675 |
| 65 | Ga0070706_100122381 | 3300005467 | Bacteria | 2425 |
| 66 | Ga0070679_100031660 | 3300005530 | Bacteria | 5228 |
| 67 | Ga0070679_100042340 | 3300005530 | Bacteria | 4534 |
| 68 | Ga0070684_100035959 | 3300005535 | Bacteria | 4242 |
| 69 | Ga0070684_100058437 | 3300005535 | Bacteria | 3370 |
| 70 | Ga0070697_100190378 | 3300005536 | Bacteria | 1741 |
| 71 | Ga0068853_100132821 | 3300005539 | Bacteria | 2229 |
| 72 | Ga0070672_100002537 | 3300005543 | Bacteria | 11636 |
| 73 | Ga0070672_100083712 | 3300005543 | Bacteria | 2561 |
| 74 | Ga0070695_100068298 | 3300005545 | Bacteria | 2320 |
| 75 | Ga0070693_100028334 | 3300005547 | Bacteria | 3044 |
| 76 | Ga0070665_100006755 | 3300005548 | Bacteria | 11660 |
| 77 | Ga0068855_100028293 | 3300005563 | Bacteria | 6704 |
| 78 | Ga0068855_100072497 | 3300005563 | Bacteria | 4003 |
| 79 | Ga0068855_100307245 | 3300005563 | Bacteria | 1755 |
| 80 | Ga0070664_100003458 | 3300005564 | Bacteria | 12762 |
| 81 | Ga0070664_100005811 | 3300005564 | Bacteria | 9951 |
| 82 | Ga0070664_100088893 | 3300005564 | Bacteria | 2671 |
| 83 | Ga0068857_100058949 | 3300005577 | Bacteria | 3410 |
| 84 | Ga0068856_100099568 | 3300005614 | Bacteria | 2898 |
| 85 | Ga0068852_100011341 | 3300005616 | Bacteria | 6704 |
| 86 | Ga0068852_100041568 | 3300005616 | Bacteria | 3886 |
| 87 | Ga0068852_100182344 | 3300005616 | Bacteria | 1975 |
| 88 | Ga0068859_100125022 | 3300005617 | Bacteria | 2640 |
| 89 | Ga0068859_100141303 | 3300005617 | Bacteria | 2481 |
| 90 | Ga0068861_100160396 | 3300005719 | Bacteria | 1854 |
| 91 | Ga0068851_10000771 | 3300005834 | Bacteria | 13794 |
| 92 | Ga0068851_10024448 | 3300005834 | Bacteria | 2957 |
| 93 | Ga0068858_100141705 | 3300005842 | Bacteria | 2257 |
| 94 | Ga0068860_100006214 | 3300005843 | Bacteria | 12010 |
| 95 | Ga0068860_100006537 | 3300005843 | Bacteria | 11700 |
| 96 | Ga0068860_100040107 | 3300005843 | Bacteria | 4477 |
| 97 | Ga0068860_100071549 | 3300005843 | Bacteria | 3295 |
| 98 | Ga0068860_100085166 | 3300005843 | Bacteria | 3007 |
| 99 | Ga0068860_100201716 | 3300005843 | Bacteria | 1928 |
| 100 | Ga0068862_100007547 | 3300005844 | Bacteria | 9012 |
| 101 | Ga0068862_100010139 | 3300005844 | Bacteria | 7777 |
| 102 | Ga0068862_100055462 | 3300005844 | Bacteria | 3394 |
| 103 | Ga0081455_10000116 | 3300005937 | Bacteria | 91321 |
| 104 | Ga0081455_10001166 | 3300005937 | Bacteria | 32865 |
| 105 | Ga0081455_10025839 | 3300005937 | Bacteria | 5413 |
| 106 | Ga0081538_10033760 | 3300005981 | Bacteria | 3397 |
| 107 | Ga0081540_1001357 | 3300005983 | Bacteria | 21280 |
| 108 | Ga0081540_1001469 | 3300005983 | Bacteria | 20349 |
| 109 | Ga0081540_1001498 | 3300005983 | Bacteria | 20120 |
| 110 | Ga0081540_1009440 | 3300005983 | Bacteria | 6724 |
| 111 | Ga0081540_1018187 | 3300005983 | Bacteria | 4322 |
| 112 | Ga0081539_10000255 | 3300005985 | Bacteria | 123054 |
| 113 | Ga0081539_10000726 | 3300005985 | Bacteria | 66051 |
| 114 | Ga0070717_10008134 | 3300006028 | Bacteria | 7826 |
| 115 | Ga0070717_10029723 | 3300006028 | Bacteria | 4388 |
| 116 | Ga0070717_10050429 | 3300006028 | Bacteria | 3420 |
| 117 | Ga0075365_10000870 | 3300006038 | Bacteria | 12580 |
| 118 | Ga0075365_10044251 | 3300006038 | Bacteria | 2916 |
| 119 | Ga0075365_10064309 | 3300006038 | Bacteria | 2457 |
| 120 | Ga0075365_10070545 | 3300006038 | Bacteria | 2350 |
| 121 | Ga0075365_10083747 | 3300006038 | Bacteria | 2163 |
| 122 | Ga0075363_100048472 | 3300006048 | Bacteria | 2259 |
| 123 | Ga0075363_100086644 | 3300006048 | Bacteria | 1720 |
| 124 | Ga0075364_10063952 | 3300006051 | Bacteria | 2415 |
| 125 | Ga0075364_10122938 | 3300006051 | Bacteria | 1738 |
| 126 | Ga0075432_10006827 | 3300006058 | Bacteria | 3887 |
| 127 | Ga0075432_10036962 | 3300006058 | Bacteria | 1699 |
| 128 | Ga0070716_100046089 | 3300006173 | Bacteria | 2451 |
| 129 | Ga0070712_100014857 | 3300006175 | Bacteria | 5003 |
| 130 | Ga0070712_100059974 | 3300006175 | Bacteria | 2681 |
| 131 | Ga0070712_100105048 | 3300006175 | Bacteria | 2097 |
| 132 | Ga0075362_10024429 | 3300006177 | Bacteria | 2564 |
| 133 | Ga0075367_10002487 | 3300006178 | Bacteria | 8442 |
| 134 | Ga0075367_10015961 | 3300006178 | Bacteria | 4094 |
| 135 | Ga0075367_10070670 | 3300006178 | Bacteria | 2099 |
| 136 | Ga0075369_10020895 | 3300006186 | Bacteria | 2684 |
| 137 | Ga0097621_100016503 | 3300006237 | Bacteria | 5585 |
| 138 | Ga0075370_10013261 | 3300006353 | Bacteria | 4375 |
| 139 | Ga0075428_100020068 | 3300006844 | Bacteria | 7400 |
| 140 | Ga0068865_100000872 | 3300006881 | Bacteria | 17095 |
| 141 | Ga0097620_100099933 | 3300006931 | Bacteria | 2956 |
| 142 | Ga0097620_100125025 | 3300006931 | Bacteria | 2640 |
| 143 | Ga0097620_100141293 | 3300006931 | Bacteria | 2481 |
| 144 | Ga0099825_1019011 | 3300006941 | Bacteria | 5206 |
| 145 | Ga0099824_1013886 | 3300006942 | Bacteria | 8199 |
| 146 | Ga0099824_1029633 | 3300006942 | Bacteria | 2304 |
| 147 | Ga0099822_1020952 | 3300006943 | Bacteria | 6398 |
| 148 | Ga0075435_100158514 | 3300007076 | Bacteria | 1906 |
| 149 | Ga0105240_10038362 | 3300009093 | Bacteria | 6145 |
| 150 | Ga0105240_10067855 | 3300009093 | Bacteria | 4420 |
| 151 | Ga0105240_10068838 | 3300009093 | Bacteria | 4384 |
| 152 | Ga0105240_10202906 | 3300009093 | Bacteria | 2323 |
| 153 | Ga0105245_10114917 | 3300009098 | Bacteria | 2507 |
| 154 | Ga0105247_10005003 | 3300009101 | Bacteria | 8419 |
| 155 | Ga0105241_10138810 | 3300009174 | Bacteria | 1977 |
| 156 | Ga0105241_10168389 | 3300009174 | Bacteria | 1807 |
| 157 | Ga0105242_10065668 | 3300009176 | Bacteria | 2994 |
| 158 | Ga0105237_10004145 | 3300009545 | Bacteria | 16891 |
| 159 | Ga0105237_10056348 | 3300009545 | Bacteria | 3935 |
| 160 | Ga0105237_10128168 | 3300009545 | Bacteria | 2532 |
| 161 | Ga0105237_10207059 | 3300009545 | Bacteria | 1962 |
| 162 | Ga0105237_10259140 | 3300009545 | Bacteria | 1742 |
| 163 | Ga0105238_10069091 | 3300009551 | Bacteria | 3533 |
| 164 | Ga0105238_10135032 | 3300009551 | Bacteria | 2445 |
| 165 | Ga0105238_10212635 | 3300009551 | Bacteria | 1910 |
| 166 | Ga0105249_10016709 | 3300009553 | Bacteria | 6512 |
| 167 | Ga0105239_10048668 | 3300010375 | Bacteria | 4648 |
| 168 | Ga0105239_10144726 | 3300010375 | Bacteria | 2650 |
| 169 | Ga0105246_10006170 | 3300011119 | Bacteria | 7314 |
| 170 | Ga0105246_10014246 | 3300011119 | Bacteria | 4998 |
| 171 | Ga0157370_10135348 | 3300013104 | Bacteria | 2297 |
| 172 | Ga0157369_10003596 | 3300013105 | Bacteria | 18418 |
| 173 | Ga0157369_10012022 | 3300013105 | Bacteria | 9833 |
| 174 | Ga0157369_10067372 | 3300013105 | Bacteria | 3849 |
| 175 | Ga0157369_10082983 | 3300013105 | Bacteria | 3428 |
| 176 | Ga0157374_10004665 | 3300013296 | Bacteria | 11502 |
| 177 | Ga0157374_10044291 | 3300013296 | Bacteria | 4113 |
| 178 | Ga0157374_10100182 | 3300013296 | Bacteria | 2777 |
| 179 | Ga0157374_10127121 | 3300013296 | Bacteria | 2464 |
| 180 | Ga0157378_10012293 | 3300013297 | Bacteria | 7494 |
| 181 | Ga0157378_10155219 | 3300013297 | Bacteria | 2136 |
| 182 | Ga0163162_10002169 | 3300013306 | Bacteria | 18423 |
| 183 | Ga0163162_10013993 | 3300013306 | Bacteria | 7843 |
| 184 | Ga0163162_10202611 | 3300013306 | Bacteria | 2113 |
| 185 | Ga0157372_10184605 | 3300013307 | Bacteria | 2415 |
| 186 | Ga0157375_10037439 | 3300013308 | Bacteria | 4648 |
| 187 | Ga0163163_10011640 | 3300014325 | Bacteria | 7991 |
| 188 | Ga0157380_10030643 | 3300014326 | Bacteria | 4122 |
| 189 | Ga0157380_10180902 | 3300014326 | Bacteria | 1852 |
| 190 | Ga0157376_10019248 | 3300014969 | Bacteria | 5256 |
| 191 | Ga0157376_10274558 | 3300014969 | Bacteria | 1585 |
| 192 | Ga0163161_10064550 | 3300017792 | Bacteria | 2671 |
| 193 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 194 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 195 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 196 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 197 | Ga0213876_10021485 | 3300021384 | Bacteria | 3413 |
| 198 | Ga0213876_10046688 | 3300021384 | Bacteria | 2290 |
| 199 | Ga0213875_10022106 | 3300021388 | Bacteria | 3044 |
| 200 | Ga0209677_100702 | 3300025253 | Bacteria | 17086 |
| 201 | Ga0209677_108937 | 3300025253 | Bacteria | 1863 |
| 202 | Ga0209148_1000447 | 3300025254 | Bacteria | 45273 |
| 203 | Ga0209233_1012268 | 3300025261 | Bacteria | 2491 |
| 204 | Ga0209233_1016891 | 3300025261 | Bacteria | 2001 |
| 205 | Ga0209455_1002262 | 3300025272 | Bacteria | 7576 |
| 206 | Ga0209025_1001716 | 3300025294 | Bacteria | 26594 |
| 207 | Ga0209564_1000297 | 3300025295 | Bacteria | 100091 |
| 208 | Ga0209564_1007203 | 3300025295 | Bacteria | 5794 |
| 209 | Ga0209564_1023837 | 3300025295 | Bacteria | 2110 |
| 210 | Ga0209758_1000065 | 3300025297 | Bacteria | 306288 |
| 211 | Ga0209758_1002429 | 3300025297 | Bacteria | 19044 |
| 212 | Ga0209758_1002745 | 3300025297 | Bacteria | 17271 |
| 213 | Ga0209758_1003044 | 3300025297 | Bacteria | 15967 |
| 214 | Ga0209758_1003360 | 3300025297 | Bacteria | 14667 |
| 215 | Ga0209256_1004971 | 3300025299 | Bacteria | 7964 |
| 216 | Ga0207426_1000554 | 3300025302 | Bacteria | 51521 |
| 217 | Ga0207426_1000561 | 3300025302 | Bacteria | 50758 |
| 218 | Ga0207426_1009233 | 3300025302 | Bacteria | 3920 |
| 219 | Ga0207426_1020261 | 3300025302 | Bacteria | 2313 |
| 220 | Ga0209257_1000833 | 3300025304 | Bacteria | 44467 |
| 221 | Ga0209257_1018232 | 3300025304 | Bacteria | 2714 |
| 222 | Ga0207697_10009429 | 3300025315 | Bacteria | 4217 |
| 223 | Ga0207656_10010990 | 3300025321 | Bacteria | 3408 |
| 224 | Ga0207692_10002707 | 3300025898 | Bacteria | 6829 |
| 225 | Ga0207642_10035148 | 3300025899 | Bacteria | 2137 |
| 226 | Ga0207710_10004687 | 3300025900 | Bacteria | 5933 |
| 227 | Ga0207680_10069878 | 3300025903 | Bacteria | 2171 |
| 228 | Ga0207647_10013488 | 3300025904 | Bacteria | 5660 |
| 229 | Ga0207699_10002964 | 3300025906 | Bacteria | 8073 |
| 230 | Ga0207699_10011046 | 3300025906 | Bacteria | 4549 |
| 231 | Ga0207645_10043527 | 3300025907 | Bacteria | 2874 |
| 232 | Ga0207643_10061308 | 3300025908 | Bacteria | 2148 |
| 233 | Ga0207705_10147210 | 3300025909 | Bacteria | 1763 |
| 234 | Ga0207684_10210329 | 3300025910 | Bacteria | 1678 |
| 235 | Ga0207654_10040566 | 3300025911 | Bacteria | 2624 |
| 236 | Ga0207707_10000651 | 3300025912 | Bacteria | 34364 |
| 237 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 238 | Ga0207695_10036024 | 3300025913 | Bacteria | 5354 |
| 239 | Ga0207695_10118638 | 3300025913 | Bacteria | 2617 |
| 240 | Ga0207695_10180590 | 3300025913 | Bacteria | 2031 |
| 241 | Ga0207671_10025690 | 3300025914 | Bacteria | 4421 |
| 242 | Ga0207671_10091726 | 3300025914 | Bacteria | 2289 |
| 243 | Ga0207671_10096792 | 3300025914 | Bacteria | 2231 |
| 244 | Ga0207693_10002906 | 3300025915 | Bacteria | 14827 |
| 245 | Ga0207693_10008081 | 3300025915 | Bacteria | 8629 |
| 246 | Ga0207693_10014710 | 3300025915 | Bacteria | 6286 |
| 247 | Ga0207693_10101873 | 3300025915 | Bacteria | 2252 |
| 248 | Ga0207663_10001131 | 3300025916 | Bacteria | 12287 |
| 249 | Ga0207663_10036415 | 3300025916 | Bacteria | 2960 |
| 250 | Ga0207660_10022691 | 3300025917 | Bacteria | 4231 |
| 251 | Ga0207660_10056560 | 3300025917 | Bacteria | 2807 |
| 252 | Ga0207657_10055848 | 3300025919 | Bacteria | 3409 |
| 253 | Ga0207657_10064762 | 3300025919 | Bacteria | 3119 |
| 254 | Ga0207657_10166374 | 3300025919 | Bacteria | 1788 |
| 255 | Ga0207649_10078786 | 3300025920 | Bacteria | 2127 |
| 256 | Ga0207652_10023063 | 3300025921 | Bacteria | 5155 |
| 257 | Ga0207652_10049932 | 3300025921 | Bacteria | 3583 |
| 258 | Ga0207652_10083886 | 3300025921 | Bacteria | 2790 |
| 259 | Ga0207652_10106084 | 3300025921 | Bacteria | 2487 |
| 260 | Ga0207681_10062346 | 3300025923 | Bacteria | 2567 |
| 261 | Ga0207694_10091407 | 3300025924 | Bacteria | 2402 |
| 262 | Ga0207694_10124154 | 3300025924 | Bacteria | 2063 |
| 263 | Ga0207650_10003368 | 3300025925 | Bacteria | 10999 |
| 264 | Ga0207650_10054211 | 3300025925 | Bacteria | 2974 |
| 265 | Ga0207659_10002374 | 3300025926 | Bacteria | 11209 |
| 266 | Ga0207700_10030126 | 3300025928 | Bacteria | 3838 |
| 267 | Ga0207700_10065605 | 3300025928 | Bacteria | 2771 |
| 268 | Ga0207664_10013136 | 3300025929 | Bacteria | 5938 |
| 269 | Ga0207664_10057524 | 3300025929 | Bacteria | 3091 |
| 270 | Ga0207664_10082346 | 3300025929 | Bacteria | 2621 |
| 271 | Ga0207644_10049773 | 3300025931 | Bacteria | 3001 |
| 272 | Ga0207706_10022063 | 3300025933 | Bacteria | 5715 |
| 273 | Ga0207709_10062747 | 3300025935 | Bacteria | 2327 |
| 274 | Ga0207669_10001262 | 3300025937 | Bacteria | 10739 |
| 275 | Ga0207669_10073397 | 3300025937 | Bacteria | 2158 |
| 276 | Ga0207665_10000992 | 3300025939 | Bacteria | 19173 |
| 277 | Ga0207691_10005604 | 3300025940 | Bacteria | 12136 |
| 278 | Ga0207691_10101330 | 3300025940 | Bacteria | 2570 |
| 279 | Ga0207691_10147122 | 3300025940 | Bacteria | 2073 |
| 280 | Ga0207711_10230442 | 3300025941 | Bacteria | 1696 |
| 281 | Ga0207689_10009434 | 3300025942 | Bacteria | 8426 |
| 282 | Ga0207661_10005660 | 3300025944 | Bacteria | 8815 |
| 283 | Ga0207661_10052910 | 3300025944 | Bacteria | 3246 |
| 284 | Ga0207661_10071279 | 3300025944 | Bacteria | 2839 |
| 285 | Ga0207679_10082218 | 3300025945 | Bacteria | 2465 |
| 286 | Ga0207679_10084547 | 3300025945 | Bacteria | 2435 |
| 287 | Ga0207667_10018352 | 3300025949 | Bacteria | 7849 |
| 288 | Ga0207667_10124233 | 3300025949 | Bacteria | 2659 |
| 289 | Ga0207651_10012778 | 3300025960 | Bacteria | 4770 |
| 290 | Ga0207712_10022487 | 3300025961 | Bacteria | 4153 |
| 291 | Ga0207668_10024605 | 3300025972 | Bacteria | 3889 |
| 292 | Ga0207668_10061040 | 3300025972 | Bacteria | 2649 |
| 293 | Ga0207658_10129805 | 3300025986 | Bacteria | 2023 |
| 294 | Ga0207677_10022522 | 3300026023 | Bacteria | 3874 |
| 295 | Ga0207677_10042614 | 3300026023 | Bacteria | 3011 |
| 296 | Ga0207677_10052763 | 3300026023 | Bacteria | 2764 |
| 297 | Ga0207677_10096834 | 3300026023 | Bacteria | 2160 |
| 298 | Ga0207703_10051198 | 3300026035 | Bacteria | 3345 |
| 299 | Ga0207639_10005655 | 3300026041 | Bacteria | 8459 |
| 300 | Ga0207678_10009091 | 3300026067 | Bacteria | 8748 |
| 301 | Ga0207678_10009739 | 3300026067 | Bacteria | 8450 |
| 302 | Ga0207678_10088930 | 3300026067 | Bacteria | 2640 |
| 303 | Ga0207708_10054510 | 3300026075 | Bacteria | 3048 |
| 304 | Ga0207708_10097383 | 3300026075 | Bacteria | 2273 |
| 305 | Ga0207702_10051886 | 3300026078 | Bacteria | 3468 |
| 306 | Ga0207648_10000419 | 3300026089 | Bacteria | 46680 |
| 307 | Ga0207648_10008822 | 3300026089 | Bacteria | 9711 |
| 308 | Ga0207648_10084025 | 3300026089 | Bacteria | 2777 |
| 309 | Ga0207674_10095176 | 3300026116 | Bacteria | 2964 |
| 310 | Ga0207675_100000693 | 3300026118 | Bacteria | 33301 |
| 311 | Ga0207675_100026527 | 3300026118 | Bacteria | 5393 |
| 312 | Ga0207675_100047548 | 3300026118 | Bacteria | 4005 |
| 313 | Ga0207675_100075226 | 3300026118 | Bacteria | 3161 |
| 314 | Ga0207683_10005354 | 3300026121 | Bacteria | 10997 |
| 315 | Ga0207683_10016780 | 3300026121 | Bacteria | 6232 |
| 316 | Ga0207683_10092470 | 3300026121 | Bacteria | 2695 |
| 317 | Ga0207683_10151725 | 3300026121 | Bacteria | 2091 |
| 318 | Ga0207683_10169816 | 3300026121 | Bacteria | 1975 |
| 319 | Ga0207698_10001212 | 3300026142 | Bacteria | 15053 |
| 320 | Ga0207698_10045465 | 3300026142 | Bacteria | 3308 |
| 321 | Ga0207698_10076642 | 3300026142 | Bacteria | 2677 |
| 322 | Ga0207698_10188548 | 3300026142 | Bacteria | 1834 |
| 323 | Ga0209389_1000025 | 3300027296 | Bacteria | 149588 |
| 324 | Ga0209389_1000816 | 3300027296 | Bacteria | 19892 |
| 325 | Ga0209371_1000035 | 3300027312 | Bacteria | 368979 |
| 326 | Ga0209589_1000009 | 3300027357 | Bacteria | 252104 |
| 327 | Ga0209589_1000066 | 3300027357 | Bacteria | 100795 |
| 328 | Ga0209489_100010 | 3300027361 | Bacteria | 252139 |
| 329 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 330 | Ga0209489_106247 | 3300027361 | Bacteria | 19412 |
| 331 | Ga0209700_100017 | 3300027363 | Bacteria | 252104 |
| 332 | Ga0209700_100031 | 3300027363 | Bacteria | 207349 |
| 333 | Ga0268266_10001147 | 3300028379 | Bacteria | 32898 |
| 334 | Ga0268266_10054868 | 3300028379 | Bacteria | 3425 |
| 335 | Ga0268266_10093105 | 3300028379 | Bacteria | 2644 |
| 336 | Ga0268265_10020692 | 3300028380 | Bacteria | 4597 |
| 337 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 338 | Ga0268264_10002351 | 3300028381 | Bacteria | 16696 |
| 339 | Ga0268264_10004742 | 3300028381 | Bacteria | 11547 |
| 340 | Ga0265334_10000799 | 3300028573 | Bacteria | 15763 |
| 341 | Ga0265322_10016431 | 3300028654 | Bacteria | 2136 |
| 342 | Ga0265336_10000233 | 3300028666 | Bacteria | 39706 |
| 343 | Ga0307517_10000062 | 3300028786 | Bacteria | 145054 |
| 344 | Ga0307515_10055923 | 3300028794 | Bacteria | 5749 |
| 345 | Ga0265338_10000090 | 3300028800 | Bacteria | 171540 |
| 346 | Ga0265338_10001796 | 3300028800 | Bacteria | 33751 |
| 347 | Ga0265324_10008187 | 3300029957 | Bacteria | 4173 |
| 348 | Ga0268256_1000037 | 3300030500 | Bacteria | 367024 |
| 349 | Ga0265340_10001013 | 3300031247 | Bacteria | 15991 |
| 350 | Ga0265331_10015572 | 3300031250 | Bacteria | 4011 |
| 351 | Ga0265331_10016079 | 3300031250 | Bacteria | 3937 |
| 352 | Ga0265327_10019500 | 3300031251 | Bacteria | 4165 |
| 353 | Ga0307509_10084622 | 3300031507 | Bacteria | 3266 |
| 354 | Ga0307508_10000532 | 3300031616 | Bacteria | 45338 |
| 355 | Ga0265342_10006201 | 3300031712 | Bacteria | 8938 |
| 356 | Ga0265342_10021950 | 3300031712 | Bacteria | 4068 |
| 357 | Ga0307516_10000729 | 3300031730 | Bacteria | 44867 |
| 358 | Ga0307516_10009547 | 3300031730 | Bacteria | 10805 |
| 359 | Ga0307516_10024016 | 3300031730 | Bacteria | 6235 |
| 360 | Ga0307405_10014356 | 3300031731 | Bacteria | 4257 |
| 361 | Ga0307409_100001404 | 3300031995 | Bacteria | 11782 |
| 362 | Ga0307416_100002743 | 3300032002 | Bacteria | 10219 |
| 363 | Ga0307414_10016285 | 3300032004 | Bacteria | 4516 |
| 364 | Ga0307411_10059471 | 3300032005 | Bacteria | 2534 |
| 365 | Ga0307415_100015133 | 3300032126 | Bacteria | 4558 |
| 366 | Ga0307510_10026250 | 3300033180 | Bacteria | 6700 |
| 367 | Ga0307510_10064553 | 3300033180 | Bacteria | 3718 |
| 368 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 369 | Ga0373944_0006585 | 3300035089 | Bacteria | 3086 |
| 370 | Ga0373936_0008646 | 3300035113 | Bacteria | 3834 |
| 371 | Ga0373945_0003375 | 3300035116 | Bacteria | 5018 |
| 372 | Ga0373954_0002845 | 3300035118 | Bacteria | 7291 |
| 373 | Ga0373954_0012478 | 3300035118 | Bacteria | 3777 |
| 374 | Ga0373954_0040555 | 3300035118 | Bacteria | 2169 |
| 375 | Ga0373956_0003275 | 3300035119 | Bacteria | 6531 |
| 376 | Ga0373943_0004027 | 3300035170 | Bacteria | 6684 |
| 377 | Ga0373946_0005405 | 3300035171 | Bacteria | 4606 |
| 378 | Ga0373955_0000447 | 3300035172 | Bacteria | 17475 |
| 379 | Ga0373931_0000976 | 3300035691 | Bacteria | 12102 |
| 380 | Ga0373935_0002539 | 3300035692 | Bacteria | 10459 |
| 381 | Ga0373927_0000308 | 3300035695 | Bacteria | 38418 |
| 382 | Ga0373927_0010106 | 3300035695 | Bacteria | 6316 |
| 383 | Ga0373927_0016156 | 3300035695 | Bacteria | 4925 |
| 384 | Ga0373927_0018206 | 3300035695 | Bacteria | 4618 |
| 385 | Ga0373927_0019139 | 3300035695 | Bacteria | 4490 |
| 386 | Ga0373927_0053204 | 3300035695 | Bacteria | 2618 |
| 387 | Ga0373933_0000167 | 3300035724 | Bacteria | 42851 |
| 388 | Ga0373933_0002005 | 3300035724 | Bacteria | 11741 |
| 389 | Ga0373933_0016932 | 3300035724 | Bacteria | 4085 |
| 390 | Ga0373933_0063611 | 3300035724 | Bacteria | 2231 |
| 391 | Ga0373933_0069491 | 3300035724 | Bacteria | 2141 |
| 392 | Ga0373947_0026735 | 3300035725 | Bacteria | 3374 |
| 393 | Ga0373947_0027440 | 3300035725 | Bacteria | 3332 |
| 394 | Ga0373937_0032108 | 3300036401 | Bacteria | 4761 |
| 395 | Ga0316584_0069602 | 3300036712 | Bacteria | 2638 |
| 396 | Ga0373925_0002838 | 3300037068 | Bacteria | 13675 |
| 397 | Ga0373925_0009786 | 3300037068 | Bacteria | 6961 |
| 398 | Ga0373925_0031894 | 3300037068 | Bacteria | 3876 |
| 399 | Ga0373925_0055739 | 3300037068 | Bacteria | 2960 |
| 400 | Ga0373925_0095091 | 3300037068 | Bacteria | 2282 |
| 401 | Ga0395899_0004504 | 3300037312 | Bacteria | 10864 |
| 402 | Ga0395899_0007418 | 3300037312 | Bacteria | 8474 |
| 403 | Ga0395900_0000389 | 3300037418 | Bacteria | 63583 |
| 404 | Ga0395900_0003228 | 3300037418 | Bacteria | 17658 |
| 405 | Ga0395898_0000866 | 3300037466 | Bacteria | 49465 |
| 406 | Ga0395898_0019758 | 3300037466 | Bacteria | 6851 |
| 407 | Ga0395898_0029402 | 3300037466 | Bacteria | 5504 |
| 408 | Ga0395905_0034838 | 3300037471 | Bacteria | 4726 |
| 409 | Ga0395901_0000164 | 3300038443 | Bacteria | 86884 |
| 410 | Ga0395901_0049817 | 3300038443 | Bacteria | 4353 |
| 411 | Ga0395901_0065415 | 3300038443 | Bacteria | 3786 |
| 412 | Ga0395901_0140659 | 3300038443 | Bacteria | 2536 |
| 413 | Ga0436365_0680043 | 3300039437 | Bacteria | 4127 |
| 414 | Ga0436365_1888691 | 3300039437 | Bacteria | 3222 |
| 415 | Ga0436360_1087539 | 3300039438 | Bacteria | 2981 |
| 416 | Ga0436360_1198791 | 3300039438 | Bacteria | 2227 |
| 417 | Ga0436360_1252590 | 3300039438 | Bacteria | 1705 |
| 418 | Ga0436363_1600596 | 3300039450 | Bacteria | 7381 |
| 419 | Ga0439456_005986 | 3300042013 | Bacteria | 2478 |
| 420 | Ga0451577_0004589 | 3300042876 | Bacteria | 14515 |
| 421 | Ga0466972_0000174 | 3300044658 | Bacteria | 49914 |
| 422 | Ga0466966_0000148 | 3300044684 | Bacteria | 44828 |
| 423 | Ga0466961_0000045 | 3300044693 | Bacteria | 75331 |
| 424 | Ga0466963_0012884 | 3300044694 | Bacteria | 5123 |
| 425 | Ga0466964_0009932 | 3300044706 | Bacteria | 3586 |
| 426 | Ga0466957_0036720 | 3300044842 | Bacteria | 2947 |
| 427 | Ga0466959_0006449 | 3300045049 | Bacteria | 8125 |
| 428 | Ga0466958_0076522 | 3300045836 | Bacteria | 2054 |
| 429 | Ga0466967_0020296 | 3300045976 | Bacteria | 5366 |
| 430 | Ga0495617_002315 | 3300046452 | Bacteria | 7673 |
| 431 | Ga0495617_006936 | 3300046452 | Bacteria | 3955 |
| 432 | Ga0495617_018404 | 3300046452 | Bacteria | 2362 |
| 433 | Ga0495592_0001539 | 3300046454 | Bacteria | 16097 |
| 434 | Ga0495592_0014889 | 3300046454 | Bacteria | 5903 |
| 435 | Ga0495603_0000218 | 3300046455 | Bacteria | 29764 |
| 436 | Ga0495603_0000229 | 3300046455 | Bacteria | 29318 |
| 437 | Ga0495603_0004160 | 3300046455 | Bacteria | 8621 |
| 438 | Ga0495603_0004383 | 3300046455 | Bacteria | 8412 |
| 439 | Ga0495590_0007217 | 3300046457 | Bacteria | 4296 |
| 440 | Ga0495629_0000170 | 3300046459 | Bacteria | 57733 |
| 441 | Ga0495629_0000212 | 3300046459 | Bacteria | 52191 |
| 442 | Ga0495629_0001699 | 3300046459 | Bacteria | 17299 |
| 443 | Ga0495638_0010390 | 3300046460 | Bacteria | 6470 |
| 444 | Ga0495638_0013179 | 3300046460 | Bacteria | 5641 |
| 445 | Ga0495638_0026634 | 3300046460 | Bacteria | 3746 |
| 446 | Ga0495638_0077243 | 3300046460 | Bacteria | 2027 |
| 447 | Ga0495641_0002021 | 3300046461 | Bacteria | 16470 |
| 448 | Ga0495651_0000472 | 3300046462 | Bacteria | 30989 |
| 449 | Ga0495653_0011183 | 3300046463 | Bacteria | 7337 |
| 450 | Ga0495653_0030645 | 3300046463 | Bacteria | 4282 |
| 451 | Ga0495653_0134992 | 3300046463 | Bacteria | 1742 |
| 452 | Ga0495580_0002791 | 3300046472 | Bacteria | 15022 |
| 453 | Ga0495580_0006642 | 3300046472 | Bacteria | 9398 |
| 454 | Ga0495580_0028950 | 3300046472 | Bacteria | 4023 |
| 455 | Ga0495580_0053004 | 3300046472 | Bacteria | 2864 |
| 456 | Ga0495582_0000053 | 3300046473 | Bacteria | 58155 |
| 457 | Ga0495605_0004425 | 3300046474 | Bacteria | 8261 |
| 458 | Ga0495605_0042933 | 3300046474 | Bacteria | 2244 |
| 459 | Ga0495605_0058845 | 3300046474 | Bacteria | 1846 |
| 460 | Ga0495639_0000057 | 3300046475 | Bacteria | 49641 |
| 461 | Ga0495662_0000754 | 3300046476 | Bacteria | 15558 |
| 462 | Ga0495664_0010021 | 3300046477 | Bacteria | 5317 |
| 463 | Ga0495664_0034625 | 3300046477 | Bacteria | 2971 |
| 464 | Ga0495584_0000261 | 3300046491 | Bacteria | 37768 |
| 465 | Ga0495584_0001183 | 3300046491 | Bacteria | 16048 |
| 466 | Ga0495585_0000488 | 3300046492 | Bacteria | 37644 |
| 467 | Ga0495585_0006478 | 3300046492 | Bacteria | 7258 |
| 468 | Ga0495594_0000460 | 3300046499 | Bacteria | 20731 |
| 469 | Ga0495594_0004370 | 3300046499 | Bacteria | 7269 |
| 470 | Ga0495607_0010017 | 3300046501 | Bacteria | 6387 |
| 471 | Ga0495583_0002399 | 3300046506 | Bacteria | 16105 |
| 472 | Ga0495583_0007882 | 3300046506 | Bacteria | 6609 |
| 473 | Ga0495583_0016627 | 3300046506 | Bacteria | 3945 |
| 474 | Ga0495606_0004247 | 3300046507 | Bacteria | 14485 |
| 475 | Ga0495606_0031059 | 3300046507 | Bacteria | 3719 |
| 476 | Ga0495608_0002196 | 3300046511 | Bacteria | 14088 |
| 477 | Ga0495610_0040644 | 3300046512 | Bacteria | 2342 |
| 478 | Ga0495610_0060308 | 3300046512 | Bacteria | 1807 |
| 479 | Ga0495616_0000624 | 3300046513 | Bacteria | 26551 |
| 480 | Ga0495616_0004386 | 3300046513 | Bacteria | 8902 |
| 481 | Ga0495618_0016659 | 3300046514 | Bacteria | 4501 |
| 482 | Ga0495620_0001070 | 3300046515 | Bacteria | 16772 |
| 483 | Ga0495620_0015393 | 3300046515 | Bacteria | 3863 |
| 484 | Ga0495620_0028613 | 3300046515 | Bacteria | 2589 |
| 485 | Ga0495628_0016571 | 3300046516 | Bacteria | 6144 |
| 486 | Ga0495628_0031144 | 3300046516 | Bacteria | 4315 |
| 487 | Ga0495628_0043562 | 3300046516 | Bacteria | 3573 |
| 488 | Ga0495630_0001122 | 3300046517 | Bacteria | 18446 |
| 489 | Ga0495630_0001776 | 3300046517 | Bacteria | 15084 |
| 490 | Ga0495631_0000005 | 3300046518 | Bacteria | 159179 |
| 491 | Ga0495631_0000084 | 3300046518 | Bacteria | 60799 |
| 492 | Ga0495631_0000131 | 3300046518 | Bacteria | 50430 |
| 493 | Ga0495632_0000144 | 3300046519 | Bacteria | 73366 |
| 494 | Ga0495637_0000096 | 3300046520 | Bacteria | 68502 |
| 495 | Ga0495637_0008501 | 3300046520 | Bacteria | 5038 |
| 496 | Ga0495643_0000464 | 3300046522 | Bacteria | 51511 |
| 497 | Ga0495643_0012522 | 3300046522 | Bacteria | 5114 |
| 498 | Ga0495648_0000702 | 3300046524 | Bacteria | 35749 |
| 499 | Ga0495648_0003979 | 3300046524 | Bacteria | 12789 |
| 500 | Ga0495648_0006268 | 3300046524 | Bacteria | 9732 |
| 501 | Ga0495652_0001339 | 3300046529 | Bacteria | 27421 |
| 502 | Ga0495652_0115272 | 3300046529 | Bacteria | 2153 |
| 503 | Ga0495654_0059679 | 3300046530 | Bacteria | 1836 |
| 504 | Ga0495665_0000197 | 3300046531 | Bacteria | 31107 |
| 505 | Ga0495665_0012624 | 3300046531 | Bacteria | 4574 |
| 506 | Ga0495640_0006354 | 3300046533 | Bacteria | 9363 |
| 507 | Ga0495640_0016526 | 3300046533 | Bacteria | 5519 |
| 508 | Ga0495640_0071245 | 3300046533 | Bacteria | 2333 |
| 509 | Ga0495586_0021029 | 3300046535 | Bacteria | 3478 |
| 510 | Ga0495587_0009632 | 3300046536 | Bacteria | 6180 |
| 511 | Ga0495587_0012034 | 3300046536 | Bacteria | 5464 |
| 512 | Ga0495609_0000064 | 3300046538 | Bacteria | 135200 |
| 513 | Ga0495645_0011172 | 3300046543 | Bacteria | 6315 |
| 514 | Ga0495645_0014222 | 3300046543 | Bacteria | 5644 |
| 515 | Ga0495622_0000066 | 3300046557 | Bacteria | 92491 |
| 516 | Ga0495622_0003160 | 3300046557 | Bacteria | 7797 |
| 517 | Ga0495667_0001807 | 3300046559 | Bacteria | 14207 |
| 518 | Ga0495667_0045297 | 3300046559 | Bacteria | 2913 |
| 519 | Ga0495667_0047982 | 3300046559 | Bacteria | 2820 |
| 520 | Ga0495656_0000014 | 3300046615 | Bacteria | 132902 |
| 521 | Ga0495634_0001079 | 3300046642 | Bacteria | 25459 |
| 522 | Ga0495634_0016913 | 3300046642 | Bacteria | 5210 |
| 523 | Ga0495634_0049130 | 3300046642 | Bacteria | 2838 |
| 524 | Ga0495611_0068158 | 3300046648 | Bacteria | 1624 |
| 525 | Ga0495625_0000995 | 3300046660 | Bacteria | 37531 |
| 526 | Ga0495625_0068283 | 3300046660 | Bacteria | 2499 |
| 527 | Ga0495625_0100556 | 3300046660 | Bacteria | 1987 |
| 528 | Ga0495635_0000738 | 3300046663 | Bacteria | 21137 |
| 529 | Ga0495635_0000989 | 3300046663 | Bacteria | 18730 |
| 530 | Ga0495635_0060076 | 3300046663 | Bacteria | 2613 |
| 531 | Ga0495659_0023539 | 3300046664 | Bacteria | 2093 |
| 532 | Ga0495661_0092119 | 3300046665 | Bacteria | 1723 |
| 533 | Ga0495588_0000345 | 3300046674 | Bacteria | 29792 |
| 534 | Ga0495588_0010162 | 3300046674 | Bacteria | 4366 |
| 535 | Ga0495657_0001505 | 3300046675 | Bacteria | 20049 |
| 536 | Ga0495623_0002081 | 3300046679 | Bacteria | 13394 |
| 537 | Ga0495623_0004396 | 3300046679 | Bacteria | 9261 |
| 538 | Ga0495646_0006464 | 3300046680 | Bacteria | 7436 |
| 539 | Ga0495646_0008486 | 3300046680 | Bacteria | 6525 |
| 540 | Ga0495646_0028359 | 3300046680 | Bacteria | 3506 |
| 541 | Ga0495647_0010372 | 3300046681 | Bacteria | 3170 |
| 542 | Ga0495658_0000217 | 3300046683 | Bacteria | 32918 |
| 543 | Ga0495658_0009739 | 3300046683 | Bacteria | 4792 |
| 544 | Ga0495669_0000056 | 3300046684 | Bacteria | 77304 |
| 545 | Ga0495669_0003449 | 3300046684 | Bacteria | 6516 |
| 546 | Ga0495613_0000817 | 3300046689 | Bacteria | 24120 |
| 547 | Ga0495613_0012678 | 3300046689 | Bacteria | 6268 |
| 548 | Ga0495613_0017612 | 3300046689 | Bacteria | 5320 |
| 549 | Ga0495613_0029342 | 3300046689 | Bacteria | 4090 |
| 550 | Ga0495613_0063319 | 3300046689 | Bacteria | 2706 |
| 551 | Ga0495624_0000394 | 3300046690 | Bacteria | 34712 |
| 552 | Ga0495624_0005712 | 3300046690 | Bacteria | 8920 |
| 553 | Ga0495624_0010608 | 3300046690 | Bacteria | 6347 |
| 554 | Ga0495670_0002345 | 3300046691 | Bacteria | 9334 |
| 555 | Ga0495670_0024772 | 3300046691 | Bacteria | 2966 |
| 556 | Ga0495671_0005579 | 3300046692 | Bacteria | 7348 |
| 557 | Ga0495671_0006314 | 3300046692 | Bacteria | 6860 |
| 558 | Ga0495671_0095707 | 3300046692 | Bacteria | 1453 |
| 559 | Ga0495649_0023084 | 3300046694 | Bacteria | 3475 |
| 560 | Ga0495649_0059019 | 3300046694 | Bacteria | 2066 |
| 561 | Ga0495649_0066655 | 3300046694 | Bacteria | 1932 |
| 562 | Ga0495589_0000320 | 3300046794 | Bacteria | 37756 |
| 563 | Ga0495600_0003220 | 3300046809 | Bacteria | 9550 |
| 564 | Ga0495600_0009711 | 3300046809 | Bacteria | 5946 |
| 565 | Ga0495600_0028149 | 3300046809 | Bacteria | 3635 |
| 566 | Ga0495660_0000382 | 3300046810 | Bacteria | 38537 |
| 567 | Ga0495660_0004041 | 3300046810 | Bacteria | 8955 |
| 568 | Ga0495604_0000953 | 3300047317 | Bacteria | 24133 |
| 569 | Ga0495674_0001522 | 3300047319 | Bacteria | 22627 |
| 570 | Ga0495674_0003054 | 3300047319 | Bacteria | 16280 |
| 571 | Ga0495674_0004663 | 3300047319 | Bacteria | 13179 |
| 572 | Ga0495674_0004930 | 3300047319 | Bacteria | 12836 |
| 573 | Ga0495674_0005696 | 3300047319 | Bacteria | 11935 |
| 574 | Ga0495674_0008322 | 3300047319 | Bacteria | 9890 |
| 575 | Ga0495674_0019530 | 3300047319 | Bacteria | 6287 |
| 576 | Ga0495674_0045274 | 3300047319 | Bacteria | 3907 |
| 577 | Ga0495672_0000578 | 3300047320 | Bacteria | 41468 |
| 578 | Ga0495672_0006289 | 3300047320 | Bacteria | 9242 |
| 579 | Ga0495672_0039774 | 3300047320 | Bacteria | 2857 |
| 580 | Ga0495676_0054211 | 3300047321 | Bacteria | 3189 |
| 581 | Ga0495680_0001642 | 3300047322 | Bacteria | 23759 |
| 582 | Ga0495680_0001893 | 3300047322 | Bacteria | 21968 |
| 583 | Ga0495683_0000102 | 3300047323 | Bacteria | 87439 |
| 584 | Ga0495683_0001188 | 3300047323 | Bacteria | 17747 |
| 585 | Ga0495683_0051951 | 3300047323 | Bacteria | 2047 |
| 586 | Ga0495687_000020 | 3300047443 | Bacteria | 337717 |
| 587 | Ga0495687_005443 | 3300047443 | Bacteria | 8115 |
| 588 | Ga0495675_0004647 | 3300047444 | Bacteria | 8342 |
| 589 | Ga0495675_0034624 | 3300047444 | Bacteria | 3224 |
| 590 | Ga0495677_0000058 | 3300047445 | Bacteria | 63139 |
| 591 | Ga0495679_000102 | 3300047446 | Bacteria | 76337 |
| 592 | Ga0495673_0000521 | 3300047469 | Bacteria | 40382 |
| 593 | Ga0495673_0004250 | 3300047469 | Bacteria | 9044 |
| 594 | Ga0495673_0005620 | 3300047469 | Bacteria | 7535 |
| 595 | Ga0495681_0000009 | 3300047470 | Bacteria | 205224 |
| 596 | Ga0495681_0012687 | 3300047470 | Bacteria | 4937 |
| 597 | Ga0495684_0001724 | 3300047471 | Bacteria | 17597 |
| 598 | Ga0495684_0031222 | 3300047471 | Bacteria | 4090 |
| 599 | Ga0495686_0000390 | 3300047472 | Bacteria | 69916 |
| 600 | Ga0495686_0016459 | 3300047472 | Bacteria | 5013 |
| 601 | Ga0495593_0000177 | 3300047673 | Bacteria | 32957 |
| 602 | Ga0495593_0001077 | 3300047673 | Bacteria | 15940 |
| 603 | Ga0495602_0163345 | 3300048088 | Bacteria | 1736 |
| 604 | Ga0495626_0000110 | 3300048091 | Bacteria | 105407 |
| 605 | Ga0496100_0100928 | 3300048903 | Bacteria | 1989 |
| 606 | Ga0496101_0006174 | 3300048904 | Bacteria | 7700 |
| 607 | Ga0496101_0016503 | 3300048904 | Bacteria | 4991 |
| 608 | Ga0496102_0006702 | 3300048905 | Bacteria | 9837 |
| 609 | Ga0496102_0023707 | 3300048905 | Bacteria | 5453 |
| 610 | Ga0496102_0026901 | 3300048905 | Bacteria | 5135 |
| 611 | Ga0496102_0047072 | 3300048905 | Bacteria | 3918 |
| 612 | Ga0496103_0009134 | 3300048906 | Bacteria | 5870 |
| 613 | Ga0496103_0022467 | 3300048906 | Bacteria | 3799 |
| 614 | Ga0496103_0105833 | 3300048906 | Bacteria | 1784 |
| 615 | Ga0496104_0004724 | 3300048907 | Bacteria | 11857 |
| 616 | Ga0496104_0026572 | 3300048907 | Bacteria | 5348 |
| 617 | Ga0496104_0045567 | 3300048907 | Bacteria | 4125 |
| 618 | Ga0496104_0102549 | 3300048907 | Bacteria | 2740 |
| 619 | Ga0496105_0002621 | 3300048908 | Bacteria | 13078 |
| 620 | Ga0496105_0066683 | 3300048908 | Bacteria | 2972 |
| 621 | Ga0496106_0002433 | 3300048909 | Bacteria | 13869 |
| 622 | Ga0496106_0010607 | 3300048909 | Bacteria | 6808 |
| 623 | Ga0496106_0037669 | 3300048909 | Bacteria | 3618 |
| 624 | Ga0496107_0001854 | 3300048910 | Bacteria | 13352 |
| 625 | Ga0496108_0154968 | 3300048911 | Bacteria | 1978 |
| 626 | Ga0496109_0099716 | 3300048912 | Bacteria | 2694 |
| 627 | Ga0496109_0162099 | 3300048912 | Bacteria | 2095 |
| 628 | Ga0496109_0173713 | 3300048912 | Bacteria | 2022 |
| 629 | Ga0496109_0203387 | 3300048912 | Bacteria | 1862 |
| 630 | Ga0496110_0014673 | 3300048913 | Bacteria | 6512 |
| 631 | Ga0496111_0024893 | 3300048914 | Bacteria | 4221 |
| 632 | Ga0496112_0000016 | 3300048915 | Bacteria | 194634 |
| 633 | Ga0496112_0011656 | 3300048915 | Bacteria | 8041 |
| 634 | Ga0496112_0279222 | 3300048915 | Bacteria | 1618 |
| 635 | Ga0496113_0039842 | 3300048916 | Bacteria | 3460 |
| 636 | Ga0496114_0003242 | 3300048917 | Bacteria | 12487 |
| 637 | Ga0496114_0096266 | 3300048917 | Bacteria | 2520 |
| 638 | Ga0496115_0011689 | 3300048918 | Bacteria | 6590 |
| 639 | Ga0496116_0003781 | 3300048919 | Bacteria | 14794 |
| 640 | Ga0496116_0059662 | 3300048919 | Bacteria | 2479 |
| 641 | Ga0496116_0086953 | 3300048919 | Bacteria | 1915 |
| 642 | Ga0496116_0096664 | 3300048919 | Bacteria | 1778 |
| 643 | Ga0496117_0017193 | 3300048920 | Bacteria | 6053 |
| 644 | Ga0496117_0034099 | 3300048920 | Bacteria | 3842 |
| 645 | Ga0496117_0100286 | 3300048920 | Bacteria | 1834 |
| 646 | Ga0496118_0001822 | 3300048921 | Bacteria | 30624 |
| 647 | Ga0496118_0075119 | 3300048921 | Bacteria | 2412 |
| 648 | Ga0496119_0006070 | 3300048922 | Bacteria | 11317 |
| 649 | Ga0496119_0008464 | 3300048922 | Bacteria | 9032 |
| 650 | Ga0496119_0068261 | 3300048922 | Bacteria | 2094 |
| 651 | Ga0496120_0085948 | 3300048923 | Bacteria | 1692 |
| 652 | Ga0496121_0000508 | 3300048924 | Bacteria | 74420 |
| 653 | Ga0496121_0000875 | 3300048924 | Bacteria | 54487 |
| 654 | Ga0496121_0001443 | 3300048924 | Bacteria | 40145 |
| 655 | Ga0496121_0001527 | 3300048924 | Bacteria | 38742 |
| 656 | Ga0496121_0005628 | 3300048924 | Bacteria | 15955 |
| 657 | Ga0496121_0006578 | 3300048924 | Bacteria | 14342 |
| 658 | Ga0496121_0032648 | 3300048924 | Bacteria | 4728 |
| 659 | Ga0496121_0035638 | 3300048924 | Bacteria | 4454 |
| 660 | Ga0496121_0051892 | 3300048924 | Bacteria | 3450 |
| 661 | Ga0496121_0062474 | 3300048924 | Bacteria | 3050 |
| 662 | Ga0496121_0137652 | 3300048924 | Bacteria | 1817 |
| 663 | Ga0496122_0003144 | 3300048925 | Bacteria | 22097 |
| 664 | Ga0496122_0022158 | 3300048925 | Bacteria | 5657 |
| 665 | Ga0496122_0025193 | 3300048925 | Bacteria | 5176 |
| 666 | Ga0496122_0026336 | 3300048925 | Bacteria | 5017 |
| 667 | Ga0496123_0020781 | 3300048926 | Bacteria | 5123 |
| 668 | Ga0496123_0034230 | 3300048926 | Bacteria | 3643 |
| 669 | Ga0496123_0052065 | 3300048926 | Bacteria | 2720 |
| 670 | Ga0496124_0000013 | 3300048927 | Bacteria | 484884 |
| 671 | Ga0496124_0008790 | 3300048927 | Bacteria | 10490 |
| 672 | Ga0496124_0037214 | 3300048927 | Bacteria | 4234 |
| 673 | Ga0496124_0139370 | 3300048927 | Bacteria | 1916 |
| 674 | Ga0496125_0000083 | 3300048928 | Bacteria | 227168 |
| 675 | Ga0496125_0000092 | 3300048928 | Bacteria | 211050 |
| 676 | Ga0496125_0001341 | 3300048928 | Bacteria | 36276 |
| 677 | Ga0496125_0002637 | 3300048928 | Bacteria | 22956 |
| 678 | Ga0496125_0009813 | 3300048928 | Bacteria | 9756 |
| 679 | Ga0496125_0026278 | 3300048928 | Bacteria | 5309 |
| 680 | Ga0496125_0053908 | 3300048928 | Bacteria | 3292 |
| 681 | Ga0496125_0090312 | 3300048928 | Bacteria | 2299 |
| 682 | Ga0496126_0006684 | 3300048929 | Bacteria | 12815 |
| 683 | Ga0496126_0008250 | 3300048929 | Bacteria | 11251 |
| 684 | Ga0496126_0009337 | 3300048929 | Bacteria | 10434 |
| 685 | Ga0496126_0013694 | 3300048929 | Bacteria | 8232 |
| 686 | Ga0496126_0025148 | 3300048929 | Bacteria | 5734 |
| 687 | Ga0496126_0048534 | 3300048929 | Bacteria | 3878 |
| 688 | Ga0496126_0064742 | 3300048929 | Bacteria | 3273 |
| 689 | Ga0496126_0069891 | 3300048929 | Bacteria | 3130 |
| 690 | Ga0496126_0073087 | 3300048929 | Bacteria | 3049 |
| 691 | Ga0496126_0116666 | 3300048929 | Bacteria | 2320 |
| 692 | Ga0496126_0151034 | 3300048929 | Bacteria | 1991 |
| 693 | Ga0495678_000522 | 3300049459 | Bacteria | 37556 |
| 694 | Ga0495682_0000032 | 3300049460 | Bacteria | 132787 |
| 695 | Ga0495682_0001908 | 3300049460 | Bacteria | 10386 |
| 696 | Ga0501031_0004352 | 3300049568 | Bacteria | 9161 |
| 697 | Ga0501031_0008031 | 3300049568 | Bacteria | 6870 |
| 698 | Ga0501032_0000120 | 3300049569 | Bacteria | 64900 |
| 699 | Ga0501032_0000224 | 3300049569 | Bacteria | 46893 |
| 700 | Ga0501032_0100119 | 3300049569 | Bacteria | 1920 |
| 701 | Ga0501033_0000095 | 3300049570 | Bacteria | 84522 |
| 702 | Ga0501033_0002325 | 3300049570 | Bacteria | 16196 |
| 703 | Ga0501033_0092037 | 3300049570 | Bacteria | 2218 |
| 704 | Ga0501034_0000061 | 3300049571 | Bacteria | 195178 |
| 705 | Ga0501034_0001094 | 3300049571 | Bacteria | 38145 |
| 706 | Ga0501034_0001606 | 3300049571 | Bacteria | 29373 |
| 707 | Ga0501034_0046058 | 3300049571 | Bacteria | 4407 |
| 708 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 709 | Ga0501036_0000054 | 3300049572 | Bacteria | 74190 |
| 710 | Ga0501036_0147425 | 3300049572 | Bacteria | 1985 |
| 711 | Ga0501037_0000093 | 3300049573 | Bacteria | 83246 |
| 712 | Ga0501037_0000159 | 3300049573 | Bacteria | 63178 |
| 713 | Ga0501038_0000028 | 3300049574 | Bacteria | 144481 |
| 714 | Ga0501038_0000066 | 3300049574 | Bacteria | 86216 |
| 715 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 716 | Ga0501039_0000142 | 3300049575 | Bacteria | 48935 |
| 717 | Ga0501043_0000127 | 3300049579 | Bacteria | 70587 |
| 718 | Ga0501043_0027793 | 3300049579 | Bacteria | 4440 |
| 719 | Ga0501043_0074699 | 3300049579 | Bacteria | 2663 |
| 720 | Ga0501046_0000032 | 3300049580 | Bacteria | 180265 |
| 721 | Ga0501046_0000487 | 3300049580 | Bacteria | 39622 |
| 722 | Ga0501047_0000077 | 3300049581 | Bacteria | 123480 |
| 723 | Ga0501047_0000122 | 3300049581 | Bacteria | 95307 |
| 724 | Ga0501047_0013416 | 3300049581 | Bacteria | 7768 |
| 725 | Ga0501047_0093430 | 3300049581 | Bacteria | 2887 |
| 726 | Ga0501048_0000053 | 3300049582 | Bacteria | 57136 |
| 727 | Ga0501048_0000693 | 3300049582 | Bacteria | 24501 |
| 728 | Ga0501067_0000387 | 3300049583 | Bacteria | 23972 |
| 729 | Ga0501067_0002215 | 3300049583 | Bacteria | 10744 |
| 730 | Ga0501068_0000392 | 3300049584 | Bacteria | 22164 |
| 731 | Ga0501068_0007764 | 3300049584 | Bacteria | 5942 |
| 732 | Ga0501069_0003878 | 3300049585 | Bacteria | 7704 |
| 733 | Ga0501069_0006700 | 3300049585 | Bacteria | 6032 |
| 734 | Ga0501070_0000070 | 3300049586 | Bacteria | 86706 |
| 735 | Ga0501070_0001577 | 3300049586 | Bacteria | 20268 |
| 736 | Ga0501070_0009608 | 3300049586 | Bacteria | 8171 |
| 737 | Ga0501072_0002094 | 3300049588 | Bacteria | 14863 |
| 738 | Ga0501073_0000146 | 3300049589 | Bacteria | 46947 |
| 739 | Ga0501073_0004857 | 3300049589 | Bacteria | 10089 |
| 740 | Ga0501074_0000712 | 3300049590 | Bacteria | 20837 |
| 741 | Ga0501079_0010566 | 3300049741 | Bacteria | 7022 |
| 742 | Ga0501079_0027146 | 3300049741 | Bacteria | 4389 |
| 743 | Ga0501080_0000035 | 3300049742 | Bacteria | 83220 |
| 744 | Ga0501080_0001268 | 3300049742 | Bacteria | 21004 |
| 745 | Ga0501083_0001199 | 3300049744 | Bacteria | 17528 |
| 746 | Ga0501083_0065317 | 3300049744 | Bacteria | 2424 |
| 747 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 748 | Ga0501035_0000099 | 3300049822 | Bacteria | 108224 |
| 749 | Ga0501035_0096382 | 3300049822 | Bacteria | 2599 |
| 750 | Ga0501044_0000184 | 3300049823 | Bacteria | 77805 |
| 751 | Ga0501044_0000195 | 3300049823 | Bacteria | 76643 |
| 752 | Ga0501044_0003221 | 3300049823 | Bacteria | 18386 |
| 753 | Ga0501044_0047111 | 3300049823 | Bacteria | 4460 |
| 754 | Ga0501044_0172289 | 3300049823 | Bacteria | 2135 |
| 755 | Ga0501044_0230224 | 3300049823 | Bacteria | 1801 |
| 756 | Ga0501045_0062682 | 3300049824 | Bacteria | 2728 |
| 757 | nmdc:mga03683_5300_c1 | 3300050489 | Bacteria | 3848 |
| 758 | nmdc:mga03683_9545_c1 | 3300050489 | Bacteria | 2878 |
| 759 | nmdc:mga03n38_31072_c1 | 3300050490 | Bacteria | 2251 |
| 760 | nmdc:mga00v17_17576_c1 | 3300050491 | Bacteria | 4051 |
| 761 | nmdc:mga00v17_63532_c1 | 3300050491 | Bacteria | 2274 |
| 762 | nmdc:mga0yw44_274_c1 | 3300050492 | Bacteria | 17652 |
| 763 | nmdc:mga0yw44_39673_c1 | 3300050492 | Bacteria | 2794 |
| 764 | nmdc:mga0yw44_47146_c1 | 3300050492 | Bacteria | 2592 |
| 765 | nmdc:mga0yw44_57800_c1 | 3300050492 | Bacteria | 2367 |
| 766 | nmdc:mga0k408_22951_c1 | 3300050493 | Bacteria | 3517 |
| 767 | nmdc:mga06z11_1702_c1 | 3300050494 | Bacteria | 8254 |
| 768 | nmdc:mga06z11_44277_c1 | 3300050494 | Bacteria | 2244 |
| 769 | nmdc:mga07m45_92356_c1 | 3300050496 | Bacteria | 1735 |
| 770 | nmdc:mga05p37_35437_c1 | 3300050507 | Bacteria | 6118 |
| 771 | nmdc:mga0n895_82137_c1 | 3300050512 | Bacteria | 3212 |
| 772 | nmdc:mga0rr50_182223_c1 | 3300050513 | Bacteria | 1717 |
| 773 | Ga0495601_0020614 | 3300053077 | Bacteria | 4028 |
| 774 | Ga0495601_0037498 | 3300053077 | Bacteria | 3030 |
| 775 | Ga0495612_0042849 | 3300053078 | Bacteria | 1848 |
| 776 | Ga0500610_0056565 | 3300053079 | Bacteria | 2047 |
| 777 | Ga0500635_0000788 | 3300053080 | Bacteria | 7875 |
| 778 | Ga0500635_0001533 | 3300053080 | Bacteria | 5549 |
| 779 | Ga0495619_0000394 | 3300053085 | Bacteria | 29767 |
| 780 | Ga0495619_0009011 | 3300053085 | Bacteria | 6295 |
| 781 | Ga0495619_0058270 | 3300053085 | Bacteria | 2563 |
| 782 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 783 | Ga0500643_009059 | 3300053087 | Bacteria | 3841 |
| 784 | Ga0500647_0041146 | 3300053091 | Bacteria | 2217 |
| 785 | Ga0500651_0063025 | 3300053093 | Bacteria | 2314 |
| 786 | Ga0500566_0000020 | 3300053094 | Bacteria | 83462 |
| 787 | Ga0500566_0000693 | 3300053094 | Bacteria | 18973 |
| 788 | Ga0500566_0004708 | 3300053094 | Bacteria | 8125 |
| 789 | Ga0500566_0087109 | 3300053094 | Bacteria | 1730 |
| 790 | Ga0500640_018256 | 3300053095 | Bacteria | 2989 |
| 791 | Ga0500648_018307 | 3300053097 | Bacteria | 3847 |
| 792 | Ga0500650_0054909 | 3300053098 | Bacteria | 1854 |
| 793 | Ga0500556_0000024 | 3300053104 | Bacteria | 167556 |
| 794 | Ga0500557_000093 | 3300053105 | Bacteria | 30291 |
| 795 | Ga0500562_030373 | 3300053108 | Bacteria | 1423 |
| 796 | Ga0500572_001222 | 3300053111 | Bacteria | 7259 |
| 797 | Ga0500572_001274 | 3300053111 | Bacteria | 7047 |
| 798 | Ga0500595_000478 | 3300053119 | Bacteria | 24694 |
| 799 | Ga0500595_005213 | 3300053119 | Bacteria | 5698 |
| 800 | Ga0500595_007973 | 3300053119 | Bacteria | 4348 |
| 801 | Ga0500595_008884 | 3300053119 | Bacteria | 4083 |
| 802 | Ga0500607_088018 | 3300053121 | Unclassified | 1569 |
| 803 | Ga0500608_001404 | 3300053122 | Bacteria | 8620 |
| 804 | Ga0500608_023436 | 3300053122 | Bacteria | 2874 |
| 805 | Ga0500618_000216 | 3300053125 | Bacteria | 45255 |
| 806 | Ga0500618_000423 | 3300053125 | Bacteria | 28476 |
| 807 | Ga0500618_000988 | 3300053125 | Bacteria | 14371 |
| 808 | Ga0500618_004319 | 3300053125 | Bacteria | 4591 |
| 809 | Ga0500642_0000035 | 3300053130 | Bacteria | 106656 |
| 810 | Ga0500642_0000096 | 3300053130 | Bacteria | 42836 |
| 811 | Ga0500642_0002242 | 3300053130 | Bacteria | 5643 |
| 812 | Ga0500642_0003238 | 3300053130 | Bacteria | 4891 |
| 813 | Ga0500642_0012766 | 3300053130 | Bacteria | 3060 |
| 814 | Ga0500559_0000491 | 3300053136 | Bacteria | 27718 |
| 815 | Ga0500559_0000520 | 3300053136 | Bacteria | 27012 |
| 816 | Ga0500559_0012987 | 3300053136 | Bacteria | 3532 |
| 817 | Ga0500559_0014071 | 3300053136 | Bacteria | 3382 |
| 818 | Ga0500559_0056627 | 3300053136 | Bacteria | 1740 |
| 819 | Ga0500568_0005882 | 3300053139 | Bacteria | 6245 |
| 820 | Ga0500573_0039050 | 3300053140 | Bacteria | 2742 |
| 821 | Ga0500577_0000455 | 3300053142 | Bacteria | 10570 |
| 822 | Ga0500589_062883 | 3300053147 | Bacteria | 1696 |
| 823 | Ga0500603_000105 | 3300053150 | Bacteria | 19663 |
| 824 | Ga0500603_000891 | 3300053150 | Bacteria | 7091 |
| 825 | Ga0500604_0029999 | 3300053151 | Bacteria | 1588 |
| 826 | Ga0500616_0000122 | 3300053153 | Bacteria | 140228 |
| 827 | Ga0500619_009306 | 3300053154 | Bacteria | 2431 |
| 828 | Ga0500622_0000790 | 3300053156 | Bacteria | 27440 |
| 829 | Ga0500622_0026034 | 3300053156 | Bacteria | 3089 |
| 830 | Ga0500624_002474 | 3300053157 | Bacteria | 2501 |
| 831 | Ga0500630_003888 | 3300053159 | Bacteria | 7253 |
| 832 | Ga0500634_0011768 | 3300053161 | Bacteria | 4528 |
| 833 | Ga0500638_009264 | 3300053162 | Bacteria | 4248 |
| 834 | Ga0500638_022688 | 3300053162 | Bacteria | 2976 |
| 835 | Ga0500639_000066 | 3300053163 | Bacteria | 47938 |
| 836 | Ga0500636_0000645 | 3300053177 | Bacteria | 18823 |
| 837 | Ga0500636_0003147 | 3300053177 | Bacteria | 9247 |
| 838 | Ga0500636_0072687 | 3300053177 | Bacteria | 1992 |
| 839 | Ga0500637_0004444 | 3300053178 | Bacteria | 6652 |
| 840 | Ga0500625_034445 | 3300053729 | Bacteria | 2400 |
| 841 | Ga0500609_001844 | 3300053731 | Bacteria | 3070 |
| 842 | Ga0500596_003119 | 3300053735 | Bacteria | 3187 |
| 843 | Ga0500601_000120 | 3300053737 | Bacteria | 16487 |
| 844 | Ga0501084_0002556 | 3300054114 | Bacteria | 14660 |
| 845 | Ga0501082_0001454 | 3300060353 | Bacteria | 20806 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 8016575299 | 8016578743 | 416 |
| 2 | iso_pu_bacteria | 2935916978 | 2935920519 | 442 |
| 3 | 3300028800 | Ga0265338_10001796 | Ga0265338_100017964 | 449 |
| 4 | 3300025921 | Ga0207652_10106084 | Ga0207652_101060841 | 453 |
| 5 | 3300046529 | Ga0495652_0115272 | Ga0495652_0115272_19_1422 | 454 |
| 6 | 3300048088 | Ga0495602_0163345 | Ga0495602_0163345_19_1422 | 454 |
| 7 | 3300032004 | Ga0307414_10016285 | Ga0307414_100162852 | 455 |
| 8 | 3300053108 | Ga0500562_030373 | Ga0500562_030373_17_1408 | 459 |
| 9 | 3300046692 | Ga0495671_0095707 | Ga0495671_0095707_52_1443 | 463 |
| 10 | 3300053078 | Ga0495612_0042849 | Ga0495612_0042849_12_1415 | 463 |
| 11 | 3300053121 | Ga0500607_088018 | Ga0500607_088018_21_1418 | 464 |
| 12 | 3300009093 | Ga0105240_10068838 | Ga0105240_100688382 | 466 |
| 13 | 3300025913 | Ga0207695_10180590 | Ga0207695_101805902 | 466 |
| 14 | 3300005331 | Ga0070670_100004805 | Ga0070670_1000048056 | 467 |
| 15 | 3300005331 | Ga0070670_100136636 | Ga0070670_1001366362 | 467 |
| 16 | 3300005333 | Ga0070677_10001495 | Ga0070677_100014953 | 467 |
| 17 | 3300005338 | Ga0068868_100013364 | Ga0068868_1000133643 | 467 |
| 18 | 3300005354 | Ga0070675_100007548 | Ga0070675_1000075486 | 467 |
| 19 | 3300005355 | Ga0070671_100023332 | Ga0070671_1000233322 | 467 |
| 20 | 3300005356 | Ga0070674_100038097 | Ga0070674_1000380972 | 467 |
| 21 | 3300005364 | Ga0070673_100002260 | Ga0070673_1000022608 | 467 |
| 22 | 3300005367 | Ga0070667_100018417 | Ga0070667_1000184172 | 467 |
| 23 | 3300005456 | Ga0070678_100003016 | Ga0070678_1000030166 | 467 |
| 24 | 3300005459 | Ga0068867_100003767 | Ga0068867_1000037676 | 467 |
| 25 | 3300005543 | Ga0070672_100002537 | Ga0070672_1000025376 | 467 |
| 26 | 3300025315 | Ga0207697_10009429 | Ga0207697_100094292 | 467 |
| 27 | 3300025908 | Ga0207643_10061308 | Ga0207643_100613082 | 467 |
| 28 | 3300025923 | Ga0207681_10062346 | Ga0207681_100623462 | 467 |
| 29 | 3300025925 | Ga0207650_10003368 | Ga0207650_100033687 | 467 |
| 30 | 3300025925 | Ga0207650_10054211 | Ga0207650_100542112 | 467 |
| 31 | 3300025926 | Ga0207659_10002374 | Ga0207659_100023746 | 467 |
| 32 | 3300025931 | Ga0207644_10049773 | Ga0207644_100497732 | 467 |
| 33 | 3300025937 | Ga0207669_10001262 | Ga0207669_100012626 | 467 |
| 34 | 3300025940 | Ga0207691_10005604 | Ga0207691_100056048 | 467 |
| 35 | 3300025945 | Ga0207679_10082218 | Ga0207679_100822182 | 467 |
| 36 | 3300025960 | Ga0207651_10012778 | Ga0207651_100127782 | 467 |
| 37 | 3300025986 | Ga0207658_10129805 | Ga0207658_101298052 | 467 |
| 38 | 3300026023 | Ga0207677_10052763 | Ga0207677_100527634 | 467 |
| 39 | 3300026089 | Ga0207648_10008822 | Ga0207648_100088226 | 467 |
| 40 | 3300026121 | Ga0207683_10005354 | Ga0207683_100053546 | 467 |
| 41 | 3300031731 | Ga0307405_10014356 | Ga0307405_100143563 | 467 |
| 42 | 3300031995 | Ga0307409_100001404 | Ga0307409_1000014048 | 467 |
| 43 | 3300032002 | Ga0307416_100002743 | Ga0307416_1000027435 | 467 |
| 44 | 3300032005 | Ga0307411_10059471 | Ga0307411_100594712 | 467 |
| 45 | 3300032126 | Ga0307415_100015133 | Ga0307415_1000151332 | 467 |
| 46 | 3300031251 | Ga0265327_10019500 | Ga0265327_100195002 | 469 |
| 47 | 3300048919 | Ga0496116_0096664 | Ga0496116_0096664_327_1760 | 471 |
| 48 | 3300053147 | Ga0500589_062883 | Ga0500589_062883_24_1454 | 472 |
| 49 | 3300038443 | Ga0395901_0140659 | Ga0395901_0140659_269_1777 | 474 |
| 50 | 3300048929 | Ga0496126_0048534 | Ga0496126_0048534_1258_2790 | 474 |
| 51 | 3300005329 | Ga0070683_100011469 | Ga0070683_1000114694 | 475 |
| 52 | 3300005334 | Ga0068869_100014332 | Ga0068869_1000143321 | 475 |
| 53 | 3300005456 | Ga0070678_100166723 | Ga0070678_1001667232 | 475 |
| 54 | 3300005564 | Ga0070664_100005811 | Ga0070664_10000581112 | 475 |
| 55 | 3300009551 | Ga0105238_10069091 | Ga0105238_100690915 | 475 |
| 56 | 3300013105 | Ga0157369_10067372 | Ga0157369_100673725 | 475 |
| 57 | 3300013296 | Ga0157374_10100182 | Ga0157374_101001823 | 475 |
| 58 | 3300014969 | Ga0157376_10274558 | Ga0157376_102745581 | 475 |
| 59 | 3300025942 | Ga0207689_10009434 | Ga0207689_100094344 | 475 |
| 60 | 3300026078 | Ga0207702_10051886 | Ga0207702_100518865 | 475 |
| 61 | 3300026121 | Ga0207683_10169816 | Ga0207683_101698162 | 475 |
| 62 | 3300037312 | Ga0395899_0004504 | Ga0395899_0004504_8185_9696 | 475 |
| 63 | 3300037418 | Ga0395900_0003228 | Ga0395900_0003228_651_2162 | 475 |
| 64 | 3300049571 | Ga0501034_0001094 | Ga0501034_0001094_12926_14437 | 475 |
| 65 | 3300049571 | Ga0501034_0046058 | Ga0501034_0046058_1634_3145 | 475 |
| 66 | 3300049579 | Ga0501043_0074699 | Ga0501043_0074699_1102_2613 | 475 |
| 67 | 3300049823 | Ga0501044_0230224 | Ga0501044_0230224_60_1571 | 475 |
| 68 | 3300005937 | Ga0081455_10000116 | Ga0081455_1000011651 | 476 |
| 69 | 3300009174 | Ga0105241_10138810 | Ga0105241_101388101 | 476 |
| 70 | 3300026121 | Ga0207683_10151725 | Ga0207683_101517252 | 476 |
| 71 | 3300025909 | Ga0207705_10147210 | Ga0207705_101472102 | 478 |
| 72 | 3300025919 | Ga0207657_10064762 | Ga0207657_100647622 | 478 |
| 73 | 3300025945 | Ga0207679_10084547 | Ga0207679_100845472 | 478 |
| 74 | 3300003187 | JGI25151J46595_10011809 | JGI25151J46595_100118092 | 481 |
| 75 | 3300027312 | Ga0209371_1000035 | Ga0209371_1000035219 | 482 |
| 76 | 3300030500 | Ga0268256_1000037 | Ga0268256_1000037218 | 482 |
| 77 | 3300048924 | Ga0496121_0000875 | Ga0496121_0000875_8331_9857 | 482 |
| 78 | 3300048924 | Ga0496121_0035638 | Ga0496121_0035638_129_1658 | 482 |
| 79 | 3300048928 | Ga0496125_0000092 | Ga0496125_0000092_133401_134933 | 482 |
| 80 | 3300048929 | Ga0496126_0151034 | Ga0496126_0151034_56_1675 | 482 |
| 81 | 3300053130 | Ga0500642_0002242 | Ga0500642_0002242_3676_5178 | 482 |
| 82 | 3300053142 | Ga0500577_0000455 | Ga0500577_0000455_1628_3157 | 482 |
| 83 | 3300025294 | Ga0209025_1001716 | Ga0209025_100171616 | 484 |
| 84 | 3300048928 | Ga0496125_0001341 | Ga0496125_0001341_19199_20731 | 484 |
| 85 | 3300049581 | Ga0501047_0013416 | Ga0501047_0013416_298_1818 | 485 |
| 86 | 3300049586 | Ga0501070_0009608 | Ga0501070_0009608_144_1664 | 485 |
| 87 | 3300049823 | Ga0501044_0047111 | Ga0501044_0047111_1017_2537 | 485 |
| 88 | iso_pu_bacteria | 2808606386 | 2808983214 | 485 |
| 89 | iso_pu_bacteria | 2808606415 | 2809128434 | 485 |
| 90 | iso_pu_bacteria | 2808606419 | 2809148055 | 485 |
| 91 | iso_pu_bacteria | 2852618963 | 2852620530 | 485 |
| 92 | 3300005339 | Ga0070660_100088939 | Ga0070660_1000889391 | 486 |
| 93 | 3300005347 | Ga0070668_100032035 | Ga0070668_1000320352 | 486 |
| 94 | 3300005564 | Ga0070664_100088893 | Ga0070664_1000888932 | 486 |
| 95 | 3300005616 | Ga0068852_100041568 | Ga0068852_1000415682 | 486 |
| 96 | 3300005617 | Ga0068859_100125022 | Ga0068859_1001250222 | 486 |
| 97 | 3300005842 | Ga0068858_100141705 | Ga0068858_1001417052 | 486 |
| 98 | 3300005843 | Ga0068860_100040107 | Ga0068860_1000401072 | 486 |
| 99 | 3300005843 | Ga0068860_100071549 | Ga0068860_1000715492 | 486 |
| 100 | 3300005844 | Ga0068862_100010139 | Ga0068862_1000101393 | 486 |
| 101 | 3300006931 | Ga0097620_100125025 | Ga0097620_1001250252 | 486 |
| 102 | 3300013104 | Ga0157370_10135348 | Ga0157370_101353482 | 486 |
| 103 | 3300025972 | Ga0207668_10024605 | Ga0207668_100246052 | 486 |
| 104 | 3300026118 | Ga0207675_100026527 | Ga0207675_1000265273 | 486 |
| 105 | 3300026142 | Ga0207698_10045465 | Ga0207698_100454652 | 486 |
| 106 | 3300028380 | Ga0268265_10020692 | Ga0268265_100206922 | 486 |
| 107 | 3300028381 | Ga0268264_10004742 | Ga0268264_100047422 | 486 |
| 108 | 3300005347 | Ga0070668_100177948 | Ga0070668_1001779482 | 487 |
| 109 | 3300005543 | Ga0070672_100083712 | Ga0070672_1000837122 | 487 |
| 110 | 3300005616 | Ga0068852_100182344 | Ga0068852_1001823442 | 487 |
| 111 | 3300005843 | Ga0068860_100006214 | Ga0068860_1000062142 | 487 |
| 112 | 3300005844 | Ga0068862_100007547 | Ga0068862_1000075476 | 487 |
| 113 | 3300006881 | Ga0068865_100000872 | Ga0068865_1000008728 | 487 |
| 114 | 3300009553 | Ga0105249_10016709 | Ga0105249_100167094 | 487 |
| 115 | 3300013297 | Ga0157378_10012293 | Ga0157378_100122932 | 487 |
| 116 | 3300013306 | Ga0163162_10002169 | Ga0163162_100021699 | 487 |
| 117 | 3300014326 | Ga0157380_10030643 | Ga0157380_100306433 | 487 |
| 118 | 3300025940 | Ga0207691_10101330 | Ga0207691_101013302 | 487 |
| 119 | 3300026075 | Ga0207708_10054510 | Ga0207708_100545102 | 487 |
| 120 | 3300026089 | Ga0207648_10000419 | Ga0207648_1000041944 | 487 |
| 121 | 3300026118 | Ga0207675_100000693 | Ga0207675_10000069322 | 487 |
| 122 | 3300028381 | Ga0268264_10002351 | Ga0268264_100023514 | 487 |
| 123 | 3300042876 | Ga0451577_0004589 | Ga0451577_0004589_2353_3861 | 487 |
| 124 | 3300053093 | Ga0500651_0063025 | Ga0500651_0063025_178_1683 | 487 |
| 125 | 3300053125 | Ga0500618_000216 | Ga0500618_000216_23494_24978 | 487 |
| 126 | 3300053130 | Ga0500642_0012766 | Ga0500642_0012766_1201_2706 | 487 |
| 127 | 3300053136 | Ga0500559_0056627 | Ga0500559_0056627_69_1571 | 487 |
| 128 | 3300053731 | Ga0500609_001844 | Ga0500609_001844_435_1940 | 487 |
| 129 | 3300005262 | Ga0065165_1003321 | Ga0065165_10033218 | 488 |
| 130 | 3300025302 | Ga0207426_1000554 | Ga0207426_100055415 | 488 |
| 131 | 3300046507 | Ga0495606_0031059 | Ga0495606_0031059_1934_3439 | 488 |
| 132 | 3300046524 | Ga0495648_0003979 | Ga0495648_0003979_10435_11940 | 488 |
| 133 | 3300046660 | Ga0495625_0068283 | Ga0495625_0068283_589_2094 | 488 |
| 134 | 3300046694 | Ga0495649_0059019 | Ga0495649_0059019_283_1788 | 488 |
| 135 | 3300048908 | Ga0496105_0002621 | Ga0496105_0002621_10406_11911 | 488 |
| 136 | 3300048924 | Ga0496121_0032648 | Ga0496121_0032648_2321_3841 | 488 |
| 137 | 3300053087 | Ga0500643_000019 | Ga0500643_000019_12895_14400 | 488 |
| 138 | 3300053125 | Ga0500618_004319 | Ga0500618_004319_64_1596 | 488 |
| 139 | 3300005436 | Ga0070713_100029836 | Ga0070713_1000298362 | 489 |
| 140 | 3300005616 | Ga0068852_100011341 | Ga0068852_1000113418 | 489 |
| 141 | 3300005834 | Ga0068851_10000771 | Ga0068851_1000077114 | 489 |
| 142 | 3300006175 | Ga0070712_100059974 | Ga0070712_1000599742 | 489 |
| 143 | 3300006237 | Ga0097621_100016503 | Ga0097621_1000165036 | 489 |
| 144 | 3300006941 | Ga0099825_1019011 | Ga0099825_10190113 | 489 |
| 145 | 3300025906 | Ga0207699_10011046 | Ga0207699_100110461 | 489 |
| 146 | 3300025915 | Ga0207693_10008081 | Ga0207693_100080817 | 489 |
| 147 | 3300025928 | Ga0207700_10065605 | Ga0207700_100656052 | 489 |
| 148 | 3300025935 | Ga0207709_10062747 | Ga0207709_100627472 | 489 |
| 149 | 3300026023 | Ga0207677_10096834 | Ga0207677_100968342 | 489 |
| 150 | 3300026142 | Ga0207698_10001212 | Ga0207698_100012129 | 489 |
| 151 | 3300027296 | Ga0209389_1000816 | Ga0209389_10008165 | 489 |
| 152 | 3300027361 | Ga0209489_106247 | Ga0209489_1062475 | 489 |
| 153 | 3300027363 | Ga0209700_100031 | Ga0209700_1000315 | 489 |
| 154 | 3300048927 | Ga0496124_0000013 | Ga0496124_0000013_192631_194106 | 489 |
| 155 | 3300031730 | Ga0307516_10024016 | Ga0307516_100240169 | 490 |
| 156 | 3300037068 | Ga0373925_0031894 | Ga0373925_0031894_960_2483 | 490 |
| 157 | 3300005937 | Ga0081455_10025839 | Ga0081455_100258392 | 491 |
| 158 | 3300025261 | Ga0209233_1012268 | Ga0209233_10122682 | 491 |
| 159 | 3300048905 | Ga0496102_0047072 | Ga0496102_0047072_2401_3882 | 491 |
| 160 | 3300050512 | nmdc:mga0n895_82137_c1 | nmdc:mga0n895_82137_c1_1000_2520 | 491 |
| 161 | iso_pu_bacteria | 2511231026 | 2511387293 | 491 |
| 162 | 3300005347 | Ga0070668_100113213 | Ga0070668_1001132131 | 492 |
| 163 | 3300006038 | Ga0075365_10083747 | Ga0075365_100837472 | 492 |
| 164 | 3300033442 | Ga0315911_1000009 | Ga0315911_1000009368 | 492 |
| 165 | 3300046530 | Ga0495654_0059679 | Ga0495654_0059679_39_1544 | 492 |
| 166 | 3300048908 | Ga0496105_0066683 | Ga0496105_0066683_193_1698 | 492 |
| 167 | 3300048929 | Ga0496126_0116666 | Ga0496126_0116666_346_1851 | 492 |
| 168 | 3300050492 | nmdc:mga0yw44_47146_c1 | nmdc:mga0yw44_47146_c1_457_1962 | 492 |
| 169 | 3300053125 | Ga0500618_000423 | Ga0500618_000423_14159_15679 | 492 |
| 170 | iso_pu_bacteria | 2751185800 | 2753357819 | 492 |
| 171 | iso_pu_bacteria | 2928521798 | 2928524863 | 492 |
| 172 | iso_pu_bacteria | 2954011201 | 2954011514 | 492 |
| 173 | 3300005981 | Ga0081538_10033760 | Ga0081538_100337601 | 493 |
| 174 | 3300006038 | Ga0075365_10000870 | Ga0075365_100008708 | 493 |
| 175 | 3300006177 | Ga0075362_10024429 | Ga0075362_100244292 | 493 |
| 176 | 3300046457 | Ga0495590_0007217 | Ga0495590_0007217_330_1874 | 493 |
| 177 | 3300046694 | Ga0495649_0066655 | Ga0495649_0066655_226_1719 | 493 |
| 178 | 3300047319 | Ga0495674_0005696 | Ga0495674_0005696_2880_4367 | 493 |
| 179 | 3300050489 | nmdc:mga03683_5300_c1 | nmdc:mga03683_5300_c1_1575_3071 | 493 |
| 180 | 3300050491 | nmdc:mga00v17_17576_c1 | nmdc:mga00v17_17576_c1_1379_2875 | 493 |
| 181 | 3300050492 | nmdc:mga0yw44_274_c1 | nmdc:mga0yw44_274_c1_13229_14725 | 493 |
| 182 | iso_pu_bacteria | 2854911287 | 2854915348 | 493 |
| 183 | 3300005937 | Ga0081455_10001166 | Ga0081455_1000116627 | 494 |
| 184 | 3300006058 | Ga0075432_10036962 | Ga0075432_100369622 | 494 |
| 185 | 3300042013 | Ga0439456_005986 | Ga0439456_005986_64_1554 | 494 |
| 186 | 3300046452 | Ga0495617_006936 | Ga0495617_006936_1366_2856 | 494 |
| 187 | 3300046452 | Ga0495617_018404 | Ga0495617_018404_57_1547 | 494 |
| 188 | 3300046455 | Ga0495603_0000218 | Ga0495603_0000218_22870_24360 | 494 |
| 189 | 3300046459 | Ga0495629_0000212 | Ga0495629_0000212_24090_25637 | 494 |
| 190 | 3300046460 | Ga0495638_0013179 | Ga0495638_0013179_1548_3038 | 494 |
| 191 | 3300046472 | Ga0495580_0002791 | Ga0495580_0002791_10160_11704 | 494 |
| 192 | 3300046472 | Ga0495580_0028950 | Ga0495580_0028950_1685_3232 | 494 |
| 193 | 3300046474 | Ga0495605_0058845 | Ga0495605_0058845_168_1658 | 494 |
| 194 | 3300046491 | Ga0495584_0000261 | Ga0495584_0000261_2692_4182 | 494 |
| 195 | 3300046492 | Ga0495585_0000488 | Ga0495585_0000488_33711_35201 | 494 |
| 196 | 3300046499 | Ga0495594_0004370 | Ga0495594_0004370_297_1787 | 494 |
| 197 | 3300046506 | Ga0495583_0007882 | Ga0495583_0007882_4667_6211 | 494 |
| 198 | 3300046506 | Ga0495583_0016627 | Ga0495583_0016627_2280_3857 | 494 |
| 199 | 3300046513 | Ga0495616_0000624 | Ga0495616_0000624_7956_9446 | 494 |
| 200 | 3300046515 | Ga0495620_0028613 | Ga0495620_0028613_61_1605 | 494 |
| 201 | 3300046516 | Ga0495628_0043562 | Ga0495628_0043562_1639_3186 | 494 |
| 202 | 3300046517 | Ga0495630_0001776 | Ga0495630_0001776_6457_8001 | 494 |
| 203 | 3300046518 | Ga0495631_0000084 | Ga0495631_0000084_26181_27671 | 494 |
| 204 | 3300046518 | Ga0495631_0000131 | Ga0495631_0000131_34232_35722 | 494 |
| 205 | 3300046519 | Ga0495632_0000144 | Ga0495632_0000144_66049_67539 | 494 |
| 206 | 3300046520 | Ga0495637_0000096 | Ga0495637_0000096_2463_3953 | 494 |
| 207 | 3300046522 | Ga0495643_0000464 | Ga0495643_0000464_6336_7826 | 494 |
| 208 | 3300046524 | Ga0495648_0000702 | Ga0495648_0000702_31797_33287 | 494 |
| 209 | 3300046533 | Ga0495640_0071245 | Ga0495640_0071245_701_2248 | 494 |
| 210 | 3300046538 | Ga0495609_0000064 | Ga0495609_0000064_71733_73223 | 494 |
| 211 | 3300046557 | Ga0495622_0000066 | Ga0495622_0000066_84374_85864 | 494 |
| 212 | 3300046615 | Ga0495656_0000014 | Ga0495656_0000014_61842_63332 | 494 |
| 213 | 3300046648 | Ga0495611_0068158 | Ga0495611_0068158_19_1563 | 494 |
| 214 | 3300046660 | Ga0495625_0000995 | Ga0495625_0000995_2463_3953 | 494 |
| 215 | 3300046665 | Ga0495661_0092119 | Ga0495661_0092119_80_1624 | 494 |
| 216 | 3300046674 | Ga0495588_0000345 | Ga0495588_0000345_17074_18564 | 494 |
| 217 | 3300046680 | Ga0495646_0008486 | Ga0495646_0008486_4092_5639 | 494 |
| 218 | 3300046684 | Ga0495669_0000056 | Ga0495669_0000056_71284_72774 | 494 |
| 219 | 3300046689 | Ga0495613_0000817 | Ga0495613_0000817_18461_19951 | 494 |
| 220 | 3300046690 | Ga0495624_0005712 | Ga0495624_0005712_571_2118 | 494 |
| 221 | 3300046690 | Ga0495624_0010608 | Ga0495624_0010608_4233_5777 | 494 |
| 222 | 3300046691 | Ga0495670_0024772 | Ga0495670_0024772_1275_2765 | 494 |
| 223 | 3300046692 | Ga0495671_0006314 | Ga0495671_0006314_4549_6039 | 494 |
| 224 | 3300046794 | Ga0495589_0000320 | Ga0495589_0000320_2463_3953 | 494 |
| 225 | 3300046810 | Ga0495660_0000382 | Ga0495660_0000382_33762_35252 | 494 |
| 226 | 3300047319 | Ga0495674_0003054 | Ga0495674_0003054_3716_5263 | 494 |
| 227 | 3300047319 | Ga0495674_0004663 | Ga0495674_0004663_5179_6723 | 494 |
| 228 | 3300047320 | Ga0495672_0000578 | Ga0495672_0000578_33852_35342 | 494 |
| 229 | 3300047323 | Ga0495683_0000102 | Ga0495683_0000102_19164_20654 | 494 |
| 230 | 3300047323 | Ga0495683_0001188 | Ga0495683_0001188_3895_5385 | 494 |
| 231 | 3300047445 | Ga0495677_0000058 | Ga0495677_0000058_5573_7063 | 494 |
| 232 | 3300047446 | Ga0495679_000102 | Ga0495679_000102_72328_73872 | 494 |
| 233 | 3300047469 | Ga0495673_0000521 | Ga0495673_0000521_33852_35342 | 494 |
| 234 | 3300047673 | Ga0495593_0001077 | Ga0495593_0001077_5149_6696 | 494 |
| 235 | 3300048091 | Ga0495626_0000110 | Ga0495626_0000110_66413_67903 | 494 |
| 236 | 3300048920 | Ga0496117_0017193 | Ga0496117_0017193_1723_3267 | 494 |
| 237 | 3300049459 | Ga0495678_000522 | Ga0495678_000522_2463_3953 | 494 |
| 238 | 3300049460 | Ga0495682_0000032 | Ga0495682_0000032_64801_66291 | 494 |
| 239 | 3300050513 | nmdc:mga0rr50_182223_c1 | nmdc:mga0rr50_182223_c1_111_1634 | 494 |
| 240 | 3300053125 | Ga0500618_000988 | Ga0500618_000988_8051_9568 | 494 |
| 241 | iso_pu_bacteria | 2599185210 | 2599605680 | 494 |
| 242 | iso_pu_bacteria | 2818991439 | 2819561257 | 494 |
| 243 | iso_pu_bacteria | 2919114240 | 2919119013 | 494 |
| 244 | iso_pu_bacteria | 2922368715 | 2922375435 | 494 |
| 245 | iso_pu_bacteria | 2926754445 | 2926759502 | 494 |
| 246 | iso_pu_bacteria | 2979100975 | 2979101839 | 494 |
| 247 | iso_pu_bacteria | 2984509177 | 2984510227 | 494 |
| 248 | iso_pu_bacteria | 2984518228 | 2984519069 | 494 |
| 249 | iso_pu_bacteria | 2984537506 | 2984538571 | 494 |
| 250 | iso_pu_bacteria | 2984601300 | 2984605282 | 494 |
| 251 | iso_pu_bacteria | 8045864390 | 8045866518 | 494 |
| 252 | 3300035724 | Ga0373933_0069491 | Ga0373933_0069491_254_1741 | 495 |
| 253 | 3300047472 | Ga0495686_0000390 | Ga0495686_0000390_51701_53209 | 495 |
| 254 | 3300048922 | Ga0496119_0008464 | Ga0496119_0008464_1606_3099 | 495 |
| 255 | 3300048925 | Ga0496122_0003144 | Ga0496122_0003144_1167_2660 | 495 |
| 256 | 3300048925 | Ga0496122_0022158 | Ga0496122_0022158_1204_2697 | 495 |
| 257 | 3300048928 | Ga0496125_0000083 | Ga0496125_0000083_7715_9208 | 495 |
| 258 | 3300048928 | Ga0496125_0090312 | Ga0496125_0090312_189_1682 | 495 |
| 259 | iso_pu_bacteria | 2507262055 | 2507509967 | 495 |
| 260 | iso_pu_bacteria | 2508501009 | 2508543973 | 495 |
| 261 | iso_pu_bacteria | 2508501042 | 2508698088 | 495 |
| 262 | iso_pu_bacteria | 2511231028 | 2511398906 | 495 |
| 263 | iso_pu_bacteria | 2513237092 | 2513627610 | 495 |
| 264 | iso_pu_bacteria | 2513237094 | 2513644436 | 495 |
| 265 | iso_pu_bacteria | 2513237095 | 2513652257 | 495 |
| 266 | iso_pu_bacteria | 2513237102 | 2513700253 | 495 |
| 267 | iso_pu_bacteria | 2513237104 | 2513721941 | 495 |
| 268 | iso_pu_bacteria | 2513237139 | 2513876064 | 495 |
| 269 | iso_pu_bacteria | 2513237161 | 2514011277 | 495 |
| 270 | iso_pu_bacteria | 2515154112 | 2515629190 | 495 |
| 271 | iso_pu_bacteria | 2517093001 | 2517103280 | 495 |
| 272 | iso_pu_bacteria | 2524023205 | 2524438999 | 495 |
| 273 | iso_pu_bacteria | 2528768022 | 2528852742 | 495 |
| 274 | iso_pu_bacteria | 2617270735 | 2617353450 | 495 |
| 275 | iso_pu_bacteria | 2617270741 | 2617378002 | 495 |
| 276 | iso_pu_bacteria | 2744054633 | 2745078888 | 495 |
| 277 | iso_pu_bacteria | 2758568016 | 2758640416 | 495 |
| 278 | iso_pu_bacteria | 2791355196 | 2793060046 | 495 |
| 279 | iso_pu_bacteria | 2802429603 | 2805917403 | 495 |
| 280 | iso_pu_bacteria | 2816332527 | 2818242482 | 495 |
| 281 | iso_pu_bacteria | 2824600985 | 2824608079 | 495 |
| 282 | iso_pu_bacteria | 2824609381 | 2824609912 | 495 |
| 283 | iso_pu_bacteria | 2824617872 | 2824623112 | 495 |
| 284 | iso_pu_bacteria | 2824626560 | 2824634494 | 495 |
| 285 | iso_pu_bacteria | 2824635225 | 2824639825 | 495 |
| 286 | iso_pu_bacteria | 2824644064 | 2824649525 | 495 |
| 287 | iso_pu_bacteria | 2824653114 | 2824655689 | 495 |
| 288 | iso_pu_bacteria | 2824661429 | 2824666575 | 495 |
| 289 | iso_pu_bacteria | 2824671348 | 2824677938 | 495 |
| 290 | iso_pu_bacteria | 2824679649 | 2824685948 | 495 |
| 291 | iso_pu_bacteria | 2824687955 | 2824694351 | 495 |
| 292 | iso_pu_bacteria | 2824696289 | 2824701997 | 495 |
| 293 | iso_pu_bacteria | 2824704595 | 2824710168 | 495 |
| 294 | iso_pu_bacteria | 2824714736 | 2824720135 | 495 |
| 295 | iso_pu_bacteria | 2824723954 | 2824730067 | 495 |
| 296 | iso_pu_bacteria | 2824732956 | 2824738896 | 495 |
| 297 | iso_pu_bacteria | 2824746037 | 2824751087 | 495 |
| 298 | iso_pu_bacteria | 2824753945 | 2824758099 | 495 |
| 299 | iso_pu_bacteria | 2824763712 | 2824766237 | 495 |
| 300 | iso_pu_bacteria | 2824773399 | 2824774242 | 495 |
| 301 | iso_pu_bacteria | 2838122688 | 2838127587 | 495 |
| 302 | iso_pu_bacteria | 2841941048 | 2841941462 | 495 |
| 303 | iso_pu_bacteria | 2841949485 | 2841952527 | 495 |
| 304 | iso_pu_bacteria | 2841957949 | 2841959545 | 495 |
| 305 | iso_pu_bacteria | 2841966195 | 2841967601 | 495 |
| 306 | iso_pu_bacteria | 2841974524 | 2841979006 | 495 |
| 307 | iso_pu_bacteria | 2841983080 | 2841986548 | 495 |
| 308 | iso_pu_bacteria | 2842038055 | 2842038316 | 495 |
| 309 | iso_pu_bacteria | 2842045827 | 2842048739 | 495 |
| 310 | iso_pu_bacteria | 2844315083 | 2844317788 | 495 |
| 311 | iso_pu_bacteria | 2847930680 | 2847934575 | 495 |
| 312 | iso_pu_bacteria | 2847939898 | 2847945187 | 495 |
| 313 | iso_pu_bacteria | 2849076700 | 2849080633 | 495 |
| 314 | iso_pu_bacteria | 2857509624 | 2857510005 | 495 |
| 315 | iso_pu_bacteria | 2874590934 | 2874596715 | 495 |
| 316 | iso_pu_bacteria | 2874612657 | 2874618275 | 495 |
| 317 | iso_pu_bacteria | 2874620515 | 2874623266 | 495 |
| 318 | iso_pu_bacteria | 2874628541 | 2874635957 | 495 |
| 319 | iso_pu_bacteria | 2874645413 | 2874653056 | 495 |
| 320 | iso_pu_bacteria | 2876761206 | 2876766637 | 495 |
| 321 | iso_pu_bacteria | 2876771140 | 2876776989 | 495 |
| 322 | iso_pu_bacteria | 2876818435 | 2876825261 | 495 |
| 323 | iso_pu_bacteria | 2879074833 | 2879081126 | 495 |
| 324 | iso_pu_bacteria | 2879083081 | 2879088224 | 495 |
| 325 | iso_pu_bacteria | 2879099564 | 2879104040 | 495 |
| 326 | iso_pu_bacteria | 2879127579 | 2879130864 | 495 |
| 327 | iso_pu_bacteria | 2879142872 | 2879147546 | 495 |
| 328 | iso_pu_bacteria | 2881364244 | 2881365623 | 495 |
| 329 | iso_pu_bacteria | 2881665667 | 2881671814 | 495 |
| 330 | iso_pu_bacteria | 2885366525 | 2885372486 | 495 |
| 331 | iso_pu_bacteria | 2885409591 | 2885411791 | 495 |
| 332 | iso_pu_bacteria | 2888378607 | 2888382523 | 495 |
| 333 | iso_pu_bacteria | 2888388044 | 2888388175 | 495 |
| 334 | iso_pu_bacteria | 2888419890 | 2888423100 | 495 |
| 335 | iso_pu_bacteria | 2903727486 | 2903735466 | 495 |
| 336 | iso_pu_bacteria | 2904666416 | 2904670086 | 495 |
| 337 | iso_pu_bacteria | 2904711408 | 2904718411 | 495 |
| 338 | iso_pu_bacteria | 2906602504 | 2906607540 | 495 |
| 339 | iso_pu_bacteria | 2906626472 | 2906634939 | 495 |
| 340 | iso_pu_bacteria | 2906643746 | 2906648975 | 495 |
| 341 | iso_pu_bacteria | 2908775508 | 2908778764 | 495 |
| 342 | iso_pu_bacteria | 2922393267 | 2922395040 | 495 |
| 343 | iso_pu_bacteria | 2929615660 | 2929616172 | 495 |
| 344 | iso_pu_bacteria | 2929624759 | 2929624916 | 495 |
| 345 | iso_pu_bacteria | 2932784394 | 2932787163 | 495 |
| 346 | iso_pu_bacteria | 2932794094 | 2932797377 | 495 |
| 347 | iso_pu_bacteria | 2932801729 | 2932804738 | 495 |
| 348 | iso_pu_bacteria | 2932809354 | 2932811356 | 495 |
| 349 | iso_pu_bacteria | 2932818245 | 2932819771 | 495 |
| 350 | iso_pu_bacteria | 2932828146 | 2932835780 | 495 |
| 351 | iso_pu_bacteria | 2933577622 | 2933578544 | 495 |
| 352 | iso_pu_bacteria | 2935608549 | 2935611128 | 495 |
| 353 | iso_pu_bacteria | 2935616580 | 2935618957 | 495 |
| 354 | iso_pu_bacteria | 2935638405 | 2935643226 | 495 |
| 355 | iso_pu_bacteria | 2935648319 | 2935648557 | 495 |
| 356 | iso_pu_bacteria | 2935656913 | 2935657455 | 495 |
| 357 | iso_pu_bacteria | 2935665750 | 2935669852 | 495 |
| 358 | iso_pu_bacteria | 2935675223 | 2935677007 | 495 |
| 359 | iso_pu_bacteria | 2935684952 | 2935693048 | 495 |
| 360 | iso_pu_bacteria | 2935694250 | 2935695462 | 495 |
| 361 | iso_pu_bacteria | 2935703347 | 2935709429 | 495 |
| 362 | iso_pu_bacteria | 2935713505 | 2935719656 | 495 |
| 363 | iso_pu_bacteria | 2935722832 | 2935729577 | 495 |
| 364 | iso_pu_bacteria | 2935732158 | 2935739539 | 495 |
| 365 | iso_pu_bacteria | 2935741537 | 2935748577 | 495 |
| 366 | iso_pu_bacteria | 2935750917 | 2935756836 | 495 |
| 367 | iso_pu_bacteria | 2935760218 | 2935761176 | 495 |
| 368 | iso_pu_bacteria | 2935769743 | 2935771529 | 495 |
| 369 | iso_pu_bacteria | 2935777560 | 2935779218 | 495 |
| 370 | iso_pu_bacteria | 2935785616 | 2935790812 | 495 |
| 371 | iso_pu_bacteria | 2935793552 | 2935799247 | 495 |
| 372 | iso_pu_bacteria | 2935801545 | 2935807369 | 495 |
| 373 | iso_pu_bacteria | 2935810662 | 2935812509 | 495 |
| 374 | iso_pu_bacteria | 2935819856 | 2935820613 | 495 |
| 375 | iso_pu_bacteria | 2935827899 | 2935832630 | 495 |
| 376 | iso_pu_bacteria | 2935837841 | 2935839291 | 495 |
| 377 | iso_pu_bacteria | 2935847175 | 2935849378 | 495 |
| 378 | iso_pu_bacteria | 2935855204 | 2935857322 | 495 |
| 379 | iso_pu_bacteria | 2935864058 | 2935864851 | 495 |
| 380 | iso_pu_bacteria | 2935873716 | 2935876629 | 495 |
| 381 | iso_pu_bacteria | 2935883170 | 2935885026 | 495 |
| 382 | iso_pu_bacteria | 2935908558 | 2935911847 | 495 |
| 383 | iso_pu_bacteria | 2935926038 | 2935928876 | 495 |
| 384 | iso_pu_bacteria | 2935934488 | 2935938521 | 495 |
| 385 | iso_pu_bacteria | 2935942939 | 2935945587 | 495 |
| 386 | iso_pu_bacteria | 2935951376 | 2935954806 | 495 |
| 387 | iso_pu_bacteria | 2935959822 | 2935963405 | 495 |
| 388 | iso_pu_bacteria | 2935967501 | 2935970693 | 495 |
| 389 | iso_pu_bacteria | 2935975950 | 2935979070 | 495 |
| 390 | iso_pu_bacteria | 2935984226 | 2935987913 | 495 |
| 391 | iso_pu_bacteria | 2935992306 | 2935999019 | 495 |
| 392 | iso_pu_bacteria | 2936002035 | 2936008223 | 495 |
| 393 | iso_pu_bacteria | 2936011229 | 2936011467 | 495 |
| 394 | iso_pu_bacteria | 2936019824 | 2936020062 | 495 |
| 395 | iso_pu_bacteria | 2936028420 | 2936028658 | 495 |
| 396 | iso_pu_bacteria | 2936037263 | 2936039102 | 495 |
| 397 | iso_pu_bacteria | 2936046547 | 2936046785 | 495 |
| 398 | iso_pu_bacteria | 2936055302 | 2936058340 | 495 |
| 399 | iso_pu_bacteria | 2940556831 | 2940562750 | 495 |
| 400 | iso_pu_bacteria | 2941531003 | 2941536425 | 495 |
| 401 | iso_pu_bacteria | 2941538514 | 2941539981 | 495 |
| 402 | iso_pu_bacteria | 3005483717 | 3005487987 | 495 |
| 403 | iso_pu_bacteria | 3005506211 | 3005508681 | 495 |
| 404 | iso_pu_bacteria | 3005587118 | 3005590661 | 495 |
| 405 | iso_pu_bacteria | 3005594810 | 3005597541 | 495 |
| 406 | iso_pu_bacteria | 3005710791 | 3005713563 | 495 |
| 407 | iso_pu_bacteria | 3005718088 | 3005720965 | 495 |
| 408 | iso_pu_bacteria | 8006926726 | 8006926928 | 495 |
| 409 | iso_pu_bacteria | 8016511872 | 8016515043 | 495 |
| 410 | iso_pu_bacteria | 8016539877 | 8016540586 | 495 |
| 411 | iso_pu_bacteria | 8016548790 | 8016552658 | 495 |
| 412 | iso_pu_bacteria | 8016557553 | 8016561036 | 495 |
| 413 | iso_pu_bacteria | 8016566248 | 8016574669 | 495 |
| 414 | iso_pu_bacteria | 8016583857 | 8016590906 | 495 |
| 415 | iso_pu_bacteria | 8016595262 | 8016598896 | 495 |
| 416 | iso_pu_bacteria | 8016603502 | 8016612177 | 495 |
| 417 | iso_pu_bacteria | 8016613128 | 8016621625 | 495 |
| 418 | iso_pu_bacteria | 8016622563 | 8016628336 | 495 |
| 419 | iso_pu_bacteria | 8016630954 | 8016632528 | 495 |
| 420 | iso_pu_bacteria | 8017057580 | 8017061410 | 495 |
| 421 | iso_pu_bacteria | 8019530166 | 8019536030 | 495 |
| 422 | iso_pu_bacteria | 8019538911 | 8019543440 | 495 |
| 423 | iso_pu_bacteria | 8019547302 | 8019555414 | 495 |
| 424 | iso_pu_bacteria | 8019576017 | 8019580885 | 495 |
| 425 | iso_pu_bacteria | 8019597564 | 8019602715 | 495 |
| 426 | iso_pu_bacteria | 8019608314 | 8019615844 | 495 |
| 427 | iso_pu_bacteria | 8019619141 | 8019626577 | 495 |
| 428 | iso_pu_bacteria | 8019648815 | 8019656527 | 495 |
| 429 | iso_pu_bacteria | 8019668869 | 8019673314 | 495 |
| 430 | iso_pu_bacteria | 8019678201 | 8019682812 | 495 |
| 431 | iso_pu_bacteria | 8019687851 | 8019688500 | 495 |
| 432 | iso_pu_bacteria | 8055742211 | 8055747819 | 495 |
| 433 | iso_pu_bacteria | 8056967851 | 8056970033 | 495 |
| 434 | 3300003203 | JGI25406J46586_10001342 | JGI25406J46586_100013424 | 496 |
| 435 | 3300005467 | Ga0070706_100122381 | Ga0070706_1001223811 | 496 |
| 436 | 3300005985 | Ga0081539_10000726 | Ga0081539_1000072631 | 496 |
| 437 | 3300006048 | Ga0075363_100048472 | Ga0075363_1000484722 | 496 |
| 438 | 3300006178 | Ga0075367_10070670 | Ga0075367_100706702 | 496 |
| 439 | 3300021384 | Ga0213876_10021485 | Ga0213876_100214853 | 496 |
| 440 | 3300021388 | Ga0213875_10022106 | Ga0213875_100221061 | 496 |
| 441 | 3300025253 | Ga0209677_100702 | Ga0209677_1007022 | 496 |
| 442 | 3300025910 | Ga0207684_10210329 | Ga0207684_102103291 | 496 |
| 443 | 3300026089 | Ga0207648_10084025 | Ga0207648_100840252 | 496 |
| 444 | 3300039437 | Ga0436365_0680043 | Ga0436365_0680043_2547_4043 | 496 |
| 445 | 3300046674 | Ga0495588_0010162 | Ga0495588_0010162_2320_3822 | 496 |
| 446 | 3300047470 | Ga0495681_0012687 | Ga0495681_0012687_1115_2617 | 496 |
| 447 | 3300048903 | Ga0496100_0100928 | Ga0496100_0100928_369_1865 | 496 |
| 448 | 3300048924 | Ga0496121_0062474 | Ga0496121_0062474_1315_2811 | 496 |
| 449 | 3300048927 | Ga0496124_0139370 | Ga0496124_0139370_253_1749 | 496 |
| 450 | 3300053091 | Ga0500647_0041146 | Ga0500647_0041146_492_1994 | 496 |
| 451 | 3300053094 | Ga0500566_0000020 | Ga0500566_0000020_78860_80362 | 496 |
| 452 | 3300053095 | Ga0500640_018256 | Ga0500640_018256_365_1867 | 496 |
| 453 | 3300053111 | Ga0500572_001222 | Ga0500572_001222_3736_5238 | 496 |
| 454 | 3300053122 | Ga0500608_023436 | Ga0500608_023436_620_2122 | 496 |
| 455 | 3300053136 | Ga0500559_0014071 | Ga0500559_0014071_492_1994 | 496 |
| 456 | 3300053150 | Ga0500603_000105 | Ga0500603_000105_16398_17900 | 496 |
| 457 | 3300053159 | Ga0500630_003888 | Ga0500630_003888_1983_3485 | 496 |
| 458 | 3300053161 | Ga0500634_0011768 | Ga0500634_0011768_2432_3931 | 496 |
| 459 | 3300053162 | Ga0500638_022688 | Ga0500638_022688_247_1749 | 496 |
| 460 | 3300053163 | Ga0500639_000066 | Ga0500639_000066_23672_25174 | 496 |
| 461 | iso_pu_bacteria | 2857542790 | 2857543136 | 496 |
| 462 | 3300003215 | JGI25153J46596_10022212 | JGI25153J46596_100222122 | 497 |
| 463 | 3300005458 | Ga0070681_10015109 | Ga0070681_100151093 | 497 |
| 464 | 3300005563 | Ga0068855_100072497 | Ga0068855_1000724974 | 497 |
| 465 | 3300006931 | Ga0097620_100099933 | Ga0097620_1000999332 | 497 |
| 466 | 3300009093 | Ga0105240_10202906 | Ga0105240_102029062 | 497 |
| 467 | 3300013296 | Ga0157374_10127121 | Ga0157374_101271211 | 497 |
| 468 | 3300025899 | Ga0207642_10035148 | Ga0207642_100351481 | 497 |
| 469 | 3300026041 | Ga0207639_10005655 | Ga0207639_100056555 | 497 |
| 470 | 3300026116 | Ga0207674_10095176 | Ga0207674_100951762 | 497 |
| 471 | 3300039450 | Ga0436363_1600596 | Ga0436363_1600596_5345_6844 | 497 |
| 472 | 3300048924 | Ga0496121_0137652 | Ga0496121_0137652_257_1756 | 497 |
| 473 | 3300053111 | Ga0500572_001274 | Ga0500572_001274_2799_4298 | 497 |
| 474 | 3300053136 | Ga0500559_0000491 | Ga0500559_0000491_24646_26145 | 497 |
| 475 | iso_pu_bacteria | 8019638758 | 8019643750 | 497 |
| 476 | 3300003659 | JGI25404J52841_10001451 | JGI25404J52841_100014512 | 498 |
| 477 | 3300005843 | Ga0068860_100006537 | Ga0068860_1000065372 | 498 |
| 478 | 3300005983 | Ga0081540_1001469 | Ga0081540_100146917 | 498 |
| 479 | 3300005983 | Ga0081540_1018187 | Ga0081540_10181873 | 498 |
| 480 | 3300009101 | Ga0105247_10005003 | Ga0105247_100050036 | 498 |
| 481 | 3300009545 | Ga0105237_10056348 | Ga0105237_100563482 | 498 |
| 482 | 3300009545 | Ga0105237_10207059 | Ga0105237_102070592 | 498 |
| 483 | 3300025900 | Ga0207710_10004687 | Ga0207710_100046872 | 498 |
| 484 | 3300028381 | Ga0268264_10000035 | Ga0268264_10000035220 | 498 |
| 485 | 3300031507 | Ga0307509_10084622 | Ga0307509_100846224 | 498 |
| 486 | 3300031730 | Ga0307516_10000729 | Ga0307516_100007292 | 498 |
| 487 | 3300035695 | Ga0373927_0053204 | Ga0373927_0053204_176_1681 | 498 |
| 488 | 3300036712 | Ga0316584_0069602 | Ga0316584_0069602_245_1753 | 498 |
| 489 | 3300037068 | Ga0373925_0009786 | Ga0373925_0009786_1995_3500 | 498 |
| 490 | 3300039438 | Ga0436360_1252590 | Ga0436360_1252590_11_1519 | 498 |
| 491 | 3300046454 | Ga0495592_0014889 | Ga0495592_0014889_498_2006 | 498 |
| 492 | 3300046515 | Ga0495620_0001070 | Ga0495620_0001070_4017_5519 | 498 |
| 493 | 3300046518 | Ga0495631_0000005 | Ga0495631_0000005_28292_29794 | 498 |
| 494 | 3300046694 | Ga0495649_0023084 | Ga0495649_0023084_989_2494 | 498 |
| 495 | 3300047319 | Ga0495674_0004930 | Ga0495674_0004930_4880_6448 | 498 |
| 496 | 3300047443 | Ga0495687_000020 | Ga0495687_000020_85429_86934 | 498 |
| 497 | 3300047444 | Ga0495675_0034624 | Ga0495675_0034624_28_1533 | 498 |
| 498 | 3300047469 | Ga0495673_0005620 | Ga0495673_0005620_2628_4130 | 498 |
| 499 | 3300048919 | Ga0496116_0086953 | Ga0496116_0086953_292_1797 | 498 |
| 500 | 3300048921 | Ga0496118_0001822 | Ga0496118_0001822_2660_4165 | 498 |
| 501 | 3300048924 | Ga0496121_0001443 | Ga0496121_0001443_28863_30368 | 498 |
| 502 | 3300048927 | Ga0496124_0008790 | Ga0496124_0008790_3432_4937 | 498 |
| 503 | 3300048929 | Ga0496126_0006684 | Ga0496126_0006684_8204_9709 | 498 |
| 504 | 3300049568 | Ga0501031_0004352 | Ga0501031_0004352_6088_7590 | 498 |
| 505 | 3300049568 | Ga0501031_0008031 | Ga0501031_0008031_1815_3317 | 498 |
| 506 | 3300049569 | Ga0501032_0000120 | Ga0501032_0000120_23333_24835 | 498 |
| 507 | 3300049569 | Ga0501032_0000224 | Ga0501032_0000224_29385_30887 | 498 |
| 508 | 3300049570 | Ga0501033_0000095 | Ga0501033_0000095_25896_27398 | 498 |
| 509 | 3300049570 | Ga0501033_0002325 | Ga0501033_0002325_2168_3670 | 498 |
| 510 | 3300049571 | Ga0501034_0000061 | Ga0501034_0000061_80862_82364 | 498 |
| 511 | 3300049571 | Ga0501034_0001606 | Ga0501034_0001606_21685_23187 | 498 |
| 512 | 3300049572 | Ga0501036_0000007 | Ga0501036_0000007_66197_67699 | 498 |
| 513 | 3300049572 | Ga0501036_0000054 | Ga0501036_0000054_23784_25286 | 498 |
| 514 | 3300049573 | Ga0501037_0000093 | Ga0501037_0000093_23424_24926 | 498 |
| 515 | 3300049573 | Ga0501037_0000159 | Ga0501037_0000159_29288_30790 | 498 |
| 516 | 3300049574 | Ga0501038_0000028 | Ga0501038_0000028_32779_34281 | 498 |
| 517 | 3300049574 | Ga0501038_0000066 | Ga0501038_0000066_12303_13805 | 498 |
| 518 | 3300049575 | Ga0501039_0000005 | Ga0501039_0000005_184492_185994 | 498 |
| 519 | 3300049575 | Ga0501039_0000142 | Ga0501039_0000142_41527_43029 | 498 |
| 520 | 3300049579 | Ga0501043_0000127 | Ga0501043_0000127_28266_29768 | 498 |
| 521 | 3300049579 | Ga0501043_0027793 | Ga0501043_0027793_833_2335 | 498 |
| 522 | 3300049580 | Ga0501046_0000032 | Ga0501046_0000032_109030_110532 | 498 |
| 523 | 3300049580 | Ga0501046_0000487 | Ga0501046_0000487_26603_28105 | 498 |
| 524 | 3300049581 | Ga0501047_0000077 | Ga0501047_0000077_66089_67591 | 498 |
| 525 | 3300049581 | Ga0501047_0000122 | Ga0501047_0000122_74629_76131 | 498 |
| 526 | 3300049582 | Ga0501048_0000053 | Ga0501048_0000053_38574_40076 | 498 |
| 527 | 3300049582 | Ga0501048_0000693 | Ga0501048_0000693_21844_23346 | 498 |
| 528 | 3300049583 | Ga0501067_0000387 | Ga0501067_0000387_12987_14489 | 498 |
| 529 | 3300049583 | Ga0501067_0002215 | Ga0501067_0002215_7996_9498 | 498 |
| 530 | 3300049584 | Ga0501068_0000392 | Ga0501068_0000392_17923_19425 | 498 |
| 531 | 3300049584 | Ga0501068_0007764 | Ga0501068_0007764_551_2053 | 498 |
| 532 | 3300049585 | Ga0501069_0003878 | Ga0501069_0003878_5924_7426 | 498 |
| 533 | 3300049585 | Ga0501069_0006700 | Ga0501069_0006700_3822_5324 | 498 |
| 534 | 3300049586 | Ga0501070_0000070 | Ga0501070_0000070_9361_10863 | 498 |
| 535 | 3300049586 | Ga0501070_0001577 | Ga0501070_0001577_3350_4852 | 498 |
| 536 | 3300049588 | Ga0501072_0002094 | Ga0501072_0002094_4448_5950 | 498 |
| 537 | 3300049589 | Ga0501073_0000146 | Ga0501073_0000146_17506_19008 | 498 |
| 538 | 3300049589 | Ga0501073_0004857 | Ga0501073_0004857_2891_4393 | 498 |
| 539 | 3300049590 | Ga0501074_0000712 | Ga0501074_0000712_17332_18834 | 498 |
| 540 | 3300049741 | Ga0501079_0010566 | Ga0501079_0010566_546_2048 | 498 |
| 541 | 3300049741 | Ga0501079_0027146 | Ga0501079_0027146_1676_3178 | 498 |
| 542 | 3300049742 | Ga0501080_0000035 | Ga0501080_0000035_25073_26575 | 498 |
| 543 | 3300049742 | Ga0501080_0001268 | Ga0501080_0001268_2918_4420 | 498 |
| 544 | 3300049744 | Ga0501083_0001199 | Ga0501083_0001199_3842_5344 | 498 |
| 545 | 3300049744 | Ga0501083_0065317 | Ga0501083_0065317_576_2078 | 498 |
| 546 | 3300049822 | Ga0501035_0000016 | Ga0501035_0000016_126475_127977 | 498 |
| 547 | 3300049822 | Ga0501035_0000099 | Ga0501035_0000099_59121_60623 | 498 |
| 548 | 3300049823 | Ga0501044_0000184 | Ga0501044_0000184_48032_49534 | 498 |
| 549 | 3300049823 | Ga0501044_0000195 | Ga0501044_0000195_16018_17520 | 498 |
| 550 | 3300049824 | Ga0501045_0062682 | Ga0501045_0062682_1079_2581 | 498 |
| 551 | 3300053080 | Ga0500635_0001533 | Ga0500635_0001533_3298_4803 | 498 |
| 552 | 3300053097 | Ga0500648_018307 | Ga0500648_018307_1835_3340 | 498 |
| 553 | 3300053136 | Ga0500559_0012987 | Ga0500559_0012987_1447_2952 | 498 |
| 554 | 3300053140 | Ga0500573_0039050 | Ga0500573_0039050_656_2161 | 498 |
| 555 | 3300053154 | Ga0500619_009306 | Ga0500619_009306_211_1716 | 498 |
| 556 | 3300053177 | Ga0500636_0072687 | Ga0500636_0072687_117_1622 | 498 |
| 557 | 3300053735 | Ga0500596_003119 | Ga0500596_003119_1028_2533 | 498 |
| 558 | 3300054114 | Ga0501084_0002556 | Ga0501084_0002556_3832_5334 | 498 |
| 559 | 3300060353 | Ga0501082_0001454 | Ga0501082_0001454_17881_19383 | 498 |
| 560 | iso_pu_bacteria | 2513237096 | 2513659274 | 498 |
| 561 | iso_pu_bacteria | 2513237137 | 2513862044 | 498 |
| 562 | iso_pu_bacteria | 2513237145 | 2513921464 | 498 |
| 563 | iso_pu_bacteria | 2517572143 | 2517893780 | 498 |
| 564 | iso_pu_bacteria | 2524023228 | 2524537729 | 498 |
| 565 | iso_pu_bacteria | 2667528175 | 2671124130 | 498 |
| 566 | iso_pu_bacteria | 2728368998 | 2728752925 | 498 |
| 567 | iso_pu_bacteria | 2791355197 | 2793070719 | 498 |
| 568 | iso_pu_bacteria | 2885374607 | 2885376276 | 498 |
| 569 | iso_pu_bacteria | 2903748898 | 2903752935 | 498 |
| 570 | iso_pu_bacteria | 2904690495 | 2904691551 | 498 |
| 571 | iso_pu_bacteria | 2904699407 | 2904705049 | 498 |
| 572 | iso_pu_bacteria | 2906610324 | 2906610666 | 498 |
| 573 | iso_pu_bacteria | 2906635258 | 2906641227 | 498 |
| 574 | iso_pu_bacteria | 2906660503 | 2906665157 | 498 |
| 575 | iso_pu_bacteria | 2908739725 | 2908744189 | 498 |
| 576 | iso_pu_bacteria | 2908756301 | 2908761637 | 498 |
| 577 | iso_pu_bacteria | 2922425934 | 2922428658 | 498 |
| 578 | iso_pu_bacteria | 2935630451 | 2935634629 | 498 |
| 579 | iso_pu_bacteria | 2941507105 | 2941509115 | 498 |
| 580 | iso_pu_bacteria | 2941515067 | 2941516944 | 498 |
| 581 | iso_pu_bacteria | 2941523033 | 2941524961 | 498 |
| 582 | iso_pu_bacteria | 3005474847 | 3005478789 | 498 |
| 583 | iso_pu_bacteria | 8006933436 | 8006942554 | 498 |
| 584 | iso_pu_bacteria | 8006973647 | 8006982278 | 498 |
| 585 | iso_pu_bacteria | 8019555841 | 8019558321 | 498 |
| 586 | iso_pu_bacteria | 8019565922 | 8019566972 | 498 |
| 587 | iso_pu_bacteria | 8056689827 | 8056695943 | 498 |
| 588 | 3300003215 | JGI25153J46596_10001707 | JGI25153J46596_100017073 | 499 |
| 589 | 3300003215 | JGI25153J46596_10004084 | JGI25153J46596_100040842 | 499 |
| 590 | 3300003215 | JGI25153J46596_10010236 | JGI25153J46596_100102362 | 499 |
| 591 | 3300003354 | JGI25160J50197_1002568 | JGI25160J50197_10025686 | 499 |
| 592 | 3300003354 | JGI25160J50197_1004939 | JGI25160J50197_10049392 | 499 |
| 593 | 3300003354 | JGI25160J50197_1008493 | JGI25160J50197_10084933 | 499 |
| 594 | 3300003794 | Ga0055531_10002184 | Ga0055531_100021848 | 499 |
| 595 | 3300005262 | Ga0065165_1002008 | Ga0065165_10020081 | 499 |
| 596 | 3300005262 | Ga0065165_1007524 | Ga0065165_10075242 | 499 |
| 597 | 3300005344 | Ga0070661_100078355 | Ga0070661_1000783551 | 499 |
| 598 | 3300005347 | Ga0070668_100074431 | Ga0070668_1000744312 | 499 |
| 599 | 3300005355 | Ga0070671_100105789 | Ga0070671_1001057892 | 499 |
| 600 | 3300005455 | Ga0070663_100087085 | Ga0070663_1000870852 | 499 |
| 601 | 3300005563 | Ga0068855_100307245 | Ga0068855_1003072451 | 499 |
| 602 | 3300005843 | Ga0068860_100201716 | Ga0068860_1002017162 | 499 |
| 603 | 3300005983 | Ga0081540_1009440 | Ga0081540_10094403 | 499 |
| 604 | 3300006038 | Ga0075365_10064309 | Ga0075365_100643092 | 499 |
| 605 | 3300006058 | Ga0075432_10006827 | Ga0075432_100068272 | 499 |
| 606 | 3300006178 | Ga0075367_10015961 | Ga0075367_100159612 | 499 |
| 607 | 3300006942 | Ga0099824_1029633 | Ga0099824_10296332 | 499 |
| 608 | 3300009174 | Ga0105241_10168389 | Ga0105241_101683892 | 499 |
| 609 | 3300009176 | Ga0105242_10065668 | Ga0105242_100656682 | 499 |
| 610 | 3300009545 | Ga0105237_10004145 | Ga0105237_100041452 | 499 |
| 611 | 3300011119 | Ga0105246_10014246 | Ga0105246_100142463 | 499 |
| 612 | 3300013306 | Ga0163162_10013993 | Ga0163162_100139934 | 499 |
| 613 | 3300021320 | Ga0214544_1000006 | Ga0214544_1000006356 | 499 |
| 614 | 3300021321 | Ga0214542_1000002 | Ga0214542_100000218 | 499 |
| 615 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002701 | 499 |
| 616 | 3300021327 | Ga0214543_1000017 | Ga0214543_1000017304 | 499 |
| 617 | 3300025253 | Ga0209677_108937 | Ga0209677_1089371 | 499 |
| 618 | 3300025254 | Ga0209148_1000447 | Ga0209148_100044728 | 499 |
| 619 | 3300025261 | Ga0209233_1016891 | Ga0209233_10168911 | 499 |
| 620 | 3300025272 | Ga0209455_1002262 | Ga0209455_10022623 | 499 |
| 621 | 3300025295 | Ga0209564_1023837 | Ga0209564_10238371 | 499 |
| 622 | 3300025297 | Ga0209758_1000065 | Ga0209758_100006579 | 499 |
| 623 | 3300025297 | Ga0209758_1002429 | Ga0209758_10024294 | 499 |
| 624 | 3300025297 | Ga0209758_1002745 | Ga0209758_100274513 | 499 |
| 625 | 3300025297 | Ga0209758_1003044 | Ga0209758_10030442 | 499 |
| 626 | 3300025297 | Ga0209758_1003360 | Ga0209758_10033609 | 499 |
| 627 | 3300025299 | Ga0209256_1004971 | Ga0209256_10049714 | 499 |
| 628 | 3300025302 | Ga0207426_1000561 | Ga0207426_100056124 | 499 |
| 629 | 3300025302 | Ga0207426_1009233 | Ga0207426_10092333 | 499 |
| 630 | 3300025302 | Ga0207426_1020261 | Ga0207426_10202612 | 499 |
| 631 | 3300025304 | Ga0209257_1000833 | Ga0209257_100083311 | 499 |
| 632 | 3300025304 | Ga0209257_1018232 | Ga0209257_10182322 | 499 |
| 633 | 3300025904 | Ga0207647_10013488 | Ga0207647_100134882 | 499 |
| 634 | 3300025913 | Ga0207695_10000029 | Ga0207695_1000002933 | 499 |
| 635 | 3300025914 | Ga0207671_10096792 | Ga0207671_100967922 | 499 |
| 636 | 3300025972 | Ga0207668_10061040 | Ga0207668_100610402 | 499 |
| 637 | 3300026142 | Ga0207698_10076642 | Ga0207698_100766422 | 499 |
| 638 | 3300027296 | Ga0209389_1000025 | Ga0209389_100002552 | 499 |
| 639 | 3300027357 | Ga0209589_1000066 | Ga0209589_10000661 | 499 |
| 640 | 3300027361 | Ga0209489_100030 | Ga0209489_100030111 | 499 |
| 641 | 3300037471 | Ga0395905_0034838 | Ga0395905_0034838_365_1870 | 499 |
| 642 | 3300039438 | Ga0436360_1087539 | Ga0436360_1087539_887_2389 | 499 |
| 643 | 3300039438 | Ga0436360_1198791 | Ga0436360_1198791_102_1604 | 499 |
| 644 | 3300044658 | Ga0466972_0000174 | Ga0466972_0000174_9360_10865 | 499 |
| 645 | 3300044684 | Ga0466966_0000148 | Ga0466966_0000148_26114_27619 | 499 |
| 646 | 3300044693 | Ga0466961_0000045 | Ga0466961_0000045_57456_58961 | 499 |
| 647 | 3300044694 | Ga0466963_0012884 | Ga0466963_0012884_3559_5064 | 499 |
| 648 | 3300044706 | Ga0466964_0009932 | Ga0466964_0009932_204_1709 | 499 |
| 649 | 3300044842 | Ga0466957_0036720 | Ga0466957_0036720_793_2298 | 499 |
| 650 | 3300045049 | Ga0466959_0006449 | Ga0466959_0006449_6201_7706 | 499 |
| 651 | 3300045976 | Ga0466967_0020296 | Ga0466967_0020296_378_1883 | 499 |
| 652 | 3300046452 | Ga0495617_002315 | Ga0495617_002315_4237_5742 | 499 |
| 653 | 3300046455 | Ga0495603_0004160 | Ga0495603_0004160_5343_6848 | 499 |
| 654 | 3300046460 | Ga0495638_0026634 | Ga0495638_0026634_1300_2805 | 499 |
| 655 | 3300046462 | Ga0495651_0000472 | Ga0495651_0000472_24482_25987 | 499 |
| 656 | 3300046463 | Ga0495653_0134992 | Ga0495653_0134992_207_1712 | 499 |
| 657 | 3300046474 | Ga0495605_0004425 | Ga0495605_0004425_2905_4410 | 499 |
| 658 | 3300046491 | Ga0495584_0001183 | Ga0495584_0001183_12725_14230 | 499 |
| 659 | 3300046492 | Ga0495585_0006478 | Ga0495585_0006478_3796_5301 | 499 |
| 660 | 3300046501 | Ga0495607_0010017 | Ga0495607_0010017_1842_3347 | 499 |
| 661 | 3300046506 | Ga0495583_0002399 | Ga0495583_0002399_3850_5355 | 499 |
| 662 | 3300046513 | Ga0495616_0004386 | Ga0495616_0004386_3500_5005 | 499 |
| 663 | 3300046520 | Ga0495637_0008501 | Ga0495637_0008501_1184_2689 | 499 |
| 664 | 3300046522 | Ga0495643_0012522 | Ga0495643_0012522_3237_4742 | 499 |
| 665 | 3300046524 | Ga0495648_0006268 | Ga0495648_0006268_4524_6029 | 499 |
| 666 | 3300046529 | Ga0495652_0001339 | Ga0495652_0001339_25057_26562 | 499 |
| 667 | 3300046642 | Ga0495634_0049130 | Ga0495634_0049130_927_2432 | 499 |
| 668 | 3300046660 | Ga0495625_0100556 | Ga0495625_0100556_130_1635 | 499 |
| 669 | 3300046663 | Ga0495635_0060076 | Ga0495635_0060076_144_1649 | 499 |
| 670 | 3300046664 | Ga0495659_0023539 | Ga0495659_0023539_366_1871 | 499 |
| 671 | 3300046679 | Ga0495623_0004396 | Ga0495623_0004396_2658_4163 | 499 |
| 672 | 3300046684 | Ga0495669_0003449 | Ga0495669_0003449_1661_3166 | 499 |
| 673 | 3300046689 | Ga0495613_0063319 | Ga0495613_0063319_400_1905 | 499 |
| 674 | 3300046691 | Ga0495670_0002345 | Ga0495670_0002345_3898_5403 | 499 |
| 675 | 3300046692 | Ga0495671_0005579 | Ga0495671_0005579_1386_2891 | 499 |
| 676 | 3300046809 | Ga0495600_0009711 | Ga0495600_0009711_2117_3622 | 499 |
| 677 | 3300046810 | Ga0495660_0004041 | Ga0495660_0004041_3796_5301 | 499 |
| 678 | 3300047317 | Ga0495604_0000953 | Ga0495604_0000953_21035_22540 | 499 |
| 679 | 3300047319 | Ga0495674_0008322 | Ga0495674_0008322_7087_8592 | 499 |
| 680 | 3300047320 | Ga0495672_0006289 | Ga0495672_0006289_3942_5447 | 499 |
| 681 | 3300047322 | Ga0495680_0001642 | Ga0495680_0001642_11723_13228 | 499 |
| 682 | 3300047323 | Ga0495683_0051951 | Ga0495683_0051951_388_1893 | 499 |
| 683 | 3300047443 | Ga0495687_005443 | Ga0495687_005443_3052_4557 | 499 |
| 684 | 3300047469 | Ga0495673_0004250 | Ga0495673_0004250_3688_5193 | 499 |
| 685 | 3300048905 | Ga0496102_0026901 | Ga0496102_0026901_1732_3237 | 499 |
| 686 | 3300048907 | Ga0496104_0102549 | Ga0496104_0102549_651_2156 | 499 |
| 687 | 3300048912 | Ga0496109_0173713 | Ga0496109_0173713_184_1689 | 499 |
| 688 | 3300048924 | Ga0496121_0051892 | Ga0496121_0051892_1736_3241 | 499 |
| 689 | 3300048928 | Ga0496125_0026278 | Ga0496125_0026278_268_1773 | 499 |
| 690 | 3300048928 | Ga0496125_0053908 | Ga0496125_0053908_1365_2870 | 499 |
| 691 | 3300049460 | Ga0495682_0001908 | Ga0495682_0001908_5086_6591 | 499 |
| 692 | 3300049569 | Ga0501032_0100119 | Ga0501032_0100119_115_1620 | 499 |
| 693 | 3300049570 | Ga0501033_0092037 | Ga0501033_0092037_56_1561 | 499 |
| 694 | 3300049572 | Ga0501036_0147425 | Ga0501036_0147425_188_1693 | 499 |
| 695 | 3300049581 | Ga0501047_0093430 | Ga0501047_0093430_1275_2780 | 499 |
| 696 | 3300049822 | Ga0501035_0096382 | Ga0501035_0096382_827_2332 | 499 |
| 697 | 3300049823 | Ga0501044_0003221 | Ga0501044_0003221_3294_4799 | 499 |
| 698 | 3300050492 | nmdc:mga0yw44_39673_c1 | nmdc:mga0yw44_39673_c1_156_1661 | 499 |
| 699 | 3300050493 | nmdc:mga0k408_22951_c1 | nmdc:mga0k408_22951_c1_965_2470 | 499 |
| 700 | 3300050494 | nmdc:mga06z11_44277_c1 | nmdc:mga06z11_44277_c1_51_1556 | 499 |
| 701 | 3300050496 | nmdc:mga07m45_92356_c1 | nmdc:mga07m45_92356_c1_50_1555 | 499 |
| 702 | 3300053079 | Ga0500610_0056565 | Ga0500610_0056565_46_1551 | 499 |
| 703 | 3300053094 | Ga0500566_0000693 | Ga0500566_0000693_8261_9766 | 499 |
| 704 | 3300053094 | Ga0500566_0087109 | Ga0500566_0087109_68_1573 | 499 |
| 705 | 3300053105 | Ga0500557_000093 | Ga0500557_000093_28598_30103 | 499 |
| 706 | 3300053130 | Ga0500642_0000096 | Ga0500642_0000096_17950_19455 | 499 |
| 707 | 3300053156 | Ga0500622_0026034 | Ga0500622_0026034_158_1663 | 499 |
| 708 | 3300053177 | Ga0500636_0000645 | Ga0500636_0000645_215_1720 | 499 |
| 709 | 3300053729 | Ga0500625_034445 | Ga0500625_034445_739_2244 | 499 |
| 710 | 3300053737 | Ga0500601_000120 | Ga0500601_000120_82_1587 | 499 |
| 711 | iso_pu_bacteria | 2508501128 | 2509147616 | 499 |
| 712 | iso_pu_bacteria | 2513237098 | 2513676373 | 499 |
| 713 | iso_pu_bacteria | 2524023210 | 2524470282 | 499 |
| 714 | iso_pu_bacteria | 2602042107 | 2603861112 | 499 |
| 715 | iso_pu_bacteria | 2857524615 | 2857528760 | 499 |
| 716 | iso_pu_bacteria | 2885383462 | 2885388009 | 499 |
| 717 | iso_pu_bacteria | 2889914905 | 2889915116 | 499 |
| 718 | iso_pu_bacteria | 2893066018 | 2893068955 | 499 |
| 719 | iso_pu_bacteria | 2903768456 | 2903775953 | 499 |
| 720 | iso_pu_bacteria | 2919073203 | 2919079188 | 499 |
| 721 | iso_pu_bacteria | 8056681323 | 8056688398 | 499 |
| 722 | 3300005564 | Ga0070664_100003458 | Ga0070664_1000034589 | 500 |
| 723 | 3300005614 | Ga0068856_100099568 | Ga0068856_1000995681 | 500 |
| 724 | 3300013307 | Ga0157372_10184605 | Ga0157372_101846052 | 500 |
| 725 | 3300037466 | Ga0395898_0019758 | Ga0395898_0019758_3109_4617 | 500 |
| 726 | 3300038443 | Ga0395901_0065415 | Ga0395901_0065415_2012_3520 | 500 |
| 727 | 3300048905 | Ga0496102_0006702 | Ga0496102_0006702_3300_4853 | 500 |
| 728 | iso_pu_bacteria | 2791355199 | 2793083275 | 500 |
| 729 | iso_pu_bacteria | 8056673599 | 8056680294 | 500 |
| 730 | 3300028573 | Ga0265334_10000799 | Ga0265334_100007992 | 501 |
| 731 | 3300028654 | Ga0265322_10016431 | Ga0265322_100164312 | 501 |
| 732 | 3300028666 | Ga0265336_10000233 | Ga0265336_1000023310 | 501 |
| 733 | 3300028800 | Ga0265338_10000090 | Ga0265338_1000009027 | 501 |
| 734 | 3300037312 | Ga0395899_0007418 | Ga0395899_0007418_1534_3102 | 501 |
| 735 | 3300037418 | Ga0395900_0000389 | Ga0395900_0000389_35517_37085 | 501 |
| 736 | 3300037466 | Ga0395898_0000866 | Ga0395898_0000866_40302_41870 | 501 |
| 737 | 3300038443 | Ga0395901_0000164 | Ga0395901_0000164_54484_56052 | 501 |
| 738 | iso_pu_bacteria | 2922386360 | 2922388107 | 501 |
| 739 | iso_pu_bacteria | 2937843397 | 2937843660 | 501 |
| 740 | 3300005336 | Ga0070680_100046107 | Ga0070680_1000461072 | 502 |
| 741 | 3300005458 | Ga0070681_10034264 | Ga0070681_100342642 | 502 |
| 742 | 3300005530 | Ga0070679_100042340 | Ga0070679_1000423402 | 502 |
| 743 | 3300006942 | Ga0099824_1013886 | Ga0099824_10138866 | 502 |
| 744 | 3300006943 | Ga0099822_1020952 | Ga0099822_10209525 | 502 |
| 745 | 3300009093 | Ga0105240_10067855 | Ga0105240_100678552 | 502 |
| 746 | 3300013105 | Ga0157369_10003596 | Ga0157369_100035967 | 502 |
| 747 | 3300013105 | Ga0157369_10082983 | Ga0157369_100829832 | 502 |
| 748 | 3300025912 | Ga0207707_10000651 | Ga0207707_100006517 | 502 |
| 749 | 3300025917 | Ga0207660_10022691 | Ga0207660_100226913 | 502 |
| 750 | 3300025921 | Ga0207652_10049932 | Ga0207652_100499322 | 502 |
| 751 | 3300025924 | Ga0207694_10091407 | Ga0207694_100914072 | 502 |
| 752 | 3300025949 | Ga0207667_10124233 | Ga0207667_101242332 | 502 |
| 753 | 3300027357 | Ga0209589_1000009 | Ga0209589_1000009244 | 502 |
| 754 | 3300027361 | Ga0209489_100010 | Ga0209489_10001026 | 502 |
| 755 | 3300027363 | Ga0209700_100017 | Ga0209700_10001726 | 502 |
| 756 | 3300028794 | Ga0307515_10055923 | Ga0307515_100559232 | 502 |
| 757 | 3300035116 | Ga0373945_0003375 | Ga0373945_0003375_3484_5004 | 502 |
| 758 | 3300037068 | Ga0373925_0055739 | Ga0373925_0055739_697_2217 | 502 |
| 759 | 3300037466 | Ga0395898_0029402 | Ga0395898_0029402_1004_2524 | 502 |
| 760 | 3300038443 | Ga0395901_0049817 | Ga0395901_0049817_2507_4027 | 502 |
| 761 | 3300046477 | Ga0495664_0034625 | Ga0495664_0034625_309_1829 | 502 |
| 762 | 3300047470 | Ga0495681_0000009 | Ga0495681_0000009_5764_7314 | 502 |
| 763 | 3300049823 | Ga0501044_0172289 | Ga0501044_0172289_123_1649 | 502 |
| 764 | iso_pu_bacteria | 2876808645 | 2876811727 | 502 |
| 765 | iso_pu_bacteria | 2879110137 | 2879118789 | 502 |
| 766 | iso_pu_bacteria | 2889033259 | 2889039179 | 502 |
| 767 | iso_pu_bacteria | 8006984368 | 8006991945 | 502 |
| 768 | 3300005329 | Ga0070683_100049783 | Ga0070683_1000497832 | 503 |
| 769 | 3300005336 | Ga0070680_100058029 | Ga0070680_1000580292 | 503 |
| 770 | 3300005434 | Ga0070709_10067655 | Ga0070709_100676552 | 503 |
| 771 | 3300005436 | Ga0070713_100002066 | Ga0070713_1000020669 | 503 |
| 772 | 3300005439 | Ga0070711_100005920 | Ga0070711_1000059203 | 503 |
| 773 | 3300005535 | Ga0070684_100035959 | Ga0070684_1000359592 | 503 |
| 774 | 3300005563 | Ga0068855_100028293 | Ga0068855_1000282933 | 503 |
| 775 | 3300005983 | Ga0081540_1001357 | Ga0081540_10013573 | 503 |
| 776 | 3300005983 | Ga0081540_1001498 | Ga0081540_100149821 | 503 |
| 777 | 3300006028 | Ga0070717_10029723 | Ga0070717_100297232 | 503 |
| 778 | 3300006048 | Ga0075363_100086644 | Ga0075363_1000866441 | 503 |
| 779 | 3300006051 | Ga0075364_10063952 | Ga0075364_100639522 | 503 |
| 780 | 3300006175 | Ga0070712_100014857 | Ga0070712_1000148574 | 503 |
| 781 | 3300006175 | Ga0070712_100105048 | Ga0070712_1001050482 | 503 |
| 782 | 3300009545 | Ga0105237_10128168 | Ga0105237_101281682 | 503 |
| 783 | 3300009551 | Ga0105238_10135032 | Ga0105238_101350322 | 503 |
| 784 | 3300013296 | Ga0157374_10044291 | Ga0157374_100442912 | 503 |
| 785 | 3300014326 | Ga0157380_10180902 | Ga0157380_101809021 | 503 |
| 786 | 3300021384 | Ga0213876_10046688 | Ga0213876_100466882 | 503 |
| 787 | 3300025295 | Ga0209564_1000297 | Ga0209564_100029730 | 503 |
| 788 | 3300025295 | Ga0209564_1007203 | Ga0209564_10072032 | 503 |
| 789 | 3300025914 | Ga0207671_10091726 | Ga0207671_100917261 | 503 |
| 790 | 3300025915 | Ga0207693_10014710 | Ga0207693_100147102 | 503 |
| 791 | 3300025915 | Ga0207693_10101873 | Ga0207693_101018731 | 503 |
| 792 | 3300025916 | Ga0207663_10036415 | Ga0207663_100364152 | 503 |
| 793 | 3300025924 | Ga0207694_10124154 | Ga0207694_101241542 | 503 |
| 794 | 3300025929 | Ga0207664_10013136 | Ga0207664_100131363 | 503 |
| 795 | 3300025929 | Ga0207664_10082346 | Ga0207664_100823462 | 503 |
| 796 | 3300025944 | Ga0207661_10005660 | Ga0207661_100056602 | 503 |
| 797 | 3300025944 | Ga0207661_10052910 | Ga0207661_100529102 | 503 |
| 798 | 3300031247 | Ga0265340_10001013 | Ga0265340_1000101311 | 503 |
| 799 | 3300031250 | Ga0265331_10015572 | Ga0265331_100155722 | 503 |
| 800 | 3300031616 | Ga0307508_10000532 | Ga0307508_1000053214 | 503 |
| 801 | 3300031712 | Ga0265342_10021950 | Ga0265342_100219503 | 503 |
| 802 | 3300035089 | Ga0373944_0006585 | Ga0373944_0006585_628_2151 | 503 |
| 803 | 3300035113 | Ga0373936_0008646 | Ga0373936_0008646_1324_2847 | 503 |
| 804 | 3300035118 | Ga0373954_0002845 | Ga0373954_0002845_4665_6188 | 503 |
| 805 | 3300035118 | Ga0373954_0012478 | Ga0373954_0012478_1895_3418 | 503 |
| 806 | 3300035119 | Ga0373956_0003275 | Ga0373956_0003275_4866_6389 | 503 |
| 807 | 3300035170 | Ga0373943_0004027 | Ga0373943_0004027_1683_3206 | 503 |
| 808 | 3300035171 | Ga0373946_0005405 | Ga0373946_0005405_864_2387 | 503 |
| 809 | 3300035172 | Ga0373955_0000447 | Ga0373955_0000447_5913_7436 | 503 |
| 810 | 3300035695 | Ga0373927_0016156 | Ga0373927_0016156_3209_4732 | 503 |
| 811 | 3300035695 | Ga0373927_0018206 | Ga0373927_0018206_2656_4179 | 503 |
| 812 | 3300035724 | Ga0373933_0000167 | Ga0373933_0000167_29016_30539 | 503 |
| 813 | 3300035724 | Ga0373933_0002005 | Ga0373933_0002005_9406_10929 | 503 |
| 814 | 3300035725 | Ga0373947_0027440 | Ga0373947_0027440_356_1879 | 503 |
| 815 | 3300039437 | Ga0436365_1888691 | Ga0436365_1888691_827_2350 | 503 |
| 816 | 3300045836 | Ga0466958_0076522 | Ga0466958_0076522_447_1970 | 503 |
| 817 | 3300046454 | Ga0495592_0001539 | Ga0495592_0001539_10204_11727 | 503 |
| 818 | 3300046459 | Ga0495629_0001699 | Ga0495629_0001699_9024_10547 | 503 |
| 819 | 3300046460 | Ga0495638_0010390 | Ga0495638_0010390_4933_6456 | 503 |
| 820 | 3300046460 | Ga0495638_0077243 | Ga0495638_0077243_490_2013 | 503 |
| 821 | 3300046463 | Ga0495653_0011183 | Ga0495653_0011183_636_2159 | 503 |
| 822 | 3300046472 | Ga0495580_0053004 | Ga0495580_0053004_41_1564 | 503 |
| 823 | 3300046511 | Ga0495608_0002196 | Ga0495608_0002196_4766_6289 | 503 |
| 824 | 3300046512 | Ga0495610_0040644 | Ga0495610_0040644_15_1538 | 503 |
| 825 | 3300046514 | Ga0495618_0016659 | Ga0495618_0016659_1610_3133 | 503 |
| 826 | 3300046515 | Ga0495620_0015393 | Ga0495620_0015393_174_1697 | 503 |
| 827 | 3300046516 | Ga0495628_0031144 | Ga0495628_0031144_307_1830 | 503 |
| 828 | 3300046531 | Ga0495665_0012624 | Ga0495665_0012624_1275_2798 | 503 |
| 829 | 3300046533 | Ga0495640_0016526 | Ga0495640_0016526_1103_2626 | 503 |
| 830 | 3300046535 | Ga0495586_0021029 | Ga0495586_0021029_1737_3260 | 503 |
| 831 | 3300046536 | Ga0495587_0012034 | Ga0495587_0012034_813_2336 | 503 |
| 832 | 3300046543 | Ga0495645_0011172 | Ga0495645_0011172_3261_4784 | 503 |
| 833 | 3300046559 | Ga0495667_0001807 | Ga0495667_0001807_9428_10951 | 503 |
| 834 | 3300046559 | Ga0495667_0045297 | Ga0495667_0045297_1272_2795 | 503 |
| 835 | 3300046642 | Ga0495634_0016913 | Ga0495634_0016913_1001_2524 | 503 |
| 836 | 3300046663 | Ga0495635_0000989 | Ga0495635_0000989_2299_3822 | 503 |
| 837 | 3300046675 | Ga0495657_0001505 | Ga0495657_0001505_3833_5356 | 503 |
| 838 | 3300046679 | Ga0495623_0002081 | Ga0495623_0002081_4205_5728 | 503 |
| 839 | 3300046683 | Ga0495658_0009739 | Ga0495658_0009739_1518_3041 | 503 |
| 840 | 3300046689 | Ga0495613_0017612 | Ga0495613_0017612_1610_3133 | 503 |
| 841 | 3300046689 | Ga0495613_0029342 | Ga0495613_0029342_1447_2970 | 503 |
| 842 | 3300046809 | Ga0495600_0003220 | Ga0495600_0003220_5857_7380 | 503 |
| 843 | 3300047319 | Ga0495674_0019530 | Ga0495674_0019530_1907_3430 | 503 |
| 844 | 3300047319 | Ga0495674_0045274 | Ga0495674_0045274_752_2275 | 503 |
| 845 | 3300047322 | Ga0495680_0001893 | Ga0495680_0001893_1631_3154 | 503 |
| 846 | 3300047444 | Ga0495675_0004647 | Ga0495675_0004647_813_2336 | 503 |
| 847 | 3300047471 | Ga0495684_0001724 | Ga0495684_0001724_10572_12095 | 503 |
| 848 | 3300047472 | Ga0495686_0016459 | Ga0495686_0016459_2005_3528 | 503 |
| 849 | 3300048915 | Ga0496112_0279222 | Ga0496112_0279222_48_1571 | 503 |
| 850 | 3300048919 | Ga0496116_0003781 | Ga0496116_0003781_10465_11988 | 503 |
| 851 | 3300048920 | Ga0496117_0100286 | Ga0496117_0100286_68_1591 | 503 |
| 852 | 3300048921 | Ga0496118_0075119 | Ga0496118_0075119_439_1962 | 503 |
| 853 | 3300048924 | Ga0496121_0006578 | Ga0496121_0006578_11836_13359 | 503 |
| 854 | 3300048925 | Ga0496122_0025193 | Ga0496122_0025193_1446_2969 | 503 |
| 855 | 3300048925 | Ga0496122_0026336 | Ga0496122_0026336_1308_2831 | 503 |
| 856 | 3300048926 | Ga0496123_0020781 | Ga0496123_0020781_2857_4380 | 503 |
| 857 | 3300048926 | Ga0496123_0034230 | Ga0496123_0034230_414_1937 | 503 |
| 858 | 3300048928 | Ga0496125_0009813 | Ga0496125_0009813_291_1814 | 503 |
| 859 | 3300048929 | Ga0496126_0013694 | Ga0496126_0013694_347_1870 | 503 |
| 860 | 3300048929 | Ga0496126_0025148 | Ga0496126_0025148_833_2356 | 503 |
| 861 | 3300053085 | Ga0495619_0000394 | Ga0495619_0000394_20645_22168 | 503 |
| 862 | 3300053087 | Ga0500643_009059 | Ga0500643_009059_206_1729 | 503 |
| 863 | 3300053094 | Ga0500566_0004708 | Ga0500566_0004708_4503_6026 | 503 |
| 864 | 3300053098 | Ga0500650_0054909 | Ga0500650_0054909_175_1698 | 503 |
| 865 | 3300053104 | Ga0500556_0000024 | Ga0500556_0000024_63923_65446 | 503 |
| 866 | 3300053122 | Ga0500608_001404 | Ga0500608_001404_5987_7510 | 503 |
| 867 | 3300053130 | Ga0500642_0000035 | Ga0500642_0000035_72381_73904 | 503 |
| 868 | 3300053136 | Ga0500559_0000520 | Ga0500559_0000520_22049_23572 | 503 |
| 869 | 3300053139 | Ga0500568_0005882 | Ga0500568_0005882_2489_4012 | 503 |
| 870 | 3300053151 | Ga0500604_0029999 | Ga0500604_0029999_14_1537 | 503 |
| 871 | 3300053153 | Ga0500616_0000122 | Ga0500616_0000122_66744_68267 | 503 |
| 872 | 3300053156 | Ga0500622_0000790 | Ga0500622_0000790_17831_19354 | 503 |
| 873 | 3300053157 | Ga0500624_002474 | Ga0500624_002474_681_2204 | 503 |
| 874 | 3300053177 | Ga0500636_0003147 | Ga0500636_0003147_2414_3937 | 503 |
| 875 | iso_pu_bacteria | 2513237101 | 2513696088 | 503 |
| 876 | iso_pu_bacteria | 2721755755 | 2723846323 | 503 |
| 877 | iso_pu_bacteria | 2874604998 | 2874610709 | 503 |
| 878 | iso_pu_bacteria | 2922361189 | 2922362129 | 503 |
| 879 | iso_pu_bacteria | 8006964411 | 8006964704 | 503 |
| 880 | iso_pu_bacteria | 8006994254 | 8006999877 | 503 |
| 881 | 3300013297 | Ga0157378_10155219 | Ga0157378_101552192 | 504 |
| 882 | 3300048919 | Ga0496116_0059662 | Ga0496116_0059662_857_2389 | 504 |
| 883 | 3300048920 | Ga0496117_0034099 | Ga0496117_0034099_578_2110 | 504 |
| 884 | 3300048922 | Ga0496119_0006070 | Ga0496119_0006070_7886_9418 | 504 |
| 885 | 3300048924 | Ga0496121_0000508 | Ga0496121_0000508_8663_10195 | 504 |
| 886 | 3300048926 | Ga0496123_0052065 | Ga0496123_0052065_363_1895 | 504 |
| 887 | 3300048927 | Ga0496124_0037214 | Ga0496124_0037214_669_2201 | 504 |
| 888 | 3300048928 | Ga0496125_0002637 | Ga0496125_0002637_19391_20923 | 504 |
| 889 | 3300048929 | Ga0496126_0008250 | Ga0496126_0008250_9667_11199 | 504 |
| 890 | iso_pu_bacteria | 2941479691 | 2941484574 | 504 |
| 891 | 3300006028 | Ga0070717_10050429 | Ga0070717_100504293 | 505 |
| 892 | 3300026142 | Ga0207698_10188548 | Ga0207698_101885481 | 505 |
| 893 | 3300028786 | Ga0307517_10000062 | Ga0307517_1000006240 | 505 |
| 894 | 3300029957 | Ga0265324_10008187 | Ga0265324_100081872 | 505 |
| 895 | 3300046512 | Ga0495610_0060308 | Ga0495610_0060308_171_1700 | 505 |
| 896 | 3300005334 | Ga0068869_100129333 | Ga0068869_1001293332 | 506 |
| 897 | 3300005338 | Ga0068868_100038322 | Ga0068868_1000383222 | 506 |
| 898 | 3300005367 | Ga0070667_100108652 | Ga0070667_1001086522 | 506 |
| 899 | 3300005434 | Ga0070709_10005063 | Ga0070709_100050635 | 506 |
| 900 | 3300005435 | Ga0070714_100022534 | Ga0070714_1000225342 | 506 |
| 901 | 3300005436 | Ga0070713_100004489 | Ga0070713_1000044892 | 506 |
| 902 | 3300005437 | Ga0070710_10024959 | Ga0070710_100249592 | 506 |
| 903 | 3300005455 | Ga0070663_100015939 | Ga0070663_1000159393 | 506 |
| 904 | 3300005530 | Ga0070679_100031660 | Ga0070679_1000316603 | 506 |
| 905 | 3300005545 | Ga0070695_100068298 | Ga0070695_1000682982 | 506 |
| 906 | 3300005547 | Ga0070693_100028334 | Ga0070693_1000283342 | 506 |
| 907 | 3300005548 | Ga0070665_100006755 | Ga0070665_1000067556 | 506 |
| 908 | 3300005617 | Ga0068859_100141303 | Ga0068859_1001413032 | 506 |
| 909 | 3300006028 | Ga0070717_10008134 | Ga0070717_100081342 | 506 |
| 910 | 3300006038 | Ga0075365_10070545 | Ga0075365_100705452 | 506 |
| 911 | 3300006051 | Ga0075364_10122938 | Ga0075364_101229381 | 506 |
| 912 | 3300006173 | Ga0070716_100046089 | Ga0070716_1000460892 | 506 |
| 913 | 3300006178 | Ga0075367_10002487 | Ga0075367_100024871 | 506 |
| 914 | 3300006353 | Ga0075370_10013261 | Ga0075370_100132612 | 506 |
| 915 | 3300006931 | Ga0097620_100141293 | Ga0097620_1001412932 | 506 |
| 916 | 3300007076 | Ga0075435_100158514 | Ga0075435_1001585141 | 506 |
| 917 | 3300011119 | Ga0105246_10006170 | Ga0105246_100061702 | 506 |
| 918 | 3300013296 | Ga0157374_10004665 | Ga0157374_100046653 | 506 |
| 919 | 3300025898 | Ga0207692_10002707 | Ga0207692_100027073 | 506 |
| 920 | 3300025906 | Ga0207699_10002964 | Ga0207699_100029646 | 506 |
| 921 | 3300025911 | Ga0207654_10040566 | Ga0207654_100405661 | 506 |
| 922 | 3300025913 | Ga0207695_10118638 | Ga0207695_101186382 | 506 |
| 923 | 3300025914 | Ga0207671_10025690 | Ga0207671_100256902 | 506 |
| 924 | 3300025915 | Ga0207693_10002906 | Ga0207693_100029064 | 506 |
| 925 | 3300025916 | Ga0207663_10001131 | Ga0207663_100011317 | 506 |
| 926 | 3300025919 | Ga0207657_10166374 | Ga0207657_101663742 | 506 |
| 927 | 3300025921 | Ga0207652_10083886 | Ga0207652_100838861 | 506 |
| 928 | 3300025928 | Ga0207700_10030126 | Ga0207700_100301262 | 506 |
| 929 | 3300025929 | Ga0207664_10057524 | Ga0207664_100575242 | 506 |
| 930 | 3300025939 | Ga0207665_10000992 | Ga0207665_1000099212 | 506 |
| 931 | 3300025941 | Ga0207711_10230442 | Ga0207711_102304422 | 506 |
| 932 | 3300025949 | Ga0207667_10018352 | Ga0207667_100183526 | 506 |
| 933 | 3300026023 | Ga0207677_10042614 | Ga0207677_100426142 | 506 |
| 934 | 3300026035 | Ga0207703_10051198 | Ga0207703_100511982 | 506 |
| 935 | 3300026067 | Ga0207678_10009091 | Ga0207678_100090916 | 506 |
| 936 | 3300026118 | Ga0207675_100075226 | Ga0207675_1000752262 | 506 |
| 937 | 3300028379 | Ga0268266_10001147 | Ga0268266_1000114732 | 506 |
| 938 | 3300028379 | Ga0268266_10093105 | Ga0268266_100931052 | 506 |
| 939 | 3300033180 | Ga0307510_10026250 | Ga0307510_100262503 | 506 |
| 940 | 3300046455 | Ga0495603_0004383 | Ga0495603_0004383_4123_5655 | 506 |
| 941 | 3300046474 | Ga0495605_0042933 | Ga0495605_0042933_310_1842 | 506 |
| 942 | 3300046809 | Ga0495600_0028149 | Ga0495600_0028149_563_2095 | 506 |
| 943 | 3300048906 | Ga0496103_0105833 | Ga0496103_0105833_210_1742 | 506 |
| 944 | 3300048907 | Ga0496104_0004724 | Ga0496104_0004724_1761_3284 | 506 |
| 945 | 3300048909 | Ga0496106_0002433 | Ga0496106_0002433_2781_4304 | 506 |
| 946 | 3300048912 | Ga0496109_0162099 | Ga0496109_0162099_173_1705 | 506 |
| 947 | 3300048912 | Ga0496109_0203387 | Ga0496109_0203387_303_1835 | 506 |
| 948 | 3300048915 | Ga0496112_0011656 | Ga0496112_0011656_3998_5521 | 506 |
| 949 | 3300048916 | Ga0496113_0039842 | Ga0496113_0039842_584_2107 | 506 |
| 950 | 3300048922 | Ga0496119_0068261 | Ga0496119_0068261_374_1906 | 506 |
| 951 | 3300048929 | Ga0496126_0064742 | Ga0496126_0064742_668_2200 | 506 |
| 952 | 3300050490 | nmdc:mga03n38_31072_c1 | nmdc:mga03n38_31072_c1_595_2127 | 506 |
| 953 | 3300050491 | nmdc:mga00v17_63532_c1 | nmdc:mga00v17_63532_c1_95_1627 | 506 |
| 954 | 3300050492 | nmdc:mga0yw44_57800_c1 | nmdc:mga0yw44_57800_c1_324_1856 | 506 |
| 955 | 3300050494 | nmdc:mga06z11_1702_c1 | nmdc:mga06z11_1702_c1_745_2277 | 506 |
| 956 | 3300053119 | Ga0500595_000478 | Ga0500595_000478_2884_4410 | 506 |
| 957 | 3300053119 | Ga0500595_007973 | Ga0500595_007973_46_1578 | 506 |
| 958 | 3300053162 | Ga0500638_009264 | Ga0500638_009264_1235_2761 | 506 |
| 959 | 3300002077 | JGI24744J21845_10011354 | JGI24744J21845_100113542 | 507 |
| 960 | 3300003203 | JGI25406J46586_10000169 | JGI25406J46586_1000016926 | 507 |
| 961 | 3300003203 | JGI25406J46586_10000649 | JGI25406J46586_100006497 | 507 |
| 962 | 3300005329 | Ga0070683_100044792 | Ga0070683_1000447922 | 507 |
| 963 | 3300005336 | Ga0070680_100037772 | Ga0070680_1000377721 | 507 |
| 964 | 3300005338 | Ga0068868_100020908 | Ga0068868_1000209082 | 507 |
| 965 | 3300005353 | Ga0070669_100060185 | Ga0070669_1000601852 | 507 |
| 966 | 3300005356 | Ga0070674_100053339 | Ga0070674_1000533391 | 507 |
| 967 | 3300005455 | Ga0070663_100081614 | Ga0070663_1000816142 | 507 |
| 968 | 3300005456 | Ga0070678_100008476 | Ga0070678_1000084762 | 507 |
| 969 | 3300005456 | Ga0070678_100052451 | Ga0070678_1000524512 | 507 |
| 970 | 3300005535 | Ga0070684_100058437 | Ga0070684_1000584372 | 507 |
| 971 | 3300005536 | Ga0070697_100190378 | Ga0070697_1001903781 | 507 |
| 972 | 3300005539 | Ga0068853_100132821 | Ga0068853_1001328211 | 507 |
| 973 | 3300005577 | Ga0068857_100058949 | Ga0068857_1000589492 | 507 |
| 974 | 3300005719 | Ga0068861_100160396 | Ga0068861_1001603962 | 507 |
| 975 | 3300005834 | Ga0068851_10024448 | Ga0068851_100244483 | 507 |
| 976 | 3300005843 | Ga0068860_100085166 | Ga0068860_1000851662 | 507 |
| 977 | 3300005844 | Ga0068862_100055462 | Ga0068862_1000554622 | 507 |
| 978 | 3300005985 | Ga0081539_10000255 | Ga0081539_1000025537 | 507 |
| 979 | 3300006038 | Ga0075365_10044251 | Ga0075365_100442512 | 507 |
| 980 | 3300006186 | Ga0075369_10020895 | Ga0075369_100208951 | 507 |
| 981 | 3300006844 | Ga0075428_100020068 | Ga0075428_1000200682 | 507 |
| 982 | 3300009093 | Ga0105240_10038362 | Ga0105240_100383624 | 507 |
| 983 | 3300009098 | Ga0105245_10114917 | Ga0105245_101149172 | 507 |
| 984 | 3300009545 | Ga0105237_10259140 | Ga0105237_102591401 | 507 |
| 985 | 3300009551 | Ga0105238_10212635 | Ga0105238_102126351 | 507 |
| 986 | 3300010375 | Ga0105239_10048668 | Ga0105239_100486684 | 507 |
| 987 | 3300010375 | Ga0105239_10144726 | Ga0105239_101447262 | 507 |
| 988 | 3300013105 | Ga0157369_10012022 | Ga0157369_100120227 | 507 |
| 989 | 3300013306 | Ga0163162_10202611 | Ga0163162_102026112 | 507 |
| 990 | 3300013308 | Ga0157375_10037439 | Ga0157375_100374392 | 507 |
| 991 | 3300014325 | Ga0163163_10011640 | Ga0163163_100116403 | 507 |
| 992 | 3300014969 | Ga0157376_10019248 | Ga0157376_100192484 | 507 |
| 993 | 3300017792 | Ga0163161_10064550 | Ga0163161_100645502 | 507 |
| 994 | 3300025321 | Ga0207656_10010990 | Ga0207656_100109902 | 507 |
| 995 | 3300025903 | Ga0207680_10069878 | Ga0207680_100698782 | 507 |
| 996 | 3300025907 | Ga0207645_10043527 | Ga0207645_100435272 | 507 |
| 997 | 3300025913 | Ga0207695_10036024 | Ga0207695_100360242 | 507 |
| 998 | 3300025917 | Ga0207660_10056560 | Ga0207660_100565602 | 507 |
| 999 | 3300025919 | Ga0207657_10055848 | Ga0207657_100558482 | 507 |
| 1000 | 3300025920 | Ga0207649_10078786 | Ga0207649_100787862 | 507 |
| 1001 | 3300025921 | Ga0207652_10023063 | Ga0207652_100230633 | 507 |
| 1002 | 3300025933 | Ga0207706_10022063 | Ga0207706_100220631 | 507 |
| 1003 | 3300025937 | Ga0207669_10073397 | Ga0207669_100733971 | 507 |
| 1004 | 3300025940 | Ga0207691_10147122 | Ga0207691_101471222 | 507 |
| 1005 | 3300025944 | Ga0207661_10071279 | Ga0207661_100712792 | 507 |
| 1006 | 3300025961 | Ga0207712_10022487 | Ga0207712_100224873 | 507 |
| 1007 | 3300026023 | Ga0207677_10022522 | Ga0207677_100225222 | 507 |
| 1008 | 3300026067 | Ga0207678_10009739 | Ga0207678_100097395 | 507 |
| 1009 | 3300026067 | Ga0207678_10088930 | Ga0207678_100889302 | 507 |
| 1010 | 3300026075 | Ga0207708_10097383 | Ga0207708_100973832 | 507 |
| 1011 | 3300026118 | Ga0207675_100047548 | Ga0207675_1000475483 | 507 |
| 1012 | 3300026121 | Ga0207683_10016780 | Ga0207683_100167805 | 507 |
| 1013 | 3300026121 | Ga0207683_10092470 | Ga0207683_100924702 | 507 |
| 1014 | 3300028379 | Ga0268266_10054868 | Ga0268266_100548682 | 507 |
| 1015 | 3300031250 | Ga0265331_10016079 | Ga0265331_100160792 | 507 |
| 1016 | 3300031712 | Ga0265342_10006201 | Ga0265342_100062015 | 507 |
| 1017 | 3300031730 | Ga0307516_10009547 | Ga0307516_100095475 | 507 |
| 1018 | 3300033180 | Ga0307510_10064553 | Ga0307510_100645532 | 507 |
| 1019 | 3300035118 | Ga0373954_0040555 | Ga0373954_0040555_238_1773 | 507 |
| 1020 | 3300035691 | Ga0373931_0000976 | Ga0373931_0000976_4966_6501 | 507 |
| 1021 | 3300035692 | Ga0373935_0002539 | Ga0373935_0002539_4069_5622 | 507 |
| 1022 | 3300035695 | Ga0373927_0000308 | Ga0373927_0000308_29731_31284 | 507 |
| 1023 | 3300035695 | Ga0373927_0010106 | Ga0373927_0010106_3400_4935 | 507 |
| 1024 | 3300035695 | Ga0373927_0019139 | Ga0373927_0019139_2777_4312 | 507 |
| 1025 | 3300035724 | Ga0373933_0016932 | Ga0373933_0016932_2532_4067 | 507 |
| 1026 | 3300035724 | Ga0373933_0063611 | Ga0373933_0063611_570_2123 | 507 |
| 1027 | 3300035725 | Ga0373947_0026735 | Ga0373947_0026735_274_1809 | 507 |
| 1028 | 3300036401 | Ga0373937_0032108 | Ga0373937_0032108_1405_2940 | 507 |
| 1029 | 3300037068 | Ga0373925_0002838 | Ga0373925_0002838_3293_4846 | 507 |
| 1030 | 3300037068 | Ga0373925_0095091 | Ga0373925_0095091_314_1849 | 507 |
| 1031 | 3300046455 | Ga0495603_0000229 | Ga0495603_0000229_26222_27775 | 507 |
| 1032 | 3300046459 | Ga0495629_0000170 | Ga0495629_0000170_15835_17388 | 507 |
| 1033 | 3300046461 | Ga0495641_0002021 | Ga0495641_0002021_5095_6648 | 507 |
| 1034 | 3300046463 | Ga0495653_0030645 | Ga0495653_0030645_1809_3344 | 507 |
| 1035 | 3300046472 | Ga0495580_0006642 | Ga0495580_0006642_7546_9099 | 507 |
| 1036 | 3300046473 | Ga0495582_0000053 | Ga0495582_0000053_12918_14471 | 507 |
| 1037 | 3300046475 | Ga0495639_0000057 | Ga0495639_0000057_27973_29526 | 507 |
| 1038 | 3300046476 | Ga0495662_0000754 | Ga0495662_0000754_8843_10396 | 507 |
| 1039 | 3300046477 | Ga0495664_0010021 | Ga0495664_0010021_403_1956 | 507 |
| 1040 | 3300046499 | Ga0495594_0000460 | Ga0495594_0000460_3128_4681 | 507 |
| 1041 | 3300046507 | Ga0495606_0004247 | Ga0495606_0004247_2820_4433 | 507 |
| 1042 | 3300046516 | Ga0495628_0016571 | Ga0495628_0016571_2519_4054 | 507 |
| 1043 | 3300046517 | Ga0495630_0001122 | Ga0495630_0001122_10058_11611 | 507 |
| 1044 | 3300046531 | Ga0495665_0000197 | Ga0495665_0000197_3140_4693 | 507 |
| 1045 | 3300046533 | Ga0495640_0006354 | Ga0495640_0006354_2278_3831 | 507 |
| 1046 | 3300046536 | Ga0495587_0009632 | Ga0495587_0009632_10_1545 | 507 |
| 1047 | 3300046543 | Ga0495645_0014222 | Ga0495645_0014222_3414_4949 | 507 |
| 1048 | 3300046557 | Ga0495622_0003160 | Ga0495622_0003160_4011_5564 | 507 |
| 1049 | 3300046559 | Ga0495667_0047982 | Ga0495667_0047982_772_2307 | 507 |
| 1050 | 3300046642 | Ga0495634_0001079 | Ga0495634_0001079_16051_17604 | 507 |
| 1051 | 3300046663 | Ga0495635_0000738 | Ga0495635_0000738_13092_14645 | 507 |
| 1052 | 3300046680 | Ga0495646_0006464 | Ga0495646_0006464_805_2358 | 507 |
| 1053 | 3300046680 | Ga0495646_0028359 | Ga0495646_0028359_544_2079 | 507 |
| 1054 | 3300046681 | Ga0495647_0010372 | Ga0495647_0010372_293_1846 | 507 |
| 1055 | 3300046683 | Ga0495658_0000217 | Ga0495658_0000217_11558_13111 | 507 |
| 1056 | 3300046689 | Ga0495613_0012678 | Ga0495613_0012678_2819_4372 | 507 |
| 1057 | 3300046690 | Ga0495624_0000394 | Ga0495624_0000394_13009_14562 | 507 |
| 1058 | 3300047319 | Ga0495674_0001522 | Ga0495674_0001522_3199_4752 | 507 |
| 1059 | 3300047320 | Ga0495672_0039774 | Ga0495672_0039774_986_2533 | 507 |
| 1060 | 3300047321 | Ga0495676_0054211 | Ga0495676_0054211_1140_2675 | 507 |
| 1061 | 3300047471 | Ga0495684_0031222 | Ga0495684_0031222_1849_3402 | 507 |
| 1062 | 3300047673 | Ga0495593_0000177 | Ga0495593_0000177_26944_28497 | 507 |
| 1063 | 3300048904 | Ga0496101_0006174 | Ga0496101_0006174_3339_4874 | 507 |
| 1064 | 3300048904 | Ga0496101_0016503 | Ga0496101_0016503_2381_3916 | 507 |
| 1065 | 3300048905 | Ga0496102_0023707 | Ga0496102_0023707_907_2442 | 507 |
| 1066 | 3300048906 | Ga0496103_0009134 | Ga0496103_0009134_333_1868 | 507 |
| 1067 | 3300048906 | Ga0496103_0022467 | Ga0496103_0022467_1952_3487 | 507 |
| 1068 | 3300048907 | Ga0496104_0026572 | Ga0496104_0026572_2372_3907 | 507 |
| 1069 | 3300048907 | Ga0496104_0045567 | Ga0496104_0045567_243_1778 | 507 |
| 1070 | 3300048909 | Ga0496106_0010607 | Ga0496106_0010607_4255_5790 | 507 |
| 1071 | 3300048909 | Ga0496106_0037669 | Ga0496106_0037669_104_1639 | 507 |
| 1072 | 3300048910 | Ga0496107_0001854 | Ga0496107_0001854_8314_9849 | 507 |
| 1073 | 3300048911 | Ga0496108_0154968 | Ga0496108_0154968_79_1614 | 507 |
| 1074 | 3300048912 | Ga0496109_0099716 | Ga0496109_0099716_383_1918 | 507 |
| 1075 | 3300048913 | Ga0496110_0014673 | Ga0496110_0014673_2877_4412 | 507 |
| 1076 | 3300048914 | Ga0496111_0024893 | Ga0496111_0024893_351_1886 | 507 |
| 1077 | 3300048915 | Ga0496112_0000016 | Ga0496112_0000016_93825_95357 | 507 |
| 1078 | 3300048917 | Ga0496114_0003242 | Ga0496114_0003242_8355_9890 | 507 |
| 1079 | 3300048917 | Ga0496114_0096266 | Ga0496114_0096266_224_1747 | 507 |
| 1080 | 3300048918 | Ga0496115_0011689 | Ga0496115_0011689_4364_6031 | 507 |
| 1081 | 3300048923 | Ga0496120_0085948 | Ga0496120_0085948_141_1673 | 507 |
| 1082 | 3300048924 | Ga0496121_0001527 | Ga0496121_0001527_25035_26582 | 507 |
| 1083 | 3300048924 | Ga0496121_0005628 | Ga0496121_0005628_9057_10589 | 507 |
| 1084 | 3300048929 | Ga0496126_0009337 | Ga0496126_0009337_5918_7453 | 507 |
| 1085 | 3300048929 | Ga0496126_0069891 | Ga0496126_0069891_126_1661 | 507 |
| 1086 | 3300048929 | Ga0496126_0073087 | Ga0496126_0073087_1270_2832 | 507 |
| 1087 | 3300050489 | nmdc:mga03683_9545_c1 | nmdc:mga03683_9545_c1_521_2056 | 507 |
| 1088 | 3300050507 | nmdc:mga05p37_35437_c1 | nmdc:mga05p37_35437_c1_3207_4742 | 507 |
| 1089 | 3300053077 | Ga0495601_0020614 | Ga0495601_0020614_1796_3331 | 507 |
| 1090 | 3300053077 | Ga0495601_0037498 | Ga0495601_0037498_324_1859 | 507 |
| 1091 | 3300053080 | Ga0500635_0000788 | Ga0500635_0000788_4789_6321 | 507 |
| 1092 | 3300053085 | Ga0495619_0009011 | Ga0495619_0009011_1587_3140 | 507 |
| 1093 | 3300053085 | Ga0495619_0058270 | Ga0495619_0058270_648_2183 | 507 |
| 1094 | 3300053119 | Ga0500595_005213 | Ga0500595_005213_1455_2987 | 507 |
| 1095 | 3300053119 | Ga0500595_008884 | Ga0500595_008884_1842_3374 | 507 |
| 1096 | 3300053130 | Ga0500642_0003238 | Ga0500642_0003238_544_2076 | 507 |
| 1097 | 3300053150 | Ga0500603_000891 | Ga0500603_000891_3468_5000 | 507 |
| 1098 | 3300053178 | Ga0500637_0004444 | Ga0500637_0004444_1154_2686 | 507 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iuu-assembly1.cif.gz_A | crystal structure of putative metallopeptidase (yp_676511.1) from mesorhizobium sp. bnc1 at 2.13 a resolution | 0.9081 | 2 | 486 |
| 7ylq-assembly1.cif.gz_A | crystal structure of microcystinase c from sphingomonas sp. acm-3962 at 2.6 a resolution | 0.8714 | 2 | 500 |
| 3iuu-assembly1.cif.gz_A | crystal structure of putative metallopeptidase (yp_676511.1) from mesorhizobium sp. bnc1 at 2.13 a resolution | 0.8667 | 2 | 486 |
| 7ylq-assembly1.cif.gz_A | crystal structure of microcystinase c from sphingomonas sp. acm-3962 at 2.6 a resolution | 0.8629 | 2 | 500 |
| 7ylq-assembly1.cif.gz_B | crystal structure of microcystinase c from sphingomonas sp. acm-3962 at 2.6 a resolution | 0.7714 | 1 | 497 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3i42A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6627 | 1 | 190 | 3.40.50.2300 |
| 3i42A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.6596 | 1 | 190 | 3.40.50.2300 |
| 2wp4B00 | Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit | 0.6529 | 193 | 274 | 3.90.1170.40 |
| af_C0PJ39_412_507_3.30.70.2860 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.6289 | 192 | 274 | 3.30.70.2860 |
| af_P95072_325_478_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.6254 | 72 | 163 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A401TQJ1-F1-model_v4 | Microcystin LR degradation protein MlrC N-terminal domain-containing protein | 0.9986 | 1 | 266 |
|
| AF-A0A542B5R2-F1-model_v4 | Microcystinase C (MlrC) | 0.9937 | 2 | 498 |
GO:0006508
GO:0008237 GO:0046872 |
| AF-A0A536XL31-F1-model_v4 | M81 family metallopeptidase | 0.9918 | 1 | 188 |
|
| AF-A0A401TQJ1-F1-model_v4 | Microcystin LR degradation protein MlrC N-terminal domain-containing protein | 0.9912 | 1 | 266 |
|
| AF-A0A1A9HJL2-F1-model_v4 | Microcystinase C (MlrC) | 0.99 | 2 | 499 |
GO:0006508
GO:0008237 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar