F490024

General Info

Members Datasets Scaffolds Average Seq Length
1098 675 845 501

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0011689|Ga0496115_0011689_4364_6031
Length 555
Sequence MTRIAVGGFLHETNTFAPTKATYDAFVHGGGWPRMEVGAKVLKTLRHINVGLAGFIEAAEAEGWELVPTIFTAATPSAHVTRDAYERIAKVMIDGISAAGRLDAVYLDLHGAMVTEHLDDGEGEILKRVRKVIGTDPPLVASLDLHANVTPEMVEHADALIAYRTYPHVDMADTGRAVARHLALMLKTKQRFAKAFRQLPFLIPISWQCTNDEPTKGIYQKLAAMESDAVPTLSFAPGFPAADFRDCGPSVFAYGKTQADADAATDKLAALIESHENDFDGRIFTPDEGVRHAMELARTASKPIIIADTQDNPGAGGDSDTTGMLRALVRNKAKRAATGVIYDPASAKAAHAAGXXXSVTLALGGKSGIPGDAPYKEAFIVERLSDGQFVAPGPYYGGRDMDMGPSACLRIGDVRVVVSSHKAQLADQSMYRYVGIEPIEQAILVNKSSVHFRADFEPIAERLLICAAPGAMPAGPPHCHGRDCVRASASSRTVPPSSPRPNHVQRLLQPDKIKCPTSTASKASPTNSPRSVGICTRIPRSASRKSARPGSSPTS

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
27 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
28 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
29 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
30 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
31 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
32 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
33 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
34 2751185800 Brucella pituitosa AA2 Isolate Unclassified
35 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
36 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
37 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
38 2791355199
39 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
40 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
41 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
42 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
43 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
44 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
45 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
46 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
47 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
48 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
49 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
50 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
51 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
52 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
53 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
54 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
55 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
56 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
57 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
58 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
59 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
60 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
61 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
62 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
63 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
64 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
65 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
66 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
67 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
68 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
69 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
70 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
71 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
72 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
73 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
74 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
75 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
76 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
77 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
78 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
79 2854911287 Brucella lupini LUP21 Isolate Unclassified
80 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
81 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
82 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
83 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
84 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
85 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
86 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
87 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
88 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
89 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
90 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
91 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
92 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
93 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
94 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
95 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
96 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
97 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
98 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
99 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
100 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
101 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
102 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
103 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
104 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
105 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
106 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
107 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
108 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
109 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
110 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
111 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
112 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
113 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
114 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
115 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
116 2904699407
117 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
118 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
119 2906610324
120 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
121 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
122 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
123 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
124 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
125 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
126 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
127 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
128 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
129 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
130 2922368715
131 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
132 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
133 2922425934
134 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
135 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
136 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
137 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
138 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
139 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
140 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
141 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
142 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
143 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
144 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
145 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
146 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
147 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
148 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
149 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
150 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
151 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
152 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
153 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
154 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
155 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
156 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
157 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
158 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
159 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
160 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
161 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
162 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
163 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
164 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
165 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
166 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
167 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
168 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
169 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
170 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
171 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
172 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
173 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
174 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
175 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
176 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
177 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
178 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
179 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
180 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
181 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
182 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
183 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
184 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
185 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
186 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
187 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
188 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
189 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
190 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
191 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
192 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
193 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
194 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
195 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
196 2941479691
197 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
198 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
199 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
200 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
201 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
202 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
203 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
204 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
205 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
206 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
207 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
208 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
209 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
210 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
211 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
212 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
213 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
214 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
215 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
216 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
217 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
218 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
219 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
220 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
221 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
222 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
223 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
224 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
225 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
226 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
227 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
228 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
229 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
230 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
231 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
232 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
233 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
234 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
235 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
236 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
237 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
238 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
239 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
240 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
241 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
242 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
243 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
244 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
245 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
246 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
247 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
248 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
249 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
250 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
251 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
252 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
253 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
254 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
255 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
256 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
257 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
258 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
259 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
260 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
261 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
262 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
263 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
264 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
265 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
266 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
267 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
268 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
269 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
270 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
271 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
272 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
273 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
274 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
275 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
276 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
277 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
278 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
279 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
280 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
281 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
282 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
283 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
284 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
285 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
286 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
287 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
288 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
289 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
290 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
291 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
292 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
293 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
294 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
295 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
296 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
297 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
298 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
299 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
300 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
301 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
302 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
303 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
304 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
305 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
306 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
307 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
308 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
309 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
310 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
311 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
312 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
313 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
314 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
315 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
316 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
317 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
320 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
321 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
322 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
323 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
324 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
325 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
326 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
382 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
383 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
384 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
385 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
386 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
390 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
391 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
392 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
393 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
394 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
395 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
396 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
397 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
398 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
399 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
400 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
401 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
402 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
403 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
404 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
405 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
406 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
407 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
408 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
409 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
410 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
411 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
412 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
413 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
414 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
415 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
416 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
417 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
418 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
419 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
420 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
421 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
422 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
423 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
424 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
425 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
426 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
427 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
428 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
429 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
430 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
431 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
432 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
433 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
434 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
435 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
436 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
437 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
438 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
439 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
440 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
441 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
442 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
443 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
444 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
445 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
446 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
447 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
448 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
449 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
450 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
451 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
452 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
453 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
454 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
455 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
456 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
457 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
458 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
459 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
460 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
461 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
462 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
463 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
464 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
465 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
466 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
467 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
468 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
469 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
470 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
471 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
472 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
473 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
474 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
475 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
476 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
477 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
478 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
479 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
480 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
481 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
482 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
483 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
484 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
485 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
486 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
487 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
488 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
489 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
490 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
491 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
492 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
493 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
494 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
495 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
496 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
497 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
498 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
499 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
500 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
501 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
502 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
503 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
504 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
505 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
506 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
507 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
508 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
509 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
510 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
511 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
512 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
513 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
514 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
515 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
516 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
517 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
518 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
519 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
520 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
521 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
522 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
523 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
524 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
525 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
526 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
527 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
528 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
529 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
530 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
531 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
532 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
533 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
534 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
535 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
536 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
537 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
538 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
539 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
540 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
541 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
542 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
543 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
544 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
545 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
546 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
547 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
548 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
549 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
550 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
551 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
552 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
553 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
554 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
555 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
556 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
557 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
558 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
559 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
560 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
561 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
562 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
563 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
564 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
565 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
566 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
567 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
568 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
569 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
570 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
571 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
572 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
573 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
574 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
575 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
576 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
577 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
578 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
579 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
580 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
581 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
582 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
583 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
584 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
585 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
586 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
587 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
588 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
589 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
590 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
591 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
592 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
593 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
594 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
595 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
596 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
597 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
598 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
599 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
600 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
601 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
602 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
603 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
604 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
605 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
606 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
607 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
608 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
609 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
610 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
611 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
612 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
613 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
614 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
615 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
616 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
617 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
618 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
619 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
620 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
621 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
622 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
623 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
624 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
625 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
626 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
627 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
628 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
629 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
630 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
631 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
632 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
633 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
634 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
635 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
636 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
637 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
638 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
639 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
640 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
641 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
642 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
643 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
644 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
645 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
646 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
647 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
648 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
649 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
650 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
651 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
652 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
653 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
654 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
655 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
656 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
657 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
658 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
659 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
660 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
661 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
662 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
663 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
664 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
665 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
666 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
667 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
668 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
669 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
670 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
671 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
672 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
673 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
674 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
675 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 77.31
Metatranscriptomes 0
Isolates 22.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.36
Bulb 0
Endosphere 11.57
Nodule 16.39
Rhizoplane 3.37
Rhizosphere 55.56
Stem 0
Stem Tuber 0
Unclassified 12.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10011354 3300002077 Bacteria 1822
2 JGI25151J46595_10011809 3300003187 Bacteria 4001
3 JGI25406J46586_10000169 3300003203 Bacteria 29128
4 JGI25406J46586_10000649 3300003203 Bacteria 16248
5 JGI25406J46586_10001342 3300003203 Bacteria 11588
6 JGI25153J46596_10001707 3300003215 Bacteria 13020
7 JGI25153J46596_10004084 3300003215 Bacteria 7939
8 JGI25153J46596_10010236 3300003215 Bacteria 4260
9 JGI25153J46596_10022212 3300003215 Bacteria 2345
10 JGI25160J50197_1002568 3300003354 Bacteria 8395
11 JGI25160J50197_1004939 3300003354 Bacteria 5664
12 JGI25160J50197_1008493 3300003354 Bacteria 3908
13 JGI25404J52841_10001451 3300003659 Bacteria 4168
14 Ga0055531_10002184 3300003794 Bacteria 13342
15 Ga0065165_1002008 3300005262 Bacteria 19054
16 Ga0065165_1003321 3300005262 Bacteria 11502
17 Ga0065165_1007524 3300005262 Bacteria 5326
18 Ga0070683_100011469 3300005329 Bacteria 7664
19 Ga0070683_100044792 3300005329 Bacteria 4082
20 Ga0070683_100049783 3300005329 Bacteria 3876
21 Ga0070670_100004805 3300005331 Bacteria 11344
22 Ga0070670_100136636 3300005331 Bacteria 2118
23 Ga0070677_10001495 3300005333 Bacteria 7392
24 Ga0068869_100014332 3300005334 Bacteria 5293
25 Ga0068869_100129333 3300005334 Bacteria 1939
26 Ga0070680_100037772 3300005336 Bacteria 3903
27 Ga0070680_100046107 3300005336 Bacteria 3545
28 Ga0070680_100058029 3300005336 Bacteria 3165
29 Ga0068868_100013364 3300005338 Bacteria 6021
30 Ga0068868_100020908 3300005338 Bacteria 4926
31 Ga0068868_100038322 3300005338 Bacteria 3720
32 Ga0070660_100088939 3300005339 Bacteria 2433
33 Ga0070661_100078355 3300005344 Bacteria 2437
34 Ga0070668_100032035 3300005347 Bacteria 4000
35 Ga0070668_100074431 3300005347 Bacteria 2649
36 Ga0070668_100113213 3300005347 Bacteria 2161
37 Ga0070668_100177948 3300005347 Bacteria 1736
38 Ga0070669_100060185 3300005353 Bacteria 2790
39 Ga0070675_100007548 3300005354 Bacteria 8409
40 Ga0070671_100023332 3300005355 Bacteria 5063
41 Ga0070671_100105789 3300005355 Bacteria 2362
42 Ga0070674_100038097 3300005356 Bacteria 3238
43 Ga0070674_100053339 3300005356 Bacteria 2791
44 Ga0070673_100002260 3300005364 Bacteria 11678
45 Ga0070667_100018417 3300005367 Bacteria 5791
46 Ga0070667_100108652 3300005367 Bacteria 2403
47 Ga0070709_10005063 3300005434 Bacteria 7123
48 Ga0070709_10067655 3300005434 Bacteria 2294
49 Ga0070714_100022534 3300005435 Bacteria 5165
50 Ga0070713_100002066 3300005436 Bacteria 12979
51 Ga0070713_100004489 3300005436 Bacteria 9384
52 Ga0070713_100029836 3300005436 Bacteria 4324
53 Ga0070710_10024959 3300005437 Bacteria 3159
54 Ga0070711_100005920 3300005439 Bacteria 7341
55 Ga0070663_100015939 3300005455 Bacteria 4865
56 Ga0070663_100081614 3300005455 Bacteria 2377
57 Ga0070663_100087085 3300005455 Bacteria 2308
58 Ga0070678_100003016 3300005456 Bacteria 9329
59 Ga0070678_100008476 3300005456 Bacteria 6158
60 Ga0070678_100052451 3300005456 Bacteria 2962
61 Ga0070678_100166723 3300005456 Bacteria 1790
62 Ga0070681_10015109 3300005458 Bacteria 7679
63 Ga0070681_10034264 3300005458 Bacteria 5099
64 Ga0068867_100003767 3300005459 Bacteria 10675
65 Ga0070706_100122381 3300005467 Bacteria 2425
66 Ga0070679_100031660 3300005530 Bacteria 5228
67 Ga0070679_100042340 3300005530 Bacteria 4534
68 Ga0070684_100035959 3300005535 Bacteria 4242
69 Ga0070684_100058437 3300005535 Bacteria 3370
70 Ga0070697_100190378 3300005536 Bacteria 1741
71 Ga0068853_100132821 3300005539 Bacteria 2229
72 Ga0070672_100002537 3300005543 Bacteria 11636
73 Ga0070672_100083712 3300005543 Bacteria 2561
74 Ga0070695_100068298 3300005545 Bacteria 2320
75 Ga0070693_100028334 3300005547 Bacteria 3044
76 Ga0070665_100006755 3300005548 Bacteria 11660
77 Ga0068855_100028293 3300005563 Bacteria 6704
78 Ga0068855_100072497 3300005563 Bacteria 4003
79 Ga0068855_100307245 3300005563 Bacteria 1755
80 Ga0070664_100003458 3300005564 Bacteria 12762
81 Ga0070664_100005811 3300005564 Bacteria 9951
82 Ga0070664_100088893 3300005564 Bacteria 2671
83 Ga0068857_100058949 3300005577 Bacteria 3410
84 Ga0068856_100099568 3300005614 Bacteria 2898
85 Ga0068852_100011341 3300005616 Bacteria 6704
86 Ga0068852_100041568 3300005616 Bacteria 3886
87 Ga0068852_100182344 3300005616 Bacteria 1975
88 Ga0068859_100125022 3300005617 Bacteria 2640
89 Ga0068859_100141303 3300005617 Bacteria 2481
90 Ga0068861_100160396 3300005719 Bacteria 1854
91 Ga0068851_10000771 3300005834 Bacteria 13794
92 Ga0068851_10024448 3300005834 Bacteria 2957
93 Ga0068858_100141705 3300005842 Bacteria 2257
94 Ga0068860_100006214 3300005843 Bacteria 12010
95 Ga0068860_100006537 3300005843 Bacteria 11700
96 Ga0068860_100040107 3300005843 Bacteria 4477
97 Ga0068860_100071549 3300005843 Bacteria 3295
98 Ga0068860_100085166 3300005843 Bacteria 3007
99 Ga0068860_100201716 3300005843 Bacteria 1928
100 Ga0068862_100007547 3300005844 Bacteria 9012
101 Ga0068862_100010139 3300005844 Bacteria 7777
102 Ga0068862_100055462 3300005844 Bacteria 3394
103 Ga0081455_10000116 3300005937 Bacteria 91321
104 Ga0081455_10001166 3300005937 Bacteria 32865
105 Ga0081455_10025839 3300005937 Bacteria 5413
106 Ga0081538_10033760 3300005981 Bacteria 3397
107 Ga0081540_1001357 3300005983 Bacteria 21280
108 Ga0081540_1001469 3300005983 Bacteria 20349
109 Ga0081540_1001498 3300005983 Bacteria 20120
110 Ga0081540_1009440 3300005983 Bacteria 6724
111 Ga0081540_1018187 3300005983 Bacteria 4322
112 Ga0081539_10000255 3300005985 Bacteria 123054
113 Ga0081539_10000726 3300005985 Bacteria 66051
114 Ga0070717_10008134 3300006028 Bacteria 7826
115 Ga0070717_10029723 3300006028 Bacteria 4388
116 Ga0070717_10050429 3300006028 Bacteria 3420
117 Ga0075365_10000870 3300006038 Bacteria 12580
118 Ga0075365_10044251 3300006038 Bacteria 2916
119 Ga0075365_10064309 3300006038 Bacteria 2457
120 Ga0075365_10070545 3300006038 Bacteria 2350
121 Ga0075365_10083747 3300006038 Bacteria 2163
122 Ga0075363_100048472 3300006048 Bacteria 2259
123 Ga0075363_100086644 3300006048 Bacteria 1720
124 Ga0075364_10063952 3300006051 Bacteria 2415
125 Ga0075364_10122938 3300006051 Bacteria 1738
126 Ga0075432_10006827 3300006058 Bacteria 3887
127 Ga0075432_10036962 3300006058 Bacteria 1699
128 Ga0070716_100046089 3300006173 Bacteria 2451
129 Ga0070712_100014857 3300006175 Bacteria 5003
130 Ga0070712_100059974 3300006175 Bacteria 2681
131 Ga0070712_100105048 3300006175 Bacteria 2097
132 Ga0075362_10024429 3300006177 Bacteria 2564
133 Ga0075367_10002487 3300006178 Bacteria 8442
134 Ga0075367_10015961 3300006178 Bacteria 4094
135 Ga0075367_10070670 3300006178 Bacteria 2099
136 Ga0075369_10020895 3300006186 Bacteria 2684
137 Ga0097621_100016503 3300006237 Bacteria 5585
138 Ga0075370_10013261 3300006353 Bacteria 4375
139 Ga0075428_100020068 3300006844 Bacteria 7400
140 Ga0068865_100000872 3300006881 Bacteria 17095
141 Ga0097620_100099933 3300006931 Bacteria 2956
142 Ga0097620_100125025 3300006931 Bacteria 2640
143 Ga0097620_100141293 3300006931 Bacteria 2481
144 Ga0099825_1019011 3300006941 Bacteria 5206
145 Ga0099824_1013886 3300006942 Bacteria 8199
146 Ga0099824_1029633 3300006942 Bacteria 2304
147 Ga0099822_1020952 3300006943 Bacteria 6398
148 Ga0075435_100158514 3300007076 Bacteria 1906
149 Ga0105240_10038362 3300009093 Bacteria 6145
150 Ga0105240_10067855 3300009093 Bacteria 4420
151 Ga0105240_10068838 3300009093 Bacteria 4384
152 Ga0105240_10202906 3300009093 Bacteria 2323
153 Ga0105245_10114917 3300009098 Bacteria 2507
154 Ga0105247_10005003 3300009101 Bacteria 8419
155 Ga0105241_10138810 3300009174 Bacteria 1977
156 Ga0105241_10168389 3300009174 Bacteria 1807
157 Ga0105242_10065668 3300009176 Bacteria 2994
158 Ga0105237_10004145 3300009545 Bacteria 16891
159 Ga0105237_10056348 3300009545 Bacteria 3935
160 Ga0105237_10128168 3300009545 Bacteria 2532
161 Ga0105237_10207059 3300009545 Bacteria 1962
162 Ga0105237_10259140 3300009545 Bacteria 1742
163 Ga0105238_10069091 3300009551 Bacteria 3533
164 Ga0105238_10135032 3300009551 Bacteria 2445
165 Ga0105238_10212635 3300009551 Bacteria 1910
166 Ga0105249_10016709 3300009553 Bacteria 6512
167 Ga0105239_10048668 3300010375 Bacteria 4648
168 Ga0105239_10144726 3300010375 Bacteria 2650
169 Ga0105246_10006170 3300011119 Bacteria 7314
170 Ga0105246_10014246 3300011119 Bacteria 4998
171 Ga0157370_10135348 3300013104 Bacteria 2297
172 Ga0157369_10003596 3300013105 Bacteria 18418
173 Ga0157369_10012022 3300013105 Bacteria 9833
174 Ga0157369_10067372 3300013105 Bacteria 3849
175 Ga0157369_10082983 3300013105 Bacteria 3428
176 Ga0157374_10004665 3300013296 Bacteria 11502
177 Ga0157374_10044291 3300013296 Bacteria 4113
178 Ga0157374_10100182 3300013296 Bacteria 2777
179 Ga0157374_10127121 3300013296 Bacteria 2464
180 Ga0157378_10012293 3300013297 Bacteria 7494
181 Ga0157378_10155219 3300013297 Bacteria 2136
182 Ga0163162_10002169 3300013306 Bacteria 18423
183 Ga0163162_10013993 3300013306 Bacteria 7843
184 Ga0163162_10202611 3300013306 Bacteria 2113
185 Ga0157372_10184605 3300013307 Bacteria 2415
186 Ga0157375_10037439 3300013308 Bacteria 4648
187 Ga0163163_10011640 3300014325 Bacteria 7991
188 Ga0157380_10030643 3300014326 Bacteria 4122
189 Ga0157380_10180902 3300014326 Bacteria 1852
190 Ga0157376_10019248 3300014969 Bacteria 5256
191 Ga0157376_10274558 3300014969 Bacteria 1585
192 Ga0163161_10064550 3300017792 Bacteria 2671
193 Ga0214544_1000006 3300021320 Bacteria 380728
194 Ga0214542_1000002 3300021321 Bacteria 720798
195 Ga0214545_1000002 3300021324 Bacteria 727485
196 Ga0214543_1000017 3300021327 Bacteria 290109
197 Ga0213876_10021485 3300021384 Bacteria 3413
198 Ga0213876_10046688 3300021384 Bacteria 2290
199 Ga0213875_10022106 3300021388 Bacteria 3044
200 Ga0209677_100702 3300025253 Bacteria 17086
201 Ga0209677_108937 3300025253 Bacteria 1863
202 Ga0209148_1000447 3300025254 Bacteria 45273
203 Ga0209233_1012268 3300025261 Bacteria 2491
204 Ga0209233_1016891 3300025261 Bacteria 2001
205 Ga0209455_1002262 3300025272 Bacteria 7576
206 Ga0209025_1001716 3300025294 Bacteria 26594
207 Ga0209564_1000297 3300025295 Bacteria 100091
208 Ga0209564_1007203 3300025295 Bacteria 5794
209 Ga0209564_1023837 3300025295 Bacteria 2110
210 Ga0209758_1000065 3300025297 Bacteria 306288
211 Ga0209758_1002429 3300025297 Bacteria 19044
212 Ga0209758_1002745 3300025297 Bacteria 17271
213 Ga0209758_1003044 3300025297 Bacteria 15967
214 Ga0209758_1003360 3300025297 Bacteria 14667
215 Ga0209256_1004971 3300025299 Bacteria 7964
216 Ga0207426_1000554 3300025302 Bacteria 51521
217 Ga0207426_1000561 3300025302 Bacteria 50758
218 Ga0207426_1009233 3300025302 Bacteria 3920
219 Ga0207426_1020261 3300025302 Bacteria 2313
220 Ga0209257_1000833 3300025304 Bacteria 44467
221 Ga0209257_1018232 3300025304 Bacteria 2714
222 Ga0207697_10009429 3300025315 Bacteria 4217
223 Ga0207656_10010990 3300025321 Bacteria 3408
224 Ga0207692_10002707 3300025898 Bacteria 6829
225 Ga0207642_10035148 3300025899 Bacteria 2137
226 Ga0207710_10004687 3300025900 Bacteria 5933
227 Ga0207680_10069878 3300025903 Bacteria 2171
228 Ga0207647_10013488 3300025904 Bacteria 5660
229 Ga0207699_10002964 3300025906 Bacteria 8073
230 Ga0207699_10011046 3300025906 Bacteria 4549
231 Ga0207645_10043527 3300025907 Bacteria 2874
232 Ga0207643_10061308 3300025908 Bacteria 2148
233 Ga0207705_10147210 3300025909 Bacteria 1763
234 Ga0207684_10210329 3300025910 Bacteria 1678
235 Ga0207654_10040566 3300025911 Bacteria 2624
236 Ga0207707_10000651 3300025912 Bacteria 34364
237 Ga0207695_10000029 3300025913 Bacteria 548364
238 Ga0207695_10036024 3300025913 Bacteria 5354
239 Ga0207695_10118638 3300025913 Bacteria 2617
240 Ga0207695_10180590 3300025913 Bacteria 2031
241 Ga0207671_10025690 3300025914 Bacteria 4421
242 Ga0207671_10091726 3300025914 Bacteria 2289
243 Ga0207671_10096792 3300025914 Bacteria 2231
244 Ga0207693_10002906 3300025915 Bacteria 14827
245 Ga0207693_10008081 3300025915 Bacteria 8629
246 Ga0207693_10014710 3300025915 Bacteria 6286
247 Ga0207693_10101873 3300025915 Bacteria 2252
248 Ga0207663_10001131 3300025916 Bacteria 12287
249 Ga0207663_10036415 3300025916 Bacteria 2960
250 Ga0207660_10022691 3300025917 Bacteria 4231
251 Ga0207660_10056560 3300025917 Bacteria 2807
252 Ga0207657_10055848 3300025919 Bacteria 3409
253 Ga0207657_10064762 3300025919 Bacteria 3119
254 Ga0207657_10166374 3300025919 Bacteria 1788
255 Ga0207649_10078786 3300025920 Bacteria 2127
256 Ga0207652_10023063 3300025921 Bacteria 5155
257 Ga0207652_10049932 3300025921 Bacteria 3583
258 Ga0207652_10083886 3300025921 Bacteria 2790
259 Ga0207652_10106084 3300025921 Bacteria 2487
260 Ga0207681_10062346 3300025923 Bacteria 2567
261 Ga0207694_10091407 3300025924 Bacteria 2402
262 Ga0207694_10124154 3300025924 Bacteria 2063
263 Ga0207650_10003368 3300025925 Bacteria 10999
264 Ga0207650_10054211 3300025925 Bacteria 2974
265 Ga0207659_10002374 3300025926 Bacteria 11209
266 Ga0207700_10030126 3300025928 Bacteria 3838
267 Ga0207700_10065605 3300025928 Bacteria 2771
268 Ga0207664_10013136 3300025929 Bacteria 5938
269 Ga0207664_10057524 3300025929 Bacteria 3091
270 Ga0207664_10082346 3300025929 Bacteria 2621
271 Ga0207644_10049773 3300025931 Bacteria 3001
272 Ga0207706_10022063 3300025933 Bacteria 5715
273 Ga0207709_10062747 3300025935 Bacteria 2327
274 Ga0207669_10001262 3300025937 Bacteria 10739
275 Ga0207669_10073397 3300025937 Bacteria 2158
276 Ga0207665_10000992 3300025939 Bacteria 19173
277 Ga0207691_10005604 3300025940 Bacteria 12136
278 Ga0207691_10101330 3300025940 Bacteria 2570
279 Ga0207691_10147122 3300025940 Bacteria 2073
280 Ga0207711_10230442 3300025941 Bacteria 1696
281 Ga0207689_10009434 3300025942 Bacteria 8426
282 Ga0207661_10005660 3300025944 Bacteria 8815
283 Ga0207661_10052910 3300025944 Bacteria 3246
284 Ga0207661_10071279 3300025944 Bacteria 2839
285 Ga0207679_10082218 3300025945 Bacteria 2465
286 Ga0207679_10084547 3300025945 Bacteria 2435
287 Ga0207667_10018352 3300025949 Bacteria 7849
288 Ga0207667_10124233 3300025949 Bacteria 2659
289 Ga0207651_10012778 3300025960 Bacteria 4770
290 Ga0207712_10022487 3300025961 Bacteria 4153
291 Ga0207668_10024605 3300025972 Bacteria 3889
292 Ga0207668_10061040 3300025972 Bacteria 2649
293 Ga0207658_10129805 3300025986 Bacteria 2023
294 Ga0207677_10022522 3300026023 Bacteria 3874
295 Ga0207677_10042614 3300026023 Bacteria 3011
296 Ga0207677_10052763 3300026023 Bacteria 2764
297 Ga0207677_10096834 3300026023 Bacteria 2160
298 Ga0207703_10051198 3300026035 Bacteria 3345
299 Ga0207639_10005655 3300026041 Bacteria 8459
300 Ga0207678_10009091 3300026067 Bacteria 8748
301 Ga0207678_10009739 3300026067 Bacteria 8450
302 Ga0207678_10088930 3300026067 Bacteria 2640
303 Ga0207708_10054510 3300026075 Bacteria 3048
304 Ga0207708_10097383 3300026075 Bacteria 2273
305 Ga0207702_10051886 3300026078 Bacteria 3468
306 Ga0207648_10000419 3300026089 Bacteria 46680
307 Ga0207648_10008822 3300026089 Bacteria 9711
308 Ga0207648_10084025 3300026089 Bacteria 2777
309 Ga0207674_10095176 3300026116 Bacteria 2964
310 Ga0207675_100000693 3300026118 Bacteria 33301
311 Ga0207675_100026527 3300026118 Bacteria 5393
312 Ga0207675_100047548 3300026118 Bacteria 4005
313 Ga0207675_100075226 3300026118 Bacteria 3161
314 Ga0207683_10005354 3300026121 Bacteria 10997
315 Ga0207683_10016780 3300026121 Bacteria 6232
316 Ga0207683_10092470 3300026121 Bacteria 2695
317 Ga0207683_10151725 3300026121 Bacteria 2091
318 Ga0207683_10169816 3300026121 Bacteria 1975
319 Ga0207698_10001212 3300026142 Bacteria 15053
320 Ga0207698_10045465 3300026142 Bacteria 3308
321 Ga0207698_10076642 3300026142 Bacteria 2677
322 Ga0207698_10188548 3300026142 Bacteria 1834
323 Ga0209389_1000025 3300027296 Bacteria 149588
324 Ga0209389_1000816 3300027296 Bacteria 19892
325 Ga0209371_1000035 3300027312 Bacteria 368979
326 Ga0209589_1000009 3300027357 Bacteria 252104
327 Ga0209589_1000066 3300027357 Bacteria 100795
328 Ga0209489_100010 3300027361 Bacteria 252139
329 Ga0209489_100030 3300027361 Bacteria 185999
330 Ga0209489_106247 3300027361 Bacteria 19412
331 Ga0209700_100017 3300027363 Bacteria 252104
332 Ga0209700_100031 3300027363 Bacteria 207349
333 Ga0268266_10001147 3300028379 Bacteria 32898
334 Ga0268266_10054868 3300028379 Bacteria 3425
335 Ga0268266_10093105 3300028379 Bacteria 2644
336 Ga0268265_10020692 3300028380 Bacteria 4597
337 Ga0268264_10000035 3300028381 Bacteria 398196
338 Ga0268264_10002351 3300028381 Bacteria 16696
339 Ga0268264_10004742 3300028381 Bacteria 11547
340 Ga0265334_10000799 3300028573 Bacteria 15763
341 Ga0265322_10016431 3300028654 Bacteria 2136
342 Ga0265336_10000233 3300028666 Bacteria 39706
343 Ga0307517_10000062 3300028786 Bacteria 145054
344 Ga0307515_10055923 3300028794 Bacteria 5749
345 Ga0265338_10000090 3300028800 Bacteria 171540
346 Ga0265338_10001796 3300028800 Bacteria 33751
347 Ga0265324_10008187 3300029957 Bacteria 4173
348 Ga0268256_1000037 3300030500 Bacteria 367024
349 Ga0265340_10001013 3300031247 Bacteria 15991
350 Ga0265331_10015572 3300031250 Bacteria 4011
351 Ga0265331_10016079 3300031250 Bacteria 3937
352 Ga0265327_10019500 3300031251 Bacteria 4165
353 Ga0307509_10084622 3300031507 Bacteria 3266
354 Ga0307508_10000532 3300031616 Bacteria 45338
355 Ga0265342_10006201 3300031712 Bacteria 8938
356 Ga0265342_10021950 3300031712 Bacteria 4068
357 Ga0307516_10000729 3300031730 Bacteria 44867
358 Ga0307516_10009547 3300031730 Bacteria 10805
359 Ga0307516_10024016 3300031730 Bacteria 6235
360 Ga0307405_10014356 3300031731 Bacteria 4257
361 Ga0307409_100001404 3300031995 Bacteria 11782
362 Ga0307416_100002743 3300032002 Bacteria 10219
363 Ga0307414_10016285 3300032004 Bacteria 4516
364 Ga0307411_10059471 3300032005 Bacteria 2534
365 Ga0307415_100015133 3300032126 Bacteria 4558
366 Ga0307510_10026250 3300033180 Bacteria 6700
367 Ga0307510_10064553 3300033180 Bacteria 3718
368 Ga0315911_1000009 3300033442 Bacteria 379354
369 Ga0373944_0006585 3300035089 Bacteria 3086
370 Ga0373936_0008646 3300035113 Bacteria 3834
371 Ga0373945_0003375 3300035116 Bacteria 5018
372 Ga0373954_0002845 3300035118 Bacteria 7291
373 Ga0373954_0012478 3300035118 Bacteria 3777
374 Ga0373954_0040555 3300035118 Bacteria 2169
375 Ga0373956_0003275 3300035119 Bacteria 6531
376 Ga0373943_0004027 3300035170 Bacteria 6684
377 Ga0373946_0005405 3300035171 Bacteria 4606
378 Ga0373955_0000447 3300035172 Bacteria 17475
379 Ga0373931_0000976 3300035691 Bacteria 12102
380 Ga0373935_0002539 3300035692 Bacteria 10459
381 Ga0373927_0000308 3300035695 Bacteria 38418
382 Ga0373927_0010106 3300035695 Bacteria 6316
383 Ga0373927_0016156 3300035695 Bacteria 4925
384 Ga0373927_0018206 3300035695 Bacteria 4618
385 Ga0373927_0019139 3300035695 Bacteria 4490
386 Ga0373927_0053204 3300035695 Bacteria 2618
387 Ga0373933_0000167 3300035724 Bacteria 42851
388 Ga0373933_0002005 3300035724 Bacteria 11741
389 Ga0373933_0016932 3300035724 Bacteria 4085
390 Ga0373933_0063611 3300035724 Bacteria 2231
391 Ga0373933_0069491 3300035724 Bacteria 2141
392 Ga0373947_0026735 3300035725 Bacteria 3374
393 Ga0373947_0027440 3300035725 Bacteria 3332
394 Ga0373937_0032108 3300036401 Bacteria 4761
395 Ga0316584_0069602 3300036712 Bacteria 2638
396 Ga0373925_0002838 3300037068 Bacteria 13675
397 Ga0373925_0009786 3300037068 Bacteria 6961
398 Ga0373925_0031894 3300037068 Bacteria 3876
399 Ga0373925_0055739 3300037068 Bacteria 2960
400 Ga0373925_0095091 3300037068 Bacteria 2282
401 Ga0395899_0004504 3300037312 Bacteria 10864
402 Ga0395899_0007418 3300037312 Bacteria 8474
403 Ga0395900_0000389 3300037418 Bacteria 63583
404 Ga0395900_0003228 3300037418 Bacteria 17658
405 Ga0395898_0000866 3300037466 Bacteria 49465
406 Ga0395898_0019758 3300037466 Bacteria 6851
407 Ga0395898_0029402 3300037466 Bacteria 5504
408 Ga0395905_0034838 3300037471 Bacteria 4726
409 Ga0395901_0000164 3300038443 Bacteria 86884
410 Ga0395901_0049817 3300038443 Bacteria 4353
411 Ga0395901_0065415 3300038443 Bacteria 3786
412 Ga0395901_0140659 3300038443 Bacteria 2536
413 Ga0436365_0680043 3300039437 Bacteria 4127
414 Ga0436365_1888691 3300039437 Bacteria 3222
415 Ga0436360_1087539 3300039438 Bacteria 2981
416 Ga0436360_1198791 3300039438 Bacteria 2227
417 Ga0436360_1252590 3300039438 Bacteria 1705
418 Ga0436363_1600596 3300039450 Bacteria 7381
419 Ga0439456_005986 3300042013 Bacteria 2478
420 Ga0451577_0004589 3300042876 Bacteria 14515
421 Ga0466972_0000174 3300044658 Bacteria 49914
422 Ga0466966_0000148 3300044684 Bacteria 44828
423 Ga0466961_0000045 3300044693 Bacteria 75331
424 Ga0466963_0012884 3300044694 Bacteria 5123
425 Ga0466964_0009932 3300044706 Bacteria 3586
426 Ga0466957_0036720 3300044842 Bacteria 2947
427 Ga0466959_0006449 3300045049 Bacteria 8125
428 Ga0466958_0076522 3300045836 Bacteria 2054
429 Ga0466967_0020296 3300045976 Bacteria 5366
430 Ga0495617_002315 3300046452 Bacteria 7673
431 Ga0495617_006936 3300046452 Bacteria 3955
432 Ga0495617_018404 3300046452 Bacteria 2362
433 Ga0495592_0001539 3300046454 Bacteria 16097
434 Ga0495592_0014889 3300046454 Bacteria 5903
435 Ga0495603_0000218 3300046455 Bacteria 29764
436 Ga0495603_0000229 3300046455 Bacteria 29318
437 Ga0495603_0004160 3300046455 Bacteria 8621
438 Ga0495603_0004383 3300046455 Bacteria 8412
439 Ga0495590_0007217 3300046457 Bacteria 4296
440 Ga0495629_0000170 3300046459 Bacteria 57733
441 Ga0495629_0000212 3300046459 Bacteria 52191
442 Ga0495629_0001699 3300046459 Bacteria 17299
443 Ga0495638_0010390 3300046460 Bacteria 6470
444 Ga0495638_0013179 3300046460 Bacteria 5641
445 Ga0495638_0026634 3300046460 Bacteria 3746
446 Ga0495638_0077243 3300046460 Bacteria 2027
447 Ga0495641_0002021 3300046461 Bacteria 16470
448 Ga0495651_0000472 3300046462 Bacteria 30989
449 Ga0495653_0011183 3300046463 Bacteria 7337
450 Ga0495653_0030645 3300046463 Bacteria 4282
451 Ga0495653_0134992 3300046463 Bacteria 1742
452 Ga0495580_0002791 3300046472 Bacteria 15022
453 Ga0495580_0006642 3300046472 Bacteria 9398
454 Ga0495580_0028950 3300046472 Bacteria 4023
455 Ga0495580_0053004 3300046472 Bacteria 2864
456 Ga0495582_0000053 3300046473 Bacteria 58155
457 Ga0495605_0004425 3300046474 Bacteria 8261
458 Ga0495605_0042933 3300046474 Bacteria 2244
459 Ga0495605_0058845 3300046474 Bacteria 1846
460 Ga0495639_0000057 3300046475 Bacteria 49641
461 Ga0495662_0000754 3300046476 Bacteria 15558
462 Ga0495664_0010021 3300046477 Bacteria 5317
463 Ga0495664_0034625 3300046477 Bacteria 2971
464 Ga0495584_0000261 3300046491 Bacteria 37768
465 Ga0495584_0001183 3300046491 Bacteria 16048
466 Ga0495585_0000488 3300046492 Bacteria 37644
467 Ga0495585_0006478 3300046492 Bacteria 7258
468 Ga0495594_0000460 3300046499 Bacteria 20731
469 Ga0495594_0004370 3300046499 Bacteria 7269
470 Ga0495607_0010017 3300046501 Bacteria 6387
471 Ga0495583_0002399 3300046506 Bacteria 16105
472 Ga0495583_0007882 3300046506 Bacteria 6609
473 Ga0495583_0016627 3300046506 Bacteria 3945
474 Ga0495606_0004247 3300046507 Bacteria 14485
475 Ga0495606_0031059 3300046507 Bacteria 3719
476 Ga0495608_0002196 3300046511 Bacteria 14088
477 Ga0495610_0040644 3300046512 Bacteria 2342
478 Ga0495610_0060308 3300046512 Bacteria 1807
479 Ga0495616_0000624 3300046513 Bacteria 26551
480 Ga0495616_0004386 3300046513 Bacteria 8902
481 Ga0495618_0016659 3300046514 Bacteria 4501
482 Ga0495620_0001070 3300046515 Bacteria 16772
483 Ga0495620_0015393 3300046515 Bacteria 3863
484 Ga0495620_0028613 3300046515 Bacteria 2589
485 Ga0495628_0016571 3300046516 Bacteria 6144
486 Ga0495628_0031144 3300046516 Bacteria 4315
487 Ga0495628_0043562 3300046516 Bacteria 3573
488 Ga0495630_0001122 3300046517 Bacteria 18446
489 Ga0495630_0001776 3300046517 Bacteria 15084
490 Ga0495631_0000005 3300046518 Bacteria 159179
491 Ga0495631_0000084 3300046518 Bacteria 60799
492 Ga0495631_0000131 3300046518 Bacteria 50430
493 Ga0495632_0000144 3300046519 Bacteria 73366
494 Ga0495637_0000096 3300046520 Bacteria 68502
495 Ga0495637_0008501 3300046520 Bacteria 5038
496 Ga0495643_0000464 3300046522 Bacteria 51511
497 Ga0495643_0012522 3300046522 Bacteria 5114
498 Ga0495648_0000702 3300046524 Bacteria 35749
499 Ga0495648_0003979 3300046524 Bacteria 12789
500 Ga0495648_0006268 3300046524 Bacteria 9732
501 Ga0495652_0001339 3300046529 Bacteria 27421
502 Ga0495652_0115272 3300046529 Bacteria 2153
503 Ga0495654_0059679 3300046530 Bacteria 1836
504 Ga0495665_0000197 3300046531 Bacteria 31107
505 Ga0495665_0012624 3300046531 Bacteria 4574
506 Ga0495640_0006354 3300046533 Bacteria 9363
507 Ga0495640_0016526 3300046533 Bacteria 5519
508 Ga0495640_0071245 3300046533 Bacteria 2333
509 Ga0495586_0021029 3300046535 Bacteria 3478
510 Ga0495587_0009632 3300046536 Bacteria 6180
511 Ga0495587_0012034 3300046536 Bacteria 5464
512 Ga0495609_0000064 3300046538 Bacteria 135200
513 Ga0495645_0011172 3300046543 Bacteria 6315
514 Ga0495645_0014222 3300046543 Bacteria 5644
515 Ga0495622_0000066 3300046557 Bacteria 92491
516 Ga0495622_0003160 3300046557 Bacteria 7797
517 Ga0495667_0001807 3300046559 Bacteria 14207
518 Ga0495667_0045297 3300046559 Bacteria 2913
519 Ga0495667_0047982 3300046559 Bacteria 2820
520 Ga0495656_0000014 3300046615 Bacteria 132902
521 Ga0495634_0001079 3300046642 Bacteria 25459
522 Ga0495634_0016913 3300046642 Bacteria 5210
523 Ga0495634_0049130 3300046642 Bacteria 2838
524 Ga0495611_0068158 3300046648 Bacteria 1624
525 Ga0495625_0000995 3300046660 Bacteria 37531
526 Ga0495625_0068283 3300046660 Bacteria 2499
527 Ga0495625_0100556 3300046660 Bacteria 1987
528 Ga0495635_0000738 3300046663 Bacteria 21137
529 Ga0495635_0000989 3300046663 Bacteria 18730
530 Ga0495635_0060076 3300046663 Bacteria 2613
531 Ga0495659_0023539 3300046664 Bacteria 2093
532 Ga0495661_0092119 3300046665 Bacteria 1723
533 Ga0495588_0000345 3300046674 Bacteria 29792
534 Ga0495588_0010162 3300046674 Bacteria 4366
535 Ga0495657_0001505 3300046675 Bacteria 20049
536 Ga0495623_0002081 3300046679 Bacteria 13394
537 Ga0495623_0004396 3300046679 Bacteria 9261
538 Ga0495646_0006464 3300046680 Bacteria 7436
539 Ga0495646_0008486 3300046680 Bacteria 6525
540 Ga0495646_0028359 3300046680 Bacteria 3506
541 Ga0495647_0010372 3300046681 Bacteria 3170
542 Ga0495658_0000217 3300046683 Bacteria 32918
543 Ga0495658_0009739 3300046683 Bacteria 4792
544 Ga0495669_0000056 3300046684 Bacteria 77304
545 Ga0495669_0003449 3300046684 Bacteria 6516
546 Ga0495613_0000817 3300046689 Bacteria 24120
547 Ga0495613_0012678 3300046689 Bacteria 6268
548 Ga0495613_0017612 3300046689 Bacteria 5320
549 Ga0495613_0029342 3300046689 Bacteria 4090
550 Ga0495613_0063319 3300046689 Bacteria 2706
551 Ga0495624_0000394 3300046690 Bacteria 34712
552 Ga0495624_0005712 3300046690 Bacteria 8920
553 Ga0495624_0010608 3300046690 Bacteria 6347
554 Ga0495670_0002345 3300046691 Bacteria 9334
555 Ga0495670_0024772 3300046691 Bacteria 2966
556 Ga0495671_0005579 3300046692 Bacteria 7348
557 Ga0495671_0006314 3300046692 Bacteria 6860
558 Ga0495671_0095707 3300046692 Bacteria 1453
559 Ga0495649_0023084 3300046694 Bacteria 3475
560 Ga0495649_0059019 3300046694 Bacteria 2066
561 Ga0495649_0066655 3300046694 Bacteria 1932
562 Ga0495589_0000320 3300046794 Bacteria 37756
563 Ga0495600_0003220 3300046809 Bacteria 9550
564 Ga0495600_0009711 3300046809 Bacteria 5946
565 Ga0495600_0028149 3300046809 Bacteria 3635
566 Ga0495660_0000382 3300046810 Bacteria 38537
567 Ga0495660_0004041 3300046810 Bacteria 8955
568 Ga0495604_0000953 3300047317 Bacteria 24133
569 Ga0495674_0001522 3300047319 Bacteria 22627
570 Ga0495674_0003054 3300047319 Bacteria 16280
571 Ga0495674_0004663 3300047319 Bacteria 13179
572 Ga0495674_0004930 3300047319 Bacteria 12836
573 Ga0495674_0005696 3300047319 Bacteria 11935
574 Ga0495674_0008322 3300047319 Bacteria 9890
575 Ga0495674_0019530 3300047319 Bacteria 6287
576 Ga0495674_0045274 3300047319 Bacteria 3907
577 Ga0495672_0000578 3300047320 Bacteria 41468
578 Ga0495672_0006289 3300047320 Bacteria 9242
579 Ga0495672_0039774 3300047320 Bacteria 2857
580 Ga0495676_0054211 3300047321 Bacteria 3189
581 Ga0495680_0001642 3300047322 Bacteria 23759
582 Ga0495680_0001893 3300047322 Bacteria 21968
583 Ga0495683_0000102 3300047323 Bacteria 87439
584 Ga0495683_0001188 3300047323 Bacteria 17747
585 Ga0495683_0051951 3300047323 Bacteria 2047
586 Ga0495687_000020 3300047443 Bacteria 337717
587 Ga0495687_005443 3300047443 Bacteria 8115
588 Ga0495675_0004647 3300047444 Bacteria 8342
589 Ga0495675_0034624 3300047444 Bacteria 3224
590 Ga0495677_0000058 3300047445 Bacteria 63139
591 Ga0495679_000102 3300047446 Bacteria 76337
592 Ga0495673_0000521 3300047469 Bacteria 40382
593 Ga0495673_0004250 3300047469 Bacteria 9044
594 Ga0495673_0005620 3300047469 Bacteria 7535
595 Ga0495681_0000009 3300047470 Bacteria 205224
596 Ga0495681_0012687 3300047470 Bacteria 4937
597 Ga0495684_0001724 3300047471 Bacteria 17597
598 Ga0495684_0031222 3300047471 Bacteria 4090
599 Ga0495686_0000390 3300047472 Bacteria 69916
600 Ga0495686_0016459 3300047472 Bacteria 5013
601 Ga0495593_0000177 3300047673 Bacteria 32957
602 Ga0495593_0001077 3300047673 Bacteria 15940
603 Ga0495602_0163345 3300048088 Bacteria 1736
604 Ga0495626_0000110 3300048091 Bacteria 105407
605 Ga0496100_0100928 3300048903 Bacteria 1989
606 Ga0496101_0006174 3300048904 Bacteria 7700
607 Ga0496101_0016503 3300048904 Bacteria 4991
608 Ga0496102_0006702 3300048905 Bacteria 9837
609 Ga0496102_0023707 3300048905 Bacteria 5453
610 Ga0496102_0026901 3300048905 Bacteria 5135
611 Ga0496102_0047072 3300048905 Bacteria 3918
612 Ga0496103_0009134 3300048906 Bacteria 5870
613 Ga0496103_0022467 3300048906 Bacteria 3799
614 Ga0496103_0105833 3300048906 Bacteria 1784
615 Ga0496104_0004724 3300048907 Bacteria 11857
616 Ga0496104_0026572 3300048907 Bacteria 5348
617 Ga0496104_0045567 3300048907 Bacteria 4125
618 Ga0496104_0102549 3300048907 Bacteria 2740
619 Ga0496105_0002621 3300048908 Bacteria 13078
620 Ga0496105_0066683 3300048908 Bacteria 2972
621 Ga0496106_0002433 3300048909 Bacteria 13869
622 Ga0496106_0010607 3300048909 Bacteria 6808
623 Ga0496106_0037669 3300048909 Bacteria 3618
624 Ga0496107_0001854 3300048910 Bacteria 13352
625 Ga0496108_0154968 3300048911 Bacteria 1978
626 Ga0496109_0099716 3300048912 Bacteria 2694
627 Ga0496109_0162099 3300048912 Bacteria 2095
628 Ga0496109_0173713 3300048912 Bacteria 2022
629 Ga0496109_0203387 3300048912 Bacteria 1862
630 Ga0496110_0014673 3300048913 Bacteria 6512
631 Ga0496111_0024893 3300048914 Bacteria 4221
632 Ga0496112_0000016 3300048915 Bacteria 194634
633 Ga0496112_0011656 3300048915 Bacteria 8041
634 Ga0496112_0279222 3300048915 Bacteria 1618
635 Ga0496113_0039842 3300048916 Bacteria 3460
636 Ga0496114_0003242 3300048917 Bacteria 12487
637 Ga0496114_0096266 3300048917 Bacteria 2520
638 Ga0496115_0011689 3300048918 Bacteria 6590
639 Ga0496116_0003781 3300048919 Bacteria 14794
640 Ga0496116_0059662 3300048919 Bacteria 2479
641 Ga0496116_0086953 3300048919 Bacteria 1915
642 Ga0496116_0096664 3300048919 Bacteria 1778
643 Ga0496117_0017193 3300048920 Bacteria 6053
644 Ga0496117_0034099 3300048920 Bacteria 3842
645 Ga0496117_0100286 3300048920 Bacteria 1834
646 Ga0496118_0001822 3300048921 Bacteria 30624
647 Ga0496118_0075119 3300048921 Bacteria 2412
648 Ga0496119_0006070 3300048922 Bacteria 11317
649 Ga0496119_0008464 3300048922 Bacteria 9032
650 Ga0496119_0068261 3300048922 Bacteria 2094
651 Ga0496120_0085948 3300048923 Bacteria 1692
652 Ga0496121_0000508 3300048924 Bacteria 74420
653 Ga0496121_0000875 3300048924 Bacteria 54487
654 Ga0496121_0001443 3300048924 Bacteria 40145
655 Ga0496121_0001527 3300048924 Bacteria 38742
656 Ga0496121_0005628 3300048924 Bacteria 15955
657 Ga0496121_0006578 3300048924 Bacteria 14342
658 Ga0496121_0032648 3300048924 Bacteria 4728
659 Ga0496121_0035638 3300048924 Bacteria 4454
660 Ga0496121_0051892 3300048924 Bacteria 3450
661 Ga0496121_0062474 3300048924 Bacteria 3050
662 Ga0496121_0137652 3300048924 Bacteria 1817
663 Ga0496122_0003144 3300048925 Bacteria 22097
664 Ga0496122_0022158 3300048925 Bacteria 5657
665 Ga0496122_0025193 3300048925 Bacteria 5176
666 Ga0496122_0026336 3300048925 Bacteria 5017
667 Ga0496123_0020781 3300048926 Bacteria 5123
668 Ga0496123_0034230 3300048926 Bacteria 3643
669 Ga0496123_0052065 3300048926 Bacteria 2720
670 Ga0496124_0000013 3300048927 Bacteria 484884
671 Ga0496124_0008790 3300048927 Bacteria 10490
672 Ga0496124_0037214 3300048927 Bacteria 4234
673 Ga0496124_0139370 3300048927 Bacteria 1916
674 Ga0496125_0000083 3300048928 Bacteria 227168
675 Ga0496125_0000092 3300048928 Bacteria 211050
676 Ga0496125_0001341 3300048928 Bacteria 36276
677 Ga0496125_0002637 3300048928 Bacteria 22956
678 Ga0496125_0009813 3300048928 Bacteria 9756
679 Ga0496125_0026278 3300048928 Bacteria 5309
680 Ga0496125_0053908 3300048928 Bacteria 3292
681 Ga0496125_0090312 3300048928 Bacteria 2299
682 Ga0496126_0006684 3300048929 Bacteria 12815
683 Ga0496126_0008250 3300048929 Bacteria 11251
684 Ga0496126_0009337 3300048929 Bacteria 10434
685 Ga0496126_0013694 3300048929 Bacteria 8232
686 Ga0496126_0025148 3300048929 Bacteria 5734
687 Ga0496126_0048534 3300048929 Bacteria 3878
688 Ga0496126_0064742 3300048929 Bacteria 3273
689 Ga0496126_0069891 3300048929 Bacteria 3130
690 Ga0496126_0073087 3300048929 Bacteria 3049
691 Ga0496126_0116666 3300048929 Bacteria 2320
692 Ga0496126_0151034 3300048929 Bacteria 1991
693 Ga0495678_000522 3300049459 Bacteria 37556
694 Ga0495682_0000032 3300049460 Bacteria 132787
695 Ga0495682_0001908 3300049460 Bacteria 10386
696 Ga0501031_0004352 3300049568 Bacteria 9161
697 Ga0501031_0008031 3300049568 Bacteria 6870
698 Ga0501032_0000120 3300049569 Bacteria 64900
699 Ga0501032_0000224 3300049569 Bacteria 46893
700 Ga0501032_0100119 3300049569 Bacteria 1920
701 Ga0501033_0000095 3300049570 Bacteria 84522
702 Ga0501033_0002325 3300049570 Bacteria 16196
703 Ga0501033_0092037 3300049570 Bacteria 2218
704 Ga0501034_0000061 3300049571 Bacteria 195178
705 Ga0501034_0001094 3300049571 Bacteria 38145
706 Ga0501034_0001606 3300049571 Bacteria 29373
707 Ga0501034_0046058 3300049571 Bacteria 4407
708 Ga0501036_0000007 3300049572 Bacteria 240500
709 Ga0501036_0000054 3300049572 Bacteria 74190
710 Ga0501036_0147425 3300049572 Bacteria 1985
711 Ga0501037_0000093 3300049573 Bacteria 83246
712 Ga0501037_0000159 3300049573 Bacteria 63178
713 Ga0501038_0000028 3300049574 Bacteria 144481
714 Ga0501038_0000066 3300049574 Bacteria 86216
715 Ga0501039_0000005 3300049575 Bacteria 295471
716 Ga0501039_0000142 3300049575 Bacteria 48935
717 Ga0501043_0000127 3300049579 Bacteria 70587
718 Ga0501043_0027793 3300049579 Bacteria 4440
719 Ga0501043_0074699 3300049579 Bacteria 2663
720 Ga0501046_0000032 3300049580 Bacteria 180265
721 Ga0501046_0000487 3300049580 Bacteria 39622
722 Ga0501047_0000077 3300049581 Bacteria 123480
723 Ga0501047_0000122 3300049581 Bacteria 95307
724 Ga0501047_0013416 3300049581 Bacteria 7768
725 Ga0501047_0093430 3300049581 Bacteria 2887
726 Ga0501048_0000053 3300049582 Bacteria 57136
727 Ga0501048_0000693 3300049582 Bacteria 24501
728 Ga0501067_0000387 3300049583 Bacteria 23972
729 Ga0501067_0002215 3300049583 Bacteria 10744
730 Ga0501068_0000392 3300049584 Bacteria 22164
731 Ga0501068_0007764 3300049584 Bacteria 5942
732 Ga0501069_0003878 3300049585 Bacteria 7704
733 Ga0501069_0006700 3300049585 Bacteria 6032
734 Ga0501070_0000070 3300049586 Bacteria 86706
735 Ga0501070_0001577 3300049586 Bacteria 20268
736 Ga0501070_0009608 3300049586 Bacteria 8171
737 Ga0501072_0002094 3300049588 Bacteria 14863
738 Ga0501073_0000146 3300049589 Bacteria 46947
739 Ga0501073_0004857 3300049589 Bacteria 10089
740 Ga0501074_0000712 3300049590 Bacteria 20837
741 Ga0501079_0010566 3300049741 Bacteria 7022
742 Ga0501079_0027146 3300049741 Bacteria 4389
743 Ga0501080_0000035 3300049742 Bacteria 83220
744 Ga0501080_0001268 3300049742 Bacteria 21004
745 Ga0501083_0001199 3300049744 Bacteria 17528
746 Ga0501083_0065317 3300049744 Bacteria 2424
747 Ga0501035_0000016 3300049822 Bacteria 243412
748 Ga0501035_0000099 3300049822 Bacteria 108224
749 Ga0501035_0096382 3300049822 Bacteria 2599
750 Ga0501044_0000184 3300049823 Bacteria 77805
751 Ga0501044_0000195 3300049823 Bacteria 76643
752 Ga0501044_0003221 3300049823 Bacteria 18386
753 Ga0501044_0047111 3300049823 Bacteria 4460
754 Ga0501044_0172289 3300049823 Bacteria 2135
755 Ga0501044_0230224 3300049823 Bacteria 1801
756 Ga0501045_0062682 3300049824 Bacteria 2728
757 nmdc:mga03683_5300_c1 3300050489 Bacteria 3848
758 nmdc:mga03683_9545_c1 3300050489 Bacteria 2878
759 nmdc:mga03n38_31072_c1 3300050490 Bacteria 2251
760 nmdc:mga00v17_17576_c1 3300050491 Bacteria 4051
761 nmdc:mga00v17_63532_c1 3300050491 Bacteria 2274
762 nmdc:mga0yw44_274_c1 3300050492 Bacteria 17652
763 nmdc:mga0yw44_39673_c1 3300050492 Bacteria 2794
764 nmdc:mga0yw44_47146_c1 3300050492 Bacteria 2592
765 nmdc:mga0yw44_57800_c1 3300050492 Bacteria 2367
766 nmdc:mga0k408_22951_c1 3300050493 Bacteria 3517
767 nmdc:mga06z11_1702_c1 3300050494 Bacteria 8254
768 nmdc:mga06z11_44277_c1 3300050494 Bacteria 2244
769 nmdc:mga07m45_92356_c1 3300050496 Bacteria 1735
770 nmdc:mga05p37_35437_c1 3300050507 Bacteria 6118
771 nmdc:mga0n895_82137_c1 3300050512 Bacteria 3212
772 nmdc:mga0rr50_182223_c1 3300050513 Bacteria 1717
773 Ga0495601_0020614 3300053077 Bacteria 4028
774 Ga0495601_0037498 3300053077 Bacteria 3030
775 Ga0495612_0042849 3300053078 Bacteria 1848
776 Ga0500610_0056565 3300053079 Bacteria 2047
777 Ga0500635_0000788 3300053080 Bacteria 7875
778 Ga0500635_0001533 3300053080 Bacteria 5549
779 Ga0495619_0000394 3300053085 Bacteria 29767
780 Ga0495619_0009011 3300053085 Bacteria 6295
781 Ga0495619_0058270 3300053085 Bacteria 2563
782 Ga0500643_000019 3300053087 Bacteria 294301
783 Ga0500643_009059 3300053087 Bacteria 3841
784 Ga0500647_0041146 3300053091 Bacteria 2217
785 Ga0500651_0063025 3300053093 Bacteria 2314
786 Ga0500566_0000020 3300053094 Bacteria 83462
787 Ga0500566_0000693 3300053094 Bacteria 18973
788 Ga0500566_0004708 3300053094 Bacteria 8125
789 Ga0500566_0087109 3300053094 Bacteria 1730
790 Ga0500640_018256 3300053095 Bacteria 2989
791 Ga0500648_018307 3300053097 Bacteria 3847
792 Ga0500650_0054909 3300053098 Bacteria 1854
793 Ga0500556_0000024 3300053104 Bacteria 167556
794 Ga0500557_000093 3300053105 Bacteria 30291
795 Ga0500562_030373 3300053108 Bacteria 1423
796 Ga0500572_001222 3300053111 Bacteria 7259
797 Ga0500572_001274 3300053111 Bacteria 7047
798 Ga0500595_000478 3300053119 Bacteria 24694
799 Ga0500595_005213 3300053119 Bacteria 5698
800 Ga0500595_007973 3300053119 Bacteria 4348
801 Ga0500595_008884 3300053119 Bacteria 4083
802 Ga0500607_088018 3300053121 Unclassified 1569
803 Ga0500608_001404 3300053122 Bacteria 8620
804 Ga0500608_023436 3300053122 Bacteria 2874
805 Ga0500618_000216 3300053125 Bacteria 45255
806 Ga0500618_000423 3300053125 Bacteria 28476
807 Ga0500618_000988 3300053125 Bacteria 14371
808 Ga0500618_004319 3300053125 Bacteria 4591
809 Ga0500642_0000035 3300053130 Bacteria 106656
810 Ga0500642_0000096 3300053130 Bacteria 42836
811 Ga0500642_0002242 3300053130 Bacteria 5643
812 Ga0500642_0003238 3300053130 Bacteria 4891
813 Ga0500642_0012766 3300053130 Bacteria 3060
814 Ga0500559_0000491 3300053136 Bacteria 27718
815 Ga0500559_0000520 3300053136 Bacteria 27012
816 Ga0500559_0012987 3300053136 Bacteria 3532
817 Ga0500559_0014071 3300053136 Bacteria 3382
818 Ga0500559_0056627 3300053136 Bacteria 1740
819 Ga0500568_0005882 3300053139 Bacteria 6245
820 Ga0500573_0039050 3300053140 Bacteria 2742
821 Ga0500577_0000455 3300053142 Bacteria 10570
822 Ga0500589_062883 3300053147 Bacteria 1696
823 Ga0500603_000105 3300053150 Bacteria 19663
824 Ga0500603_000891 3300053150 Bacteria 7091
825 Ga0500604_0029999 3300053151 Bacteria 1588
826 Ga0500616_0000122 3300053153 Bacteria 140228
827 Ga0500619_009306 3300053154 Bacteria 2431
828 Ga0500622_0000790 3300053156 Bacteria 27440
829 Ga0500622_0026034 3300053156 Bacteria 3089
830 Ga0500624_002474 3300053157 Bacteria 2501
831 Ga0500630_003888 3300053159 Bacteria 7253
832 Ga0500634_0011768 3300053161 Bacteria 4528
833 Ga0500638_009264 3300053162 Bacteria 4248
834 Ga0500638_022688 3300053162 Bacteria 2976
835 Ga0500639_000066 3300053163 Bacteria 47938
836 Ga0500636_0000645 3300053177 Bacteria 18823
837 Ga0500636_0003147 3300053177 Bacteria 9247
838 Ga0500636_0072687 3300053177 Bacteria 1992
839 Ga0500637_0004444 3300053178 Bacteria 6652
840 Ga0500625_034445 3300053729 Bacteria 2400
841 Ga0500609_001844 3300053731 Bacteria 3070
842 Ga0500596_003119 3300053735 Bacteria 3187
843 Ga0500601_000120 3300053737 Bacteria 16487
844 Ga0501084_0002556 3300054114 Bacteria 14660
845 Ga0501082_0001454 3300060353 Bacteria 20806

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016575299 8016578743 416
2 iso_pu_bacteria 2935916978 2935920519 442
3 3300028800 Ga0265338_10001796 Ga0265338_100017964 449
4 3300025921 Ga0207652_10106084 Ga0207652_101060841 453
5 3300046529 Ga0495652_0115272 Ga0495652_0115272_19_1422 454
6 3300048088 Ga0495602_0163345 Ga0495602_0163345_19_1422 454
7 3300032004 Ga0307414_10016285 Ga0307414_100162852 455
8 3300053108 Ga0500562_030373 Ga0500562_030373_17_1408 459
9 3300046692 Ga0495671_0095707 Ga0495671_0095707_52_1443 463
10 3300053078 Ga0495612_0042849 Ga0495612_0042849_12_1415 463
11 3300053121 Ga0500607_088018 Ga0500607_088018_21_1418 464
12 3300009093 Ga0105240_10068838 Ga0105240_100688382 466
13 3300025913 Ga0207695_10180590 Ga0207695_101805902 466
14 3300005331 Ga0070670_100004805 Ga0070670_1000048056 467
15 3300005331 Ga0070670_100136636 Ga0070670_1001366362 467
16 3300005333 Ga0070677_10001495 Ga0070677_100014953 467
17 3300005338 Ga0068868_100013364 Ga0068868_1000133643 467
18 3300005354 Ga0070675_100007548 Ga0070675_1000075486 467
19 3300005355 Ga0070671_100023332 Ga0070671_1000233322 467
20 3300005356 Ga0070674_100038097 Ga0070674_1000380972 467
21 3300005364 Ga0070673_100002260 Ga0070673_1000022608 467
22 3300005367 Ga0070667_100018417 Ga0070667_1000184172 467
23 3300005456 Ga0070678_100003016 Ga0070678_1000030166 467
24 3300005459 Ga0068867_100003767 Ga0068867_1000037676 467
25 3300005543 Ga0070672_100002537 Ga0070672_1000025376 467
26 3300025315 Ga0207697_10009429 Ga0207697_100094292 467
27 3300025908 Ga0207643_10061308 Ga0207643_100613082 467
28 3300025923 Ga0207681_10062346 Ga0207681_100623462 467
29 3300025925 Ga0207650_10003368 Ga0207650_100033687 467
30 3300025925 Ga0207650_10054211 Ga0207650_100542112 467
31 3300025926 Ga0207659_10002374 Ga0207659_100023746 467
32 3300025931 Ga0207644_10049773 Ga0207644_100497732 467
33 3300025937 Ga0207669_10001262 Ga0207669_100012626 467
34 3300025940 Ga0207691_10005604 Ga0207691_100056048 467
35 3300025945 Ga0207679_10082218 Ga0207679_100822182 467
36 3300025960 Ga0207651_10012778 Ga0207651_100127782 467
37 3300025986 Ga0207658_10129805 Ga0207658_101298052 467
38 3300026023 Ga0207677_10052763 Ga0207677_100527634 467
39 3300026089 Ga0207648_10008822 Ga0207648_100088226 467
40 3300026121 Ga0207683_10005354 Ga0207683_100053546 467
41 3300031731 Ga0307405_10014356 Ga0307405_100143563 467
42 3300031995 Ga0307409_100001404 Ga0307409_1000014048 467
43 3300032002 Ga0307416_100002743 Ga0307416_1000027435 467
44 3300032005 Ga0307411_10059471 Ga0307411_100594712 467
45 3300032126 Ga0307415_100015133 Ga0307415_1000151332 467
46 3300031251 Ga0265327_10019500 Ga0265327_100195002 469
47 3300048919 Ga0496116_0096664 Ga0496116_0096664_327_1760 471
48 3300053147 Ga0500589_062883 Ga0500589_062883_24_1454 472
49 3300038443 Ga0395901_0140659 Ga0395901_0140659_269_1777 474
50 3300048929 Ga0496126_0048534 Ga0496126_0048534_1258_2790 474
51 3300005329 Ga0070683_100011469 Ga0070683_1000114694 475
52 3300005334 Ga0068869_100014332 Ga0068869_1000143321 475
53 3300005456 Ga0070678_100166723 Ga0070678_1001667232 475
54 3300005564 Ga0070664_100005811 Ga0070664_10000581112 475
55 3300009551 Ga0105238_10069091 Ga0105238_100690915 475
56 3300013105 Ga0157369_10067372 Ga0157369_100673725 475
57 3300013296 Ga0157374_10100182 Ga0157374_101001823 475
58 3300014969 Ga0157376_10274558 Ga0157376_102745581 475
59 3300025942 Ga0207689_10009434 Ga0207689_100094344 475
60 3300026078 Ga0207702_10051886 Ga0207702_100518865 475
61 3300026121 Ga0207683_10169816 Ga0207683_101698162 475
62 3300037312 Ga0395899_0004504 Ga0395899_0004504_8185_9696 475
63 3300037418 Ga0395900_0003228 Ga0395900_0003228_651_2162 475
64 3300049571 Ga0501034_0001094 Ga0501034_0001094_12926_14437 475
65 3300049571 Ga0501034_0046058 Ga0501034_0046058_1634_3145 475
66 3300049579 Ga0501043_0074699 Ga0501043_0074699_1102_2613 475
67 3300049823 Ga0501044_0230224 Ga0501044_0230224_60_1571 475
68 3300005937 Ga0081455_10000116 Ga0081455_1000011651 476
69 3300009174 Ga0105241_10138810 Ga0105241_101388101 476
70 3300026121 Ga0207683_10151725 Ga0207683_101517252 476
71 3300025909 Ga0207705_10147210 Ga0207705_101472102 478
72 3300025919 Ga0207657_10064762 Ga0207657_100647622 478
73 3300025945 Ga0207679_10084547 Ga0207679_100845472 478
74 3300003187 JGI25151J46595_10011809 JGI25151J46595_100118092 481
75 3300027312 Ga0209371_1000035 Ga0209371_1000035219 482
76 3300030500 Ga0268256_1000037 Ga0268256_1000037218 482
77 3300048924 Ga0496121_0000875 Ga0496121_0000875_8331_9857 482
78 3300048924 Ga0496121_0035638 Ga0496121_0035638_129_1658 482
79 3300048928 Ga0496125_0000092 Ga0496125_0000092_133401_134933 482
80 3300048929 Ga0496126_0151034 Ga0496126_0151034_56_1675 482
81 3300053130 Ga0500642_0002242 Ga0500642_0002242_3676_5178 482
82 3300053142 Ga0500577_0000455 Ga0500577_0000455_1628_3157 482
83 3300025294 Ga0209025_1001716 Ga0209025_100171616 484
84 3300048928 Ga0496125_0001341 Ga0496125_0001341_19199_20731 484
85 3300049581 Ga0501047_0013416 Ga0501047_0013416_298_1818 485
86 3300049586 Ga0501070_0009608 Ga0501070_0009608_144_1664 485
87 3300049823 Ga0501044_0047111 Ga0501044_0047111_1017_2537 485
88 iso_pu_bacteria 2808606386 2808983214 485
89 iso_pu_bacteria 2808606415 2809128434 485
90 iso_pu_bacteria 2808606419 2809148055 485
91 iso_pu_bacteria 2852618963 2852620530 485
92 3300005339 Ga0070660_100088939 Ga0070660_1000889391 486
93 3300005347 Ga0070668_100032035 Ga0070668_1000320352 486
94 3300005564 Ga0070664_100088893 Ga0070664_1000888932 486
95 3300005616 Ga0068852_100041568 Ga0068852_1000415682 486
96 3300005617 Ga0068859_100125022 Ga0068859_1001250222 486
97 3300005842 Ga0068858_100141705 Ga0068858_1001417052 486
98 3300005843 Ga0068860_100040107 Ga0068860_1000401072 486
99 3300005843 Ga0068860_100071549 Ga0068860_1000715492 486
100 3300005844 Ga0068862_100010139 Ga0068862_1000101393 486
101 3300006931 Ga0097620_100125025 Ga0097620_1001250252 486
102 3300013104 Ga0157370_10135348 Ga0157370_101353482 486
103 3300025972 Ga0207668_10024605 Ga0207668_100246052 486
104 3300026118 Ga0207675_100026527 Ga0207675_1000265273 486
105 3300026142 Ga0207698_10045465 Ga0207698_100454652 486
106 3300028380 Ga0268265_10020692 Ga0268265_100206922 486
107 3300028381 Ga0268264_10004742 Ga0268264_100047422 486
108 3300005347 Ga0070668_100177948 Ga0070668_1001779482 487
109 3300005543 Ga0070672_100083712 Ga0070672_1000837122 487
110 3300005616 Ga0068852_100182344 Ga0068852_1001823442 487
111 3300005843 Ga0068860_100006214 Ga0068860_1000062142 487
112 3300005844 Ga0068862_100007547 Ga0068862_1000075476 487
113 3300006881 Ga0068865_100000872 Ga0068865_1000008728 487
114 3300009553 Ga0105249_10016709 Ga0105249_100167094 487
115 3300013297 Ga0157378_10012293 Ga0157378_100122932 487
116 3300013306 Ga0163162_10002169 Ga0163162_100021699 487
117 3300014326 Ga0157380_10030643 Ga0157380_100306433 487
118 3300025940 Ga0207691_10101330 Ga0207691_101013302 487
119 3300026075 Ga0207708_10054510 Ga0207708_100545102 487
120 3300026089 Ga0207648_10000419 Ga0207648_1000041944 487
121 3300026118 Ga0207675_100000693 Ga0207675_10000069322 487
122 3300028381 Ga0268264_10002351 Ga0268264_100023514 487
123 3300042876 Ga0451577_0004589 Ga0451577_0004589_2353_3861 487
124 3300053093 Ga0500651_0063025 Ga0500651_0063025_178_1683 487
125 3300053125 Ga0500618_000216 Ga0500618_000216_23494_24978 487
126 3300053130 Ga0500642_0012766 Ga0500642_0012766_1201_2706 487
127 3300053136 Ga0500559_0056627 Ga0500559_0056627_69_1571 487
128 3300053731 Ga0500609_001844 Ga0500609_001844_435_1940 487
129 3300005262 Ga0065165_1003321 Ga0065165_10033218 488
130 3300025302 Ga0207426_1000554 Ga0207426_100055415 488
131 3300046507 Ga0495606_0031059 Ga0495606_0031059_1934_3439 488
132 3300046524 Ga0495648_0003979 Ga0495648_0003979_10435_11940 488
133 3300046660 Ga0495625_0068283 Ga0495625_0068283_589_2094 488
134 3300046694 Ga0495649_0059019 Ga0495649_0059019_283_1788 488
135 3300048908 Ga0496105_0002621 Ga0496105_0002621_10406_11911 488
136 3300048924 Ga0496121_0032648 Ga0496121_0032648_2321_3841 488
137 3300053087 Ga0500643_000019 Ga0500643_000019_12895_14400 488
138 3300053125 Ga0500618_004319 Ga0500618_004319_64_1596 488
139 3300005436 Ga0070713_100029836 Ga0070713_1000298362 489
140 3300005616 Ga0068852_100011341 Ga0068852_1000113418 489
141 3300005834 Ga0068851_10000771 Ga0068851_1000077114 489
142 3300006175 Ga0070712_100059974 Ga0070712_1000599742 489
143 3300006237 Ga0097621_100016503 Ga0097621_1000165036 489
144 3300006941 Ga0099825_1019011 Ga0099825_10190113 489
145 3300025906 Ga0207699_10011046 Ga0207699_100110461 489
146 3300025915 Ga0207693_10008081 Ga0207693_100080817 489
147 3300025928 Ga0207700_10065605 Ga0207700_100656052 489
148 3300025935 Ga0207709_10062747 Ga0207709_100627472 489
149 3300026023 Ga0207677_10096834 Ga0207677_100968342 489
150 3300026142 Ga0207698_10001212 Ga0207698_100012129 489
151 3300027296 Ga0209389_1000816 Ga0209389_10008165 489
152 3300027361 Ga0209489_106247 Ga0209489_1062475 489
153 3300027363 Ga0209700_100031 Ga0209700_1000315 489
154 3300048927 Ga0496124_0000013 Ga0496124_0000013_192631_194106 489
155 3300031730 Ga0307516_10024016 Ga0307516_100240169 490
156 3300037068 Ga0373925_0031894 Ga0373925_0031894_960_2483 490
157 3300005937 Ga0081455_10025839 Ga0081455_100258392 491
158 3300025261 Ga0209233_1012268 Ga0209233_10122682 491
159 3300048905 Ga0496102_0047072 Ga0496102_0047072_2401_3882 491
160 3300050512 nmdc:mga0n895_82137_c1 nmdc:mga0n895_82137_c1_1000_2520 491
161 iso_pu_bacteria 2511231026 2511387293 491
162 3300005347 Ga0070668_100113213 Ga0070668_1001132131 492
163 3300006038 Ga0075365_10083747 Ga0075365_100837472 492
164 3300033442 Ga0315911_1000009 Ga0315911_1000009368 492
165 3300046530 Ga0495654_0059679 Ga0495654_0059679_39_1544 492
166 3300048908 Ga0496105_0066683 Ga0496105_0066683_193_1698 492
167 3300048929 Ga0496126_0116666 Ga0496126_0116666_346_1851 492
168 3300050492 nmdc:mga0yw44_47146_c1 nmdc:mga0yw44_47146_c1_457_1962 492
169 3300053125 Ga0500618_000423 Ga0500618_000423_14159_15679 492
170 iso_pu_bacteria 2751185800 2753357819 492
171 iso_pu_bacteria 2928521798 2928524863 492
172 iso_pu_bacteria 2954011201 2954011514 492
173 3300005981 Ga0081538_10033760 Ga0081538_100337601 493
174 3300006038 Ga0075365_10000870 Ga0075365_100008708 493
175 3300006177 Ga0075362_10024429 Ga0075362_100244292 493
176 3300046457 Ga0495590_0007217 Ga0495590_0007217_330_1874 493
177 3300046694 Ga0495649_0066655 Ga0495649_0066655_226_1719 493
178 3300047319 Ga0495674_0005696 Ga0495674_0005696_2880_4367 493
179 3300050489 nmdc:mga03683_5300_c1 nmdc:mga03683_5300_c1_1575_3071 493
180 3300050491 nmdc:mga00v17_17576_c1 nmdc:mga00v17_17576_c1_1379_2875 493
181 3300050492 nmdc:mga0yw44_274_c1 nmdc:mga0yw44_274_c1_13229_14725 493
182 iso_pu_bacteria 2854911287 2854915348 493
183 3300005937 Ga0081455_10001166 Ga0081455_1000116627 494
184 3300006058 Ga0075432_10036962 Ga0075432_100369622 494
185 3300042013 Ga0439456_005986 Ga0439456_005986_64_1554 494
186 3300046452 Ga0495617_006936 Ga0495617_006936_1366_2856 494
187 3300046452 Ga0495617_018404 Ga0495617_018404_57_1547 494
188 3300046455 Ga0495603_0000218 Ga0495603_0000218_22870_24360 494
189 3300046459 Ga0495629_0000212 Ga0495629_0000212_24090_25637 494
190 3300046460 Ga0495638_0013179 Ga0495638_0013179_1548_3038 494
191 3300046472 Ga0495580_0002791 Ga0495580_0002791_10160_11704 494
192 3300046472 Ga0495580_0028950 Ga0495580_0028950_1685_3232 494
193 3300046474 Ga0495605_0058845 Ga0495605_0058845_168_1658 494
194 3300046491 Ga0495584_0000261 Ga0495584_0000261_2692_4182 494
195 3300046492 Ga0495585_0000488 Ga0495585_0000488_33711_35201 494
196 3300046499 Ga0495594_0004370 Ga0495594_0004370_297_1787 494
197 3300046506 Ga0495583_0007882 Ga0495583_0007882_4667_6211 494
198 3300046506 Ga0495583_0016627 Ga0495583_0016627_2280_3857 494
199 3300046513 Ga0495616_0000624 Ga0495616_0000624_7956_9446 494
200 3300046515 Ga0495620_0028613 Ga0495620_0028613_61_1605 494
201 3300046516 Ga0495628_0043562 Ga0495628_0043562_1639_3186 494
202 3300046517 Ga0495630_0001776 Ga0495630_0001776_6457_8001 494
203 3300046518 Ga0495631_0000084 Ga0495631_0000084_26181_27671 494
204 3300046518 Ga0495631_0000131 Ga0495631_0000131_34232_35722 494
205 3300046519 Ga0495632_0000144 Ga0495632_0000144_66049_67539 494
206 3300046520 Ga0495637_0000096 Ga0495637_0000096_2463_3953 494
207 3300046522 Ga0495643_0000464 Ga0495643_0000464_6336_7826 494
208 3300046524 Ga0495648_0000702 Ga0495648_0000702_31797_33287 494
209 3300046533 Ga0495640_0071245 Ga0495640_0071245_701_2248 494
210 3300046538 Ga0495609_0000064 Ga0495609_0000064_71733_73223 494
211 3300046557 Ga0495622_0000066 Ga0495622_0000066_84374_85864 494
212 3300046615 Ga0495656_0000014 Ga0495656_0000014_61842_63332 494
213 3300046648 Ga0495611_0068158 Ga0495611_0068158_19_1563 494
214 3300046660 Ga0495625_0000995 Ga0495625_0000995_2463_3953 494
215 3300046665 Ga0495661_0092119 Ga0495661_0092119_80_1624 494
216 3300046674 Ga0495588_0000345 Ga0495588_0000345_17074_18564 494
217 3300046680 Ga0495646_0008486 Ga0495646_0008486_4092_5639 494
218 3300046684 Ga0495669_0000056 Ga0495669_0000056_71284_72774 494
219 3300046689 Ga0495613_0000817 Ga0495613_0000817_18461_19951 494
220 3300046690 Ga0495624_0005712 Ga0495624_0005712_571_2118 494
221 3300046690 Ga0495624_0010608 Ga0495624_0010608_4233_5777 494
222 3300046691 Ga0495670_0024772 Ga0495670_0024772_1275_2765 494
223 3300046692 Ga0495671_0006314 Ga0495671_0006314_4549_6039 494
224 3300046794 Ga0495589_0000320 Ga0495589_0000320_2463_3953 494
225 3300046810 Ga0495660_0000382 Ga0495660_0000382_33762_35252 494
226 3300047319 Ga0495674_0003054 Ga0495674_0003054_3716_5263 494
227 3300047319 Ga0495674_0004663 Ga0495674_0004663_5179_6723 494
228 3300047320 Ga0495672_0000578 Ga0495672_0000578_33852_35342 494
229 3300047323 Ga0495683_0000102 Ga0495683_0000102_19164_20654 494
230 3300047323 Ga0495683_0001188 Ga0495683_0001188_3895_5385 494
231 3300047445 Ga0495677_0000058 Ga0495677_0000058_5573_7063 494
232 3300047446 Ga0495679_000102 Ga0495679_000102_72328_73872 494
233 3300047469 Ga0495673_0000521 Ga0495673_0000521_33852_35342 494
234 3300047673 Ga0495593_0001077 Ga0495593_0001077_5149_6696 494
235 3300048091 Ga0495626_0000110 Ga0495626_0000110_66413_67903 494
236 3300048920 Ga0496117_0017193 Ga0496117_0017193_1723_3267 494
237 3300049459 Ga0495678_000522 Ga0495678_000522_2463_3953 494
238 3300049460 Ga0495682_0000032 Ga0495682_0000032_64801_66291 494
239 3300050513 nmdc:mga0rr50_182223_c1 nmdc:mga0rr50_182223_c1_111_1634 494
240 3300053125 Ga0500618_000988 Ga0500618_000988_8051_9568 494
241 iso_pu_bacteria 2599185210 2599605680 494
242 iso_pu_bacteria 2818991439 2819561257 494
243 iso_pu_bacteria 2919114240 2919119013 494
244 iso_pu_bacteria 2922368715 2922375435 494
245 iso_pu_bacteria 2926754445 2926759502 494
246 iso_pu_bacteria 2979100975 2979101839 494
247 iso_pu_bacteria 2984509177 2984510227 494
248 iso_pu_bacteria 2984518228 2984519069 494
249 iso_pu_bacteria 2984537506 2984538571 494
250 iso_pu_bacteria 2984601300 2984605282 494
251 iso_pu_bacteria 8045864390 8045866518 494
252 3300035724 Ga0373933_0069491 Ga0373933_0069491_254_1741 495
253 3300047472 Ga0495686_0000390 Ga0495686_0000390_51701_53209 495
254 3300048922 Ga0496119_0008464 Ga0496119_0008464_1606_3099 495
255 3300048925 Ga0496122_0003144 Ga0496122_0003144_1167_2660 495
256 3300048925 Ga0496122_0022158 Ga0496122_0022158_1204_2697 495
257 3300048928 Ga0496125_0000083 Ga0496125_0000083_7715_9208 495
258 3300048928 Ga0496125_0090312 Ga0496125_0090312_189_1682 495
259 iso_pu_bacteria 2507262055 2507509967 495
260 iso_pu_bacteria 2508501009 2508543973 495
261 iso_pu_bacteria 2508501042 2508698088 495
262 iso_pu_bacteria 2511231028 2511398906 495
263 iso_pu_bacteria 2513237092 2513627610 495
264 iso_pu_bacteria 2513237094 2513644436 495
265 iso_pu_bacteria 2513237095 2513652257 495
266 iso_pu_bacteria 2513237102 2513700253 495
267 iso_pu_bacteria 2513237104 2513721941 495
268 iso_pu_bacteria 2513237139 2513876064 495
269 iso_pu_bacteria 2513237161 2514011277 495
270 iso_pu_bacteria 2515154112 2515629190 495
271 iso_pu_bacteria 2517093001 2517103280 495
272 iso_pu_bacteria 2524023205 2524438999 495
273 iso_pu_bacteria 2528768022 2528852742 495
274 iso_pu_bacteria 2617270735 2617353450 495
275 iso_pu_bacteria 2617270741 2617378002 495
276 iso_pu_bacteria 2744054633 2745078888 495
277 iso_pu_bacteria 2758568016 2758640416 495
278 iso_pu_bacteria 2791355196 2793060046 495
279 iso_pu_bacteria 2802429603 2805917403 495
280 iso_pu_bacteria 2816332527 2818242482 495
281 iso_pu_bacteria 2824600985 2824608079 495
282 iso_pu_bacteria 2824609381 2824609912 495
283 iso_pu_bacteria 2824617872 2824623112 495
284 iso_pu_bacteria 2824626560 2824634494 495
285 iso_pu_bacteria 2824635225 2824639825 495
286 iso_pu_bacteria 2824644064 2824649525 495
287 iso_pu_bacteria 2824653114 2824655689 495
288 iso_pu_bacteria 2824661429 2824666575 495
289 iso_pu_bacteria 2824671348 2824677938 495
290 iso_pu_bacteria 2824679649 2824685948 495
291 iso_pu_bacteria 2824687955 2824694351 495
292 iso_pu_bacteria 2824696289 2824701997 495
293 iso_pu_bacteria 2824704595 2824710168 495
294 iso_pu_bacteria 2824714736 2824720135 495
295 iso_pu_bacteria 2824723954 2824730067 495
296 iso_pu_bacteria 2824732956 2824738896 495
297 iso_pu_bacteria 2824746037 2824751087 495
298 iso_pu_bacteria 2824753945 2824758099 495
299 iso_pu_bacteria 2824763712 2824766237 495
300 iso_pu_bacteria 2824773399 2824774242 495
301 iso_pu_bacteria 2838122688 2838127587 495
302 iso_pu_bacteria 2841941048 2841941462 495
303 iso_pu_bacteria 2841949485 2841952527 495
304 iso_pu_bacteria 2841957949 2841959545 495
305 iso_pu_bacteria 2841966195 2841967601 495
306 iso_pu_bacteria 2841974524 2841979006 495
307 iso_pu_bacteria 2841983080 2841986548 495
308 iso_pu_bacteria 2842038055 2842038316 495
309 iso_pu_bacteria 2842045827 2842048739 495
310 iso_pu_bacteria 2844315083 2844317788 495
311 iso_pu_bacteria 2847930680 2847934575 495
312 iso_pu_bacteria 2847939898 2847945187 495
313 iso_pu_bacteria 2849076700 2849080633 495
314 iso_pu_bacteria 2857509624 2857510005 495
315 iso_pu_bacteria 2874590934 2874596715 495
316 iso_pu_bacteria 2874612657 2874618275 495
317 iso_pu_bacteria 2874620515 2874623266 495
318 iso_pu_bacteria 2874628541 2874635957 495
319 iso_pu_bacteria 2874645413 2874653056 495
320 iso_pu_bacteria 2876761206 2876766637 495
321 iso_pu_bacteria 2876771140 2876776989 495
322 iso_pu_bacteria 2876818435 2876825261 495
323 iso_pu_bacteria 2879074833 2879081126 495
324 iso_pu_bacteria 2879083081 2879088224 495
325 iso_pu_bacteria 2879099564 2879104040 495
326 iso_pu_bacteria 2879127579 2879130864 495
327 iso_pu_bacteria 2879142872 2879147546 495
328 iso_pu_bacteria 2881364244 2881365623 495
329 iso_pu_bacteria 2881665667 2881671814 495
330 iso_pu_bacteria 2885366525 2885372486 495
331 iso_pu_bacteria 2885409591 2885411791 495
332 iso_pu_bacteria 2888378607 2888382523 495
333 iso_pu_bacteria 2888388044 2888388175 495
334 iso_pu_bacteria 2888419890 2888423100 495
335 iso_pu_bacteria 2903727486 2903735466 495
336 iso_pu_bacteria 2904666416 2904670086 495
337 iso_pu_bacteria 2904711408 2904718411 495
338 iso_pu_bacteria 2906602504 2906607540 495
339 iso_pu_bacteria 2906626472 2906634939 495
340 iso_pu_bacteria 2906643746 2906648975 495
341 iso_pu_bacteria 2908775508 2908778764 495
342 iso_pu_bacteria 2922393267 2922395040 495
343 iso_pu_bacteria 2929615660 2929616172 495
344 iso_pu_bacteria 2929624759 2929624916 495
345 iso_pu_bacteria 2932784394 2932787163 495
346 iso_pu_bacteria 2932794094 2932797377 495
347 iso_pu_bacteria 2932801729 2932804738 495
348 iso_pu_bacteria 2932809354 2932811356 495
349 iso_pu_bacteria 2932818245 2932819771 495
350 iso_pu_bacteria 2932828146 2932835780 495
351 iso_pu_bacteria 2933577622 2933578544 495
352 iso_pu_bacteria 2935608549 2935611128 495
353 iso_pu_bacteria 2935616580 2935618957 495
354 iso_pu_bacteria 2935638405 2935643226 495
355 iso_pu_bacteria 2935648319 2935648557 495
356 iso_pu_bacteria 2935656913 2935657455 495
357 iso_pu_bacteria 2935665750 2935669852 495
358 iso_pu_bacteria 2935675223 2935677007 495
359 iso_pu_bacteria 2935684952 2935693048 495
360 iso_pu_bacteria 2935694250 2935695462 495
361 iso_pu_bacteria 2935703347 2935709429 495
362 iso_pu_bacteria 2935713505 2935719656 495
363 iso_pu_bacteria 2935722832 2935729577 495
364 iso_pu_bacteria 2935732158 2935739539 495
365 iso_pu_bacteria 2935741537 2935748577 495
366 iso_pu_bacteria 2935750917 2935756836 495
367 iso_pu_bacteria 2935760218 2935761176 495
368 iso_pu_bacteria 2935769743 2935771529 495
369 iso_pu_bacteria 2935777560 2935779218 495
370 iso_pu_bacteria 2935785616 2935790812 495
371 iso_pu_bacteria 2935793552 2935799247 495
372 iso_pu_bacteria 2935801545 2935807369 495
373 iso_pu_bacteria 2935810662 2935812509 495
374 iso_pu_bacteria 2935819856 2935820613 495
375 iso_pu_bacteria 2935827899 2935832630 495
376 iso_pu_bacteria 2935837841 2935839291 495
377 iso_pu_bacteria 2935847175 2935849378 495
378 iso_pu_bacteria 2935855204 2935857322 495
379 iso_pu_bacteria 2935864058 2935864851 495
380 iso_pu_bacteria 2935873716 2935876629 495
381 iso_pu_bacteria 2935883170 2935885026 495
382 iso_pu_bacteria 2935908558 2935911847 495
383 iso_pu_bacteria 2935926038 2935928876 495
384 iso_pu_bacteria 2935934488 2935938521 495
385 iso_pu_bacteria 2935942939 2935945587 495
386 iso_pu_bacteria 2935951376 2935954806 495
387 iso_pu_bacteria 2935959822 2935963405 495
388 iso_pu_bacteria 2935967501 2935970693 495
389 iso_pu_bacteria 2935975950 2935979070 495
390 iso_pu_bacteria 2935984226 2935987913 495
391 iso_pu_bacteria 2935992306 2935999019 495
392 iso_pu_bacteria 2936002035 2936008223 495
393 iso_pu_bacteria 2936011229 2936011467 495
394 iso_pu_bacteria 2936019824 2936020062 495
395 iso_pu_bacteria 2936028420 2936028658 495
396 iso_pu_bacteria 2936037263 2936039102 495
397 iso_pu_bacteria 2936046547 2936046785 495
398 iso_pu_bacteria 2936055302 2936058340 495
399 iso_pu_bacteria 2940556831 2940562750 495
400 iso_pu_bacteria 2941531003 2941536425 495
401 iso_pu_bacteria 2941538514 2941539981 495
402 iso_pu_bacteria 3005483717 3005487987 495
403 iso_pu_bacteria 3005506211 3005508681 495
404 iso_pu_bacteria 3005587118 3005590661 495
405 iso_pu_bacteria 3005594810 3005597541 495
406 iso_pu_bacteria 3005710791 3005713563 495
407 iso_pu_bacteria 3005718088 3005720965 495
408 iso_pu_bacteria 8006926726 8006926928 495
409 iso_pu_bacteria 8016511872 8016515043 495
410 iso_pu_bacteria 8016539877 8016540586 495
411 iso_pu_bacteria 8016548790 8016552658 495
412 iso_pu_bacteria 8016557553 8016561036 495
413 iso_pu_bacteria 8016566248 8016574669 495
414 iso_pu_bacteria 8016583857 8016590906 495
415 iso_pu_bacteria 8016595262 8016598896 495
416 iso_pu_bacteria 8016603502 8016612177 495
417 iso_pu_bacteria 8016613128 8016621625 495
418 iso_pu_bacteria 8016622563 8016628336 495
419 iso_pu_bacteria 8016630954 8016632528 495
420 iso_pu_bacteria 8017057580 8017061410 495
421 iso_pu_bacteria 8019530166 8019536030 495
422 iso_pu_bacteria 8019538911 8019543440 495
423 iso_pu_bacteria 8019547302 8019555414 495
424 iso_pu_bacteria 8019576017 8019580885 495
425 iso_pu_bacteria 8019597564 8019602715 495
426 iso_pu_bacteria 8019608314 8019615844 495
427 iso_pu_bacteria 8019619141 8019626577 495
428 iso_pu_bacteria 8019648815 8019656527 495
429 iso_pu_bacteria 8019668869 8019673314 495
430 iso_pu_bacteria 8019678201 8019682812 495
431 iso_pu_bacteria 8019687851 8019688500 495
432 iso_pu_bacteria 8055742211 8055747819 495
433 iso_pu_bacteria 8056967851 8056970033 495
434 3300003203 JGI25406J46586_10001342 JGI25406J46586_100013424 496
435 3300005467 Ga0070706_100122381 Ga0070706_1001223811 496
436 3300005985 Ga0081539_10000726 Ga0081539_1000072631 496
437 3300006048 Ga0075363_100048472 Ga0075363_1000484722 496
438 3300006178 Ga0075367_10070670 Ga0075367_100706702 496
439 3300021384 Ga0213876_10021485 Ga0213876_100214853 496
440 3300021388 Ga0213875_10022106 Ga0213875_100221061 496
441 3300025253 Ga0209677_100702 Ga0209677_1007022 496
442 3300025910 Ga0207684_10210329 Ga0207684_102103291 496
443 3300026089 Ga0207648_10084025 Ga0207648_100840252 496
444 3300039437 Ga0436365_0680043 Ga0436365_0680043_2547_4043 496
445 3300046674 Ga0495588_0010162 Ga0495588_0010162_2320_3822 496
446 3300047470 Ga0495681_0012687 Ga0495681_0012687_1115_2617 496
447 3300048903 Ga0496100_0100928 Ga0496100_0100928_369_1865 496
448 3300048924 Ga0496121_0062474 Ga0496121_0062474_1315_2811 496
449 3300048927 Ga0496124_0139370 Ga0496124_0139370_253_1749 496
450 3300053091 Ga0500647_0041146 Ga0500647_0041146_492_1994 496
451 3300053094 Ga0500566_0000020 Ga0500566_0000020_78860_80362 496
452 3300053095 Ga0500640_018256 Ga0500640_018256_365_1867 496
453 3300053111 Ga0500572_001222 Ga0500572_001222_3736_5238 496
454 3300053122 Ga0500608_023436 Ga0500608_023436_620_2122 496
455 3300053136 Ga0500559_0014071 Ga0500559_0014071_492_1994 496
456 3300053150 Ga0500603_000105 Ga0500603_000105_16398_17900 496
457 3300053159 Ga0500630_003888 Ga0500630_003888_1983_3485 496
458 3300053161 Ga0500634_0011768 Ga0500634_0011768_2432_3931 496
459 3300053162 Ga0500638_022688 Ga0500638_022688_247_1749 496
460 3300053163 Ga0500639_000066 Ga0500639_000066_23672_25174 496
461 iso_pu_bacteria 2857542790 2857543136 496
462 3300003215 JGI25153J46596_10022212 JGI25153J46596_100222122 497
463 3300005458 Ga0070681_10015109 Ga0070681_100151093 497
464 3300005563 Ga0068855_100072497 Ga0068855_1000724974 497
465 3300006931 Ga0097620_100099933 Ga0097620_1000999332 497
466 3300009093 Ga0105240_10202906 Ga0105240_102029062 497
467 3300013296 Ga0157374_10127121 Ga0157374_101271211 497
468 3300025899 Ga0207642_10035148 Ga0207642_100351481 497
469 3300026041 Ga0207639_10005655 Ga0207639_100056555 497
470 3300026116 Ga0207674_10095176 Ga0207674_100951762 497
471 3300039450 Ga0436363_1600596 Ga0436363_1600596_5345_6844 497
472 3300048924 Ga0496121_0137652 Ga0496121_0137652_257_1756 497
473 3300053111 Ga0500572_001274 Ga0500572_001274_2799_4298 497
474 3300053136 Ga0500559_0000491 Ga0500559_0000491_24646_26145 497
475 iso_pu_bacteria 8019638758 8019643750 497
476 3300003659 JGI25404J52841_10001451 JGI25404J52841_100014512 498
477 3300005843 Ga0068860_100006537 Ga0068860_1000065372 498
478 3300005983 Ga0081540_1001469 Ga0081540_100146917 498
479 3300005983 Ga0081540_1018187 Ga0081540_10181873 498
480 3300009101 Ga0105247_10005003 Ga0105247_100050036 498
481 3300009545 Ga0105237_10056348 Ga0105237_100563482 498
482 3300009545 Ga0105237_10207059 Ga0105237_102070592 498
483 3300025900 Ga0207710_10004687 Ga0207710_100046872 498
484 3300028381 Ga0268264_10000035 Ga0268264_10000035220 498
485 3300031507 Ga0307509_10084622 Ga0307509_100846224 498
486 3300031730 Ga0307516_10000729 Ga0307516_100007292 498
487 3300035695 Ga0373927_0053204 Ga0373927_0053204_176_1681 498
488 3300036712 Ga0316584_0069602 Ga0316584_0069602_245_1753 498
489 3300037068 Ga0373925_0009786 Ga0373925_0009786_1995_3500 498
490 3300039438 Ga0436360_1252590 Ga0436360_1252590_11_1519 498
491 3300046454 Ga0495592_0014889 Ga0495592_0014889_498_2006 498
492 3300046515 Ga0495620_0001070 Ga0495620_0001070_4017_5519 498
493 3300046518 Ga0495631_0000005 Ga0495631_0000005_28292_29794 498
494 3300046694 Ga0495649_0023084 Ga0495649_0023084_989_2494 498
495 3300047319 Ga0495674_0004930 Ga0495674_0004930_4880_6448 498
496 3300047443 Ga0495687_000020 Ga0495687_000020_85429_86934 498
497 3300047444 Ga0495675_0034624 Ga0495675_0034624_28_1533 498
498 3300047469 Ga0495673_0005620 Ga0495673_0005620_2628_4130 498
499 3300048919 Ga0496116_0086953 Ga0496116_0086953_292_1797 498
500 3300048921 Ga0496118_0001822 Ga0496118_0001822_2660_4165 498
501 3300048924 Ga0496121_0001443 Ga0496121_0001443_28863_30368 498
502 3300048927 Ga0496124_0008790 Ga0496124_0008790_3432_4937 498
503 3300048929 Ga0496126_0006684 Ga0496126_0006684_8204_9709 498
504 3300049568 Ga0501031_0004352 Ga0501031_0004352_6088_7590 498
505 3300049568 Ga0501031_0008031 Ga0501031_0008031_1815_3317 498
506 3300049569 Ga0501032_0000120 Ga0501032_0000120_23333_24835 498
507 3300049569 Ga0501032_0000224 Ga0501032_0000224_29385_30887 498
508 3300049570 Ga0501033_0000095 Ga0501033_0000095_25896_27398 498
509 3300049570 Ga0501033_0002325 Ga0501033_0002325_2168_3670 498
510 3300049571 Ga0501034_0000061 Ga0501034_0000061_80862_82364 498
511 3300049571 Ga0501034_0001606 Ga0501034_0001606_21685_23187 498
512 3300049572 Ga0501036_0000007 Ga0501036_0000007_66197_67699 498
513 3300049572 Ga0501036_0000054 Ga0501036_0000054_23784_25286 498
514 3300049573 Ga0501037_0000093 Ga0501037_0000093_23424_24926 498
515 3300049573 Ga0501037_0000159 Ga0501037_0000159_29288_30790 498
516 3300049574 Ga0501038_0000028 Ga0501038_0000028_32779_34281 498
517 3300049574 Ga0501038_0000066 Ga0501038_0000066_12303_13805 498
518 3300049575 Ga0501039_0000005 Ga0501039_0000005_184492_185994 498
519 3300049575 Ga0501039_0000142 Ga0501039_0000142_41527_43029 498
520 3300049579 Ga0501043_0000127 Ga0501043_0000127_28266_29768 498
521 3300049579 Ga0501043_0027793 Ga0501043_0027793_833_2335 498
522 3300049580 Ga0501046_0000032 Ga0501046_0000032_109030_110532 498
523 3300049580 Ga0501046_0000487 Ga0501046_0000487_26603_28105 498
524 3300049581 Ga0501047_0000077 Ga0501047_0000077_66089_67591 498
525 3300049581 Ga0501047_0000122 Ga0501047_0000122_74629_76131 498
526 3300049582 Ga0501048_0000053 Ga0501048_0000053_38574_40076 498
527 3300049582 Ga0501048_0000693 Ga0501048_0000693_21844_23346 498
528 3300049583 Ga0501067_0000387 Ga0501067_0000387_12987_14489 498
529 3300049583 Ga0501067_0002215 Ga0501067_0002215_7996_9498 498
530 3300049584 Ga0501068_0000392 Ga0501068_0000392_17923_19425 498
531 3300049584 Ga0501068_0007764 Ga0501068_0007764_551_2053 498
532 3300049585 Ga0501069_0003878 Ga0501069_0003878_5924_7426 498
533 3300049585 Ga0501069_0006700 Ga0501069_0006700_3822_5324 498
534 3300049586 Ga0501070_0000070 Ga0501070_0000070_9361_10863 498
535 3300049586 Ga0501070_0001577 Ga0501070_0001577_3350_4852 498
536 3300049588 Ga0501072_0002094 Ga0501072_0002094_4448_5950 498
537 3300049589 Ga0501073_0000146 Ga0501073_0000146_17506_19008 498
538 3300049589 Ga0501073_0004857 Ga0501073_0004857_2891_4393 498
539 3300049590 Ga0501074_0000712 Ga0501074_0000712_17332_18834 498
540 3300049741 Ga0501079_0010566 Ga0501079_0010566_546_2048 498
541 3300049741 Ga0501079_0027146 Ga0501079_0027146_1676_3178 498
542 3300049742 Ga0501080_0000035 Ga0501080_0000035_25073_26575 498
543 3300049742 Ga0501080_0001268 Ga0501080_0001268_2918_4420 498
544 3300049744 Ga0501083_0001199 Ga0501083_0001199_3842_5344 498
545 3300049744 Ga0501083_0065317 Ga0501083_0065317_576_2078 498
546 3300049822 Ga0501035_0000016 Ga0501035_0000016_126475_127977 498
547 3300049822 Ga0501035_0000099 Ga0501035_0000099_59121_60623 498
548 3300049823 Ga0501044_0000184 Ga0501044_0000184_48032_49534 498
549 3300049823 Ga0501044_0000195 Ga0501044_0000195_16018_17520 498
550 3300049824 Ga0501045_0062682 Ga0501045_0062682_1079_2581 498
551 3300053080 Ga0500635_0001533 Ga0500635_0001533_3298_4803 498
552 3300053097 Ga0500648_018307 Ga0500648_018307_1835_3340 498
553 3300053136 Ga0500559_0012987 Ga0500559_0012987_1447_2952 498
554 3300053140 Ga0500573_0039050 Ga0500573_0039050_656_2161 498
555 3300053154 Ga0500619_009306 Ga0500619_009306_211_1716 498
556 3300053177 Ga0500636_0072687 Ga0500636_0072687_117_1622 498
557 3300053735 Ga0500596_003119 Ga0500596_003119_1028_2533 498
558 3300054114 Ga0501084_0002556 Ga0501084_0002556_3832_5334 498
559 3300060353 Ga0501082_0001454 Ga0501082_0001454_17881_19383 498
560 iso_pu_bacteria 2513237096 2513659274 498
561 iso_pu_bacteria 2513237137 2513862044 498
562 iso_pu_bacteria 2513237145 2513921464 498
563 iso_pu_bacteria 2517572143 2517893780 498
564 iso_pu_bacteria 2524023228 2524537729 498
565 iso_pu_bacteria 2667528175 2671124130 498
566 iso_pu_bacteria 2728368998 2728752925 498
567 iso_pu_bacteria 2791355197 2793070719 498
568 iso_pu_bacteria 2885374607 2885376276 498
569 iso_pu_bacteria 2903748898 2903752935 498
570 iso_pu_bacteria 2904690495 2904691551 498
571 iso_pu_bacteria 2904699407 2904705049 498
572 iso_pu_bacteria 2906610324 2906610666 498
573 iso_pu_bacteria 2906635258 2906641227 498
574 iso_pu_bacteria 2906660503 2906665157 498
575 iso_pu_bacteria 2908739725 2908744189 498
576 iso_pu_bacteria 2908756301 2908761637 498
577 iso_pu_bacteria 2922425934 2922428658 498
578 iso_pu_bacteria 2935630451 2935634629 498
579 iso_pu_bacteria 2941507105 2941509115 498
580 iso_pu_bacteria 2941515067 2941516944 498
581 iso_pu_bacteria 2941523033 2941524961 498
582 iso_pu_bacteria 3005474847 3005478789 498
583 iso_pu_bacteria 8006933436 8006942554 498
584 iso_pu_bacteria 8006973647 8006982278 498
585 iso_pu_bacteria 8019555841 8019558321 498
586 iso_pu_bacteria 8019565922 8019566972 498
587 iso_pu_bacteria 8056689827 8056695943 498
588 3300003215 JGI25153J46596_10001707 JGI25153J46596_100017073 499
589 3300003215 JGI25153J46596_10004084 JGI25153J46596_100040842 499
590 3300003215 JGI25153J46596_10010236 JGI25153J46596_100102362 499
591 3300003354 JGI25160J50197_1002568 JGI25160J50197_10025686 499
592 3300003354 JGI25160J50197_1004939 JGI25160J50197_10049392 499
593 3300003354 JGI25160J50197_1008493 JGI25160J50197_10084933 499
594 3300003794 Ga0055531_10002184 Ga0055531_100021848 499
595 3300005262 Ga0065165_1002008 Ga0065165_10020081 499
596 3300005262 Ga0065165_1007524 Ga0065165_10075242 499
597 3300005344 Ga0070661_100078355 Ga0070661_1000783551 499
598 3300005347 Ga0070668_100074431 Ga0070668_1000744312 499
599 3300005355 Ga0070671_100105789 Ga0070671_1001057892 499
600 3300005455 Ga0070663_100087085 Ga0070663_1000870852 499
601 3300005563 Ga0068855_100307245 Ga0068855_1003072451 499
602 3300005843 Ga0068860_100201716 Ga0068860_1002017162 499
603 3300005983 Ga0081540_1009440 Ga0081540_10094403 499
604 3300006038 Ga0075365_10064309 Ga0075365_100643092 499
605 3300006058 Ga0075432_10006827 Ga0075432_100068272 499
606 3300006178 Ga0075367_10015961 Ga0075367_100159612 499
607 3300006942 Ga0099824_1029633 Ga0099824_10296332 499
608 3300009174 Ga0105241_10168389 Ga0105241_101683892 499
609 3300009176 Ga0105242_10065668 Ga0105242_100656682 499
610 3300009545 Ga0105237_10004145 Ga0105237_100041452 499
611 3300011119 Ga0105246_10014246 Ga0105246_100142463 499
612 3300013306 Ga0163162_10013993 Ga0163162_100139934 499
613 3300021320 Ga0214544_1000006 Ga0214544_1000006356 499
614 3300021321 Ga0214542_1000002 Ga0214542_100000218 499
615 3300021324 Ga0214545_1000002 Ga0214545_1000002701 499
616 3300021327 Ga0214543_1000017 Ga0214543_1000017304 499
617 3300025253 Ga0209677_108937 Ga0209677_1089371 499
618 3300025254 Ga0209148_1000447 Ga0209148_100044728 499
619 3300025261 Ga0209233_1016891 Ga0209233_10168911 499
620 3300025272 Ga0209455_1002262 Ga0209455_10022623 499
621 3300025295 Ga0209564_1023837 Ga0209564_10238371 499
622 3300025297 Ga0209758_1000065 Ga0209758_100006579 499
623 3300025297 Ga0209758_1002429 Ga0209758_10024294 499
624 3300025297 Ga0209758_1002745 Ga0209758_100274513 499
625 3300025297 Ga0209758_1003044 Ga0209758_10030442 499
626 3300025297 Ga0209758_1003360 Ga0209758_10033609 499
627 3300025299 Ga0209256_1004971 Ga0209256_10049714 499
628 3300025302 Ga0207426_1000561 Ga0207426_100056124 499
629 3300025302 Ga0207426_1009233 Ga0207426_10092333 499
630 3300025302 Ga0207426_1020261 Ga0207426_10202612 499
631 3300025304 Ga0209257_1000833 Ga0209257_100083311 499
632 3300025304 Ga0209257_1018232 Ga0209257_10182322 499
633 3300025904 Ga0207647_10013488 Ga0207647_100134882 499
634 3300025913 Ga0207695_10000029 Ga0207695_1000002933 499
635 3300025914 Ga0207671_10096792 Ga0207671_100967922 499
636 3300025972 Ga0207668_10061040 Ga0207668_100610402 499
637 3300026142 Ga0207698_10076642 Ga0207698_100766422 499
638 3300027296 Ga0209389_1000025 Ga0209389_100002552 499
639 3300027357 Ga0209589_1000066 Ga0209589_10000661 499
640 3300027361 Ga0209489_100030 Ga0209489_100030111 499
641 3300037471 Ga0395905_0034838 Ga0395905_0034838_365_1870 499
642 3300039438 Ga0436360_1087539 Ga0436360_1087539_887_2389 499
643 3300039438 Ga0436360_1198791 Ga0436360_1198791_102_1604 499
644 3300044658 Ga0466972_0000174 Ga0466972_0000174_9360_10865 499
645 3300044684 Ga0466966_0000148 Ga0466966_0000148_26114_27619 499
646 3300044693 Ga0466961_0000045 Ga0466961_0000045_57456_58961 499
647 3300044694 Ga0466963_0012884 Ga0466963_0012884_3559_5064 499
648 3300044706 Ga0466964_0009932 Ga0466964_0009932_204_1709 499
649 3300044842 Ga0466957_0036720 Ga0466957_0036720_793_2298 499
650 3300045049 Ga0466959_0006449 Ga0466959_0006449_6201_7706 499
651 3300045976 Ga0466967_0020296 Ga0466967_0020296_378_1883 499
652 3300046452 Ga0495617_002315 Ga0495617_002315_4237_5742 499
653 3300046455 Ga0495603_0004160 Ga0495603_0004160_5343_6848 499
654 3300046460 Ga0495638_0026634 Ga0495638_0026634_1300_2805 499
655 3300046462 Ga0495651_0000472 Ga0495651_0000472_24482_25987 499
656 3300046463 Ga0495653_0134992 Ga0495653_0134992_207_1712 499
657 3300046474 Ga0495605_0004425 Ga0495605_0004425_2905_4410 499
658 3300046491 Ga0495584_0001183 Ga0495584_0001183_12725_14230 499
659 3300046492 Ga0495585_0006478 Ga0495585_0006478_3796_5301 499
660 3300046501 Ga0495607_0010017 Ga0495607_0010017_1842_3347 499
661 3300046506 Ga0495583_0002399 Ga0495583_0002399_3850_5355 499
662 3300046513 Ga0495616_0004386 Ga0495616_0004386_3500_5005 499
663 3300046520 Ga0495637_0008501 Ga0495637_0008501_1184_2689 499
664 3300046522 Ga0495643_0012522 Ga0495643_0012522_3237_4742 499
665 3300046524 Ga0495648_0006268 Ga0495648_0006268_4524_6029 499
666 3300046529 Ga0495652_0001339 Ga0495652_0001339_25057_26562 499
667 3300046642 Ga0495634_0049130 Ga0495634_0049130_927_2432 499
668 3300046660 Ga0495625_0100556 Ga0495625_0100556_130_1635 499
669 3300046663 Ga0495635_0060076 Ga0495635_0060076_144_1649 499
670 3300046664 Ga0495659_0023539 Ga0495659_0023539_366_1871 499
671 3300046679 Ga0495623_0004396 Ga0495623_0004396_2658_4163 499
672 3300046684 Ga0495669_0003449 Ga0495669_0003449_1661_3166 499
673 3300046689 Ga0495613_0063319 Ga0495613_0063319_400_1905 499
674 3300046691 Ga0495670_0002345 Ga0495670_0002345_3898_5403 499
675 3300046692 Ga0495671_0005579 Ga0495671_0005579_1386_2891 499
676 3300046809 Ga0495600_0009711 Ga0495600_0009711_2117_3622 499
677 3300046810 Ga0495660_0004041 Ga0495660_0004041_3796_5301 499
678 3300047317 Ga0495604_0000953 Ga0495604_0000953_21035_22540 499
679 3300047319 Ga0495674_0008322 Ga0495674_0008322_7087_8592 499
680 3300047320 Ga0495672_0006289 Ga0495672_0006289_3942_5447 499
681 3300047322 Ga0495680_0001642 Ga0495680_0001642_11723_13228 499
682 3300047323 Ga0495683_0051951 Ga0495683_0051951_388_1893 499
683 3300047443 Ga0495687_005443 Ga0495687_005443_3052_4557 499
684 3300047469 Ga0495673_0004250 Ga0495673_0004250_3688_5193 499
685 3300048905 Ga0496102_0026901 Ga0496102_0026901_1732_3237 499
686 3300048907 Ga0496104_0102549 Ga0496104_0102549_651_2156 499
687 3300048912 Ga0496109_0173713 Ga0496109_0173713_184_1689 499
688 3300048924 Ga0496121_0051892 Ga0496121_0051892_1736_3241 499
689 3300048928 Ga0496125_0026278 Ga0496125_0026278_268_1773 499
690 3300048928 Ga0496125_0053908 Ga0496125_0053908_1365_2870 499
691 3300049460 Ga0495682_0001908 Ga0495682_0001908_5086_6591 499
692 3300049569 Ga0501032_0100119 Ga0501032_0100119_115_1620 499
693 3300049570 Ga0501033_0092037 Ga0501033_0092037_56_1561 499
694 3300049572 Ga0501036_0147425 Ga0501036_0147425_188_1693 499
695 3300049581 Ga0501047_0093430 Ga0501047_0093430_1275_2780 499
696 3300049822 Ga0501035_0096382 Ga0501035_0096382_827_2332 499
697 3300049823 Ga0501044_0003221 Ga0501044_0003221_3294_4799 499
698 3300050492 nmdc:mga0yw44_39673_c1 nmdc:mga0yw44_39673_c1_156_1661 499
699 3300050493 nmdc:mga0k408_22951_c1 nmdc:mga0k408_22951_c1_965_2470 499
700 3300050494 nmdc:mga06z11_44277_c1 nmdc:mga06z11_44277_c1_51_1556 499
701 3300050496 nmdc:mga07m45_92356_c1 nmdc:mga07m45_92356_c1_50_1555 499
702 3300053079 Ga0500610_0056565 Ga0500610_0056565_46_1551 499
703 3300053094 Ga0500566_0000693 Ga0500566_0000693_8261_9766 499
704 3300053094 Ga0500566_0087109 Ga0500566_0087109_68_1573 499
705 3300053105 Ga0500557_000093 Ga0500557_000093_28598_30103 499
706 3300053130 Ga0500642_0000096 Ga0500642_0000096_17950_19455 499
707 3300053156 Ga0500622_0026034 Ga0500622_0026034_158_1663 499
708 3300053177 Ga0500636_0000645 Ga0500636_0000645_215_1720 499
709 3300053729 Ga0500625_034445 Ga0500625_034445_739_2244 499
710 3300053737 Ga0500601_000120 Ga0500601_000120_82_1587 499
711 iso_pu_bacteria 2508501128 2509147616 499
712 iso_pu_bacteria 2513237098 2513676373 499
713 iso_pu_bacteria 2524023210 2524470282 499
714 iso_pu_bacteria 2602042107 2603861112 499
715 iso_pu_bacteria 2857524615 2857528760 499
716 iso_pu_bacteria 2885383462 2885388009 499
717 iso_pu_bacteria 2889914905 2889915116 499
718 iso_pu_bacteria 2893066018 2893068955 499
719 iso_pu_bacteria 2903768456 2903775953 499
720 iso_pu_bacteria 2919073203 2919079188 499
721 iso_pu_bacteria 8056681323 8056688398 499
722 3300005564 Ga0070664_100003458 Ga0070664_1000034589 500
723 3300005614 Ga0068856_100099568 Ga0068856_1000995681 500
724 3300013307 Ga0157372_10184605 Ga0157372_101846052 500
725 3300037466 Ga0395898_0019758 Ga0395898_0019758_3109_4617 500
726 3300038443 Ga0395901_0065415 Ga0395901_0065415_2012_3520 500
727 3300048905 Ga0496102_0006702 Ga0496102_0006702_3300_4853 500
728 iso_pu_bacteria 2791355199 2793083275 500
729 iso_pu_bacteria 8056673599 8056680294 500
730 3300028573 Ga0265334_10000799 Ga0265334_100007992 501
731 3300028654 Ga0265322_10016431 Ga0265322_100164312 501
732 3300028666 Ga0265336_10000233 Ga0265336_1000023310 501
733 3300028800 Ga0265338_10000090 Ga0265338_1000009027 501
734 3300037312 Ga0395899_0007418 Ga0395899_0007418_1534_3102 501
735 3300037418 Ga0395900_0000389 Ga0395900_0000389_35517_37085 501
736 3300037466 Ga0395898_0000866 Ga0395898_0000866_40302_41870 501
737 3300038443 Ga0395901_0000164 Ga0395901_0000164_54484_56052 501
738 iso_pu_bacteria 2922386360 2922388107 501
739 iso_pu_bacteria 2937843397 2937843660 501
740 3300005336 Ga0070680_100046107 Ga0070680_1000461072 502
741 3300005458 Ga0070681_10034264 Ga0070681_100342642 502
742 3300005530 Ga0070679_100042340 Ga0070679_1000423402 502
743 3300006942 Ga0099824_1013886 Ga0099824_10138866 502
744 3300006943 Ga0099822_1020952 Ga0099822_10209525 502
745 3300009093 Ga0105240_10067855 Ga0105240_100678552 502
746 3300013105 Ga0157369_10003596 Ga0157369_100035967 502
747 3300013105 Ga0157369_10082983 Ga0157369_100829832 502
748 3300025912 Ga0207707_10000651 Ga0207707_100006517 502
749 3300025917 Ga0207660_10022691 Ga0207660_100226913 502
750 3300025921 Ga0207652_10049932 Ga0207652_100499322 502
751 3300025924 Ga0207694_10091407 Ga0207694_100914072 502
752 3300025949 Ga0207667_10124233 Ga0207667_101242332 502
753 3300027357 Ga0209589_1000009 Ga0209589_1000009244 502
754 3300027361 Ga0209489_100010 Ga0209489_10001026 502
755 3300027363 Ga0209700_100017 Ga0209700_10001726 502
756 3300028794 Ga0307515_10055923 Ga0307515_100559232 502
757 3300035116 Ga0373945_0003375 Ga0373945_0003375_3484_5004 502
758 3300037068 Ga0373925_0055739 Ga0373925_0055739_697_2217 502
759 3300037466 Ga0395898_0029402 Ga0395898_0029402_1004_2524 502
760 3300038443 Ga0395901_0049817 Ga0395901_0049817_2507_4027 502
761 3300046477 Ga0495664_0034625 Ga0495664_0034625_309_1829 502
762 3300047470 Ga0495681_0000009 Ga0495681_0000009_5764_7314 502
763 3300049823 Ga0501044_0172289 Ga0501044_0172289_123_1649 502
764 iso_pu_bacteria 2876808645 2876811727 502
765 iso_pu_bacteria 2879110137 2879118789 502
766 iso_pu_bacteria 2889033259 2889039179 502
767 iso_pu_bacteria 8006984368 8006991945 502
768 3300005329 Ga0070683_100049783 Ga0070683_1000497832 503
769 3300005336 Ga0070680_100058029 Ga0070680_1000580292 503
770 3300005434 Ga0070709_10067655 Ga0070709_100676552 503
771 3300005436 Ga0070713_100002066 Ga0070713_1000020669 503
772 3300005439 Ga0070711_100005920 Ga0070711_1000059203 503
773 3300005535 Ga0070684_100035959 Ga0070684_1000359592 503
774 3300005563 Ga0068855_100028293 Ga0068855_1000282933 503
775 3300005983 Ga0081540_1001357 Ga0081540_10013573 503
776 3300005983 Ga0081540_1001498 Ga0081540_100149821 503
777 3300006028 Ga0070717_10029723 Ga0070717_100297232 503
778 3300006048 Ga0075363_100086644 Ga0075363_1000866441 503
779 3300006051 Ga0075364_10063952 Ga0075364_100639522 503
780 3300006175 Ga0070712_100014857 Ga0070712_1000148574 503
781 3300006175 Ga0070712_100105048 Ga0070712_1001050482 503
782 3300009545 Ga0105237_10128168 Ga0105237_101281682 503
783 3300009551 Ga0105238_10135032 Ga0105238_101350322 503
784 3300013296 Ga0157374_10044291 Ga0157374_100442912 503
785 3300014326 Ga0157380_10180902 Ga0157380_101809021 503
786 3300021384 Ga0213876_10046688 Ga0213876_100466882 503
787 3300025295 Ga0209564_1000297 Ga0209564_100029730 503
788 3300025295 Ga0209564_1007203 Ga0209564_10072032 503
789 3300025914 Ga0207671_10091726 Ga0207671_100917261 503
790 3300025915 Ga0207693_10014710 Ga0207693_100147102 503
791 3300025915 Ga0207693_10101873 Ga0207693_101018731 503
792 3300025916 Ga0207663_10036415 Ga0207663_100364152 503
793 3300025924 Ga0207694_10124154 Ga0207694_101241542 503
794 3300025929 Ga0207664_10013136 Ga0207664_100131363 503
795 3300025929 Ga0207664_10082346 Ga0207664_100823462 503
796 3300025944 Ga0207661_10005660 Ga0207661_100056602 503
797 3300025944 Ga0207661_10052910 Ga0207661_100529102 503
798 3300031247 Ga0265340_10001013 Ga0265340_1000101311 503
799 3300031250 Ga0265331_10015572 Ga0265331_100155722 503
800 3300031616 Ga0307508_10000532 Ga0307508_1000053214 503
801 3300031712 Ga0265342_10021950 Ga0265342_100219503 503
802 3300035089 Ga0373944_0006585 Ga0373944_0006585_628_2151 503
803 3300035113 Ga0373936_0008646 Ga0373936_0008646_1324_2847 503
804 3300035118 Ga0373954_0002845 Ga0373954_0002845_4665_6188 503
805 3300035118 Ga0373954_0012478 Ga0373954_0012478_1895_3418 503
806 3300035119 Ga0373956_0003275 Ga0373956_0003275_4866_6389 503
807 3300035170 Ga0373943_0004027 Ga0373943_0004027_1683_3206 503
808 3300035171 Ga0373946_0005405 Ga0373946_0005405_864_2387 503
809 3300035172 Ga0373955_0000447 Ga0373955_0000447_5913_7436 503
810 3300035695 Ga0373927_0016156 Ga0373927_0016156_3209_4732 503
811 3300035695 Ga0373927_0018206 Ga0373927_0018206_2656_4179 503
812 3300035724 Ga0373933_0000167 Ga0373933_0000167_29016_30539 503
813 3300035724 Ga0373933_0002005 Ga0373933_0002005_9406_10929 503
814 3300035725 Ga0373947_0027440 Ga0373947_0027440_356_1879 503
815 3300039437 Ga0436365_1888691 Ga0436365_1888691_827_2350 503
816 3300045836 Ga0466958_0076522 Ga0466958_0076522_447_1970 503
817 3300046454 Ga0495592_0001539 Ga0495592_0001539_10204_11727 503
818 3300046459 Ga0495629_0001699 Ga0495629_0001699_9024_10547 503
819 3300046460 Ga0495638_0010390 Ga0495638_0010390_4933_6456 503
820 3300046460 Ga0495638_0077243 Ga0495638_0077243_490_2013 503
821 3300046463 Ga0495653_0011183 Ga0495653_0011183_636_2159 503
822 3300046472 Ga0495580_0053004 Ga0495580_0053004_41_1564 503
823 3300046511 Ga0495608_0002196 Ga0495608_0002196_4766_6289 503
824 3300046512 Ga0495610_0040644 Ga0495610_0040644_15_1538 503
825 3300046514 Ga0495618_0016659 Ga0495618_0016659_1610_3133 503
826 3300046515 Ga0495620_0015393 Ga0495620_0015393_174_1697 503
827 3300046516 Ga0495628_0031144 Ga0495628_0031144_307_1830 503
828 3300046531 Ga0495665_0012624 Ga0495665_0012624_1275_2798 503
829 3300046533 Ga0495640_0016526 Ga0495640_0016526_1103_2626 503
830 3300046535 Ga0495586_0021029 Ga0495586_0021029_1737_3260 503
831 3300046536 Ga0495587_0012034 Ga0495587_0012034_813_2336 503
832 3300046543 Ga0495645_0011172 Ga0495645_0011172_3261_4784 503
833 3300046559 Ga0495667_0001807 Ga0495667_0001807_9428_10951 503
834 3300046559 Ga0495667_0045297 Ga0495667_0045297_1272_2795 503
835 3300046642 Ga0495634_0016913 Ga0495634_0016913_1001_2524 503
836 3300046663 Ga0495635_0000989 Ga0495635_0000989_2299_3822 503
837 3300046675 Ga0495657_0001505 Ga0495657_0001505_3833_5356 503
838 3300046679 Ga0495623_0002081 Ga0495623_0002081_4205_5728 503
839 3300046683 Ga0495658_0009739 Ga0495658_0009739_1518_3041 503
840 3300046689 Ga0495613_0017612 Ga0495613_0017612_1610_3133 503
841 3300046689 Ga0495613_0029342 Ga0495613_0029342_1447_2970 503
842 3300046809 Ga0495600_0003220 Ga0495600_0003220_5857_7380 503
843 3300047319 Ga0495674_0019530 Ga0495674_0019530_1907_3430 503
844 3300047319 Ga0495674_0045274 Ga0495674_0045274_752_2275 503
845 3300047322 Ga0495680_0001893 Ga0495680_0001893_1631_3154 503
846 3300047444 Ga0495675_0004647 Ga0495675_0004647_813_2336 503
847 3300047471 Ga0495684_0001724 Ga0495684_0001724_10572_12095 503
848 3300047472 Ga0495686_0016459 Ga0495686_0016459_2005_3528 503
849 3300048915 Ga0496112_0279222 Ga0496112_0279222_48_1571 503
850 3300048919 Ga0496116_0003781 Ga0496116_0003781_10465_11988 503
851 3300048920 Ga0496117_0100286 Ga0496117_0100286_68_1591 503
852 3300048921 Ga0496118_0075119 Ga0496118_0075119_439_1962 503
853 3300048924 Ga0496121_0006578 Ga0496121_0006578_11836_13359 503
854 3300048925 Ga0496122_0025193 Ga0496122_0025193_1446_2969 503
855 3300048925 Ga0496122_0026336 Ga0496122_0026336_1308_2831 503
856 3300048926 Ga0496123_0020781 Ga0496123_0020781_2857_4380 503
857 3300048926 Ga0496123_0034230 Ga0496123_0034230_414_1937 503
858 3300048928 Ga0496125_0009813 Ga0496125_0009813_291_1814 503
859 3300048929 Ga0496126_0013694 Ga0496126_0013694_347_1870 503
860 3300048929 Ga0496126_0025148 Ga0496126_0025148_833_2356 503
861 3300053085 Ga0495619_0000394 Ga0495619_0000394_20645_22168 503
862 3300053087 Ga0500643_009059 Ga0500643_009059_206_1729 503
863 3300053094 Ga0500566_0004708 Ga0500566_0004708_4503_6026 503
864 3300053098 Ga0500650_0054909 Ga0500650_0054909_175_1698 503
865 3300053104 Ga0500556_0000024 Ga0500556_0000024_63923_65446 503
866 3300053122 Ga0500608_001404 Ga0500608_001404_5987_7510 503
867 3300053130 Ga0500642_0000035 Ga0500642_0000035_72381_73904 503
868 3300053136 Ga0500559_0000520 Ga0500559_0000520_22049_23572 503
869 3300053139 Ga0500568_0005882 Ga0500568_0005882_2489_4012 503
870 3300053151 Ga0500604_0029999 Ga0500604_0029999_14_1537 503
871 3300053153 Ga0500616_0000122 Ga0500616_0000122_66744_68267 503
872 3300053156 Ga0500622_0000790 Ga0500622_0000790_17831_19354 503
873 3300053157 Ga0500624_002474 Ga0500624_002474_681_2204 503
874 3300053177 Ga0500636_0003147 Ga0500636_0003147_2414_3937 503
875 iso_pu_bacteria 2513237101 2513696088 503
876 iso_pu_bacteria 2721755755 2723846323 503
877 iso_pu_bacteria 2874604998 2874610709 503
878 iso_pu_bacteria 2922361189 2922362129 503
879 iso_pu_bacteria 8006964411 8006964704 503
880 iso_pu_bacteria 8006994254 8006999877 503
881 3300013297 Ga0157378_10155219 Ga0157378_101552192 504
882 3300048919 Ga0496116_0059662 Ga0496116_0059662_857_2389 504
883 3300048920 Ga0496117_0034099 Ga0496117_0034099_578_2110 504
884 3300048922 Ga0496119_0006070 Ga0496119_0006070_7886_9418 504
885 3300048924 Ga0496121_0000508 Ga0496121_0000508_8663_10195 504
886 3300048926 Ga0496123_0052065 Ga0496123_0052065_363_1895 504
887 3300048927 Ga0496124_0037214 Ga0496124_0037214_669_2201 504
888 3300048928 Ga0496125_0002637 Ga0496125_0002637_19391_20923 504
889 3300048929 Ga0496126_0008250 Ga0496126_0008250_9667_11199 504
890 iso_pu_bacteria 2941479691 2941484574 504
891 3300006028 Ga0070717_10050429 Ga0070717_100504293 505
892 3300026142 Ga0207698_10188548 Ga0207698_101885481 505
893 3300028786 Ga0307517_10000062 Ga0307517_1000006240 505
894 3300029957 Ga0265324_10008187 Ga0265324_100081872 505
895 3300046512 Ga0495610_0060308 Ga0495610_0060308_171_1700 505
896 3300005334 Ga0068869_100129333 Ga0068869_1001293332 506
897 3300005338 Ga0068868_100038322 Ga0068868_1000383222 506
898 3300005367 Ga0070667_100108652 Ga0070667_1001086522 506
899 3300005434 Ga0070709_10005063 Ga0070709_100050635 506
900 3300005435 Ga0070714_100022534 Ga0070714_1000225342 506
901 3300005436 Ga0070713_100004489 Ga0070713_1000044892 506
902 3300005437 Ga0070710_10024959 Ga0070710_100249592 506
903 3300005455 Ga0070663_100015939 Ga0070663_1000159393 506
904 3300005530 Ga0070679_100031660 Ga0070679_1000316603 506
905 3300005545 Ga0070695_100068298 Ga0070695_1000682982 506
906 3300005547 Ga0070693_100028334 Ga0070693_1000283342 506
907 3300005548 Ga0070665_100006755 Ga0070665_1000067556 506
908 3300005617 Ga0068859_100141303 Ga0068859_1001413032 506
909 3300006028 Ga0070717_10008134 Ga0070717_100081342 506
910 3300006038 Ga0075365_10070545 Ga0075365_100705452 506
911 3300006051 Ga0075364_10122938 Ga0075364_101229381 506
912 3300006173 Ga0070716_100046089 Ga0070716_1000460892 506
913 3300006178 Ga0075367_10002487 Ga0075367_100024871 506
914 3300006353 Ga0075370_10013261 Ga0075370_100132612 506
915 3300006931 Ga0097620_100141293 Ga0097620_1001412932 506
916 3300007076 Ga0075435_100158514 Ga0075435_1001585141 506
917 3300011119 Ga0105246_10006170 Ga0105246_100061702 506
918 3300013296 Ga0157374_10004665 Ga0157374_100046653 506
919 3300025898 Ga0207692_10002707 Ga0207692_100027073 506
920 3300025906 Ga0207699_10002964 Ga0207699_100029646 506
921 3300025911 Ga0207654_10040566 Ga0207654_100405661 506
922 3300025913 Ga0207695_10118638 Ga0207695_101186382 506
923 3300025914 Ga0207671_10025690 Ga0207671_100256902 506
924 3300025915 Ga0207693_10002906 Ga0207693_100029064 506
925 3300025916 Ga0207663_10001131 Ga0207663_100011317 506
926 3300025919 Ga0207657_10166374 Ga0207657_101663742 506
927 3300025921 Ga0207652_10083886 Ga0207652_100838861 506
928 3300025928 Ga0207700_10030126 Ga0207700_100301262 506
929 3300025929 Ga0207664_10057524 Ga0207664_100575242 506
930 3300025939 Ga0207665_10000992 Ga0207665_1000099212 506
931 3300025941 Ga0207711_10230442 Ga0207711_102304422 506
932 3300025949 Ga0207667_10018352 Ga0207667_100183526 506
933 3300026023 Ga0207677_10042614 Ga0207677_100426142 506
934 3300026035 Ga0207703_10051198 Ga0207703_100511982 506
935 3300026067 Ga0207678_10009091 Ga0207678_100090916 506
936 3300026118 Ga0207675_100075226 Ga0207675_1000752262 506
937 3300028379 Ga0268266_10001147 Ga0268266_1000114732 506
938 3300028379 Ga0268266_10093105 Ga0268266_100931052 506
939 3300033180 Ga0307510_10026250 Ga0307510_100262503 506
940 3300046455 Ga0495603_0004383 Ga0495603_0004383_4123_5655 506
941 3300046474 Ga0495605_0042933 Ga0495605_0042933_310_1842 506
942 3300046809 Ga0495600_0028149 Ga0495600_0028149_563_2095 506
943 3300048906 Ga0496103_0105833 Ga0496103_0105833_210_1742 506
944 3300048907 Ga0496104_0004724 Ga0496104_0004724_1761_3284 506
945 3300048909 Ga0496106_0002433 Ga0496106_0002433_2781_4304 506
946 3300048912 Ga0496109_0162099 Ga0496109_0162099_173_1705 506
947 3300048912 Ga0496109_0203387 Ga0496109_0203387_303_1835 506
948 3300048915 Ga0496112_0011656 Ga0496112_0011656_3998_5521 506
949 3300048916 Ga0496113_0039842 Ga0496113_0039842_584_2107 506
950 3300048922 Ga0496119_0068261 Ga0496119_0068261_374_1906 506
951 3300048929 Ga0496126_0064742 Ga0496126_0064742_668_2200 506
952 3300050490 nmdc:mga03n38_31072_c1 nmdc:mga03n38_31072_c1_595_2127 506
953 3300050491 nmdc:mga00v17_63532_c1 nmdc:mga00v17_63532_c1_95_1627 506
954 3300050492 nmdc:mga0yw44_57800_c1 nmdc:mga0yw44_57800_c1_324_1856 506
955 3300050494 nmdc:mga06z11_1702_c1 nmdc:mga06z11_1702_c1_745_2277 506
956 3300053119 Ga0500595_000478 Ga0500595_000478_2884_4410 506
957 3300053119 Ga0500595_007973 Ga0500595_007973_46_1578 506
958 3300053162 Ga0500638_009264 Ga0500638_009264_1235_2761 506
959 3300002077 JGI24744J21845_10011354 JGI24744J21845_100113542 507
960 3300003203 JGI25406J46586_10000169 JGI25406J46586_1000016926 507
961 3300003203 JGI25406J46586_10000649 JGI25406J46586_100006497 507
962 3300005329 Ga0070683_100044792 Ga0070683_1000447922 507
963 3300005336 Ga0070680_100037772 Ga0070680_1000377721 507
964 3300005338 Ga0068868_100020908 Ga0068868_1000209082 507
965 3300005353 Ga0070669_100060185 Ga0070669_1000601852 507
966 3300005356 Ga0070674_100053339 Ga0070674_1000533391 507
967 3300005455 Ga0070663_100081614 Ga0070663_1000816142 507
968 3300005456 Ga0070678_100008476 Ga0070678_1000084762 507
969 3300005456 Ga0070678_100052451 Ga0070678_1000524512 507
970 3300005535 Ga0070684_100058437 Ga0070684_1000584372 507
971 3300005536 Ga0070697_100190378 Ga0070697_1001903781 507
972 3300005539 Ga0068853_100132821 Ga0068853_1001328211 507
973 3300005577 Ga0068857_100058949 Ga0068857_1000589492 507
974 3300005719 Ga0068861_100160396 Ga0068861_1001603962 507
975 3300005834 Ga0068851_10024448 Ga0068851_100244483 507
976 3300005843 Ga0068860_100085166 Ga0068860_1000851662 507
977 3300005844 Ga0068862_100055462 Ga0068862_1000554622 507
978 3300005985 Ga0081539_10000255 Ga0081539_1000025537 507
979 3300006038 Ga0075365_10044251 Ga0075365_100442512 507
980 3300006186 Ga0075369_10020895 Ga0075369_100208951 507
981 3300006844 Ga0075428_100020068 Ga0075428_1000200682 507
982 3300009093 Ga0105240_10038362 Ga0105240_100383624 507
983 3300009098 Ga0105245_10114917 Ga0105245_101149172 507
984 3300009545 Ga0105237_10259140 Ga0105237_102591401 507
985 3300009551 Ga0105238_10212635 Ga0105238_102126351 507
986 3300010375 Ga0105239_10048668 Ga0105239_100486684 507
987 3300010375 Ga0105239_10144726 Ga0105239_101447262 507
988 3300013105 Ga0157369_10012022 Ga0157369_100120227 507
989 3300013306 Ga0163162_10202611 Ga0163162_102026112 507
990 3300013308 Ga0157375_10037439 Ga0157375_100374392 507
991 3300014325 Ga0163163_10011640 Ga0163163_100116403 507
992 3300014969 Ga0157376_10019248 Ga0157376_100192484 507
993 3300017792 Ga0163161_10064550 Ga0163161_100645502 507
994 3300025321 Ga0207656_10010990 Ga0207656_100109902 507
995 3300025903 Ga0207680_10069878 Ga0207680_100698782 507
996 3300025907 Ga0207645_10043527 Ga0207645_100435272 507
997 3300025913 Ga0207695_10036024 Ga0207695_100360242 507
998 3300025917 Ga0207660_10056560 Ga0207660_100565602 507
999 3300025919 Ga0207657_10055848 Ga0207657_100558482 507
1000 3300025920 Ga0207649_10078786 Ga0207649_100787862 507
1001 3300025921 Ga0207652_10023063 Ga0207652_100230633 507
1002 3300025933 Ga0207706_10022063 Ga0207706_100220631 507
1003 3300025937 Ga0207669_10073397 Ga0207669_100733971 507
1004 3300025940 Ga0207691_10147122 Ga0207691_101471222 507
1005 3300025944 Ga0207661_10071279 Ga0207661_100712792 507
1006 3300025961 Ga0207712_10022487 Ga0207712_100224873 507
1007 3300026023 Ga0207677_10022522 Ga0207677_100225222 507
1008 3300026067 Ga0207678_10009739 Ga0207678_100097395 507
1009 3300026067 Ga0207678_10088930 Ga0207678_100889302 507
1010 3300026075 Ga0207708_10097383 Ga0207708_100973832 507
1011 3300026118 Ga0207675_100047548 Ga0207675_1000475483 507
1012 3300026121 Ga0207683_10016780 Ga0207683_100167805 507
1013 3300026121 Ga0207683_10092470 Ga0207683_100924702 507
1014 3300028379 Ga0268266_10054868 Ga0268266_100548682 507
1015 3300031250 Ga0265331_10016079 Ga0265331_100160792 507
1016 3300031712 Ga0265342_10006201 Ga0265342_100062015 507
1017 3300031730 Ga0307516_10009547 Ga0307516_100095475 507
1018 3300033180 Ga0307510_10064553 Ga0307510_100645532 507
1019 3300035118 Ga0373954_0040555 Ga0373954_0040555_238_1773 507
1020 3300035691 Ga0373931_0000976 Ga0373931_0000976_4966_6501 507
1021 3300035692 Ga0373935_0002539 Ga0373935_0002539_4069_5622 507
1022 3300035695 Ga0373927_0000308 Ga0373927_0000308_29731_31284 507
1023 3300035695 Ga0373927_0010106 Ga0373927_0010106_3400_4935 507
1024 3300035695 Ga0373927_0019139 Ga0373927_0019139_2777_4312 507
1025 3300035724 Ga0373933_0016932 Ga0373933_0016932_2532_4067 507
1026 3300035724 Ga0373933_0063611 Ga0373933_0063611_570_2123 507
1027 3300035725 Ga0373947_0026735 Ga0373947_0026735_274_1809 507
1028 3300036401 Ga0373937_0032108 Ga0373937_0032108_1405_2940 507
1029 3300037068 Ga0373925_0002838 Ga0373925_0002838_3293_4846 507
1030 3300037068 Ga0373925_0095091 Ga0373925_0095091_314_1849 507
1031 3300046455 Ga0495603_0000229 Ga0495603_0000229_26222_27775 507
1032 3300046459 Ga0495629_0000170 Ga0495629_0000170_15835_17388 507
1033 3300046461 Ga0495641_0002021 Ga0495641_0002021_5095_6648 507
1034 3300046463 Ga0495653_0030645 Ga0495653_0030645_1809_3344 507
1035 3300046472 Ga0495580_0006642 Ga0495580_0006642_7546_9099 507
1036 3300046473 Ga0495582_0000053 Ga0495582_0000053_12918_14471 507
1037 3300046475 Ga0495639_0000057 Ga0495639_0000057_27973_29526 507
1038 3300046476 Ga0495662_0000754 Ga0495662_0000754_8843_10396 507
1039 3300046477 Ga0495664_0010021 Ga0495664_0010021_403_1956 507
1040 3300046499 Ga0495594_0000460 Ga0495594_0000460_3128_4681 507
1041 3300046507 Ga0495606_0004247 Ga0495606_0004247_2820_4433 507
1042 3300046516 Ga0495628_0016571 Ga0495628_0016571_2519_4054 507
1043 3300046517 Ga0495630_0001122 Ga0495630_0001122_10058_11611 507
1044 3300046531 Ga0495665_0000197 Ga0495665_0000197_3140_4693 507
1045 3300046533 Ga0495640_0006354 Ga0495640_0006354_2278_3831 507
1046 3300046536 Ga0495587_0009632 Ga0495587_0009632_10_1545 507
1047 3300046543 Ga0495645_0014222 Ga0495645_0014222_3414_4949 507
1048 3300046557 Ga0495622_0003160 Ga0495622_0003160_4011_5564 507
1049 3300046559 Ga0495667_0047982 Ga0495667_0047982_772_2307 507
1050 3300046642 Ga0495634_0001079 Ga0495634_0001079_16051_17604 507
1051 3300046663 Ga0495635_0000738 Ga0495635_0000738_13092_14645 507
1052 3300046680 Ga0495646_0006464 Ga0495646_0006464_805_2358 507
1053 3300046680 Ga0495646_0028359 Ga0495646_0028359_544_2079 507
1054 3300046681 Ga0495647_0010372 Ga0495647_0010372_293_1846 507
1055 3300046683 Ga0495658_0000217 Ga0495658_0000217_11558_13111 507
1056 3300046689 Ga0495613_0012678 Ga0495613_0012678_2819_4372 507
1057 3300046690 Ga0495624_0000394 Ga0495624_0000394_13009_14562 507
1058 3300047319 Ga0495674_0001522 Ga0495674_0001522_3199_4752 507
1059 3300047320 Ga0495672_0039774 Ga0495672_0039774_986_2533 507
1060 3300047321 Ga0495676_0054211 Ga0495676_0054211_1140_2675 507
1061 3300047471 Ga0495684_0031222 Ga0495684_0031222_1849_3402 507
1062 3300047673 Ga0495593_0000177 Ga0495593_0000177_26944_28497 507
1063 3300048904 Ga0496101_0006174 Ga0496101_0006174_3339_4874 507
1064 3300048904 Ga0496101_0016503 Ga0496101_0016503_2381_3916 507
1065 3300048905 Ga0496102_0023707 Ga0496102_0023707_907_2442 507
1066 3300048906 Ga0496103_0009134 Ga0496103_0009134_333_1868 507
1067 3300048906 Ga0496103_0022467 Ga0496103_0022467_1952_3487 507
1068 3300048907 Ga0496104_0026572 Ga0496104_0026572_2372_3907 507
1069 3300048907 Ga0496104_0045567 Ga0496104_0045567_243_1778 507
1070 3300048909 Ga0496106_0010607 Ga0496106_0010607_4255_5790 507
1071 3300048909 Ga0496106_0037669 Ga0496106_0037669_104_1639 507
1072 3300048910 Ga0496107_0001854 Ga0496107_0001854_8314_9849 507
1073 3300048911 Ga0496108_0154968 Ga0496108_0154968_79_1614 507
1074 3300048912 Ga0496109_0099716 Ga0496109_0099716_383_1918 507
1075 3300048913 Ga0496110_0014673 Ga0496110_0014673_2877_4412 507
1076 3300048914 Ga0496111_0024893 Ga0496111_0024893_351_1886 507
1077 3300048915 Ga0496112_0000016 Ga0496112_0000016_93825_95357 507
1078 3300048917 Ga0496114_0003242 Ga0496114_0003242_8355_9890 507
1079 3300048917 Ga0496114_0096266 Ga0496114_0096266_224_1747 507
1080 3300048918 Ga0496115_0011689 Ga0496115_0011689_4364_6031 507
1081 3300048923 Ga0496120_0085948 Ga0496120_0085948_141_1673 507
1082 3300048924 Ga0496121_0001527 Ga0496121_0001527_25035_26582 507
1083 3300048924 Ga0496121_0005628 Ga0496121_0005628_9057_10589 507
1084 3300048929 Ga0496126_0009337 Ga0496126_0009337_5918_7453 507
1085 3300048929 Ga0496126_0069891 Ga0496126_0069891_126_1661 507
1086 3300048929 Ga0496126_0073087 Ga0496126_0073087_1270_2832 507
1087 3300050489 nmdc:mga03683_9545_c1 nmdc:mga03683_9545_c1_521_2056 507
1088 3300050507 nmdc:mga05p37_35437_c1 nmdc:mga05p37_35437_c1_3207_4742 507
1089 3300053077 Ga0495601_0020614 Ga0495601_0020614_1796_3331 507
1090 3300053077 Ga0495601_0037498 Ga0495601_0037498_324_1859 507
1091 3300053080 Ga0500635_0000788 Ga0500635_0000788_4789_6321 507
1092 3300053085 Ga0495619_0009011 Ga0495619_0009011_1587_3140 507
1093 3300053085 Ga0495619_0058270 Ga0495619_0058270_648_2183 507
1094 3300053119 Ga0500595_005213 Ga0500595_005213_1455_2987 507
1095 3300053119 Ga0500595_008884 Ga0500595_008884_1842_3374 507
1096 3300053130 Ga0500642_0003238 Ga0500642_0003238_544_2076 507
1097 3300053150 Ga0500603_000891 Ga0500603_000891_3468_5000 507
1098 3300053178 Ga0500637_0004444 Ga0500637_0004444_1154_2686 507

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07171

MlrC_C

MlrC C-terminus

306

479

0.99

PF07364

DUF1485

Metallopeptidase family M81

3

294

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iuu-assembly1.cif.gz_A crystal structure of putative metallopeptidase (yp_676511.1) from mesorhizobium sp. bnc1 at 2.13 a resolution 0.9081 2 486
7ylq-assembly1.cif.gz_A crystal structure of microcystinase c from sphingomonas sp. acm-3962 at 2.6 a resolution 0.8714 2 500
3iuu-assembly1.cif.gz_A crystal structure of putative metallopeptidase (yp_676511.1) from mesorhizobium sp. bnc1 at 2.13 a resolution 0.8667 2 486
7ylq-assembly1.cif.gz_A crystal structure of microcystinase c from sphingomonas sp. acm-3962 at 2.6 a resolution 0.8629 2 500
7ylq-assembly1.cif.gz_B crystal structure of microcystinase c from sphingomonas sp. acm-3962 at 2.6 a resolution 0.7714 1 497
ID Description Score Start End Superfamily
3i42A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6627 1 190 3.40.50.2300
3i42A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6596 1 190 3.40.50.2300
2wp4B00 Alpha Beta;Alpha-Beta Complex;Aldehyde Oxidoreductase; domain 3;Molybdopterin biosynthesis MoaE subunit 0.6529 193 274 3.90.1170.40
af_C0PJ39_412_507_3.30.70.2860 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6289 192 274 3.30.70.2860
af_P95072_325_478_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.6254 72 163 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A401TQJ1-F1-model_v4 Microcystin LR degradation protein MlrC N-terminal domain-containing protein 0.9986 1 266
AF-A0A542B5R2-F1-model_v4 Microcystinase C (MlrC) 0.9937 2 498 GO:0006508
GO:0008237
GO:0046872
AF-A0A536XL31-F1-model_v4 M81 family metallopeptidase 0.9918 1 188
AF-A0A401TQJ1-F1-model_v4 Microcystin LR degradation protein MlrC N-terminal domain-containing protein 0.9912 1 266
AF-A0A1A9HJL2-F1-model_v4 Microcystinase C (MlrC) 0.99 2 499 GO:0006508
GO:0008237
GO:0046872

Feature Viewer

pLDDT pTM Quality
94.12 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map