F490003

General Info

Members Datasets Scaffolds Average Seq Length
1097 320 2194 457

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0007793|Ga0451576_0007793_9831_11324
Length 497
Sequence MTVEGTKTFGTTKNPPRTSVSFVTFVVYVRLRDLRGKTQDMNDVVDFINVNRDRYIDELKQYLAIPSISALPEHAADTRRAAQWTADAISAAGMQHVTLIETPGNPVVYGDWLNEPGKPTILFYGHYDVQPVDPLDLWTTPPFEADVRDGEIYARGSADDKGQVFMHIKAIEAHMKKAGRLPLNFKFFIEGEEEVGSVHLDDFVRSHKSDLAADVVIISDSPMFDRGIPSICYGLRGLTYFQIDLRGSKSDLHSGSFGGAVANPAYVLATVLAQMKDKGNGRIRIPGFYDDVRPLSEEERAEWKKLPFNETRYRKELGAPKLWGEKGYTTLERVWARPTFEINGLLSGFTGEGAKTVLPAVAMAKVSMRLVPDQDPKKIGDLFEAYVHKIAPRTMELKVTRMHGGKPWMTEFDNKYVRAAGRAIEKGFGKAPVFNREGGSIPVVSTFQEELGLPSVLFGVGLPDENAHAPNEKLDLSNFHNGVIASAFLYDEIANLE

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
180 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
188 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
190 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
207 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
210 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
211 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
212 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
213 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
225 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
282 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
283 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
293 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
307 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
308 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
309 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
310 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
311 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
312 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
313 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
314 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
315 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
316 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
317 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
318 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
319 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0
Rhizoplane 3.83
Rhizosphere 93.98
Stem 0
Stem Tuber 0
Unclassified 1.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0007793 3300045051 Bacteria 12703
2 JGI24746J21847_1004097 3300001977 Bacteria 2302
3 JGI24034J26672_10006487 3300002239 Bacteria 1688
4 JGI24751J29686_10002583 3300002459 Bacteria 3637
5 JGI25406J46586_10000491 3300003203 Bacteria 18498
6 JGI25406J46586_10003429 3300003203 Bacteria 7459
7 Ga0065712_10000222 3300005290 Bacteria 26523
8 Ga0065712_10000910 3300005290 Bacteria 8234
9 Ga0065712_10004515 3300005290 Bacteria 4073
10 Ga0065712_10006263 3300005290 Bacteria 2659
11 Ga0065712_10069851 3300005290 Bacteria 6600
12 Ga0065712_10079698 3300005290 Bacteria 3189
13 Ga0065712_10083902 3300005290 Bacteria 2799
14 Ga0065712_10106209 3300005290 Bacteria 1922
15 Ga0065712_10146227 3300005290 Bacteria 1406
16 Ga0065715_10000983 3300005293 Bacteria 14551
17 Ga0065715_10003839 3300005293 Bacteria 4157
18 Ga0065715_10006437 3300005293 Bacteria 3199
19 Ga0065715_10012129 3300005293 Bacteria 2802
20 Ga0065715_10014474 3300005293 Bacteria 2225
21 Ga0065715_10017121 3300005293 Bacteria 2772
22 Ga0065715_10091646 3300005293 Bacteria 5648
23 Ga0065715_10098196 3300005293 Bacteria 3582
24 Ga0065715_10098379 3300005293 Bacteria 3557
25 Ga0065715_10108954 3300005293 Bacteria 2688
26 Ga0065715_10110891 3300005293 Bacteria 2588
27 Ga0065715_10122979 3300005293 Bacteria 2190
28 Ga0065715_10167948 3300005293 Bacteria 1570
29 Ga0065707_10002248 3300005295 Bacteria 5635
30 Ga0065707_10002756 3300005295 Bacteria 5016
31 Ga0065707_10003696 3300005295 Bacteria 6593
32 Ga0065707_10109271 3300005295 Bacteria 2460
33 Ga0065707_10139006 3300005295 Bacteria 1798
34 Ga0070658_10049975 3300005327 Bacteria 3389
35 Ga0070676_10009637 3300005328 Bacteria 5221
36 Ga0070676_10013764 3300005328 Bacteria 4435
37 Ga0070676_10015164 3300005328 Bacteria 4249
38 Ga0070683_100000702 3300005329 Bacteria 24327
39 Ga0070683_100041284 3300005329 Bacteria 4243
40 Ga0070690_100016985 3300005330 Bacteria 4369
41 Ga0070690_100023271 3300005330 Bacteria 3798
42 Ga0070690_100085429 3300005330 Bacteria 2070
43 Ga0070670_100003559 3300005331 Bacteria 12957
44 Ga0070670_100006267 3300005331 Bacteria 10070
45 Ga0070670_100024192 3300005331 Bacteria 5226
46 Ga0070670_100027941 3300005331 Bacteria 4854
47 Ga0070677_10011542 3300005333 Bacteria 3049
48 Ga0070677_10020351 3300005333 Bacteria 2416
49 Ga0068869_100008691 3300005334 Bacteria 6559
50 Ga0068869_100120544 3300005334 Bacteria 2005
51 Ga0070666_10061055 3300005335 Bacteria 2552
52 Ga0068868_100023017 3300005338 Bacteria 4711
53 Ga0068868_100023041 3300005338 Bacteria 4709
54 Ga0068868_100026944 3300005338 Bacteria 4382
55 Ga0068868_100194820 3300005338 Bacteria 1687
56 Ga0070660_100019139 3300005339 Bacteria 5012
57 Ga0070660_100056916 3300005339 Bacteria 3027
58 Ga0070689_100004535 3300005340 Bacteria 9403
59 Ga0070689_100006832 3300005340 Bacteria 7938
60 Ga0070689_100143963 3300005340 Unclassified 1919
61 Ga0070687_100026143 3300005343 Bacteria 2808
62 Ga0070687_100043262 3300005343 Bacteria 2288
63 Ga0070687_100050568 3300005343 Bacteria 2147
64 Ga0070687_100081101 3300005343 Bacteria 1770
65 Ga0070661_100044407 3300005344 Bacteria 3247
66 Ga0070692_10018791 3300005345 Bacteria 3329
67 Ga0070668_100004968 3300005347 Bacteria 9847
68 Ga0070668_100043444 3300005347 Bacteria 3447
69 Ga0070668_100063659 3300005347 Bacteria 2859
70 Ga0070668_100064576 3300005347 Bacteria 2838
71 Ga0070668_100081102 3300005347 Bacteria 2543
72 Ga0070669_100001192 3300005353 Bacteria 18941
73 Ga0070669_100001561 3300005353 Bacteria 16592
74 Ga0070669_100004537 3300005353 Bacteria 10025
75 Ga0070669_100028454 3300005353 Bacteria 4025
76 Ga0070669_100035328 3300005353 Bacteria 3620
77 Ga0070669_100041033 3300005353 Bacteria 3365
78 Ga0070669_100071751 3300005353 Bacteria 2563
79 Ga0070669_100120839 3300005353 Bacteria 1998
80 Ga0070675_100000202 3300005354 Bacteria 37748
81 Ga0070675_100000206 3300005354 Bacteria 37528
82 Ga0070675_100005108 3300005354 Bacteria 10007
83 Ga0070675_100005942 3300005354 Bacteria 9351
84 Ga0070675_100012775 3300005354 Bacteria 6587
85 Ga0070675_100017985 3300005354 Bacteria 5625
86 Ga0070675_100018812 3300005354 Bacteria 5499
87 Ga0070675_100024739 3300005354 Bacteria 4808
88 Ga0070675_100039166 3300005354 Bacteria 3866
89 Ga0070675_100041623 3300005354 Bacteria 3753
90 Ga0070675_100044603 3300005354 Bacteria 3626
91 Ga0070675_100059125 3300005354 Bacteria 3161
92 Ga0070675_100079333 3300005354 Bacteria 2735
93 Ga0070671_100028379 3300005355 Bacteria 4607
94 Ga0070671_100030682 3300005355 Bacteria 4437
95 Ga0070671_100035887 3300005355 Bacteria 4109
96 Ga0070671_100038680 3300005355 Bacteria 3959
97 Ga0070674_100002368 3300005356 Bacteria 10405
98 Ga0070674_100025398 3300005356 Bacteria 3856
99 Ga0070674_100134407 3300005356 Bacteria 1848
100 Ga0070674_100170575 3300005356 Bacteria 1658
101 Ga0070673_100002817 3300005364 Bacteria 10694
102 Ga0070673_100064826 3300005364 Bacteria 2912
103 Ga0070673_100123153 3300005364 Bacteria 2166
104 Ga0070688_100001628 3300005365 Bacteria 11244
105 Ga0070688_100020187 3300005365 Bacteria 3870
106 Ga0070688_100022403 3300005365 Bacteria 3701
107 Ga0070688_100028569 3300005365 Bacteria 3331
108 Ga0070667_100021458 3300005367 Bacteria 5361
109 Ga0070667_100075871 3300005367 Bacteria 2870
110 Ga0070714_100198070 3300005435 Bacteria 1836
111 Ga0070713_100025976 3300005436 Bacteria 4590
112 Ga0070705_100029528 3300005440 Unclassified 3017
113 Ga0070705_100070476 3300005440 Bacteria 2111
114 Ga0070705_100136569 3300005440 Bacteria 1607
115 Ga0070700_100000968 3300005441 Bacteria 14164
116 Ga0070700_100025697 3300005441 Bacteria 3469
117 Ga0070700_100037343 3300005441 Bacteria 2953
118 Ga0070700_100038341 3300005441 Bacteria 2920
119 Ga0070700_100049340 3300005441 Bacteria 2613
120 Ga0070700_100066926 3300005441 Bacteria 2281
121 Ga0070694_100012880 3300005444 Bacteria 5214
122 Ga0070694_100023992 3300005444 Bacteria 3932
123 Ga0070694_100174569 3300005444 Bacteria 1585
124 Ga0070678_100029881 3300005456 Bacteria 3738
125 Ga0070678_100043784 3300005456 Unclassified 3191
126 Ga0070678_100086152 3300005456 Bacteria 2396
127 Ga0070662_100061538 3300005457 Bacteria 2741
128 Ga0070662_100170308 3300005457 Bacteria 1710
129 Ga0070681_10013233 3300005458 Bacteria 8198
130 Ga0070681_10140196 3300005458 Bacteria 2348
131 Ga0068867_100010452 3300005459 Bacteria 6550
132 Ga0068867_100013700 3300005459 Bacteria 5742
133 Ga0068867_100019671 3300005459 Bacteria 4810
134 Ga0068867_100132362 3300005459 Bacteria 1940
135 Ga0070685_10001979 3300005466 Bacteria 10643
136 Ga0070685_10014580 3300005466 Unclassified 4165
137 Ga0070698_100039536 3300005471 Bacteria 4854
138 Ga0070698_100097134 3300005471 Bacteria 2922
139 Ga0070698_100191331 3300005471 Bacteria 1984
140 Ga0070699_100000007 3300005518 Bacteria 310847
141 Ga0070699_100003987 3300005518 Bacteria 13044
142 Ga0070679_100016110 3300005530 Bacteria 7202
143 Ga0070679_100172727 3300005530 Bacteria 2134
144 Ga0070684_100000068 3300005535 Bacteria 65538
145 Ga0070684_100020170 3300005535 Bacteria 5530
146 Ga0070697_100192204 3300005536 Bacteria 1733
147 Ga0070672_100008568 3300005543 Bacteria 7004
148 Ga0070672_100025303 3300005543 Bacteria 4400
149 Ga0070672_100041589 3300005543 Bacteria 3534
150 Ga0070672_100053873 3300005543 Bacteria 3147
151 Ga0070672_100111763 3300005543 Bacteria 2227
152 Ga0070686_100006352 3300005544 Bacteria 6560
153 Ga0070686_100007023 3300005544 Bacteria 6276
154 Ga0070695_100001205 3300005545 Bacteria 14243
155 Ga0070695_100001952 3300005545 Bacteria 11704
156 Ga0070695_100030029 3300005545 Bacteria 3381
157 Ga0070695_100038335 3300005545 Bacteria 3023
158 Ga0070696_100001294 3300005546 Bacteria 16298
159 Ga0070696_100008998 3300005546 Bacteria 6684
160 Ga0070665_100007987 3300005548 Bacteria 10720
161 Ga0070665_100010173 3300005548 Bacteria 9513
162 Ga0070704_100004180 3300005549 Bacteria 8334
163 Ga0070704_100018397 3300005549 Bacteria 4468
164 Ga0070704_100025329 3300005549 Bacteria 3905
165 Ga0070704_100059921 3300005549 Bacteria 2717
166 Ga0070704_100070130 3300005549 Bacteria 2542
167 Ga0068855_100012923 3300005563 Bacteria 10073
168 Ga0068855_100374663 3300005563 Bacteria 1564
169 Ga0070664_100000408 3300005564 Bacteria 32016
170 Ga0070664_100003670 3300005564 Bacteria 12367
171 Ga0070664_100019545 3300005564 Bacteria 5573
172 Ga0070664_100032713 3300005564 Bacteria 4351
173 Ga0070664_100093589 3300005564 Bacteria 2604
174 Ga0070664_100165718 3300005564 Bacteria 1958
175 Ga0068857_100108744 3300005577 Bacteria 2491
176 Ga0068854_100028686 3300005578 Bacteria 3848
177 Ga0068856_100180363 3300005614 Bacteria 2125
178 Ga0068859_100004188 3300005617 Bacteria 14722
179 Ga0068859_100015694 3300005617 Bacteria 7611
180 Ga0068859_100066179 3300005617 Bacteria 3648
181 Ga0068859_100075855 3300005617 Bacteria 3403
182 Ga0068859_100084090 3300005617 Bacteria 3226
183 Ga0068864_100005121 3300005618 Bacteria 10738
184 Ga0068864_100006208 3300005618 Bacteria 9797
185 Ga0068864_100026939 3300005618 Bacteria 4849
186 Ga0068864_100177456 3300005618 Bacteria 1946
187 Ga0068861_100027826 3300005719 Bacteria 4122
188 Ga0068861_100030653 3300005719 Bacteria 3943
189 Ga0068861_100034050 3300005719 Bacteria 3764
190 Ga0068861_100131029 3300005719 Bacteria 2035
191 Ga0068870_10002093 3300005840 Bacteria 8273
192 Ga0068870_10081442 3300005840 Bacteria 1790
193 Ga0068863_100005710 3300005841 Bacteria 12219
194 Ga0068863_100058868 3300005841 Bacteria 3635
195 Ga0068863_100085510 3300005841 Bacteria 2989
196 Ga0068863_100122683 3300005841 Bacteria 2478
197 Ga0068858_100021570 3300005842 Bacteria 6020
198 Ga0068858_100051153 3300005842 Bacteria 3822
199 Ga0068858_100074937 3300005842 Bacteria 3143
200 Ga0068858_100109801 3300005842 Bacteria 2575
201 Ga0068858_100115632 3300005842 Bacteria 2507
202 Ga0068860_100022781 3300005843 Bacteria 6057
203 Ga0068860_100029728 3300005843 Bacteria 5256
204 Ga0068860_100080666 3300005843 Bacteria 3094
205 Ga0068862_100001571 3300005844 Bacteria 20810
206 Ga0068862_100009631 3300005844 Bacteria 7985
207 Ga0068862_100012472 3300005844 Bacteria 7034
208 Ga0068862_100040589 3300005844 Bacteria 3956
209 Ga0068862_100045061 3300005844 Bacteria 3763
210 Ga0081455_10051291 3300005937 Bacteria 3539
211 Ga0081539_10000093 3300005985 Bacteria 207314
212 Ga0081539_10001136 3300005985 Bacteria 48290
213 Ga0081539_10005341 3300005985 Bacteria 13186
214 Ga0081539_10024601 3300005985 Bacteria 3901
215 Ga0081539_10060814 3300005985 Bacteria 2072
216 Ga0070717_10025040 3300006028 Bacteria 4740
217 Ga0075365_10001207 3300006038 Bacteria 11410
218 Ga0075368_10012646 3300006042 Bacteria 3091
219 Ga0075364_10011061 3300006051 Bacteria 5476
220 Ga0075364_10058015 3300006051 Bacteria 2536
221 Ga0075364_10103863 3300006051 Bacteria 1893
222 Ga0075362_10017339 3300006177 Bacteria 2965
223 Ga0075367_10009279 3300006178 Bacteria 5135
224 Ga0075366_10039830 3300006195 Bacteria 2778
225 Ga0097621_100000477 3300006237 Bacteria 28162
226 Ga0097621_100008437 3300006237 Bacteria 7422
227 Ga0097621_100022155 3300006237 Bacteria 4928
228 Ga0097621_100036950 3300006237 Bacteria 3910
229 Ga0097621_100037047 3300006237 Bacteria 3905
230 Ga0097621_100038495 3300006237 Bacteria 3838
231 Ga0097621_100050813 3300006237 Bacteria 3372
232 Ga0097621_100067724 3300006237 Bacteria 2943
233 Ga0097621_100147494 3300006237 Bacteria 2016
234 Ga0068871_100008313 3300006358 Bacteria 7458
235 Ga0068871_100012223 3300006358 Bacteria 6320
236 Ga0068871_100047791 3300006358 Bacteria 3452
237 Ga0068871_100068766 3300006358 Bacteria 2908
238 Ga0068871_100161286 3300006358 Bacteria 1918
239 Ga0068871_100181531 3300006358 Bacteria 1809
240 Ga0075428_100000007 3300006844 Bacteria 273226
241 Ga0075428_100000080 3300006844 Bacteria 80349
242 Ga0075428_100000786 3300006844 Bacteria 33072
243 Ga0075428_100003353 3300006844 Bacteria 17522
244 Ga0075428_100008548 3300006844 Bacteria 11358
245 Ga0075428_100008810 3300006844 Bacteria 11196
246 Ga0075428_100011793 3300006844 Bacteria 9729
247 Ga0075428_100019393 3300006844 Bacteria 7527
248 Ga0075428_100020230 3300006844 Bacteria 7371
249 Ga0075428_100054663 3300006844 Bacteria 4375
250 Ga0075428_100077112 3300006844 Bacteria 3638
251 Ga0075428_100199333 3300006844 Bacteria 2164
252 Ga0075430_100000632 3300006846 Bacteria 26776
253 Ga0075430_100001296 3300006846 Bacteria 20155
254 Ga0075430_100003498 3300006846 Bacteria 13148
255 Ga0075430_100008831 3300006846 Bacteria 8504
256 Ga0075430_100038848 3300006846 Bacteria 4031
257 Ga0075430_100038936 3300006846 Bacteria 4026
258 Ga0075430_100104393 3300006846 Bacteria 2365
259 Ga0075430_100196300 3300006846 Bacteria 1677
260 Ga0075431_100002075 3300006847 Bacteria 19135
261 Ga0075431_100013703 3300006847 Bacteria 8193
262 Ga0075431_100017585 3300006847 Bacteria 7268
263 Ga0075431_100032416 3300006847 Bacteria 5384
264 Ga0075431_100050231 3300006847 Bacteria 4300
265 Ga0075431_100062128 3300006847 Bacteria 3855
266 Ga0075431_100105378 3300006847 Bacteria 2910
267 Ga0075431_100111446 3300006847 Bacteria 2824
268 Ga0075431_100132447 3300006847 Unclassified 2571
269 Ga0075431_100145681 3300006847 Bacteria 2441
270 Ga0075431_100315985 3300006847 Bacteria 1576
271 Ga0075433_10002779 3300006852 Bacteria 13391
272 Ga0075433_10010054 3300006852 Bacteria 7583
273 Ga0075433_10011200 3300006852 Bacteria 7216
274 Ga0075433_10012778 3300006852 Bacteria 6799
275 Ga0075433_10027266 3300006852 Bacteria 4843
276 Ga0075433_10027302 3300006852 Bacteria 4840
277 Ga0075433_10036661 3300006852 Bacteria 4226
278 Ga0075433_10038072 3300006852 Bacteria 4152
279 Ga0075433_10045659 3300006852 Bacteria 3809
280 Ga0075433_10057747 3300006852 Bacteria 3392
281 Ga0075433_10079463 3300006852 Bacteria 2890
282 Ga0075433_10211787 3300006852 Bacteria 1722
283 Ga0075434_100000553 3300006871 Bacteria 28642
284 Ga0075434_100002096 3300006871 Bacteria 17342
285 Ga0075434_100002820 3300006871 Bacteria 15389
286 Ga0075434_100007871 3300006871 Bacteria 9873
287 Ga0075434_100010094 3300006871 Bacteria 8843
288 Ga0075434_100012917 3300006871 Bacteria 7932
289 Ga0075434_100014738 3300006871 Bacteria 7480
290 Ga0075434_100041345 3300006871 Bacteria 4568
291 Ga0075434_100042603 3300006871 Bacteria 4501
292 Ga0075434_100058710 3300006871 Bacteria 3824
293 Ga0075429_100000156 3300006880 Bacteria 42804
294 Ga0075429_100000181 3300006880 Bacteria 41066
295 Ga0075429_100001098 3300006880 Bacteria 21794
296 Ga0075429_100004082 3300006880 Bacteria 12517
297 Ga0075429_100117096 3300006880 Bacteria 2328
298 Ga0075429_100255418 3300006880 Bacteria 1535
299 Ga0068865_100002173 3300006881 Bacteria 11552
300 Ga0075436_100033289 3300006914 Bacteria 3553
301 Ga0075436_100087256 3300006914 Bacteria 2167
302 Ga0097620_100004188 3300006931 Bacteria 14722
303 Ga0097620_100015694 3300006931 Bacteria 7611
304 Ga0097620_100066176 3300006931 Bacteria 3648
305 Ga0097620_100075856 3300006931 Bacteria 3403
306 Ga0097620_100084096 3300006931 Bacteria 3226
307 Ga0075435_100009665 3300007076 Bacteria 7002
308 Ga0075435_100011975 3300007076 Bacteria 6407
309 Ga0075435_100016827 3300007076 Bacteria 5520
310 Ga0075435_100021045 3300007076 Bacteria 5010
311 Ga0075435_100031932 3300007076 Bacteria 4154
312 Ga0075435_100104286 3300007076 Bacteria 2352
313 Ga0105240_10009773 3300009093 Bacteria 13541
314 Ga0105240_10013841 3300009093 Bacteria 11048
315 Ga0105240_10036167 3300009093 Bacteria 6354
316 Ga0105240_10238719 3300009093 Bacteria 2108
317 Ga0111539_10000181 3300009094 Bacteria 73457
318 Ga0111539_10000209 3300009094 Bacteria 69503
319 Ga0111539_10000574 3300009094 Bacteria 47151
320 Ga0111539_10002852 3300009094 Bacteria 22969
321 Ga0111539_10003328 3300009094 Bacteria 21227
322 Ga0111539_10003739 3300009094 Bacteria 20026
323 Ga0111539_10004071 3300009094 Bacteria 19196
324 Ga0111539_10004218 3300009094 Bacteria 18846
325 Ga0111539_10016089 3300009094 Bacteria 9283
326 Ga0111539_10029772 3300009094 Bacteria 6644
327 Ga0111539_10048815 3300009094 Bacteria 5051
328 Ga0111539_10052978 3300009094 Bacteria 4829
329 Ga0111539_10059071 3300009094 Bacteria 4549
330 Ga0111539_10084906 3300009094 Bacteria 3721
331 Ga0111539_10135308 3300009094 Unclassified 2886
332 Ga0111539_10146840 3300009094 Bacteria 2761
333 Ga0111539_10261123 3300009094 Bacteria 2016
334 Ga0111539_10314674 3300009094 Bacteria 1822
335 Ga0105245_10131765 3300009098 Bacteria 2346
336 Ga0105247_10008195 3300009101 Bacteria 6380
337 Ga0105247_10011689 3300009101 Bacteria 5283
338 Ga0114129_10000077 3300009147 Bacteria 90951
339 Ga0114129_10000113 3300009147 Bacteria 80752
340 Ga0114129_10000307 3300009147 Bacteria 57086
341 Ga0114129_10002524 3300009147 Bacteria 25421
342 Ga0114129_10004747 3300009147 Bacteria 19200
343 Ga0114129_10005533 3300009147 Bacteria 17870
344 Ga0114129_10006290 3300009147 Bacteria 16838
345 Ga0114129_10006678 3300009147 Bacteria 16387
346 Ga0114129_10007407 3300009147 Bacteria 15621
347 Ga0114129_10009011 3300009147 Bacteria 14229
348 Ga0114129_10009671 3300009147 Bacteria 13758
349 Ga0114129_10013454 3300009147 Bacteria 11657
350 Ga0114129_10013767 3300009147 Bacteria 11528
351 Ga0114129_10015882 3300009147 Bacteria 10708
352 Ga0114129_10030092 3300009147 Bacteria 7689
353 Ga0114129_10036699 3300009147 Bacteria 6920
354 Ga0114129_10039874 3300009147 Bacteria 6625
355 Ga0114129_10042957 3300009147 Bacteria 6362
356 Ga0114129_10058505 3300009147 Bacteria 5391
357 Ga0114129_10063737 3300009147 Bacteria 5145
358 Ga0114129_10089306 3300009147 Bacteria 4271
359 Ga0114129_10107549 3300009147 Bacteria 3851
360 Ga0114129_10154116 3300009147 Bacteria 3144
361 Ga0114129_10158910 3300009147 Bacteria 3090
362 Ga0105243_10003051 3300009148 Bacteria 13802
363 Ga0105242_10005143 3300009176 Bacteria 10089
364 Ga0105242_10042492 3300009176 Bacteria 3671
365 Ga0105242_10055119 3300009176 Bacteria 3252
366 Ga0105242_10160113 3300009176 Bacteria 1969
367 Ga0105248_10001783 3300009177 Bacteria 23918
368 Ga0105248_10003833 3300009177 Bacteria 16666
369 Ga0105248_10005184 3300009177 Bacteria 14364
370 Ga0105248_10010776 3300009177 Bacteria 10093
371 Ga0105248_10010908 3300009177 Bacteria 10026
372 Ga0105248_10012467 3300009177 Bacteria 9374
373 Ga0105248_10028175 3300009177 Bacteria 6255
374 Ga0105248_10038320 3300009177 Bacteria 5364
375 Ga0105248_10044199 3300009177 Bacteria 4996
376 Ga0105248_10054018 3300009177 Bacteria 4506
377 Ga0105248_10192225 3300009177 Bacteria 2300
378 Ga0105248_10358169 3300009177 Bacteria 1642
379 Ga0105237_10030497 3300009545 Bacteria 5475
380 Ga0105238_10027781 3300009551 Bacteria 5766
381 Ga0105238_10029490 3300009551 Bacteria 5589
382 Ga0105249_10001092 3300009553 Bacteria 24120
383 Ga0105249_10011683 3300009553 Bacteria 7722
384 Ga0105249_10052233 3300009553 Bacteria 3732
385 Ga0105249_10055785 3300009553 Bacteria 3616
386 Ga0105249_10083921 3300009553 Bacteria 2966
387 Ga0105249_10087484 3300009553 Bacteria 2907
388 Ga0105239_10017761 3300010375 Bacteria 7869
389 Ga0105239_10276831 3300010375 Bacteria 1888
390 Ga0157374_10024063 3300013296 Bacteria 5455
391 Ga0157374_10366784 3300013296 Bacteria 1433
392 Ga0163162_10008545 3300013306 Bacteria 9983
393 Ga0163162_10032984 3300013306 Bacteria 5143
394 Ga0163162_10074115 3300013306 Bacteria 3462
395 Ga0163162_10091254 3300013306 Bacteria 3129
396 Ga0163162_10095784 3300013306 Bacteria 3055
397 Ga0157375_10025155 3300013308 Bacteria 5524
398 Ga0157375_10068735 3300013308 Bacteria 3546
399 Ga0157375_10142257 3300013308 Bacteria 2527
400 Ga0163163_10000047 3300014325 Bacteria 131685
401 Ga0163163_10005340 3300014325 Bacteria 11096
402 Ga0163163_10021497 3300014325 Bacteria 6091
403 Ga0163163_10028101 3300014325 Bacteria 5397
404 Ga0163163_10064946 3300014325 Bacteria 3622
405 Ga0163163_10075314 3300014325 Bacteria 3369
406 Ga0157380_10001986 3300014326 Bacteria 13614
407 Ga0157380_10007318 3300014326 Bacteria 7836
408 Ga0157380_10010028 3300014326 Bacteria 6799
409 Ga0157380_10020053 3300014326 Bacteria 4992
410 Ga0157380_10024109 3300014326 Bacteria 4600
411 Ga0157380_10026961 3300014326 Bacteria 4366
412 Ga0157380_10174858 3300014326 Bacteria 1880
413 Ga0157377_10042638 3300014745 Bacteria 2521
414 Ga0157379_10012793 3300014968 Bacteria 7339
415 Ga0157379_10013798 3300014968 Bacteria 7080
416 Ga0157379_10020122 3300014968 Bacteria 5899
417 Ga0157379_10099515 3300014968 Bacteria 2610
418 Ga0157376_10060992 3300014969 Bacteria 3169
419 Ga0157376_10149303 3300014969 Bacteria 2106
420 Ga0163161_10040200 3300017792 Bacteria 3359
421 Ga0163161_10056954 3300017792 Bacteria 2839
422 Ga0163161_10080236 3300017792 Bacteria 2401
423 Ga0207697_10020849 3300025315 Bacteria 2683
424 Ga0207697_10025754 3300025315 Bacteria 2405
425 Ga0207697_10050815 3300025315 Bacteria 1712
426 Ga0207682_10006048 3300025893 Bacteria 4894
427 Ga0207682_10017796 3300025893 Bacteria 2774
428 Ga0207710_10006310 3300025900 Bacteria 5071
429 Ga0207710_10006379 3300025900 Bacteria 5041
430 Ga0207688_10003950 3300025901 Bacteria 8086
431 Ga0207688_10013281 3300025901 Bacteria 4475
432 Ga0207688_10014183 3300025901 Bacteria 4336
433 Ga0207688_10018526 3300025901 Unclassified 3788
434 Ga0207688_10084546 3300025901 Bacteria 1816
435 Ga0207688_10087308 3300025901 Bacteria 1788
436 Ga0207680_10067251 3300025903 Bacteria 2207
437 Ga0207645_10004101 3300025907 Bacteria 10841
438 Ga0207645_10008400 3300025907 Bacteria 7204
439 Ga0207645_10034657 3300025907 Bacteria 3243
440 Ga0207645_10088921 3300025907 Bacteria 1986
441 Ga0207643_10007282 3300025908 Bacteria 5936
442 Ga0207643_10098178 3300025908 Bacteria 1715
443 Ga0207705_10060270 3300025909 Bacteria 2741
444 Ga0207654_10106822 3300025911 Bacteria 1734
445 Ga0207707_10038117 3300025912 Bacteria 4200
446 Ga0207707_10172741 3300025912 Bacteria 1888
447 Ga0207695_10026602 3300025913 Bacteria 6456
448 Ga0207695_10029236 3300025913 Bacteria 6095
449 Ga0207663_10007364 3300025916 Bacteria 5703
450 Ga0207663_10068767 3300025916 Bacteria 2276
451 Ga0207662_10023067 3300025918 Bacteria 3573
452 Ga0207662_10025576 3300025918 Bacteria 3400
453 Ga0207662_10036774 3300025918 Bacteria 2863
454 Ga0207662_10042909 3300025918 Bacteria 2667
455 Ga0207657_10003257 3300025919 Bacteria 17382
456 Ga0207657_10073468 3300025919 Bacteria 2889
457 Ga0207649_10106048 3300025920 Bacteria 1869
458 Ga0207681_10004007 3300025923 Bacteria 9139
459 Ga0207681_10016755 3300025923 Bacteria 4592
460 Ga0207681_10057356 3300025923 Bacteria 2661
461 Ga0207681_10066082 3300025923 Bacteria 2502
462 Ga0207681_10235816 3300025923 Bacteria 1422
463 Ga0207694_10103779 3300025924 Bacteria 2255
464 Ga0207650_10001649 3300025925 Bacteria 15896
465 Ga0207650_10031961 3300025925 Bacteria 3806
466 Ga0207650_10032634 3300025925 Bacteria 3767
467 Ga0207650_10033192 3300025925 Bacteria 3736
468 Ga0207650_10133276 3300025925 Bacteria 1947
469 Ga0207650_10250376 3300025925 Bacteria 1434
470 Ga0207659_10000076 3300025926 Bacteria 62373
471 Ga0207659_10000461 3300025926 Bacteria 24425
472 Ga0207659_10000471 3300025926 Bacteria 24162
473 Ga0207659_10002587 3300025926 Bacteria 10780
474 Ga0207659_10029776 3300025926 Bacteria 3724
475 Ga0207659_10044650 3300025926 Bacteria 3119
476 Ga0207659_10076973 3300025926 Bacteria 2454
477 Ga0207659_10088369 3300025926 Bacteria 2308
478 Ga0207659_10116355 3300025926 Bacteria 2041
479 Ga0207659_10175480 3300025926 Bacteria 1693
480 Ga0207687_10020472 3300025927 Bacteria 4388
481 Ga0207700_10025895 3300025928 Bacteria 4082
482 Ga0207644_10024625 3300025931 Bacteria 4133
483 Ga0207644_10029970 3300025931 Bacteria 3778
484 Ga0207644_10064587 3300025931 Bacteria 2660
485 Ga0207644_10068560 3300025931 Bacteria 2588
486 Ga0207644_10117017 3300025931 Bacteria 2024
487 Ga0207644_10119771 3300025931 Bacteria 2002
488 Ga0207706_10015171 3300025933 Bacteria 6972
489 Ga0207706_10022207 3300025933 Bacteria 5695
490 Ga0207706_10025028 3300025933 Bacteria 5351
491 Ga0207706_10041843 3300025933 Bacteria 4061
492 Ga0207706_10071329 3300025933 Unclassified 3055
493 Ga0207706_10135628 3300025933 Bacteria 2165
494 Ga0207706_10202514 3300025933 Bacteria 1741
495 Ga0207686_10014644 3300025934 Bacteria 4372
496 Ga0207670_10015612 3300025936 Unclassified 4542
497 Ga0207670_10036404 3300025936 Bacteria 3200
498 Ga0207670_10093337 3300025936 Bacteria 2132
499 Ga0207669_10001846 3300025937 Bacteria 8978
500 Ga0207669_10002258 3300025937 Bacteria 8193
501 Ga0207669_10062597 3300025937 Bacteria 2292
502 Ga0207704_10003631 3300025938 Bacteria 7005
503 Ga0207704_10006204 3300025938 Bacteria 5556
504 Ga0207704_10074490 3300025938 Bacteria 2166
505 Ga0207704_10199139 3300025938 Bacteria 1464
506 Ga0207665_10046373 3300025939 Bacteria 2912
507 Ga0207691_10015367 3300025940 Bacteria 7283
508 Ga0207691_10020336 3300025940 Bacteria 6275
509 Ga0207691_10027470 3300025940 Bacteria 5335
510 Ga0207691_10028121 3300025940 Bacteria 5266
511 Ga0207691_10074612 3300025940 Bacteria 3059
512 Ga0207691_10119995 3300025940 Unclassified 2331
513 Ga0207711_10005797 3300025941 Bacteria 10436
514 Ga0207711_10006846 3300025941 Bacteria 9574
515 Ga0207711_10025494 3300025941 Bacteria 4960
516 Ga0207711_10035473 3300025941 Bacteria 4227
517 Ga0207711_10038575 3300025941 Bacteria 4063
518 Ga0207711_10077908 3300025941 Bacteria 2890
519 Ga0207711_10079461 3300025941 Bacteria 2863
520 Ga0207711_10094799 3300025941 Bacteria 2631
521 Ga0207711_10099480 3300025941 Bacteria 2571
522 Ga0207711_10101058 3300025941 Bacteria 2552
523 Ga0207711_10114314 3300025941 Bacteria 2403
524 Ga0207711_10116727 3300025941 Bacteria 2380
525 Ga0207711_10131652 3300025941 Bacteria 2243
526 Ga0207711_10183217 3300025941 Bacteria 1905
527 Ga0207689_10006551 3300025942 Bacteria 10273
528 Ga0207689_10054504 3300025942 Bacteria 3292
529 Ga0207689_10064609 3300025942 Bacteria 3011
530 Ga0207689_10067119 3300025942 Bacteria 2948
531 Ga0207689_10180641 3300025942 Bacteria 1740
532 Ga0207689_10212793 3300025942 Bacteria 1597
533 Ga0207661_10010865 3300025944 Bacteria 6570
534 Ga0207679_10008091 3300025945 Bacteria 6687
535 Ga0207679_10015098 3300025945 Bacteria 5094
536 Ga0207679_10022966 3300025945 Bacteria 4257
537 Ga0207679_10036244 3300025945 Bacteria 3496
538 Ga0207679_10058401 3300025945 Bacteria 2859
539 Ga0207679_10158403 3300025945 Bacteria 1851
540 Ga0207679_10228993 3300025945 Bacteria 1568
541 Ga0207667_10082696 3300025949 Bacteria 3325
542 Ga0207651_10001596 3300025960 Bacteria 10386
543 Ga0207651_10037798 3300025960 Bacteria 3165
544 Ga0207651_10049016 3300025960 Bacteria 2858
545 Ga0207651_10075547 3300025960 Unclassified 2405
546 Ga0207651_10113378 3300025960 Bacteria 2040
547 Ga0207651_10151327 3300025960 Bacteria 1806
548 Ga0207712_10002016 3300025961 Bacteria 13325
549 Ga0207712_10016762 3300025961 Bacteria 4750
550 Ga0207668_10020507 3300025972 Bacteria 4201
551 Ga0207668_10065097 3300025972 Bacteria 2579
552 Ga0207668_10103531 3300025972 Bacteria 2120
553 Ga0207668_10245007 3300025972 Bacteria 1452
554 Ga0207640_10067270 3300025981 Bacteria 2397
555 Ga0207677_10080621 3300026023 Bacteria 2332
556 Ga0207703_10014928 3300026035 Bacteria 6061
557 Ga0207703_10034006 3300026035 Bacteria 4043
558 Ga0207703_10084479 3300026035 Bacteria 2655
559 Ga0207703_10093741 3300026035 Bacteria 2529
560 Ga0207703_10099811 3300026035 Bacteria 2458
561 Ga0207703_10146966 3300026035 Bacteria 2051
562 Ga0207678_10009478 3300026067 Bacteria 8565
563 Ga0207708_10002926 3300026075 Bacteria 12581
564 Ga0207708_10004049 3300026075 Bacteria 10771
565 Ga0207708_10008308 3300026075 Bacteria 7687
566 Ga0207708_10063453 3300026075 Bacteria 2822
567 Ga0207708_10075886 3300026075 Bacteria 2578
568 Ga0207708_10100586 3300026075 Bacteria 2237
569 Ga0207708_10125077 3300026075 Bacteria 2006
570 Ga0207708_10133793 3300026075 Bacteria 1940
571 Ga0207702_10099973 3300026078 Bacteria 2558
572 Ga0207641_10001113 3300026088 Bacteria 27018
573 Ga0207641_10108949 3300026088 Bacteria 2452
574 Ga0207648_10000280 3300026089 Bacteria 55313
575 Ga0207648_10000778 3300026089 Bacteria 35949
576 Ga0207648_10001579 3300026089 Bacteria 24975
577 Ga0207648_10017573 3300026089 Bacteria 6499
578 Ga0207648_10018816 3300026089 Bacteria 6243
579 Ga0207648_10021802 3300026089 Bacteria 5756
580 Ga0207648_10029855 3300026089 Bacteria 4835
581 Ga0207648_10154234 3300026089 Bacteria 2027
582 Ga0207676_10004456 3300026095 Bacteria 9905
583 Ga0207676_10008274 3300026095 Bacteria 7396
584 Ga0207676_10056969 3300026095 Bacteria 3076
585 Ga0207676_10058130 3300026095 Bacteria 3049
586 Ga0207676_10121922 3300026095 Bacteria 2200
587 Ga0207676_10166247 3300026095 Bacteria 1917
588 Ga0207674_10037574 3300026116 Bacteria 5034
589 Ga0207674_10046430 3300026116 Bacteria 4459
590 Ga0207675_100004493 3300026118 Bacteria 13478
591 Ga0207675_100006921 3300026118 Bacteria 10730
592 Ga0207675_100021110 3300026118 Bacteria 6069
593 Ga0207675_100030806 3300026118 Bacteria 4996
594 Ga0207675_100062718 3300026118 Bacteria 3472
595 Ga0207675_100130760 3300026118 Bacteria 2380
596 Ga0207683_10005213 3300026121 Bacteria 11161
597 Ga0207683_10015247 3300026121 Bacteria 6540
598 Ga0207683_10015261 3300026121 Bacteria 6538
599 Ga0207683_10034580 3300026121 Bacteria 4392
600 Ga0207683_10060734 3300026121 Bacteria 3323
601 Ga0207683_10141509 3300026121 Bacteria 2168
602 Ga0207428_10000022 3300027907 Bacteria 273333
603 Ga0207428_10000135 3300027907 Bacteria 99170
604 Ga0207428_10000558 3300027907 Bacteria 44040
605 Ga0207428_10001447 3300027907 Bacteria 24864
606 Ga0207428_10003305 3300027907 Bacteria 15681
607 Ga0207428_10004896 3300027907 Bacteria 12615
608 Ga0207428_10022460 3300027907 Bacteria 5324
609 Ga0207428_10023294 3300027907 Bacteria 5209
610 Ga0207428_10086259 3300027907 Bacteria 2444
611 Ga0207428_10106509 3300027907 Bacteria 2161
612 Ga0268266_10009623 3300028379 Bacteria 8500
613 Ga0268266_10029590 3300028379 Bacteria 4656
614 Ga0268266_10034751 3300028379 Bacteria 4287
615 Ga0268266_10077059 3300028379 Bacteria 2898
616 Ga0268265_10010233 3300028380 Bacteria 6334
617 Ga0268265_10021994 3300028380 Bacteria 4476
618 Ga0268265_10080877 3300028380 Bacteria 2564
619 Ga0268265_10094471 3300028380 Bacteria 2398
620 Ga0268264_10002874 3300028381 Bacteria 14997
621 Ga0268264_10062701 3300028381 Bacteria 3123
622 Ga0265330_10000015 3300031235 Bacteria 173077
623 Ga0265332_10000017 3300031238 Bacteria 229400
624 Ga0265325_10008270 3300031241 Bacteria 6146
625 Ga0265329_10002615 3300031242 Bacteria 8109
626 Ga0265339_10020207 3300031249 Unclassified 3894
627 Ga0265316_10000039 3300031344 Bacteria 147384
628 Ga0307408_100061008 3300031548 Bacteria 2751
629 Ga0307408_100066172 3300031548 Bacteria 2653
630 Ga0307408_100080829 3300031548 Bacteria 2429
631 Ga0307408_100112073 3300031548 Bacteria 2097
632 Ga0265314_10000016 3300031711 Bacteria 365251
633 Ga0265314_10040093 3300031711 Bacteria 3365
634 Ga0265342_10000044 3300031712 Bacteria 136312
635 Ga0307405_10061364 3300031731 Bacteria 2376
636 Ga0307405_10064241 3300031731 Bacteria 2332
637 Ga0307413_10089348 3300031824 Bacteria 2001
638 Ga0307410_10009583 3300031852 Bacteria 5441
639 Ga0307406_10087873 3300031901 Bacteria 2084
640 Ga0307407_10013241 3300031903 Bacteria 3995
641 Ga0307407_10102617 3300031903 Bacteria 1779
642 Ga0307407_10116007 3300031903 Bacteria 1689
643 Ga0307412_10071374 3300031911 Bacteria 2370
644 Ga0307412_10149961 3300031911 Bacteria 1719
645 Ga0307409_100001375 3300031995 Bacteria 11866
646 Ga0307409_100005295 3300031995 Bacteria 7401
647 Ga0307409_100065308 3300031995 Bacteria 2863
648 Ga0307409_100103060 3300031995 Bacteria 2372
649 Ga0307416_100034586 3300032002 Bacteria 3847
650 Ga0307416_100066921 3300032002 Bacteria 2960
651 Ga0307416_100088076 3300032002 Bacteria 2653
652 Ga0307416_100210504 3300032002 Bacteria 1854
653 Ga0307414_10097526 3300032004 Bacteria 2202
654 Ga0307411_10004969 3300032005 Bacteria 6467
655 Ga0307411_10063979 3300032005 Bacteria 2461
656 Ga0307411_10140265 3300032005 Bacteria 1781
657 Ga0307411_10156657 3300032005 Bacteria 1700
658 Ga0307411_10168329 3300032005 Bacteria 1649
659 Ga0373930_0003680 3300034816 Bacteria 2450
660 Ga0373948_0001775 3300034817 Bacteria 3069
661 Ga0373928_0005146 3300035084 Bacteria 2496
662 Ga0373929_0004697 3300035085 Bacteria 2449
663 Ga0373934_0010765 3300035086 Bacteria 3435
664 Ga0373940_0001492 3300035088 Bacteria 4248
665 Ga0373949_0002727 3300035090 Bacteria 4424
666 Ga0373951_0018499 3300035091 Bacteria 1583
667 Ga0373952_0002782 3300035092 Bacteria 3160
668 Ga0373923_0035010 3300035111 Bacteria 2042
669 Ga0373932_0009933 3300035112 Bacteria 2295
670 Ga0373939_0002941 3300035114 Bacteria 4005
671 Ga0373939_0020235 3300035114 Bacteria 1805
672 Ga0373945_0031010 3300035116 Bacteria 1887
673 Ga0373945_0066025 3300035116 Bacteria 1360
674 Ga0373953_0052620 3300035117 Bacteria 1648
675 Ga0373957_0063118 3300035120 Bacteria 1438
676 Ga0373957_0075069 3300035120 Bacteria 1328
677 Ga0373960_0000362 3300035121 Bacteria 8753
678 Ga0373943_0001725 3300035170 Bacteria 9911
679 Ga0373946_0001902 3300035171 Bacteria 7279
680 Ga0373955_0031813 3300035172 Bacteria 2765
681 Ga0373942_0001010 3300035207 Bacteria 7657
682 Ga0373961_0010557 3300035241 Bacteria 2278
683 Ga0373931_0042939 3300035691 Bacteria 2379
684 Ga0373931_0080686 3300035691 Bacteria 1794
685 Ga0373933_0034123 3300035724 Bacteria 2964
686 Ga0373947_0007561 3300035725 Bacteria 6286
687 Ga0373947_0052813 3300035725 Bacteria 2449
688 Ga0373937_0001526 3300036401 Bacteria 19483
689 Ga0373937_0041405 3300036401 Bacteria 4201
690 Ga0373937_0177620 3300036401 Bacteria 1999
691 Ga0373937_0233866 3300036401 Bacteria 1731
692 Ga0373925_0000666 3300037068 Bacteria 32236
693 Ga0395901_0248514 3300038443 Bacteria 1854
694 Ga0436365_1277884 3300039437 Bacteria 2087
695 Ga0439453_0004790 3300041408 Bacteria 2030
696 Ga0439433_0003999 3300041999 Bacteria 3171
697 Ga0439450_010016 3300042008 Bacteria 1816
698 Ga0450920_005947 3300042122 Bacteria 2181
699 Ga0439446_0011237 3300042156 Bacteria 2428
700 Ga0439435_0001853 3300042436 Bacteria 4040
701 Ga0439435_0002783 3300042436 Bacteria 3532
702 Ga0439435_0003350 3300042436 Bacteria 3323
703 Ga0439435_0008135 3300042436 Bacteria 2426
704 Ga0439464_0000294 3300042439 Bacteria 9448
705 Ga0451577_0028425 3300042876 Bacteria 5057
706 Ga0439440_0007708 3300042993 Bacteria 2194
707 Ga0453683_0095050 3300044673 Bacteria 1870
708 Ga0453684_0029348 3300044712 Bacteria 7814
709 Ga0453684_0072257 3300044712 Bacteria 4357
710 Ga0453684_0320139 3300044712 Bacteria 1757
711 Ga0451576_0004346 3300045051 Bacteria 18494
712 Ga0451576_0008073 3300045051 Bacteria 12412
713 Ga0451576_0015327 3300045051 Bacteria 8494
714 Ga0451576_0077844 3300045051 Bacteria 3451
715 Ga0451576_0139283 3300045051 Bacteria 2531
716 Ga0451576_0183987 3300045051 Bacteria 2181
717 Ga0466967_0118006 3300045976 Bacteria 2447
718 Ga0466967_0294117 3300045976 Bacteria 1561
719 Ga0495592_0071588 3300046454 Bacteria 2523
720 Ga0495629_0009461 3300046459 Bacteria 7128
721 Ga0495638_0006332 3300046460 Bacteria 8626
722 Ga0495594_0020752 3300046499 Bacteria 3502
723 Ga0495608_0041859 3300046511 Bacteria 3064
724 Ga0495608_0130295 3300046511 Bacteria 1610
725 Ga0495628_0028907 3300046516 Bacteria 4499
726 Ga0495630_0013627 3300046517 Bacteria 5913
727 Ga0495630_0201793 3300046517 Bacteria 1518
728 Ga0495643_0001393 3300046522 Bacteria 22576
729 Ga0495640_0064900 3300046533 Bacteria 2467
730 Ga0495621_0003318 3300046539 Bacteria 4433
731 Ga0495645_0098078 3300046543 Bacteria 2086
732 Ga0495633_0053293 3300046558 Bacteria 1904
733 Ga0495667_0016766 3300046559 Bacteria 4948
734 Ga0495634_0088813 3300046642 Bacteria 2010
735 Ga0495635_0039743 3300046663 Bacteria 3253
736 Ga0495635_0106324 3300046663 Bacteria 1917
737 Ga0495659_0027088 3300046664 Bacteria 1975
738 Ga0495599_0088562 3300046678 Bacteria 1932
739 Ga0495647_0029052 3300046681 Bacteria 2042
740 Ga0495658_0123868 3300046683 Bacteria 1566
741 Ga0495613_0006956 3300046689 Bacteria 8437
742 Ga0495613_0047158 3300046689 Bacteria 3183
743 Ga0495613_0065824 3300046689 Bacteria 2648
744 Ga0495670_0036826 3300046691 Bacteria 2438
745 Ga0495600_0030274 3300046809 Bacteria 3506
746 Ga0495600_0049474 3300046809 Bacteria 2743
747 Ga0495604_0031343 3300047317 Bacteria 4216
748 Ga0495674_0024135 3300047319 Bacteria 5595
749 Ga0495674_0196121 3300047319 Bacteria 1677
750 Ga0495676_0016362 3300047321 Bacteria 6587
751 Ga0495684_0016408 3300047471 Bacteria 5703
752 Ga0496100_0016532 3300048903 Bacteria 4335
753 Ga0496101_0003307 3300048904 Bacteria 10026
754 Ga0496101_0141223 3300048904 Bacteria 1836
755 Ga0496101_0268106 3300048904 Bacteria 1333
756 Ga0496102_0073123 3300048905 Bacteria 3151
757 Ga0496104_0003519 3300048907 Bacteria 13506
758 Ga0496104_0028934 3300048907 Bacteria 5138
759 Ga0496104_0159847 3300048907 Bacteria 2161
760 Ga0496105_0022601 3300048908 Bacteria 5094
761 Ga0496105_0094445 3300048908 Bacteria 2470
762 Ga0496106_0077177 3300048909 Bacteria 2554
763 Ga0496108_0004496 3300048911 Bacteria 11232
764 Ga0496108_0015408 3300048911 Bacteria 6237
765 Ga0496108_0040971 3300048911 Bacteria 3864
766 Ga0496108_0261787 3300048911 Bacteria 1505
767 Ga0496109_0004709 3300048912 Bacteria 11388
768 Ga0496109_0029372 3300048912 Bacteria 4924
769 Ga0496109_0040714 3300048912 Bacteria 4208
770 Ga0496109_0046363 3300048912 Bacteria 3948
771 Ga0496109_0068823 3300048912 Bacteria 3245
772 Ga0496109_0223162 3300048912 Bacteria 1772
773 Ga0496110_0000897 3300048913 Bacteria 20981
774 Ga0496110_0036291 3300048913 Bacteria 4280
775 Ga0496110_0073346 3300048913 Bacteria 3038
776 Ga0496110_0077169 3300048913 Bacteria 2963
777 Ga0496111_0009214 3300048914 Bacteria 6576
778 Ga0496112_0001650 3300048915 Bacteria 17325
779 Ga0496112_0005540 3300048915 Bacteria 10941
780 Ga0496112_0044107 3300048915 Bacteria 4368
781 Ga0496112_0046744 3300048915 Bacteria 4246
782 Ga0496112_0060715 3300048915 Bacteria 3726
783 Ga0496112_0065423 3300048915 Bacteria 3588
784 Ga0496112_0137220 3300048915 Bacteria 2416
785 Ga0496112_0349109 3300048915 Bacteria 1422
786 Ga0496113_0011624 3300048916 Bacteria 5884
787 Ga0496113_0019327 3300048916 Bacteria 4763
788 Ga0496113_0037367 3300048916 Bacteria 3563
789 Ga0496113_0089534 3300048916 Bacteria 2369
790 Ga0496114_0001952 3300048917 Bacteria 15679
791 Ga0496114_0095742 3300048917 Bacteria 2527
792 Ga0496115_0016366 3300048918 Bacteria 5646
793 Ga0496115_0158739 3300048918 Bacteria 1868
794 Ga0501031_0003834 3300049568 Bacteria 9673
795 Ga0501031_0008319 3300049568 Bacteria 6749
796 Ga0501031_0023534 3300049568 Bacteria 4015
797 Ga0501031_0045228 3300049568 Bacteria 2872
798 Ga0501032_0003406 3300049569 Bacteria 12178
799 Ga0501032_0006591 3300049569 Bacteria 8526
800 Ga0501032_0036893 3300049569 Bacteria 3335
801 Ga0501032_0066980 3300049569 Bacteria 2399
802 Ga0501032_0081126 3300049569 Bacteria 2158
803 Ga0501033_0002656 3300049570 Bacteria 15022
804 Ga0501033_0003334 3300049570 Bacteria 13267
805 Ga0501033_0032808 3300049570 Bacteria 3899
806 Ga0501034_0002688 3300049571 Bacteria 20936
807 Ga0501034_0006185 3300049571 Bacteria 12896
808 Ga0501034_0104305 3300049571 Bacteria 2828
809 Ga0501034_0109328 3300049571 Bacteria 2755
810 Ga0501034_0150014 3300049571 Bacteria 2307
811 Ga0501036_0000736 3300049572 Bacteria 24203
812 Ga0501036_0026222 3300049572 Bacteria 4918
813 Ga0501036_0031508 3300049572 Bacteria 4481
814 Ga0501036_0040955 3300049572 Unclassified 3920
815 Ga0501036_0092669 3300049572 Bacteria 2553
816 Ga0501036_0173626 3300049572 Bacteria 1815
817 Ga0501037_0017021 3300049573 Bacteria 5348
818 Ga0501037_0102470 3300049573 Bacteria 2064
819 Ga0501038_0031235 3300049574 Bacteria 4708
820 Ga0501038_0056964 3300049574 Bacteria 3356
821 Ga0501038_0057808 3300049574 Bacteria 3328
822 Ga0501038_0079986 3300049574 Bacteria 2756
823 Ga0501038_0093989 3300049574 Bacteria 2507
824 Ga0501039_0004068 3300049575 Bacteria 10996
825 Ga0501039_0021503 3300049575 Bacteria 4948
826 Ga0501039_0024800 3300049575 Bacteria 4606
827 Ga0501039_0025318 3300049575 Bacteria 4558
828 Ga0501039_0052428 3300049575 Bacteria 3157
829 Ga0501039_0168200 3300049575 Bacteria 1723
830 Ga0501040_0004631 3300049576 Bacteria 8923
831 Ga0501040_0014041 3300049576 Bacteria 5272
832 Ga0501041_0003049 3300049577 Bacteria 9614
833 Ga0501041_0007112 3300049577 Bacteria 6565
834 Ga0501041_0035518 3300049577 Bacteria 3020
835 Ga0501041_0037166 3300049577 Bacteria 2950
836 Ga0501041_0049888 3300049577 Bacteria 2550
837 Ga0501042_0019253 3300049578 Bacteria 4737
838 Ga0501042_0044893 3300049578 Bacteria 3149
839 Ga0501042_0052527 3300049578 Bacteria 2907
840 Ga0501042_0066464 3300049578 Bacteria 2577
841 Ga0501042_0073355 3300049578 Bacteria 2448
842 Ga0501042_0093100 3300049578 Bacteria 2164
843 Ga0501043_0001882 3300049579 Bacteria 17977
844 Ga0501043_0010240 3300049579 Bacteria 7349
845 Ga0501043_0016768 3300049579 Bacteria 5741
846 Ga0501043_0032928 3300049579 Bacteria 4076
847 Ga0501046_0003259 3300049580 Bacteria 14898
848 Ga0501046_0005980 3300049580 Bacteria 10830
849 Ga0501046_0006934 3300049580 Bacteria 9983
850 Ga0501046_0008383 3300049580 Bacteria 9012
851 Ga0501046_0008645 3300049580 Bacteria 8853
852 Ga0501047_0000683 3300049581 Bacteria 35386
853 Ga0501047_0007619 3300049581 Bacteria 10190
854 Ga0501047_0105225 3300049581 Bacteria 2702
855 Ga0501047_0185436 3300049581 Bacteria 1946
856 Ga0501048_0001747 3300049582 Bacteria 16531
857 Ga0501048_0037048 3300049582 Bacteria 3503
858 Ga0501048_0050038 3300049582 Bacteria 2976
859 Ga0501067_0000667 3300049583 Bacteria 18455
860 Ga0501067_0029727 3300049583 Bacteria 3028
861 Ga0501067_0082339 3300049583 Bacteria 1785
862 Ga0501068_0002566 3300049584 Bacteria 9636
863 Ga0501068_0005128 3300049584 Bacteria 7138
864 Ga0501068_0013785 3300049584 Bacteria 4605
865 Ga0501068_0033414 3300049584 Bacteria 3063
866 Ga0501069_0004495 3300049585 Bacteria 7206
867 Ga0501069_0006759 3300049585 Bacteria 6005
868 Ga0501069_0106586 3300049585 Bacteria 1593
869 Ga0501071_0005860 3300049587 Bacteria 7941
870 Ga0501071_0049041 3300049587 Bacteria 3038
871 Ga0501071_0066591 3300049587 Bacteria 2618
872 Ga0501071_0067781 3300049587 Bacteria 2596
873 Ga0501071_0124512 3300049587 Bacteria 1912
874 Ga0501071_0222438 3300049587 Bacteria 1421
875 Ga0501072_0016556 3300049588 Bacteria 5664
876 Ga0501072_0018465 3300049588 Bacteria 5371
877 Ga0501072_0025220 3300049588 Bacteria 4630
878 Ga0501072_0050222 3300049588 Bacteria 3284
879 Ga0501072_0060664 3300049588 Bacteria 2982
880 Ga0501072_0079185 3300049588 Unclassified 2602
881 Ga0501072_0085501 3300049588 Bacteria 2502
882 Ga0501072_0135903 3300049588 Bacteria 1960
883 Ga0501072_0194357 3300049588 Bacteria 1618
884 Ga0501073_0000363 3300049589 Bacteria 30504
885 Ga0501073_0008385 3300049589 Bacteria 7666
886 Ga0501073_0009371 3300049589 Bacteria 7226
887 Ga0501073_0015623 3300049589 Bacteria 5508
888 Ga0501073_0021300 3300049589 Bacteria 4673
889 Ga0501074_0000197 3300049590 Bacteria 32785
890 Ga0501074_0012371 3300049590 Bacteria 6203
891 Ga0501074_0023665 3300049590 Unclassified 4464
892 Ga0501074_0039684 3300049590 Bacteria 3409
893 Ga0501075_0002949 3300049591 Bacteria 11398
894 Ga0501075_0012496 3300049591 Bacteria 6036
895 Ga0501075_0017691 3300049591 Bacteria 5148
896 Ga0501075_0055766 3300049591 Bacteria 2973
897 Ga0501075_0061219 3300049591 Bacteria 2836
898 Ga0501075_0088849 3300049591 Archaea 2343
899 Ga0501075_0143058 3300049591 Bacteria 1823
900 Ga0501075_0146215 3300049591 Bacteria 1801
901 Ga0501075_0171592 3300049591 Bacteria 1655
902 Ga0501076_0003473 3300049592 Bacteria 11070
903 Ga0501076_0016095 3300049592 Bacteria 5662
904 Ga0501076_0050857 3300049592 Unclassified 3279
905 Ga0501076_0091889 3300049592 Bacteria 2441
906 Ga0501076_0112589 3300049592 Bacteria 2201
907 Ga0501076_0121583 3300049592 Bacteria 2114
908 Ga0501077_0009163 3300049593 Bacteria 6146
909 Ga0501077_0029005 3300049593 Bacteria 3518
910 Ga0501077_0056012 3300049593 Bacteria 2503
911 Ga0501079_0002309 3300049741 Bacteria 13805
912 Ga0501079_0009932 3300049741 Bacteria 7224
913 Ga0501079_0010748 3300049741 Bacteria 6971
914 Ga0501079_0011505 3300049741 Bacteria 6754
915 Ga0501079_0039516 3300049741 Bacteria 3639
916 Ga0501079_0053754 3300049741 Bacteria 3106
917 Ga0501079_0126866 3300049741 Archaea 1985
918 Ga0501079_0168806 3300049741 Bacteria 1706
919 Ga0501080_0012238 3300049742 Bacteria 7863
920 Ga0501080_0020637 3300049742 Bacteria 6102
921 Ga0501080_0027704 3300049742 Bacteria 5268
922 Ga0501080_0058390 3300049742 Bacteria 3592
923 Ga0501080_0149584 3300049742 Bacteria 2159
924 Ga0501080_0203556 3300049742 Bacteria 1816
925 Ga0501081_0002534 3300049743 Bacteria 11514
926 Ga0501081_0007283 3300049743 Bacteria 7191
927 Ga0501083_0000821 3300049744 Bacteria 20331
928 Ga0501083_0001645 3300049744 Bacteria 15248
929 Ga0501083_0078559 3300049744 Bacteria 2189
930 Ga0501273_002376 3300049770 Bacteria 1910
931 Ga0501035_0006399 3300049822 Bacteria 11071
932 Ga0501035_0015915 3300049822 Bacteria 6940
933 Ga0501035_0038001 3300049822 Bacteria 4359
934 Ga0501035_0137659 3300049822 Bacteria 2124
935 Ga0501044_0000893 3300049823 Bacteria 36023
936 Ga0501044_0007809 3300049823 Bacteria 11760
937 Ga0501044_0043943 3300049823 Bacteria 4640
938 Ga0501044_0045575 3300049823 Bacteria 4542
939 Ga0501044_0064105 3300049823 Bacteria 3752
940 Ga0501044_0266688 3300049823 Bacteria 1649
941 Ga0501045_0007060 3300049824 Bacteria 7782
942 Ga0501045_0008748 3300049824 Bacteria 7062
943 Ga0501045_0017536 3300049824 Bacteria 5084
944 Ga0501045_0047426 3300049824 Bacteria 3129
945 Ga0501045_0125103 3300049824 Archaea 1910
946 Ga0501045_0152383 3300049824 Bacteria 1720
947 Ga0501045_0223050 3300049824 Bacteria 1403
948 Ga0501045_0275276 3300049824 Bacteria 1253
949 nmdc:mga00v17_1243_c1 3300050491 Bacteria 13352
950 nmdc:mga00v17_2801_c1 3300050491 Bacteria 8960
951 nmdc:mga00v17_72478_c1 3300050491 Bacteria 2137
952 nmdc:mga0yw44_115174_c1 3300050492 Bacteria 1726
953 nmdc:mga0k408_29521_c1 3300050493 Bacteria 3122
954 nmdc:mga0k408_5416_c1 3300050493 Bacteria 6789
955 nmdc:mga06z11_34387_c1 3300050494 Bacteria 2488
956 nmdc:mga06z11_7457_c1 3300050494 Bacteria 4501
957 nmdc:mga07m45_1298_c1 3300050496 Bacteria 11368
958 nmdc:mga05p37_1139_c1 3300050507 Bacteria 30539
959 nmdc:mga05p37_12748_c1 3300050507 Bacteria 10051
960 nmdc:mga05p37_131786_c1 3300050507 Bacteria 3067
961 nmdc:mga05p37_145314_c1 3300050507 Bacteria 2905
962 nmdc:mga05p37_157050_c1 3300050507 Bacteria 2779
963 nmdc:mga05p37_197_c1 3300050507 Bacteria 60217
964 nmdc:mga05p37_21237_c1 3300050507 Bacteria 7859
965 nmdc:mga05p37_21303_c1 3300050507 Bacteria 7848
966 nmdc:mga05p37_21501_c1 3300050507 Bacteria 7815
967 nmdc:mga05p37_25752_c1 3300050507 Bacteria 7155
968 nmdc:mga05p37_28099_c1 3300050507 Bacteria 6855
969 nmdc:mga05p37_286280_c1 3300050507 Bacteria 1963
970 nmdc:mga05p37_30361_c1 3300050507 Bacteria 6594
971 nmdc:mga05p37_31101_c1 3300050507 Bacteria 6518
972 nmdc:mga05p37_311500_c1 3300050507 Bacteria 1866
973 nmdc:mga05p37_322755_c1 3300050507 Bacteria 1827
974 nmdc:mga05p37_33308_c1 3300050507 Bacteria 6310
975 nmdc:mga05p37_57005_c1 3300050507 Bacteria 4811
976 nmdc:mga05p37_62749_c1 3300050507 Bacteria 4573
977 nmdc:mga05p37_65335_c1 3300050507 Bacteria 2340
978 nmdc:mga05p37_74954_c1 3300050507 Bacteria 4165
979 nmdc:mga05p37_7667_c1 3300050507 Bacteria 12735
980 nmdc:mga05p37_9253_c1 3300050507 Bacteria 11642
981 nmdc:mga09592_204633_c1 3300050508 Bacteria 1710
982 nmdc:mga09592_256854_c1 3300050508 Bacteria 1515
983 nmdc:mga09592_53130_c1 3300050508 Bacteria 3420
984 nmdc:mga09592_5795_c1 3300050508 Bacteria 10075
985 nmdc:mga09592_8337_c1 3300050508 Bacteria 8425
986 nmdc:mga09592_89838_c1 3300050508 Bacteria 2624
987 nmdc:mga0qj67_1042_c1 3300050509 Bacteria 19184
988 nmdc:mga0qj67_170442_c1 3300050509 Bacteria 1767
989 nmdc:mga0qj67_19242_c1 3300050509 Bacteria 5215
990 nmdc:mga0qj67_209930_c1 3300050509 Unclassified 1582
991 nmdc:mga0qj67_31433_c1 3300050509 Bacteria 4135
992 nmdc:mga0qj67_32635_c1 3300050509 Bacteria 4062
993 nmdc:mga0qj67_39879_c1 3300050509 Bacteria 3690
994 nmdc:mga0qj67_90989_c1 3300050509 Bacteria 2452
995 nmdc:mga06r32_104172_c1 3300050510 Bacteria 2786
996 nmdc:mga06r32_116254_c1 3300050510 Bacteria 2635
997 nmdc:mga06r32_118584_c1 3300050510 Bacteria 2609
998 nmdc:mga06r32_12799_c1 3300050510 Bacteria 7586
999 nmdc:mga06r32_18508_c1 3300050510 Bacteria 6378
1000 nmdc:mga06r32_61558_c1 3300050510 Bacteria 3613
1001 nmdc:mga06r32_64352_c1 3300050510 Unclassified 3536
1002 nmdc:mga06r32_69541_c1 3300050510 Bacteria 3403
1003 nmdc:mga06r32_7395_c1 3300050510 Bacteria 9881
1004 nmdc:mga06r32_81749_c1 3300050510 Bacteria 3147
1005 nmdc:mga06r32_86527_c1 3300050510 Bacteria 3057
1006 nmdc:mga08y16_10795_c1 3300050511 Bacteria 9586
1007 nmdc:mga08y16_11591_c1 3300050511 Bacteria 9264
1008 nmdc:mga08y16_124538_c1 3300050511 Bacteria 2681
1009 nmdc:mga08y16_1923_c1 3300050511 Bacteria 21184
1010 nmdc:mga08y16_21139_c1 3300050511 Bacteria 6870
1011 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
1012 nmdc:mga08y16_243407_c1 3300050511 Bacteria 1859
1013 nmdc:mga08y16_25842_c1 3300050511 Bacteria 6195
1014 nmdc:mga08y16_26547_c1 3300050511 Bacteria 6105
1015 nmdc:mga08y16_3644_c1 3300050511 Bacteria 16014
1016 nmdc:mga08y16_403_c1 3300050511 Bacteria 39740
1017 nmdc:mga08y16_408076_c1 3300050511 Bacteria 1390
1018 nmdc:mga08y16_44989_c1 3300050511 Bacteria 4625
1019 nmdc:mga08y16_56579_c1 3300050511 Bacteria 4098
1020 nmdc:mga08y16_71603_c1 3300050511 Bacteria 3612
1021 nmdc:mga08y16_75338_c1 3300050511 Unclassified 3518
1022 nmdc:mga08y16_8892_c1 3300050511 Bacteria 10545
1023 nmdc:mga08y16_90833_c1 3300050511 Bacteria 3183
1024 nmdc:mga0n895_11067_c1 3300050512 Bacteria 8024
1025 nmdc:mga0n895_129542_c1 3300050512 Bacteria 2548
1026 nmdc:mga0n895_151369_c1 3300050512 Bacteria 2350
1027 nmdc:mga0n895_16192_c1 3300050512 Bacteria 6836
1028 nmdc:mga0n895_16479_c1 3300050512 Bacteria 6783
1029 nmdc:mga0n895_337729_c1 3300050512 Bacteria 1526
1030 nmdc:mga0n895_41462_c1 3300050512 Bacteria 4476
1031 nmdc:mga0n895_5746_c1 3300050512 Bacteria 10411
1032 nmdc:mga0n895_75673_c1 3300050512 Bacteria 3346
1033 nmdc:mga0n895_84815_c1 3300050512 Bacteria 3161
1034 nmdc:mga0n895_9342_c1 3300050512 Bacteria 8571
1035 nmdc:mga0n895_97_c1 3300050512 Bacteria 14298
1036 nmdc:mga0rr50_116257_c1 3300050513 Bacteria 2123
1037 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
1038 nmdc:mga0rr50_31024_c1 3300050513 Bacteria 3791
1039 nmdc:mga0rr50_45356_c1 3300050513 Unclassified 3230
1040 nmdc:mga0rr50_47864_c1 3300050513 Bacteria 3158
1041 nmdc:mga0rr50_77144_c1 3300050513 Bacteria 2560
1042 nmdc:mga08x19_13758_c1 3300050514 Bacteria 4898
1043 nmdc:mga08x19_17369_c1 3300050514 Bacteria 4402
1044 nmdc:mga08x19_26445_c1 3300050514 Bacteria 3621
1045 nmdc:mga08x19_52646_c1 3300050514 Bacteria 2618
1046 nmdc:mga0a205_10050_c1 3300050515 Bacteria 8684
1047 nmdc:mga0a205_105792_c1 3300050515 Bacteria 2713
1048 nmdc:mga0a205_11144_c1 3300050515 Bacteria 8274
1049 nmdc:mga0a205_122403_c1 3300050515 Bacteria 2501
1050 nmdc:mga0a205_127758_c1 3300050515 Bacteria 2442
1051 nmdc:mga0a205_13412_c1 3300050515 Bacteria 7631
1052 nmdc:mga0a205_138344_c1 3300050515 Bacteria 2335
1053 nmdc:mga0a205_17279_c1 3300050515 Bacteria 6759
1054 nmdc:mga0a205_17801_c1 3300050515 Bacteria 6668
1055 nmdc:mga0a205_18723_c1 3300050515 Bacteria 6517
1056 nmdc:mga0a205_261307_c1 3300050515 Bacteria 1609
1057 nmdc:mga0a205_323_c1 3300050515 Bacteria 35802
1058 nmdc:mga0a205_57110_c1 3300050515 Bacteria 3769
1059 nmdc:mga0a205_92383_c1 3300050515 Bacteria 2924
1060 Ga0495595_0020623 3300053084 Bacteria 2870
1061 Ga0495619_0000422 3300053085 Bacteria 28636
1062 Ga0495619_0034133 3300053085 Bacteria 3307
1063 Ga0500646_0011717 3300053090 Bacteria 2258
1064 Ga0500641_0002981 3300053096 Bacteria 5993
1065 Ga0500555_000105 3300053103 Bacteria 40073
1066 Ga0500568_0002105 3300053139 Bacteria 12023
1067 Ga0500616_0000272 3300053153 Bacteria 77108
1068 Ga0500645_000251 3300053730 Bacteria 39552
1069 Ga0501084_0003994 3300054114 Bacteria 12017
1070 Ga0501084_0006296 3300054114 Bacteria 9755
1071 Ga0501084_0008323 3300054114 Bacteria 8560
1072 Ga0501084_0009481 3300054114 Bacteria 8054
1073 Ga0501084_0050218 3300054114 Bacteria 3491
1074 Ga0501084_0095918 3300054114 Bacteria 2491
1075 Ga0501084_0281728 3300054114 Bacteria 1404
1076 Ga0590071_000104 3300059421 Bacteria 24141
1077 Ga0590071_001734 3300059421 Bacteria 5629
1078 Ga0590071_004006 3300059421 Bacteria 3599
1079 Ga0590071_004538 3300059421 Bacteria 3368
1080 Ga0590071_012213 3300059421 Bacteria 2013
1081 Ga0590074_000015 3300059423 Bacteria 22750
1082 Ga0590074_001626 3300059423 Bacteria 3655
1083 Ga0590075_000096 3300059424 Bacteria 22788
1084 Ga0590075_000408 3300059424 Bacteria 11687
1085 Ga0590075_004582 3300059424 Bacteria 3274
1086 Ga0590077_000033 3300059426 Bacteria 32115
1087 Ga0590077_000087 3300059426 Bacteria 23513
1088 Ga0590077_000326 3300059426 Bacteria 13503
1089 Ga0501082_0002482 3300060353 Bacteria 16165
1090 Ga0501082_0004282 3300060353 Bacteria 12483
1091 Ga0501082_0049538 3300060353 Bacteria 3622
1092 Ga0501082_0058341 3300060353 Bacteria 3326
1093 Ga0501082_0093849 3300060353 Bacteria 2593
1094 Ga0530510_0000198 3300061734 Bacteria 37256
1095 Ga0530510_0001830 3300061734 Bacteria 14520
1096 Ga0530510_0012625 3300061734 Bacteria 5938
1097 Ga0530510_0069602 3300061734 Bacteria 2553
1098 Ga0451576_0007793
1099 JGI24746J21847_1004097
1100 JGI24034J26672_10006487
1101 JGI24751J29686_10002583
1102 JGI25406J46586_10000491
1103 JGI25406J46586_10003429
1104 Ga0065712_10000222
1105 Ga0065712_10000910
1106 Ga0065712_10004515
1107 Ga0065712_10006263
1108 Ga0065712_10069851
1109 Ga0065712_10079698
1110 Ga0065712_10083902
1111 Ga0065712_10106209
1112 Ga0065712_10146227
1113 Ga0065715_10000983
1114 Ga0065715_10003839
1115 Ga0065715_10006437
1116 Ga0065715_10012129
1117 Ga0065715_10014474
1118 Ga0065715_10017121
1119 Ga0065715_10091646
1120 Ga0065715_10098196
1121 Ga0065715_10098379
1122 Ga0065715_10108954
1123 Ga0065715_10110891
1124 Ga0065715_10122979
1125 Ga0065715_10167948
1126 Ga0065707_10002248
1127 Ga0065707_10002756
1128 Ga0065707_10003696
1129 Ga0065707_10109271
1130 Ga0065707_10139006
1131 Ga0070658_10049975
1132 Ga0070676_10009637
1133 Ga0070676_10013764
1134 Ga0070676_10015164
1135 Ga0070683_100000702
1136 Ga0070683_100041284
1137 Ga0070690_100016985
1138 Ga0070690_100023271
1139 Ga0070690_100085429
1140 Ga0070670_100003559
1141 Ga0070670_100006267
1142 Ga0070670_100024192
1143 Ga0070670_100027941
1144 Ga0070677_10011542
1145 Ga0070677_10020351
1146 Ga0068869_100008691
1147 Ga0068869_100120544
1148 Ga0070666_10061055
1149 Ga0068868_100023017
1150 Ga0068868_100023041
1151 Ga0068868_100026944
1152 Ga0068868_100194820
1153 Ga0070660_100019139
1154 Ga0070660_100056916
1155 Ga0070689_100004535
1156 Ga0070689_100006832
1157 Ga0070689_100143963
1158 Ga0070687_100026143
1159 Ga0070687_100043262
1160 Ga0070687_100050568
1161 Ga0070687_100081101
1162 Ga0070661_100044407
1163 Ga0070692_10018791
1164 Ga0070668_100004968
1165 Ga0070668_100043444
1166 Ga0070668_100063659
1167 Ga0070668_100064576
1168 Ga0070668_100081102
1169 Ga0070669_100001192
1170 Ga0070669_100001561
1171 Ga0070669_100004537
1172 Ga0070669_100028454
1173 Ga0070669_100035328
1174 Ga0070669_100041033
1175 Ga0070669_100071751
1176 Ga0070669_100120839
1177 Ga0070675_100000202
1178 Ga0070675_100000206
1179 Ga0070675_100005108
1180 Ga0070675_100005942
1181 Ga0070675_100012775
1182 Ga0070675_100017985
1183 Ga0070675_100018812
1184 Ga0070675_100024739
1185 Ga0070675_100039166
1186 Ga0070675_100041623
1187 Ga0070675_100044603
1188 Ga0070675_100059125
1189 Ga0070675_100079333
1190 Ga0070671_100028379
1191 Ga0070671_100030682
1192 Ga0070671_100035887
1193 Ga0070671_100038680
1194 Ga0070674_100002368
1195 Ga0070674_100025398
1196 Ga0070674_100134407
1197 Ga0070674_100170575
1198 Ga0070673_100002817
1199 Ga0070673_100064826
1200 Ga0070673_100123153
1201 Ga0070688_100001628
1202 Ga0070688_100020187
1203 Ga0070688_100022403
1204 Ga0070688_100028569
1205 Ga0070667_100021458
1206 Ga0070667_100075871
1207 Ga0070714_100198070
1208 Ga0070713_100025976
1209 Ga0070705_100029528
1210 Ga0070705_100070476
1211 Ga0070705_100136569
1212 Ga0070700_100000968
1213 Ga0070700_100025697
1214 Ga0070700_100037343
1215 Ga0070700_100038341
1216 Ga0070700_100049340
1217 Ga0070700_100066926
1218 Ga0070694_100012880
1219 Ga0070694_100023992
1220 Ga0070694_100174569
1221 Ga0070678_100029881
1222 Ga0070678_100043784
1223 Ga0070678_100086152
1224 Ga0070662_100061538
1225 Ga0070662_100170308
1226 Ga0070681_10013233
1227 Ga0070681_10140196
1228 Ga0068867_100010452
1229 Ga0068867_100013700
1230 Ga0068867_100019671
1231 Ga0068867_100132362
1232 Ga0070685_10001979
1233 Ga0070685_10014580
1234 Ga0070698_100039536
1235 Ga0070698_100097134
1236 Ga0070698_100191331
1237 Ga0070699_100000007
1238 Ga0070699_100003987
1239 Ga0070679_100016110
1240 Ga0070679_100172727
1241 Ga0070684_100000068
1242 Ga0070684_100020170
1243 Ga0070697_100192204
1244 Ga0070672_100008568
1245 Ga0070672_100025303
1246 Ga0070672_100041589
1247 Ga0070672_100053873
1248 Ga0070672_100111763
1249 Ga0070686_100006352
1250 Ga0070686_100007023
1251 Ga0070695_100001205
1252 Ga0070695_100001952
1253 Ga0070695_100030029
1254 Ga0070695_100038335
1255 Ga0070696_100001294
1256 Ga0070696_100008998
1257 Ga0070665_100007987
1258 Ga0070665_100010173
1259 Ga0070704_100004180
1260 Ga0070704_100018397
1261 Ga0070704_100025329
1262 Ga0070704_100059921
1263 Ga0070704_100070130
1264 Ga0068855_100012923
1265 Ga0068855_100374663
1266 Ga0070664_100000408
1267 Ga0070664_100003670
1268 Ga0070664_100019545
1269 Ga0070664_100032713
1270 Ga0070664_100093589
1271 Ga0070664_100165718
1272 Ga0068857_100108744
1273 Ga0068854_100028686
1274 Ga0068856_100180363
1275 Ga0068859_100004188
1276 Ga0068859_100015694
1277 Ga0068859_100066179
1278 Ga0068859_100075855
1279 Ga0068859_100084090
1280 Ga0068864_100005121
1281 Ga0068864_100006208
1282 Ga0068864_100026939
1283 Ga0068864_100177456
1284 Ga0068861_100027826
1285 Ga0068861_100030653
1286 Ga0068861_100034050
1287 Ga0068861_100131029
1288 Ga0068870_10002093
1289 Ga0068870_10081442
1290 Ga0068863_100005710
1291 Ga0068863_100058868
1292 Ga0068863_100085510
1293 Ga0068863_100122683
1294 Ga0068858_100021570
1295 Ga0068858_100051153
1296 Ga0068858_100074937
1297 Ga0068858_100109801
1298 Ga0068858_100115632
1299 Ga0068860_100022781
1300 Ga0068860_100029728
1301 Ga0068860_100080666
1302 Ga0068862_100001571
1303 Ga0068862_100009631
1304 Ga0068862_100012472
1305 Ga0068862_100040589
1306 Ga0068862_100045061
1307 Ga0081455_10051291
1308 Ga0081539_10000093
1309 Ga0081539_10001136
1310 Ga0081539_10005341
1311 Ga0081539_10024601
1312 Ga0081539_10060814
1313 Ga0070717_10025040
1314 Ga0075365_10001207
1315 Ga0075368_10012646
1316 Ga0075364_10011061
1317 Ga0075364_10058015
1318 Ga0075364_10103863
1319 Ga0075362_10017339
1320 Ga0075367_10009279
1321 Ga0075366_10039830
1322 Ga0097621_100000477
1323 Ga0097621_100008437
1324 Ga0097621_100022155
1325 Ga0097621_100036950
1326 Ga0097621_100037047
1327 Ga0097621_100038495
1328 Ga0097621_100050813
1329 Ga0097621_100067724
1330 Ga0097621_100147494
1331 Ga0068871_100008313
1332 Ga0068871_100012223
1333 Ga0068871_100047791
1334 Ga0068871_100068766
1335 Ga0068871_100161286
1336 Ga0068871_100181531
1337 Ga0075428_100000007
1338 Ga0075428_100000080
1339 Ga0075428_100000786
1340 Ga0075428_100003353
1341 Ga0075428_100008548
1342 Ga0075428_100008810
1343 Ga0075428_100011793
1344 Ga0075428_100019393
1345 Ga0075428_100020230
1346 Ga0075428_100054663
1347 Ga0075428_100077112
1348 Ga0075428_100199333
1349 Ga0075430_100000632
1350 Ga0075430_100001296
1351 Ga0075430_100003498
1352 Ga0075430_100008831
1353 Ga0075430_100038848
1354 Ga0075430_100038936
1355 Ga0075430_100104393
1356 Ga0075430_100196300
1357 Ga0075431_100002075
1358 Ga0075431_100013703
1359 Ga0075431_100017585
1360 Ga0075431_100032416
1361 Ga0075431_100050231
1362 Ga0075431_100062128
1363 Ga0075431_100105378
1364 Ga0075431_100111446
1365 Ga0075431_100132447
1366 Ga0075431_100145681
1367 Ga0075431_100315985
1368 Ga0075433_10002779
1369 Ga0075433_10010054
1370 Ga0075433_10011200
1371 Ga0075433_10012778
1372 Ga0075433_10027266
1373 Ga0075433_10027302
1374 Ga0075433_10036661
1375 Ga0075433_10038072
1376 Ga0075433_10045659
1377 Ga0075433_10057747
1378 Ga0075433_10079463
1379 Ga0075433_10211787
1380 Ga0075434_100000553
1381 Ga0075434_100002096
1382 Ga0075434_100002820
1383 Ga0075434_100007871
1384 Ga0075434_100010094
1385 Ga0075434_100012917
1386 Ga0075434_100014738
1387 Ga0075434_100041345
1388 Ga0075434_100042603
1389 Ga0075434_100058710
1390 Ga0075429_100000156
1391 Ga0075429_100000181
1392 Ga0075429_100001098
1393 Ga0075429_100004082
1394 Ga0075429_100117096
1395 Ga0075429_100255418
1396 Ga0068865_100002173
1397 Ga0075436_100033289
1398 Ga0075436_100087256
1399 Ga0097620_100004188
1400 Ga0097620_100015694
1401 Ga0097620_100066176
1402 Ga0097620_100075856
1403 Ga0097620_100084096
1404 Ga0075435_100009665
1405 Ga0075435_100011975
1406 Ga0075435_100016827
1407 Ga0075435_100021045
1408 Ga0075435_100031932
1409 Ga0075435_100104286
1410 Ga0105240_10009773
1411 Ga0105240_10013841
1412 Ga0105240_10036167
1413 Ga0105240_10238719
1414 Ga0111539_10000181
1415 Ga0111539_10000209
1416 Ga0111539_10000574
1417 Ga0111539_10002852
1418 Ga0111539_10003328
1419 Ga0111539_10003739
1420 Ga0111539_10004071
1421 Ga0111539_10004218
1422 Ga0111539_10016089
1423 Ga0111539_10029772
1424 Ga0111539_10048815
1425 Ga0111539_10052978
1426 Ga0111539_10059071
1427 Ga0111539_10084906
1428 Ga0111539_10135308
1429 Ga0111539_10146840
1430 Ga0111539_10261123
1431 Ga0111539_10314674
1432 Ga0105245_10131765
1433 Ga0105247_10008195
1434 Ga0105247_10011689
1435 Ga0114129_10000077
1436 Ga0114129_10000113
1437 Ga0114129_10000307
1438 Ga0114129_10002524
1439 Ga0114129_10004747
1440 Ga0114129_10005533
1441 Ga0114129_10006290
1442 Ga0114129_10006678
1443 Ga0114129_10007407
1444 Ga0114129_10009011
1445 Ga0114129_10009671
1446 Ga0114129_10013454
1447 Ga0114129_10013767
1448 Ga0114129_10015882
1449 Ga0114129_10030092
1450 Ga0114129_10036699
1451 Ga0114129_10039874
1452 Ga0114129_10042957
1453 Ga0114129_10058505
1454 Ga0114129_10063737
1455 Ga0114129_10089306
1456 Ga0114129_10107549
1457 Ga0114129_10154116
1458 Ga0114129_10158910
1459 Ga0105243_10003051
1460 Ga0105242_10005143
1461 Ga0105242_10042492
1462 Ga0105242_10055119
1463 Ga0105242_10160113
1464 Ga0105248_10001783
1465 Ga0105248_10003833
1466 Ga0105248_10005184
1467 Ga0105248_10010776
1468 Ga0105248_10010908
1469 Ga0105248_10012467
1470 Ga0105248_10028175
1471 Ga0105248_10038320
1472 Ga0105248_10044199
1473 Ga0105248_10054018
1474 Ga0105248_10192225
1475 Ga0105248_10358169
1476 Ga0105237_10030497
1477 Ga0105238_10027781
1478 Ga0105238_10029490
1479 Ga0105249_10001092
1480 Ga0105249_10011683
1481 Ga0105249_10052233
1482 Ga0105249_10055785
1483 Ga0105249_10083921
1484 Ga0105249_10087484
1485 Ga0105239_10017761
1486 Ga0105239_10276831
1487 Ga0157374_10024063
1488 Ga0157374_10366784
1489 Ga0163162_10008545
1490 Ga0163162_10032984
1491 Ga0163162_10074115
1492 Ga0163162_10091254
1493 Ga0163162_10095784
1494 Ga0157375_10025155
1495 Ga0157375_10068735
1496 Ga0157375_10142257
1497 Ga0163163_10000047
1498 Ga0163163_10005340
1499 Ga0163163_10021497
1500 Ga0163163_10028101
1501 Ga0163163_10064946
1502 Ga0163163_10075314
1503 Ga0157380_10001986
1504 Ga0157380_10007318
1505 Ga0157380_10010028
1506 Ga0157380_10020053
1507 Ga0157380_10024109
1508 Ga0157380_10026961
1509 Ga0157380_10174858
1510 Ga0157377_10042638
1511 Ga0157379_10012793
1512 Ga0157379_10013798
1513 Ga0157379_10020122
1514 Ga0157379_10099515
1515 Ga0157376_10060992
1516 Ga0157376_10149303
1517 Ga0163161_10040200
1518 Ga0163161_10056954
1519 Ga0163161_10080236
1520 Ga0207697_10020849
1521 Ga0207697_10025754
1522 Ga0207697_10050815
1523 Ga0207682_10006048
1524 Ga0207682_10017796
1525 Ga0207710_10006310
1526 Ga0207710_10006379
1527 Ga0207688_10003950
1528 Ga0207688_10013281
1529 Ga0207688_10014183
1530 Ga0207688_10018526
1531 Ga0207688_10084546
1532 Ga0207688_10087308
1533 Ga0207680_10067251
1534 Ga0207645_10004101
1535 Ga0207645_10008400
1536 Ga0207645_10034657
1537 Ga0207645_10088921
1538 Ga0207643_10007282
1539 Ga0207643_10098178
1540 Ga0207705_10060270
1541 Ga0207654_10106822
1542 Ga0207707_10038117
1543 Ga0207707_10172741
1544 Ga0207695_10026602
1545 Ga0207695_10029236
1546 Ga0207663_10007364
1547 Ga0207663_10068767
1548 Ga0207662_10023067
1549 Ga0207662_10025576
1550 Ga0207662_10036774
1551 Ga0207662_10042909
1552 Ga0207657_10003257
1553 Ga0207657_10073468
1554 Ga0207649_10106048
1555 Ga0207681_10004007
1556 Ga0207681_10016755
1557 Ga0207681_10057356
1558 Ga0207681_10066082
1559 Ga0207681_10235816
1560 Ga0207694_10103779
1561 Ga0207650_10001649
1562 Ga0207650_10031961
1563 Ga0207650_10032634
1564 Ga0207650_10033192
1565 Ga0207650_10133276
1566 Ga0207650_10250376
1567 Ga0207659_10000076
1568 Ga0207659_10000461
1569 Ga0207659_10000471
1570 Ga0207659_10002587
1571 Ga0207659_10029776
1572 Ga0207659_10044650
1573 Ga0207659_10076973
1574 Ga0207659_10088369
1575 Ga0207659_10116355
1576 Ga0207659_10175480
1577 Ga0207687_10020472
1578 Ga0207700_10025895
1579 Ga0207644_10024625
1580 Ga0207644_10029970
1581 Ga0207644_10064587
1582 Ga0207644_10068560
1583 Ga0207644_10117017
1584 Ga0207644_10119771
1585 Ga0207706_10015171
1586 Ga0207706_10022207
1587 Ga0207706_10025028
1588 Ga0207706_10041843
1589 Ga0207706_10071329
1590 Ga0207706_10135628
1591 Ga0207706_10202514
1592 Ga0207686_10014644
1593 Ga0207670_10015612
1594 Ga0207670_10036404
1595 Ga0207670_10093337
1596 Ga0207669_10001846
1597 Ga0207669_10002258
1598 Ga0207669_10062597
1599 Ga0207704_10003631
1600 Ga0207704_10006204
1601 Ga0207704_10074490
1602 Ga0207704_10199139
1603 Ga0207665_10046373
1604 Ga0207691_10015367
1605 Ga0207691_10020336
1606 Ga0207691_10027470
1607 Ga0207691_10028121
1608 Ga0207691_10074612
1609 Ga0207691_10119995
1610 Ga0207711_10005797
1611 Ga0207711_10006846
1612 Ga0207711_10025494
1613 Ga0207711_10035473
1614 Ga0207711_10038575
1615 Ga0207711_10077908
1616 Ga0207711_10079461
1617 Ga0207711_10094799
1618 Ga0207711_10099480
1619 Ga0207711_10101058
1620 Ga0207711_10114314
1621 Ga0207711_10116727
1622 Ga0207711_10131652
1623 Ga0207711_10183217
1624 Ga0207689_10006551
1625 Ga0207689_10054504
1626 Ga0207689_10064609
1627 Ga0207689_10067119
1628 Ga0207689_10180641
1629 Ga0207689_10212793
1630 Ga0207661_10010865
1631 Ga0207679_10008091
1632 Ga0207679_10015098
1633 Ga0207679_10022966
1634 Ga0207679_10036244
1635 Ga0207679_10058401
1636 Ga0207679_10158403
1637 Ga0207679_10228993
1638 Ga0207667_10082696
1639 Ga0207651_10001596
1640 Ga0207651_10037798
1641 Ga0207651_10049016
1642 Ga0207651_10075547
1643 Ga0207651_10113378
1644 Ga0207651_10151327
1645 Ga0207712_10002016
1646 Ga0207712_10016762
1647 Ga0207668_10020507
1648 Ga0207668_10065097
1649 Ga0207668_10103531
1650 Ga0207668_10245007
1651 Ga0207640_10067270
1652 Ga0207677_10080621
1653 Ga0207703_10014928
1654 Ga0207703_10034006
1655 Ga0207703_10084479
1656 Ga0207703_10093741
1657 Ga0207703_10099811
1658 Ga0207703_10146966
1659 Ga0207678_10009478
1660 Ga0207708_10002926
1661 Ga0207708_10004049
1662 Ga0207708_10008308
1663 Ga0207708_10063453
1664 Ga0207708_10075886
1665 Ga0207708_10100586
1666 Ga0207708_10125077
1667 Ga0207708_10133793
1668 Ga0207702_10099973
1669 Ga0207641_10001113
1670 Ga0207641_10108949
1671 Ga0207648_10000280
1672 Ga0207648_10000778
1673 Ga0207648_10001579
1674 Ga0207648_10017573
1675 Ga0207648_10018816
1676 Ga0207648_10021802
1677 Ga0207648_10029855
1678 Ga0207648_10154234
1679 Ga0207676_10004456
1680 Ga0207676_10008274
1681 Ga0207676_10056969
1682 Ga0207676_10058130
1683 Ga0207676_10121922
1684 Ga0207676_10166247
1685 Ga0207674_10037574
1686 Ga0207674_10046430
1687 Ga0207675_100004493
1688 Ga0207675_100006921
1689 Ga0207675_100021110
1690 Ga0207675_100030806
1691 Ga0207675_100062718
1692 Ga0207675_100130760
1693 Ga0207683_10005213
1694 Ga0207683_10015247
1695 Ga0207683_10015261
1696 Ga0207683_10034580
1697 Ga0207683_10060734
1698 Ga0207683_10141509
1699 Ga0207428_10000022
1700 Ga0207428_10000135
1701 Ga0207428_10000558
1702 Ga0207428_10001447
1703 Ga0207428_10003305
1704 Ga0207428_10004896
1705 Ga0207428_10022460
1706 Ga0207428_10023294
1707 Ga0207428_10086259
1708 Ga0207428_10106509
1709 Ga0268266_10009623
1710 Ga0268266_10029590
1711 Ga0268266_10034751
1712 Ga0268266_10077059
1713 Ga0268265_10010233
1714 Ga0268265_10021994
1715 Ga0268265_10080877
1716 Ga0268265_10094471
1717 Ga0268264_10002874
1718 Ga0268264_10062701
1719 Ga0265330_10000015
1720 Ga0265332_10000017
1721 Ga0265325_10008270
1722 Ga0265329_10002615
1723 Ga0265339_10020207
1724 Ga0265316_10000039
1725 Ga0307408_100061008
1726 Ga0307408_100066172
1727 Ga0307408_100080829
1728 Ga0307408_100112073
1729 Ga0265314_10000016
1730 Ga0265314_10040093
1731 Ga0265342_10000044
1732 Ga0307405_10061364
1733 Ga0307405_10064241
1734 Ga0307413_10089348
1735 Ga0307410_10009583
1736 Ga0307406_10087873
1737 Ga0307407_10013241
1738 Ga0307407_10102617
1739 Ga0307407_10116007
1740 Ga0307412_10071374
1741 Ga0307412_10149961
1742 Ga0307409_100001375
1743 Ga0307409_100005295
1744 Ga0307409_100065308
1745 Ga0307409_100103060
1746 Ga0307416_100034586
1747 Ga0307416_100066921
1748 Ga0307416_100088076
1749 Ga0307416_100210504
1750 Ga0307414_10097526
1751 Ga0307411_10004969
1752 Ga0307411_10063979
1753 Ga0307411_10140265
1754 Ga0307411_10156657
1755 Ga0307411_10168329
1756 Ga0373930_0003680
1757 Ga0373948_0001775
1758 Ga0373928_0005146
1759 Ga0373929_0004697
1760 Ga0373934_0010765
1761 Ga0373940_0001492
1762 Ga0373949_0002727
1763 Ga0373951_0018499
1764 Ga0373952_0002782
1765 Ga0373923_0035010
1766 Ga0373932_0009933
1767 Ga0373939_0002941
1768 Ga0373939_0020235
1769 Ga0373945_0031010
1770 Ga0373945_0066025
1771 Ga0373953_0052620
1772 Ga0373957_0063118
1773 Ga0373957_0075069
1774 Ga0373960_0000362
1775 Ga0373943_0001725
1776 Ga0373946_0001902
1777 Ga0373955_0031813
1778 Ga0373942_0001010
1779 Ga0373961_0010557
1780 Ga0373931_0042939
1781 Ga0373931_0080686
1782 Ga0373933_0034123
1783 Ga0373947_0007561
1784 Ga0373947_0052813
1785 Ga0373937_0001526
1786 Ga0373937_0041405
1787 Ga0373937_0177620
1788 Ga0373937_0233866
1789 Ga0373925_0000666
1790 Ga0395901_0248514
1791 Ga0436365_1277884
1792 Ga0439453_0004790
1793 Ga0439433_0003999
1794 Ga0439450_010016
1795 Ga0450920_005947
1796 Ga0439446_0011237
1797 Ga0439435_0001853
1798 Ga0439435_0002783
1799 Ga0439435_0003350
1800 Ga0439435_0008135
1801 Ga0439464_0000294
1802 Ga0451577_0028425
1803 Ga0439440_0007708
1804 Ga0453683_0095050
1805 Ga0453684_0029348
1806 Ga0453684_0072257
1807 Ga0453684_0320139
1808 Ga0451576_0004346
1809 Ga0451576_0008073
1810 Ga0451576_0015327
1811 Ga0451576_0077844
1812 Ga0451576_0139283
1813 Ga0451576_0183987
1814 Ga0466967_0118006
1815 Ga0466967_0294117
1816 Ga0495592_0071588
1817 Ga0495629_0009461
1818 Ga0495638_0006332
1819 Ga0495594_0020752
1820 Ga0495608_0041859
1821 Ga0495608_0130295
1822 Ga0495628_0028907
1823 Ga0495630_0013627
1824 Ga0495630_0201793
1825 Ga0495643_0001393
1826 Ga0495640_0064900
1827 Ga0495621_0003318
1828 Ga0495645_0098078
1829 Ga0495633_0053293
1830 Ga0495667_0016766
1831 Ga0495634_0088813
1832 Ga0495635_0039743
1833 Ga0495635_0106324
1834 Ga0495659_0027088
1835 Ga0495599_0088562
1836 Ga0495647_0029052
1837 Ga0495658_0123868
1838 Ga0495613_0006956
1839 Ga0495613_0047158
1840 Ga0495613_0065824
1841 Ga0495670_0036826
1842 Ga0495600_0030274
1843 Ga0495600_0049474
1844 Ga0495604_0031343
1845 Ga0495674_0024135
1846 Ga0495674_0196121
1847 Ga0495676_0016362
1848 Ga0495684_0016408
1849 Ga0496100_0016532
1850 Ga0496101_0003307
1851 Ga0496101_0141223
1852 Ga0496101_0268106
1853 Ga0496102_0073123
1854 Ga0496104_0003519
1855 Ga0496104_0028934
1856 Ga0496104_0159847
1857 Ga0496105_0022601
1858 Ga0496105_0094445
1859 Ga0496106_0077177
1860 Ga0496108_0004496
1861 Ga0496108_0015408
1862 Ga0496108_0040971
1863 Ga0496108_0261787
1864 Ga0496109_0004709
1865 Ga0496109_0029372
1866 Ga0496109_0040714
1867 Ga0496109_0046363
1868 Ga0496109_0068823
1869 Ga0496109_0223162
1870 Ga0496110_0000897
1871 Ga0496110_0036291
1872 Ga0496110_0073346
1873 Ga0496110_0077169
1874 Ga0496111_0009214
1875 Ga0496112_0001650
1876 Ga0496112_0005540
1877 Ga0496112_0044107
1878 Ga0496112_0046744
1879 Ga0496112_0060715
1880 Ga0496112_0065423
1881 Ga0496112_0137220
1882 Ga0496112_0349109
1883 Ga0496113_0011624
1884 Ga0496113_0019327
1885 Ga0496113_0037367
1886 Ga0496113_0089534
1887 Ga0496114_0001952
1888 Ga0496114_0095742
1889 Ga0496115_0016366
1890 Ga0496115_0158739
1891 Ga0501031_0003834
1892 Ga0501031_0008319
1893 Ga0501031_0023534
1894 Ga0501031_0045228
1895 Ga0501032_0003406
1896 Ga0501032_0006591
1897 Ga0501032_0036893
1898 Ga0501032_0066980
1899 Ga0501032_0081126
1900 Ga0501033_0002656
1901 Ga0501033_0003334
1902 Ga0501033_0032808
1903 Ga0501034_0002688
1904 Ga0501034_0006185
1905 Ga0501034_0104305
1906 Ga0501034_0109328
1907 Ga0501034_0150014
1908 Ga0501036_0000736
1909 Ga0501036_0026222
1910 Ga0501036_0031508
1911 Ga0501036_0040955
1912 Ga0501036_0092669
1913 Ga0501036_0173626
1914 Ga0501037_0017021
1915 Ga0501037_0102470
1916 Ga0501038_0031235
1917 Ga0501038_0056964
1918 Ga0501038_0057808
1919 Ga0501038_0079986
1920 Ga0501038_0093989
1921 Ga0501039_0004068
1922 Ga0501039_0021503
1923 Ga0501039_0024800
1924 Ga0501039_0025318
1925 Ga0501039_0052428
1926 Ga0501039_0168200
1927 Ga0501040_0004631
1928 Ga0501040_0014041
1929 Ga0501041_0003049
1930 Ga0501041_0007112
1931 Ga0501041_0035518
1932 Ga0501041_0037166
1933 Ga0501041_0049888
1934 Ga0501042_0019253
1935 Ga0501042_0044893
1936 Ga0501042_0052527
1937 Ga0501042_0066464
1938 Ga0501042_0073355
1939 Ga0501042_0093100
1940 Ga0501043_0001882
1941 Ga0501043_0010240
1942 Ga0501043_0016768
1943 Ga0501043_0032928
1944 Ga0501046_0003259
1945 Ga0501046_0005980
1946 Ga0501046_0006934
1947 Ga0501046_0008383
1948 Ga0501046_0008645
1949 Ga0501047_0000683
1950 Ga0501047_0007619
1951 Ga0501047_0105225
1952 Ga0501047_0185436
1953 Ga0501048_0001747
1954 Ga0501048_0037048
1955 Ga0501048_0050038
1956 Ga0501067_0000667
1957 Ga0501067_0029727
1958 Ga0501067_0082339
1959 Ga0501068_0002566
1960 Ga0501068_0005128
1961 Ga0501068_0013785
1962 Ga0501068_0033414
1963 Ga0501069_0004495
1964 Ga0501069_0006759
1965 Ga0501069_0106586
1966 Ga0501071_0005860
1967 Ga0501071_0049041
1968 Ga0501071_0066591
1969 Ga0501071_0067781
1970 Ga0501071_0124512
1971 Ga0501071_0222438
1972 Ga0501072_0016556
1973 Ga0501072_0018465
1974 Ga0501072_0025220
1975 Ga0501072_0050222
1976 Ga0501072_0060664
1977 Ga0501072_0079185
1978 Ga0501072_0085501
1979 Ga0501072_0135903
1980 Ga0501072_0194357
1981 Ga0501073_0000363
1982 Ga0501073_0008385
1983 Ga0501073_0009371
1984 Ga0501073_0015623
1985 Ga0501073_0021300
1986 Ga0501074_0000197
1987 Ga0501074_0012371
1988 Ga0501074_0023665
1989 Ga0501074_0039684
1990 Ga0501075_0002949
1991 Ga0501075_0012496
1992 Ga0501075_0017691
1993 Ga0501075_0055766
1994 Ga0501075_0061219
1995 Ga0501075_0088849
1996 Ga0501075_0143058
1997 Ga0501075_0146215
1998 Ga0501075_0171592
1999 Ga0501076_0003473
2000 Ga0501076_0016095
2001 Ga0501076_0050857
2002 Ga0501076_0091889
2003 Ga0501076_0112589
2004 Ga0501076_0121583
2005 Ga0501077_0009163
2006 Ga0501077_0029005
2007 Ga0501077_0056012
2008 Ga0501079_0002309
2009 Ga0501079_0009932
2010 Ga0501079_0010748
2011 Ga0501079_0011505
2012 Ga0501079_0039516
2013 Ga0501079_0053754
2014 Ga0501079_0126866
2015 Ga0501079_0168806
2016 Ga0501080_0012238
2017 Ga0501080_0020637
2018 Ga0501080_0027704
2019 Ga0501080_0058390
2020 Ga0501080_0149584
2021 Ga0501080_0203556
2022 Ga0501081_0002534
2023 Ga0501081_0007283
2024 Ga0501083_0000821
2025 Ga0501083_0001645
2026 Ga0501083_0078559
2027 Ga0501273_002376
2028 Ga0501035_0006399
2029 Ga0501035_0015915
2030 Ga0501035_0038001
2031 Ga0501035_0137659
2032 Ga0501044_0000893
2033 Ga0501044_0007809
2034 Ga0501044_0043943
2035 Ga0501044_0045575
2036 Ga0501044_0064105
2037 Ga0501044_0266688
2038 Ga0501045_0007060
2039 Ga0501045_0008748
2040 Ga0501045_0017536
2041 Ga0501045_0047426
2042 Ga0501045_0125103
2043 Ga0501045_0152383
2044 Ga0501045_0223050
2045 Ga0501045_0275276
2046 nmdc:mga00v17_1243_c1
2047 nmdc:mga00v17_2801_c1
2048 nmdc:mga00v17_72478_c1
2049 nmdc:mga0yw44_115174_c1
2050 nmdc:mga0k408_29521_c1
2051 nmdc:mga0k408_5416_c1
2052 nmdc:mga06z11_34387_c1
2053 nmdc:mga06z11_7457_c1
2054 nmdc:mga07m45_1298_c1
2055 nmdc:mga05p37_1139_c1
2056 nmdc:mga05p37_12748_c1
2057 nmdc:mga05p37_131786_c1
2058 nmdc:mga05p37_145314_c1
2059 nmdc:mga05p37_157050_c1
2060 nmdc:mga05p37_197_c1
2061 nmdc:mga05p37_21237_c1
2062 nmdc:mga05p37_21303_c1
2063 nmdc:mga05p37_21501_c1
2064 nmdc:mga05p37_25752_c1
2065 nmdc:mga05p37_28099_c1
2066 nmdc:mga05p37_286280_c1
2067 nmdc:mga05p37_30361_c1
2068 nmdc:mga05p37_31101_c1
2069 nmdc:mga05p37_311500_c1
2070 nmdc:mga05p37_322755_c1
2071 nmdc:mga05p37_33308_c1
2072 nmdc:mga05p37_57005_c1
2073 nmdc:mga05p37_62749_c1
2074 nmdc:mga05p37_65335_c1
2075 nmdc:mga05p37_74954_c1
2076 nmdc:mga05p37_7667_c1
2077 nmdc:mga05p37_9253_c1
2078 nmdc:mga09592_204633_c1
2079 nmdc:mga09592_256854_c1
2080 nmdc:mga09592_53130_c1
2081 nmdc:mga09592_5795_c1
2082 nmdc:mga09592_8337_c1
2083 nmdc:mga09592_89838_c1
2084 nmdc:mga0qj67_1042_c1
2085 nmdc:mga0qj67_170442_c1
2086 nmdc:mga0qj67_19242_c1
2087 nmdc:mga0qj67_209930_c1
2088 nmdc:mga0qj67_31433_c1
2089 nmdc:mga0qj67_32635_c1
2090 nmdc:mga0qj67_39879_c1
2091 nmdc:mga0qj67_90989_c1
2092 nmdc:mga06r32_104172_c1
2093 nmdc:mga06r32_116254_c1
2094 nmdc:mga06r32_118584_c1
2095 nmdc:mga06r32_12799_c1
2096 nmdc:mga06r32_18508_c1
2097 nmdc:mga06r32_61558_c1
2098 nmdc:mga06r32_64352_c1
2099 nmdc:mga06r32_69541_c1
2100 nmdc:mga06r32_7395_c1
2101 nmdc:mga06r32_81749_c1
2102 nmdc:mga06r32_86527_c1
2103 nmdc:mga08y16_10795_c1
2104 nmdc:mga08y16_11591_c1
2105 nmdc:mga08y16_124538_c1
2106 nmdc:mga08y16_1923_c1
2107 nmdc:mga08y16_21139_c1
2108 nmdc:mga08y16_21_c1
2109 nmdc:mga08y16_243407_c1
2110 nmdc:mga08y16_25842_c1
2111 nmdc:mga08y16_26547_c1
2112 nmdc:mga08y16_3644_c1
2113 nmdc:mga08y16_403_c1
2114 nmdc:mga08y16_408076_c1
2115 nmdc:mga08y16_44989_c1
2116 nmdc:mga08y16_56579_c1
2117 nmdc:mga08y16_71603_c1
2118 nmdc:mga08y16_75338_c1
2119 nmdc:mga08y16_8892_c1
2120 nmdc:mga08y16_90833_c1
2121 nmdc:mga0n895_11067_c1
2122 nmdc:mga0n895_129542_c1
2123 nmdc:mga0n895_151369_c1
2124 nmdc:mga0n895_16192_c1
2125 nmdc:mga0n895_16479_c1
2126 nmdc:mga0n895_337729_c1
2127 nmdc:mga0n895_41462_c1
2128 nmdc:mga0n895_5746_c1
2129 nmdc:mga0n895_75673_c1
2130 nmdc:mga0n895_84815_c1
2131 nmdc:mga0n895_9342_c1
2132 nmdc:mga0n895_97_c1
2133 nmdc:mga0rr50_116257_c1
2134 nmdc:mga0rr50_20_c1
2135 nmdc:mga0rr50_31024_c1
2136 nmdc:mga0rr50_45356_c1
2137 nmdc:mga0rr50_47864_c1
2138 nmdc:mga0rr50_77144_c1
2139 nmdc:mga08x19_13758_c1
2140 nmdc:mga08x19_17369_c1
2141 nmdc:mga08x19_26445_c1
2142 nmdc:mga08x19_52646_c1
2143 nmdc:mga0a205_10050_c1
2144 nmdc:mga0a205_105792_c1
2145 nmdc:mga0a205_11144_c1
2146 nmdc:mga0a205_122403_c1
2147 nmdc:mga0a205_127758_c1
2148 nmdc:mga0a205_13412_c1
2149 nmdc:mga0a205_138344_c1
2150 nmdc:mga0a205_17279_c1
2151 nmdc:mga0a205_17801_c1
2152 nmdc:mga0a205_18723_c1
2153 nmdc:mga0a205_261307_c1
2154 nmdc:mga0a205_323_c1
2155 nmdc:mga0a205_57110_c1
2156 nmdc:mga0a205_92383_c1
2157 Ga0495595_0020623
2158 Ga0495619_0000422
2159 Ga0495619_0034133
2160 Ga0500646_0011717
2161 Ga0500641_0002981
2162 Ga0500555_000105
2163 Ga0500568_0002105
2164 Ga0500616_0000272
2165 Ga0500645_000251
2166 Ga0501084_0003994
2167 Ga0501084_0006296
2168 Ga0501084_0008323
2169 Ga0501084_0009481
2170 Ga0501084_0050218
2171 Ga0501084_0095918
2172 Ga0501084_0281728
2173 Ga0590071_000104
2174 Ga0590071_001734
2175 Ga0590071_004006
2176 Ga0590071_004538
2177 Ga0590071_012213
2178 Ga0590074_000015
2179 Ga0590074_001626
2180 Ga0590075_000096
2181 Ga0590075_000408
2182 Ga0590075_004582
2183 Ga0590077_000033
2184 Ga0590077_000087
2185 Ga0590077_000326
2186 Ga0501082_0002482
2187 Ga0501082_0004282
2188 Ga0501082_0049538
2189 Ga0501082_0058341
2190 Ga0501082_0093849
2191 Ga0530510_0000198
2192 Ga0530510_0001830
2193 Ga0530510_0012625
2194 Ga0530510_0069602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

233

395

0.95

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

122

490

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mmo-assembly1.cif.gz_A the crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus 0.9182 15 455
4mmo-assembly1.cif.gz_A the crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus 0.9102 15 455
2zof-assembly1.cif.gz_B crystal structure of mouse carnosinase cn2 complexed with mn and bestatin 0.9023 1 456
2zof-assembly1.cif.gz_B crystal structure of mouse carnosinase cn2 complexed with mn and bestatin 0.9004 1 456
3dlj-assembly3.cif.gz_A crystal structure of human carnosine dipeptidase 1 0.8945 2 455
ID Description Score Start End Superfamily
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9249 15 455 3.40.630.10
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9117 15 455 3.40.630.10
4ruhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9064 1 456 3.40.630.10
2pokB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9025 197 365 3.30.70.360
4ruhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9005 1 456 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A7X9HR06-F1-model_v4 Dipeptidase 0.9872 105 455 GO:0016787
AF-A0A350V5P5-F1-model_v4 Dipeptidase 0.9857 85 455 GO:0016787
AF-A0A382L2L1-F1-model_v4 Peptidase M20 dimerisation domain-containing protein 0.9845 9 416 GO:0016787
AF-A0A7V2XAR8-F1-model_v4 M20/M25/M40 family metallo-hydrolase 0.9845 1 146 GO:0016787
AF-A0A1Z9KK64-F1-model_v4 deleted 0.9833 1 455

Map