F490000
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1097 | 547 | 970 | 233 |
Family's Representative Sequence
| Representative Sequence | 3300009092|Ga0105250_10032509|Ga0105250_100325092 |
| Length | 273 |
| Sequence | MGASRSVLIERLSAMSYDRGTEQQKSAIAGNIPAAAARGAMIDLHYAPTPNGWKISIMLEELGLPYQVIPVNIRAGEQFRSEFLAISPNNRIPAIVDHEPADGQGPFSVFETGAILIYLADKTGRFLPKAARPRSRVMEWLMWQMSGLGPMLGQHGHFALYAAEKIPYAIERYRDEAARLYRVLDTQLGKTGAYVAGDYSIVDIACFPWTMTHKAQGFTLDDYPNVKRWYAEVRARPQVQAGLAIGKFVKEPFDEEARRNMFGARAKEMALRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 3 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 4 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 5 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 6 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 7 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 8 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 9 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 10 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 11 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 12 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 13 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 14 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 15 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 16 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 17 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 18 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 19 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 20 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 21 | 2791355199 | |||
| 22 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 23 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 24 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 25 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 26 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 27 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 28 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 29 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 30 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 31 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 32 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 33 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 34 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 35 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 36 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 37 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 38 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 39 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 40 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 41 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 42 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 43 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 44 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 45 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 46 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 47 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 48 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 49 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 50 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 51 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 52 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 53 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 54 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 55 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 56 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 57 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 58 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 59 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 60 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 61 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 62 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 63 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 64 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 65 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 66 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 67 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 68 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 69 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 70 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 71 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 72 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 73 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 74 | 2906610324 | |||
| 75 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 76 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 77 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 78 | 2922368715 | |||
| 79 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 80 | 2922425934 | |||
| 81 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 82 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 83 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 84 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 85 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 86 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 87 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 88 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 89 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 90 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 91 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 92 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 93 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 94 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 95 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 96 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 97 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 98 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 99 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 100 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 101 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 102 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 103 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 104 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 105 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 106 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 107 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 108 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 109 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 110 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 111 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 112 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 113 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 114 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 115 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 116 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 117 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 118 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 119 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 120 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 121 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 122 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 123 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 124 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 125 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 126 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 127 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 128 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 129 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 132 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 133 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 134 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 136 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 137 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 138 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 139 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 140 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 145 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 147 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 148 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 149 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 150 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 151 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 152 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 154 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 155 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 156 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 158 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 159 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 161 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 165 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 167 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 168 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 169 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 171 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 172 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 173 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 174 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 175 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 176 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 177 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 178 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 179 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 180 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 181 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 182 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 183 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 184 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 185 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 186 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 187 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 188 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 189 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 190 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 191 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 192 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 193 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 194 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 195 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 196 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 198 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 199 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 201 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 202 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 213 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 214 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 215 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 216 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 221 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 222 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 227 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 228 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 229 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 230 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 231 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 232 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 233 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 237 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 238 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 240 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 283 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 286 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 287 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 288 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 290 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 291 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 292 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 293 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 294 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 295 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 298 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 300 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 301 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 302 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 304 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 305 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 306 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 307 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 308 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 309 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 310 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 311 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 312 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 313 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 314 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 315 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 316 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 317 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 318 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 319 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 320 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 321 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 322 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 323 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 324 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 325 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 326 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 327 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 328 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 329 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 330 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 331 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 332 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 333 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 334 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 335 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 336 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 337 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 338 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 339 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 340 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 341 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 342 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 343 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 344 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 345 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 346 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 347 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 348 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 349 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 350 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 351 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 352 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 353 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 354 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 355 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 356 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 357 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 358 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 359 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 360 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 361 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 434 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 437 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 438 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 439 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 440 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 441 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 442 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 443 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 444 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 445 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 446 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 447 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 448 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 449 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 450 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 451 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 452 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 453 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 454 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 455 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 456 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 457 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 458 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 459 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 460 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 461 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 462 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 463 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 466 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 489 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 490 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 491 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 492 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 493 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 494 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 495 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 496 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 501 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 504 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 508 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 509 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 510 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 511 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 512 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 513 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 514 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 515 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 516 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 517 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 518 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 519 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 520 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 521 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 522 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 523 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 524 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 525 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 526 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 527 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 528 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 529 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 530 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 531 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 532 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 533 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 534 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 535 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 536 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 537 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 538 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 539 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 540 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 541 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 542 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 543 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 544 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 545 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 546 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 547 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.66 |
| Metatranscriptomes | 0.09 |
| Isolates | 11.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.48 |
| Nodule | 7.66 |
| Rhizoplane | 5.38 |
| Rhizosphere | 66.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10017791 | 3300001979 | Bacteria | 2534 |
| 2 | JGI24739J22299_10059542 | 3300001989 | Bacteria | 1210 |
| 3 | JGI24737J22298_10033372 | 3300001990 | Bacteria | 1599 |
| 4 | JGI24738J21930_10055969 | 3300002075 | Bacteria | 807 |
| 5 | JGI25406J46586_10000169 | 3300003203 | Bacteria | 29128 |
| 6 | JGI25406J46586_10000649 | 3300003203 | Bacteria | 16248 |
| 7 | JGI25406J46586_10001342 | 3300003203 | Bacteria | 11588 |
| 8 | JGI25153J46596_10001707 | 3300003215 | Bacteria | 13020 |
| 9 | JGI25153J46596_10006992 | 3300003215 | Bacteria | 5622 |
| 10 | JGI25153J46596_10008439 | 3300003215 | Bacteria | 4923 |
| 11 | JGI25160J50197_1003053 | 3300003354 | Bacteria | 7635 |
| 12 | JGI25160J50197_1008288 | 3300003354 | Bacteria | 3970 |
| 13 | JGI25160J50197_1008476 | 3300003354 | Bacteria | 3913 |
| 14 | JGI25404J52841_10007600 | 3300003659 | Bacteria | 2296 |
| 15 | JGI25404J52841_10013992 | 3300003659 | Bacteria | 1740 |
| 16 | Ga0055539_1011509 | 3300003752 | Bacteria | 1089 |
| 17 | Ga0065165_1003321 | 3300005262 | Bacteria | 11502 |
| 18 | Ga0065165_1020904 | 3300005262 | Bacteria | 2287 |
| 19 | Ga0065704_10239132 | 3300005289 | Bacteria | 1012 |
| 20 | Ga0070658_10364883 | 3300005327 | Bacteria | 1237 |
| 21 | Ga0070676_10290013 | 3300005328 | Bacteria | 1105 |
| 22 | Ga0070683_100097821 | 3300005329 | Bacteria | 2761 |
| 23 | Ga0070683_100385969 | 3300005329 | Bacteria | 1335 |
| 24 | Ga0070670_100192058 | 3300005331 | Bacteria | 1774 |
| 25 | Ga0070670_100365218 | 3300005331 | Bacteria | 1270 |
| 26 | Ga0068869_100334157 | 3300005334 | Bacteria | 1232 |
| 27 | Ga0070666_10335761 | 3300005335 | Bacteria | 1080 |
| 28 | Ga0070680_100023477 | 3300005336 | Bacteria | 4918 |
| 29 | Ga0070680_100046138 | 3300005336 | Bacteria | 3544 |
| 30 | Ga0070680_100124919 | 3300005336 | Bacteria | 2149 |
| 31 | Ga0070680_100375836 | 3300005336 | Bacteria | 1210 |
| 32 | Ga0070682_100077343 | 3300005337 | Bacteria | 2144 |
| 33 | Ga0070660_100046974 | 3300005339 | Bacteria | 3310 |
| 34 | Ga0070660_100280581 | 3300005339 | Bacteria | 1363 |
| 35 | Ga0070692_10245797 | 3300005345 | Bacteria | 1068 |
| 36 | Ga0070668_100031965 | 3300005347 | Bacteria | 4005 |
| 37 | Ga0070668_100033764 | 3300005347 | Bacteria | 3898 |
| 38 | Ga0070668_100128620 | 3300005347 | Bacteria | 2031 |
| 39 | Ga0070668_100200452 | 3300005347 | Bacteria | 1638 |
| 40 | Ga0070668_100219133 | 3300005347 | Bacteria | 1569 |
| 41 | Ga0070668_100224269 | 3300005347 | Bacteria | 1551 |
| 42 | Ga0070675_100825607 | 3300005354 | Bacteria | 848 |
| 43 | Ga0070671_100040085 | 3300005355 | Bacteria | 3888 |
| 44 | Ga0070659_100087281 | 3300005366 | Bacteria | 2497 |
| 45 | Ga0070659_100333063 | 3300005366 | Bacteria | 1271 |
| 46 | Ga0070659_100476292 | 3300005366 | Bacteria | 1062 |
| 47 | Ga0070667_100227901 | 3300005367 | Bacteria | 1660 |
| 48 | Ga0070709_10023604 | 3300005434 | Bacteria | 3614 |
| 49 | Ga0070709_10206931 | 3300005434 | Bacteria | 1393 |
| 50 | Ga0070714_100004718 | 3300005435 | Bacteria | 10310 |
| 51 | Ga0070714_100024383 | 3300005435 | Bacteria | 4981 |
| 52 | Ga0070714_100100246 | 3300005435 | Bacteria | 2551 |
| 53 | Ga0070714_100192957 | 3300005435 | Bacteria | 1860 |
| 54 | Ga0070713_100004489 | 3300005436 | Bacteria | 9384 |
| 55 | Ga0070713_100027904 | 3300005436 | Bacteria | 4452 |
| 56 | Ga0070713_100032765 | 3300005436 | Bacteria | 4155 |
| 57 | Ga0070713_100396813 | 3300005436 | Bacteria | 1288 |
| 58 | Ga0070713_100451308 | 3300005436 | Bacteria | 1208 |
| 59 | Ga0070710_10013160 | 3300005437 | Bacteria | 4134 |
| 60 | Ga0070711_100011056 | 3300005439 | Bacteria | 5599 |
| 61 | Ga0070700_100104231 | 3300005441 | Bacteria | 1874 |
| 62 | Ga0070700_100117878 | 3300005441 | Bacteria | 1774 |
| 63 | Ga0070700_100220087 | 3300005441 | Bacteria | 1345 |
| 64 | Ga0070694_100134244 | 3300005444 | Bacteria | 1792 |
| 65 | Ga0070663_100040886 | 3300005455 | Bacteria | 3248 |
| 66 | Ga0070663_100053297 | 3300005455 | Bacteria | 2887 |
| 67 | Ga0070663_100063505 | 3300005455 | Bacteria | 2667 |
| 68 | Ga0070663_100067318 | 3300005455 | Bacteria | 2597 |
| 69 | Ga0070663_100183660 | 3300005455 | Bacteria | 1624 |
| 70 | Ga0070663_100269348 | 3300005455 | Bacteria | 1353 |
| 71 | Ga0070678_100031497 | 3300005456 | Bacteria | 3659 |
| 72 | Ga0070678_100170663 | 3300005456 | Bacteria | 1771 |
| 73 | Ga0070678_100253457 | 3300005456 | Bacteria | 1477 |
| 74 | Ga0070662_100146152 | 3300005457 | Bacteria | 1837 |
| 75 | Ga0070662_100187747 | 3300005457 | Bacteria | 1632 |
| 76 | Ga0070681_10017761 | 3300005458 | Bacteria | 7108 |
| 77 | Ga0070681_10092691 | 3300005458 | Bacteria | 2969 |
| 78 | Ga0070681_10146132 | 3300005458 | Bacteria | 2293 |
| 79 | Ga0070698_100118647 | 3300005471 | Bacteria | 2606 |
| 80 | Ga0070698_100219634 | 3300005471 | Bacteria | 1834 |
| 81 | Ga0070699_100116665 | 3300005518 | Bacteria | 2346 |
| 82 | Ga0070699_100297398 | 3300005518 | Bacteria | 1448 |
| 83 | Ga0070679_100006433 | 3300005530 | Bacteria | 10944 |
| 84 | Ga0070679_100061259 | 3300005530 | Bacteria | 3750 |
| 85 | Ga0070684_100275159 | 3300005535 | Bacteria | 1542 |
| 86 | Ga0070684_100374133 | 3300005535 | Bacteria | 1312 |
| 87 | Ga0070684_100908407 | 3300005535 | Bacteria | 825 |
| 88 | Ga0070697_100465339 | 3300005536 | Bacteria | 1103 |
| 89 | Ga0068853_100043317 | 3300005539 | Bacteria | 3850 |
| 90 | Ga0068853_100071780 | 3300005539 | Bacteria | 3015 |
| 91 | Ga0068853_100216372 | 3300005539 | Bacteria | 1748 |
| 92 | Ga0068853_100259998 | 3300005539 | Bacteria | 1595 |
| 93 | Ga0068853_100394271 | 3300005539 | Bacteria | 1295 |
| 94 | Ga0068853_100621687 | 3300005539 | Bacteria | 1027 |
| 95 | Ga0070672_100654552 | 3300005543 | Bacteria | 918 |
| 96 | Ga0070696_100328123 | 3300005546 | Bacteria | 1179 |
| 97 | Ga0070665_100018629 | 3300005548 | Bacteria | 6958 |
| 98 | Ga0070665_100152028 | 3300005548 | Bacteria | 2317 |
| 99 | Ga0070665_100431006 | 3300005548 | Bacteria | 1327 |
| 100 | Ga0068855_100000788 | 3300005563 | Bacteria | 39153 |
| 101 | Ga0068855_100032750 | 3300005563 | Bacteria | 6206 |
| 102 | Ga0068855_100035339 | 3300005563 | Bacteria | 5953 |
| 103 | Ga0068855_100083449 | 3300005563 | Bacteria | 3701 |
| 104 | Ga0068855_100398314 | 3300005563 | Bacteria | 1509 |
| 105 | Ga0068855_100492029 | 3300005563 | Bacteria | 1334 |
| 106 | Ga0068855_100696105 | 3300005563 | Bacteria | 1088 |
| 107 | Ga0070664_100515091 | 3300005564 | Bacteria | 1104 |
| 108 | Ga0070664_100519623 | 3300005564 | Bacteria | 1099 |
| 109 | Ga0068857_100042265 | 3300005577 | Bacteria | 4043 |
| 110 | Ga0068857_100252354 | 3300005577 | Bacteria | 1617 |
| 111 | Ga0068857_100367882 | 3300005577 | Bacteria | 1334 |
| 112 | Ga0068854_100352473 | 3300005578 | Bacteria | 1205 |
| 113 | Ga0068856_100000236 | 3300005614 | Bacteria | 60041 |
| 114 | Ga0068856_100023174 | 3300005614 | Bacteria | 6039 |
| 115 | Ga0068856_100033788 | 3300005614 | Bacteria | 5008 |
| 116 | Ga0068856_100059957 | 3300005614 | Bacteria | 3759 |
| 117 | Ga0068856_100155121 | 3300005614 | Bacteria | 2300 |
| 118 | Ga0068856_100290162 | 3300005614 | Bacteria | 1653 |
| 119 | Ga0068856_100481100 | 3300005614 | Bacteria | 1263 |
| 120 | Ga0068856_100524033 | 3300005614 | Bacteria | 1206 |
| 121 | Ga0070702_100140659 | 3300005615 | Bacteria | 1537 |
| 122 | Ga0068852_100140619 | 3300005616 | Bacteria | 2233 |
| 123 | Ga0068852_100157324 | 3300005616 | Bacteria | 2118 |
| 124 | Ga0068852_100264170 | 3300005616 | Bacteria | 1654 |
| 125 | Ga0068852_100290646 | 3300005616 | Bacteria | 1579 |
| 126 | Ga0068859_100126365 | 3300005617 | Bacteria | 2626 |
| 127 | Ga0068864_100210122 | 3300005618 | Bacteria | 1791 |
| 128 | Ga0068864_100215190 | 3300005618 | Bacteria | 1771 |
| 129 | Ga0068864_100236316 | 3300005618 | Bacteria | 1692 |
| 130 | Ga0068866_10409721 | 3300005718 | Bacteria | 877 |
| 131 | Ga0068861_100019782 | 3300005719 | Bacteria | 4811 |
| 132 | Ga0068861_100216382 | 3300005719 | Bacteria | 1616 |
| 133 | Ga0068851_10008459 | 3300005834 | Bacteria | 4757 |
| 134 | Ga0068863_100539719 | 3300005841 | Bacteria | 1151 |
| 135 | Ga0068858_100035309 | 3300005842 | Bacteria | 4637 |
| 136 | Ga0068858_100245808 | 3300005842 | Bacteria | 1698 |
| 137 | Ga0068860_100063240 | 3300005843 | Bacteria | 3515 |
| 138 | Ga0068860_100233567 | 3300005843 | Bacteria | 1787 |
| 139 | Ga0068862_100145605 | 3300005844 | Bacteria | 2105 |
| 140 | Ga0068862_100368564 | 3300005844 | Bacteria | 1336 |
| 141 | Ga0081455_10000453 | 3300005937 | Bacteria | 53921 |
| 142 | Ga0081455_10007549 | 3300005937 | Bacteria | 11436 |
| 143 | Ga0081455_10021358 | 3300005937 | Bacteria | 6074 |
| 144 | Ga0081455_10040180 | 3300005937 | Bacteria | 4128 |
| 145 | Ga0081455_10049019 | 3300005937 | Bacteria | 3644 |
| 146 | Ga0081455_10119021 | 3300005937 | Bacteria | 2084 |
| 147 | Ga0081538_10069452 | 3300005981 | Bacteria | 1951 |
| 148 | Ga0081540_1001498 | 3300005983 | Bacteria | 20120 |
| 149 | Ga0081540_1007278 | 3300005983 | Bacteria | 7924 |
| 150 | Ga0081540_1010330 | 3300005983 | Bacteria | 6331 |
| 151 | Ga0081540_1011806 | 3300005983 | Bacteria | 5806 |
| 152 | Ga0081540_1025933 | 3300005983 | Bacteria | 3359 |
| 153 | Ga0081540_1034728 | 3300005983 | Bacteria | 2714 |
| 154 | Ga0081539_10000255 | 3300005985 | Bacteria | 123054 |
| 155 | Ga0081539_10000726 | 3300005985 | Bacteria | 66051 |
| 156 | Ga0081539_10039521 | 3300005985 | Bacteria | 2782 |
| 157 | Ga0070717_10017227 | 3300006028 | Bacteria | 5616 |
| 158 | Ga0070717_10060144 | 3300006028 | Bacteria | 3145 |
| 159 | Ga0070717_10720248 | 3300006028 | Bacteria | 907 |
| 160 | Ga0075365_10145580 | 3300006038 | Bacteria | 1646 |
| 161 | Ga0075365_10210394 | 3300006038 | Bacteria | 1363 |
| 162 | Ga0075365_10220722 | 3300006038 | Bacteria | 1330 |
| 163 | Ga0075365_10260931 | 3300006038 | Bacteria | 1218 |
| 164 | Ga0075365_10366819 | 3300006038 | Bacteria | 1015 |
| 165 | Ga0075368_10038059 | 3300006042 | Bacteria | 1882 |
| 166 | Ga0075368_10046123 | 3300006042 | Bacteria | 1723 |
| 167 | Ga0075363_100008449 | 3300006048 | Bacteria | 4793 |
| 168 | Ga0075363_100020741 | 3300006048 | Bacteria | 3299 |
| 169 | Ga0075364_10035998 | 3300006051 | Bacteria | 3200 |
| 170 | Ga0075364_10070087 | 3300006051 | Bacteria | 2307 |
| 171 | Ga0075364_10375182 | 3300006051 | Bacteria | 970 |
| 172 | Ga0070715_10146529 | 3300006163 | Bacteria | 1152 |
| 173 | Ga0070716_100084726 | 3300006173 | Bacteria | 1902 |
| 174 | Ga0070716_100332479 | 3300006173 | Bacteria | 1069 |
| 175 | Ga0070712_100477898 | 3300006175 | Bacteria | 1041 |
| 176 | Ga0070712_100641460 | 3300006175 | Bacteria | 902 |
| 177 | Ga0075362_10028091 | 3300006177 | Bacteria | 2414 |
| 178 | Ga0075367_10007429 | 3300006178 | Bacteria | 5609 |
| 179 | Ga0075367_10067317 | 3300006178 | Bacteria | 2147 |
| 180 | Ga0075367_10119164 | 3300006178 | Bacteria | 1625 |
| 181 | Ga0075367_10327419 | 3300006178 | Bacteria | 966 |
| 182 | Ga0075369_10029112 | 3300006186 | Bacteria | 2318 |
| 183 | Ga0075369_10065530 | 3300006186 | Bacteria | 1592 |
| 184 | Ga0075366_10030200 | 3300006195 | Bacteria | 3185 |
| 185 | Ga0097621_100410591 | 3300006237 | Bacteria | 1214 |
| 186 | Ga0097621_100438501 | 3300006237 | Bacteria | 1175 |
| 187 | Ga0075370_10015506 | 3300006353 | Bacteria | 4081 |
| 188 | Ga0075370_10080532 | 3300006353 | Bacteria | 1871 |
| 189 | Ga0075370_10135918 | 3300006353 | Bacteria | 1436 |
| 190 | Ga0075370_10236658 | 3300006353 | Bacteria | 1081 |
| 191 | Ga0075428_101011838 | 3300006844 | Bacteria | 880 |
| 192 | Ga0097620_100126373 | 3300006931 | Bacteria | 2626 |
| 193 | Ga0099794_10043146 | 3300007265 | Bacteria | 2152 |
| 194 | Ga0099794_10054942 | 3300007265 | Bacteria | 1923 |
| 195 | Ga0099794_10239654 | 3300007265 | Bacteria | 934 |
| 196 | Ga0099795_10209060 | 3300007788 | Bacteria | 826 |
| 197 | Ga0105250_10032509 | 3300009092 | Bacteria | 2095 |
| 198 | Ga0105240_10000427 | 3300009093 | Bacteria | 78108 |
| 199 | Ga0105240_10010641 | 3300009093 | Bacteria | 12917 |
| 200 | Ga0105240_10036405 | 3300009093 | Bacteria | 6331 |
| 201 | Ga0105240_10063064 | 3300009093 | Bacteria | 4612 |
| 202 | Ga0105240_10074926 | 3300009093 | Bacteria | 4176 |
| 203 | Ga0105240_10126908 | 3300009093 | Bacteria | 3064 |
| 204 | Ga0105240_10383467 | 3300009093 | Bacteria | 1587 |
| 205 | Ga0105240_10562070 | 3300009093 | Bacteria | 1261 |
| 206 | Ga0105240_10699128 | 3300009093 | Bacteria | 1107 |
| 207 | Ga0111539_11024603 | 3300009094 | Bacteria | 960 |
| 208 | Ga0105245_10174177 | 3300009098 | Bacteria | 2051 |
| 209 | Ga0105247_10041247 | 3300009101 | Bacteria | 2824 |
| 210 | Ga0105247_10045143 | 3300009101 | Bacteria | 2704 |
| 211 | Ga0105247_10063966 | 3300009101 | Bacteria | 2285 |
| 212 | Ga0105247_10453023 | 3300009101 | Bacteria | 925 |
| 213 | Ga0114129_10386990 | 3300009147 | Bacteria | 1846 |
| 214 | Ga0105241_10051616 | 3300009174 | Bacteria | 3137 |
| 215 | Ga0105241_10054907 | 3300009174 | Bacteria | 3051 |
| 216 | Ga0105241_10171949 | 3300009174 | Bacteria | 1790 |
| 217 | Ga0105241_10697018 | 3300009174 | Bacteria | 927 |
| 218 | Ga0105242_10088622 | 3300009176 | Bacteria | 2600 |
| 219 | Ga0105248_10325701 | 3300009177 | Bacteria | 1730 |
| 220 | Ga0105237_10000653 | 3300009545 | Bacteria | 48464 |
| 221 | Ga0105237_10004145 | 3300009545 | Bacteria | 16891 |
| 222 | Ga0105237_10009769 | 3300009545 | Bacteria | 10262 |
| 223 | Ga0105237_10020210 | 3300009545 | Bacteria | 6873 |
| 224 | Ga0105237_10215301 | 3300009545 | Bacteria | 1921 |
| 225 | Ga0105237_10607693 | 3300009545 | Bacteria | 1100 |
| 226 | Ga0105237_10732091 | 3300009545 | Bacteria | 995 |
| 227 | Ga0105238_10009050 | 3300009551 | Bacteria | 9961 |
| 228 | Ga0105238_10038672 | 3300009551 | Bacteria | 4844 |
| 229 | Ga0105238_10050078 | 3300009551 | Bacteria | 4205 |
| 230 | Ga0105238_10097198 | 3300009551 | Bacteria | 2931 |
| 231 | Ga0105238_10146154 | 3300009551 | Bacteria | 2341 |
| 232 | Ga0105238_10194981 | 3300009551 | Bacteria | 2001 |
| 233 | Ga0105238_10285722 | 3300009551 | Bacteria | 1631 |
| 234 | Ga0105238_11187230 | 3300009551 | Bacteria | 787 |
| 235 | Ga0105249_10148072 | 3300009553 | Bacteria | 2257 |
| 236 | Ga0099796_10011391 | 3300010159 | Bacteria | 2480 |
| 237 | Ga0099796_10048120 | 3300010159 | Bacteria | 1469 |
| 238 | Ga0105239_10046661 | 3300010375 | Bacteria | 4747 |
| 239 | Ga0105239_10074545 | 3300010375 | Bacteria | 3731 |
| 240 | Ga0105239_10083618 | 3300010375 | Bacteria | 3515 |
| 241 | Ga0105239_10089022 | 3300010375 | Bacteria | 3404 |
| 242 | Ga0105239_10098988 | 3300010375 | Bacteria | 3224 |
| 243 | Ga0105239_10106169 | 3300010375 | Bacteria | 3111 |
| 244 | Ga0105239_10141128 | 3300010375 | Bacteria | 2684 |
| 245 | Ga0105239_10681398 | 3300010375 | Bacteria | 1175 |
| 246 | Ga0105246_10098918 | 3300011119 | Bacteria | 2120 |
| 247 | Ga0157370_10079560 | 3300013104 | Bacteria | 3086 |
| 248 | Ga0157370_10171667 | 3300013104 | Bacteria | 2016 |
| 249 | Ga0157370_10310123 | 3300013104 | Bacteria | 1456 |
| 250 | Ga0157370_10311510 | 3300013104 | Bacteria | 1452 |
| 251 | Ga0157369_10003596 | 3300013105 | Bacteria | 18418 |
| 252 | Ga0157369_10022335 | 3300013105 | Bacteria | 7062 |
| 253 | Ga0157369_10037100 | 3300013105 | Bacteria | 5338 |
| 254 | Ga0157369_10422186 | 3300013105 | Bacteria | 1382 |
| 255 | Ga0157374_10353677 | 3300013296 | Bacteria | 1460 |
| 256 | Ga0157374_11004044 | 3300013296 | Bacteria | 854 |
| 257 | Ga0157378_10020146 | 3300013297 | Bacteria | 5866 |
| 258 | Ga0157378_10401252 | 3300013297 | Bacteria | 1351 |
| 259 | Ga0163162_10094550 | 3300013306 | Bacteria | 3075 |
| 260 | Ga0163162_10215841 | 3300013306 | Bacteria | 2048 |
| 261 | Ga0163162_10585239 | 3300013306 | Bacteria | 1243 |
| 262 | Ga0157375_11277906 | 3300013308 | Bacteria | 862 |
| 263 | Ga0163163_10108183 | 3300014325 | Bacteria | 2807 |
| 264 | Ga0163163_10311906 | 3300014325 | Bacteria | 1626 |
| 265 | Ga0163163_10429042 | 3300014325 | Bacteria | 1381 |
| 266 | Ga0157380_10207632 | 3300014326 | Bacteria | 1743 |
| 267 | Ga0157377_10100591 | 3300014745 | Bacteria | 1722 |
| 268 | Ga0157377_10204491 | 3300014745 | Bacteria | 1256 |
| 269 | Ga0214544_1000006 | 3300021320 | Bacteria | 380728 |
| 270 | Ga0214544_1003487 | 3300021320 | Bacteria | 32432 |
| 271 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 272 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 273 | Ga0214543_1000017 | 3300021327 | Bacteria | 290109 |
| 274 | Ga0213876_10001081 | 3300021384 | Bacteria | 17491 |
| 275 | Ga0213875_10000651 | 3300021388 | Bacteria | 27647 |
| 276 | Ga0213875_10053548 | 3300021388 | Bacteria | 1890 |
| 277 | Ga0224712_10018155 | 3300022467 | Bacteria | 2346 |
| 278 | Ga0209563_105456 | 3300025230 | Bacteria | 2304 |
| 279 | Ga0209677_109696 | 3300025253 | Bacteria | 1692 |
| 280 | Ga0209677_110235 | 3300025253 | Bacteria | 1584 |
| 281 | Ga0209233_1003327 | 3300025261 | Bacteria | 5697 |
| 282 | Ga0209673_1038688 | 3300025273 | Bacteria | 1385 |
| 283 | Ga0209564_1003910 | 3300025295 | Bacteria | 9545 |
| 284 | Ga0209758_1001514 | 3300025297 | Bacteria | 26963 |
| 285 | Ga0209758_1002429 | 3300025297 | Bacteria | 19044 |
| 286 | Ga0209758_1003622 | 3300025297 | Bacteria | 13820 |
| 287 | Ga0209758_1022116 | 3300025297 | Bacteria | 2933 |
| 288 | Ga0209758_1064190 | 3300025297 | Bacteria | 1191 |
| 289 | Ga0209256_1011253 | 3300025299 | Bacteria | 3607 |
| 290 | Ga0207426_1000554 | 3300025302 | Bacteria | 51521 |
| 291 | Ga0207426_1000561 | 3300025302 | Bacteria | 50758 |
| 292 | Ga0207426_1002946 | 3300025302 | Bacteria | 9999 |
| 293 | Ga0207426_1025498 | 3300025302 | Bacteria | 1990 |
| 294 | Ga0209257_1016614 | 3300025304 | Bacteria | 2962 |
| 295 | Ga0209257_1034974 | 3300025304 | Bacteria | 1559 |
| 296 | Ga0209257_1051630 | 3300025304 | Bacteria | 1158 |
| 297 | Ga0207656_10006228 | 3300025321 | Bacteria | 4276 |
| 298 | Ga0207656_10136174 | 3300025321 | Bacteria | 1154 |
| 299 | Ga0207653_10021834 | 3300025885 | Bacteria | 2031 |
| 300 | Ga0207682_10166149 | 3300025893 | Bacteria | 1002 |
| 301 | Ga0207692_10273636 | 3300025898 | Bacteria | 1019 |
| 302 | Ga0207642_10288260 | 3300025899 | Bacteria | 947 |
| 303 | Ga0207710_10021248 | 3300025900 | Bacteria | 2779 |
| 304 | Ga0207710_10188708 | 3300025900 | Bacteria | 1014 |
| 305 | Ga0207710_10271083 | 3300025900 | Bacteria | 852 |
| 306 | Ga0207688_10006431 | 3300025901 | Bacteria | 6399 |
| 307 | Ga0207680_10126979 | 3300025903 | Bacteria | 1676 |
| 308 | Ga0207647_10013302 | 3300025904 | Bacteria | 5710 |
| 309 | Ga0207647_10013822 | 3300025904 | Bacteria | 5590 |
| 310 | Ga0207647_10034768 | 3300025904 | Bacteria | 3215 |
| 311 | Ga0207685_10030001 | 3300025905 | Bacteria | 1932 |
| 312 | Ga0207685_10044592 | 3300025905 | Bacteria | 1677 |
| 313 | Ga0207699_10023095 | 3300025906 | Bacteria | 3380 |
| 314 | Ga0207643_10076610 | 3300025908 | Bacteria | 1932 |
| 315 | Ga0207684_10416237 | 3300025910 | Bacteria | 1155 |
| 316 | Ga0207654_10000803 | 3300025911 | Bacteria | 17284 |
| 317 | Ga0207654_10002540 | 3300025911 | Bacteria | 9257 |
| 318 | Ga0207654_10095614 | 3300025911 | Bacteria | 1820 |
| 319 | Ga0207654_10194886 | 3300025911 | Bacteria | 1330 |
| 320 | Ga0207707_10000651 | 3300025912 | Bacteria | 34364 |
| 321 | Ga0207707_10003041 | 3300025912 | Bacteria | 14909 |
| 322 | Ga0207707_10116849 | 3300025912 | Bacteria | 2331 |
| 323 | Ga0207707_10117177 | 3300025912 | Bacteria | 2328 |
| 324 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 325 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 326 | Ga0207695_10001543 | 3300025913 | Bacteria | 37956 |
| 327 | Ga0207695_10028927 | 3300025913 | Bacteria | 6134 |
| 328 | Ga0207695_10148018 | 3300025913 | Bacteria | 2290 |
| 329 | Ga0207695_10234406 | 3300025913 | Bacteria | 1738 |
| 330 | Ga0207695_10280482 | 3300025913 | Bacteria | 1560 |
| 331 | Ga0207671_10000377 | 3300025914 | Bacteria | 63306 |
| 332 | Ga0207671_10001548 | 3300025914 | Bacteria | 26304 |
| 333 | Ga0207671_10060773 | 3300025914 | Bacteria | 2803 |
| 334 | Ga0207671_10091814 | 3300025914 | Bacteria | 2289 |
| 335 | Ga0207671_10222544 | 3300025914 | Bacteria | 1479 |
| 336 | Ga0207671_10276956 | 3300025914 | Bacteria | 1323 |
| 337 | Ga0207671_10404529 | 3300025914 | Bacteria | 1086 |
| 338 | Ga0207693_10002906 | 3300025915 | Bacteria | 14827 |
| 339 | Ga0207663_10003355 | 3300025916 | Bacteria | 7820 |
| 340 | Ga0207663_10394774 | 3300025916 | Bacteria | 1057 |
| 341 | Ga0207660_10010504 | 3300025917 | Bacteria | 6013 |
| 342 | Ga0207660_10090240 | 3300025917 | Bacteria | 2270 |
| 343 | Ga0207660_10122975 | 3300025917 | Bacteria | 1967 |
| 344 | Ga0207660_10589950 | 3300025917 | Bacteria | 905 |
| 345 | Ga0207660_10733662 | 3300025917 | Bacteria | 806 |
| 346 | Ga0207657_10009798 | 3300025919 | Bacteria | 9604 |
| 347 | Ga0207649_10229032 | 3300025920 | Bacteria | 1328 |
| 348 | Ga0207652_10002746 | 3300025921 | Bacteria | 14780 |
| 349 | Ga0207652_10009136 | 3300025921 | Bacteria | 7979 |
| 350 | Ga0207694_10001371 | 3300025924 | Bacteria | 20975 |
| 351 | Ga0207694_10012382 | 3300025924 | Bacteria | 6428 |
| 352 | Ga0207694_10063906 | 3300025924 | Bacteria | 2867 |
| 353 | Ga0207694_10104292 | 3300025924 | Bacteria | 2250 |
| 354 | Ga0207694_10125630 | 3300025924 | Bacteria | 2052 |
| 355 | Ga0207694_10269767 | 3300025924 | Bacteria | 1396 |
| 356 | Ga0207650_10081695 | 3300025925 | Bacteria | 2452 |
| 357 | Ga0207650_10548749 | 3300025925 | Bacteria | 969 |
| 358 | Ga0207659_10711480 | 3300025926 | Bacteria | 860 |
| 359 | Ga0207687_10079388 | 3300025927 | Bacteria | 2366 |
| 360 | Ga0207700_10042530 | 3300025928 | Bacteria | 3332 |
| 361 | Ga0207700_10111939 | 3300025928 | Bacteria | 2198 |
| 362 | Ga0207664_10044034 | 3300025929 | Bacteria | 3493 |
| 363 | Ga0207664_10069205 | 3300025929 | Bacteria | 2838 |
| 364 | Ga0207664_10303249 | 3300025929 | Bacteria | 1406 |
| 365 | Ga0207690_10087143 | 3300025932 | Bacteria | 2196 |
| 366 | Ga0207690_10237875 | 3300025932 | Bacteria | 1401 |
| 367 | Ga0207706_10051480 | 3300025933 | Bacteria | 3636 |
| 368 | Ga0207706_10551840 | 3300025933 | Bacteria | 992 |
| 369 | Ga0207686_10261035 | 3300025934 | Bacteria | 1270 |
| 370 | Ga0207686_10319646 | 3300025934 | Bacteria | 1159 |
| 371 | Ga0207669_10509925 | 3300025937 | Bacteria | 964 |
| 372 | Ga0207704_10144127 | 3300025938 | Bacteria | 1671 |
| 373 | Ga0207665_10000992 | 3300025939 | Bacteria | 19173 |
| 374 | Ga0207665_10473251 | 3300025939 | Bacteria | 964 |
| 375 | Ga0207665_10497186 | 3300025939 | Bacteria | 942 |
| 376 | Ga0207711_10198030 | 3300025941 | Bacteria | 1832 |
| 377 | Ga0207711_10202717 | 3300025941 | Bacteria | 1811 |
| 378 | Ga0207689_10163744 | 3300025942 | Bacteria | 1832 |
| 379 | Ga0207661_10073974 | 3300025944 | Bacteria | 2792 |
| 380 | Ga0207661_10350829 | 3300025944 | Bacteria | 1331 |
| 381 | Ga0207661_10876265 | 3300025944 | Bacteria | 827 |
| 382 | Ga0207679_10266034 | 3300025945 | Bacteria | 1464 |
| 383 | Ga0207667_10004319 | 3300025949 | Bacteria | 17403 |
| 384 | Ga0207667_10011988 | 3300025949 | Bacteria | 10035 |
| 385 | Ga0207667_10036266 | 3300025949 | Bacteria | 5286 |
| 386 | Ga0207667_10282458 | 3300025949 | Bacteria | 1696 |
| 387 | Ga0207667_10362496 | 3300025949 | Bacteria | 1478 |
| 388 | Ga0207712_10209129 | 3300025961 | Bacteria | 1553 |
| 389 | Ga0207668_10046894 | 3300025972 | Bacteria | 2955 |
| 390 | Ga0207668_10137309 | 3300025972 | Bacteria | 1875 |
| 391 | Ga0207668_10159620 | 3300025972 | Bacteria | 1755 |
| 392 | Ga0207640_10044979 | 3300025981 | Bacteria | 2832 |
| 393 | Ga0207640_10067614 | 3300025981 | Bacteria | 2392 |
| 394 | Ga0207640_10083757 | 3300025981 | Bacteria | 2187 |
| 395 | Ga0207640_10176400 | 3300025981 | Bacteria | 1598 |
| 396 | Ga0207640_10199915 | 3300025981 | Bacteria | 1514 |
| 397 | Ga0207640_10245816 | 3300025981 | Bacteria | 1385 |
| 398 | Ga0207658_10156458 | 3300025986 | Bacteria | 1863 |
| 399 | Ga0207677_10115054 | 3300026023 | Bacteria | 2011 |
| 400 | Ga0207677_10137085 | 3300026023 | Bacteria | 1868 |
| 401 | Ga0207677_10210359 | 3300026023 | Bacteria | 1553 |
| 402 | Ga0207703_10015407 | 3300026035 | Bacteria | 5963 |
| 403 | Ga0207703_10351452 | 3300026035 | Bacteria | 1357 |
| 404 | Ga0207639_10016887 | 3300026041 | Bacteria | 5171 |
| 405 | Ga0207639_10221559 | 3300026041 | Bacteria | 1634 |
| 406 | Ga0207639_10226599 | 3300026041 | Bacteria | 1617 |
| 407 | Ga0207639_10499882 | 3300026041 | Bacteria | 1111 |
| 408 | Ga0207639_10849609 | 3300026041 | Bacteria | 852 |
| 409 | Ga0207678_10027645 | 3300026067 | Bacteria | 4950 |
| 410 | Ga0207678_10069743 | 3300026067 | Bacteria | 3014 |
| 411 | Ga0207678_10087953 | 3300026067 | Bacteria | 2655 |
| 412 | Ga0207678_10183305 | 3300026067 | Bacteria | 1788 |
| 413 | Ga0207678_10206812 | 3300026067 | Bacteria | 1679 |
| 414 | Ga0207708_10164478 | 3300026075 | Bacteria | 1754 |
| 415 | Ga0207708_10271099 | 3300026075 | Bacteria | 1373 |
| 416 | Ga0207708_10282753 | 3300026075 | Bacteria | 1345 |
| 417 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 418 | Ga0207702_10000081 | 3300026078 | Bacteria | 108009 |
| 419 | Ga0207702_10037088 | 3300026078 | Bacteria | 4079 |
| 420 | Ga0207702_10170274 | 3300026078 | Bacteria | 1996 |
| 421 | Ga0207702_10414482 | 3300026078 | Bacteria | 1301 |
| 422 | Ga0207702_10556733 | 3300026078 | Bacteria | 1122 |
| 423 | Ga0207702_10596596 | 3300026078 | Bacteria | 1083 |
| 424 | Ga0207641_10783844 | 3300026088 | Bacteria | 942 |
| 425 | Ga0207648_10097768 | 3300026089 | Bacteria | 2569 |
| 426 | Ga0207648_10546069 | 3300026089 | Bacteria | 1064 |
| 427 | Ga0207676_10315740 | 3300026095 | Bacteria | 1432 |
| 428 | Ga0207676_10319315 | 3300026095 | Bacteria | 1425 |
| 429 | Ga0207674_10011138 | 3300026116 | Bacteria | 10114 |
| 430 | Ga0207674_10077170 | 3300026116 | Bacteria | 3338 |
| 431 | Ga0207674_10198565 | 3300026116 | Bacteria | 1955 |
| 432 | Ga0207675_100215702 | 3300026118 | Bacteria | 1848 |
| 433 | Ga0207683_10246075 | 3300026121 | Bacteria | 1631 |
| 434 | Ga0207698_10062768 | 3300026142 | Bacteria | 2904 |
| 435 | Ga0207698_10155529 | 3300026142 | Bacteria | 1991 |
| 436 | Ga0207698_10301479 | 3300026142 | Bacteria | 1492 |
| 437 | Ga0209588_1097887 | 3300027671 | Bacteria | 944 |
| 438 | Ga0268266_10001551 | 3300028379 | Bacteria | 26890 |
| 439 | Ga0268266_10008591 | 3300028379 | Bacteria | 9072 |
| 440 | Ga0268266_10033130 | 3300028379 | Bacteria | 4393 |
| 441 | Ga0268266_10158615 | 3300028379 | Bacteria | 2045 |
| 442 | Ga0268266_10179360 | 3300028379 | Bacteria | 1927 |
| 443 | Ga0268265_10029366 | 3300028380 | Bacteria | 3945 |
| 444 | Ga0268265_10224043 | 3300028380 | Bacteria | 1647 |
| 445 | Ga0268265_10266094 | 3300028380 | Bacteria | 1527 |
| 446 | Ga0268264_10125311 | 3300028381 | Bacteria | 2269 |
| 447 | Ga0268264_10225841 | 3300028381 | Bacteria | 1726 |
| 448 | Ga0265334_10026414 | 3300028573 | Bacteria | 2344 |
| 449 | Ga0307517_10000062 | 3300028786 | Bacteria | 145054 |
| 450 | Ga0265330_10020621 | 3300031235 | Bacteria | 3012 |
| 451 | Ga0265332_10011685 | 3300031238 | Bacteria | 3901 |
| 452 | Ga0265332_10047997 | 3300031238 | Bacteria | 1837 |
| 453 | Ga0265340_10001013 | 3300031247 | Bacteria | 15991 |
| 454 | Ga0265340_10192352 | 3300031247 | Bacteria | 920 |
| 455 | Ga0265339_10001466 | 3300031249 | Bacteria | 17422 |
| 456 | Ga0265339_10207486 | 3300031249 | Bacteria | 964 |
| 457 | Ga0265331_10026429 | 3300031250 | Bacteria | 2918 |
| 458 | Ga0265331_10142584 | 3300031250 | Bacteria | 1089 |
| 459 | Ga0265327_10001405 | 3300031251 | Bacteria | 30666 |
| 460 | Ga0307509_10082486 | 3300031507 | Bacteria | 3317 |
| 461 | Ga0307408_100057151 | 3300031548 | Bacteria | 2831 |
| 462 | Ga0307408_100271564 | 3300031548 | Bacteria | 1408 |
| 463 | Ga0307408_100917284 | 3300031548 | Bacteria | 803 |
| 464 | Ga0307508_10000532 | 3300031616 | Bacteria | 45338 |
| 465 | Ga0265314_10043780 | 3300031711 | Bacteria | 3179 |
| 466 | Ga0265314_10138884 | 3300031711 | Bacteria | 1505 |
| 467 | Ga0265342_10009526 | 3300031712 | Bacteria | 6827 |
| 468 | Ga0307516_10012214 | 3300031730 | Bacteria | 9273 |
| 469 | Ga0307405_10254792 | 3300031731 | Bacteria | 1308 |
| 470 | Ga0326468_10004453 | 3300031889 | Bacteria | 1225 |
| 471 | Ga0307412_10330192 | 3300031911 | Bacteria | 1217 |
| 472 | Ga0307411_10076597 | 3300032005 | Bacteria | 2287 |
| 473 | Ga0307415_100017135 | 3300032126 | Bacteria | 4338 |
| 474 | Ga0307415_100242030 | 3300032126 | Bacteria | 1460 |
| 475 | Ga0307510_10018748 | 3300033180 | Bacteria | 8132 |
| 476 | Ga0307510_10052699 | 3300033180 | Bacteria | 4284 |
| 477 | Ga0307510_10067265 | 3300033180 | Bacteria | 3609 |
| 478 | Ga0307510_10122729 | 3300033180 | Bacteria | 2296 |
| 479 | Ga0307510_10339700 | 3300033180 | Bacteria | 954 |
| 480 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 481 | Ga0373930_0017264 | 3300034816 | Bacteria | 1374 |
| 482 | Ga0373926_0077713 | 3300035083 | Bacteria | 1225 |
| 483 | Ga0373944_0067857 | 3300035089 | Bacteria | 1156 |
| 484 | Ga0373952_0007593 | 3300035092 | Bacteria | 2037 |
| 485 | Ga0373923_0026123 | 3300035111 | Bacteria | 2321 |
| 486 | Ga0373945_0004658 | 3300035116 | Bacteria | 4371 |
| 487 | Ga0373945_0014225 | 3300035116 | Bacteria | 2662 |
| 488 | Ga0373953_0000670 | 3300035117 | Bacteria | 9477 |
| 489 | Ga0373953_0097503 | 3300035117 | Bacteria | 1235 |
| 490 | Ga0373954_0022528 | 3300035118 | Bacteria | 2858 |
| 491 | Ga0373954_0052354 | 3300035118 | Bacteria | 1918 |
| 492 | Ga0373954_0099021 | 3300035118 | Bacteria | 1405 |
| 493 | Ga0373956_0014527 | 3300035119 | Bacteria | 3292 |
| 494 | Ga0373956_0049899 | 3300035119 | Bacteria | 1877 |
| 495 | Ga0373957_0026516 | 3300035120 | Bacteria | 2097 |
| 496 | Ga0373943_0072512 | 3300035170 | Bacteria | 1747 |
| 497 | Ga0373946_0010036 | 3300035171 | Bacteria | 3502 |
| 498 | Ga0373946_0024734 | 3300035171 | Bacteria | 2356 |
| 499 | Ga0373955_0000447 | 3300035172 | Bacteria | 17475 |
| 500 | Ga0373955_0036800 | 3300035172 | Bacteria | 2599 |
| 501 | Ga0373924_0037707 | 3300035410 | Bacteria | 1969 |
| 502 | Ga0373924_0114045 | 3300035410 | Bacteria | 1170 |
| 503 | Ga0373935_0014439 | 3300035692 | Bacteria | 4765 |
| 504 | Ga0373935_0363639 | 3300035692 | Bacteria | 1034 |
| 505 | Ga0373935_0376978 | 3300035692 | Bacteria | 1015 |
| 506 | Ga0373927_0000308 | 3300035695 | Bacteria | 38418 |
| 507 | Ga0373927_0017790 | 3300035695 | Bacteria | 4676 |
| 508 | Ga0373927_0041318 | 3300035695 | Bacteria | 2991 |
| 509 | Ga0373927_0121267 | 3300035695 | Bacteria | 1706 |
| 510 | Ga0373927_0121760 | 3300035695 | Bacteria | 1702 |
| 511 | Ga0373927_0433870 | 3300035695 | Bacteria | 867 |
| 512 | Ga0373933_0000167 | 3300035724 | Bacteria | 42851 |
| 513 | Ga0373933_0002005 | 3300035724 | Bacteria | 11741 |
| 514 | Ga0373933_0131148 | 3300035724 | Bacteria | 1576 |
| 515 | Ga0373933_0355857 | 3300035724 | Bacteria | 951 |
| 516 | Ga0373947_0005045 | 3300035725 | Bacteria | 7731 |
| 517 | Ga0373947_0207985 | 3300035725 | Bacteria | 1282 |
| 518 | Ga0373937_0032925 | 3300036401 | Bacteria | 4703 |
| 519 | Ga0373937_0111275 | 3300036401 | Bacteria | 2547 |
| 520 | Ga0373937_0121748 | 3300036401 | Bacteria | 2431 |
| 521 | Ga0373937_0232231 | 3300036401 | Bacteria | 1737 |
| 522 | Ga0373937_0468026 | 3300036401 | Bacteria | 1197 |
| 523 | Ga0373937_0577469 | 3300036401 | Bacteria | 1067 |
| 524 | Ga0373925_0011523 | 3300037068 | Bacteria | 6397 |
| 525 | Ga0373925_0057967 | 3300037068 | Bacteria | 2903 |
| 526 | Ga0373925_0450282 | 3300037068 | Bacteria | 1054 |
| 527 | Ga0395900_0079214 | 3300037418 | Bacteria | 3376 |
| 528 | Ga0395898_0011573 | 3300037466 | Bacteria | 9161 |
| 529 | Ga0395898_0202367 | 3300037466 | Bacteria | 1895 |
| 530 | Ga0395905_0007709 | 3300037471 | Bacteria | 10683 |
| 531 | Ga0436364_1423953 | 3300037853 | Bacteria | 39549 |
| 532 | Ga0436364_1499714 | 3300037853 | Bacteria | 1769 |
| 533 | Ga0395901_0100247 | 3300038443 | Bacteria | 3038 |
| 534 | Ga0436365_0675790 | 3300039437 | Bacteria | 17254 |
| 535 | Ga0436365_0839146 | 3300039437 | Bacteria | 5690 |
| 536 | Ga0436363_0632867 | 3300039450 | Bacteria | 940 |
| 537 | Ga0451787_806274 | 3300041441 | Bacteria | 832 |
| 538 | Ga0451853_1239521 | 3300041512 | Bacteria | 1088 |
| 539 | Ga0439445_0043448 | 3300042004 | Bacteria | 1199 |
| 540 | Ga0450911_001143 | 3300042115 | Bacteria | 6561 |
| 541 | Ga0466969_0014160 | 3300044656 | Bacteria | 4195 |
| 542 | Ga0466966_0000148 | 3300044684 | Bacteria | 44828 |
| 543 | Ga0466966_0048886 | 3300044684 | Bacteria | 2694 |
| 544 | Ga0466961_0000045 | 3300044693 | Bacteria | 75331 |
| 545 | Ga0466971_0089100 | 3300044719 | Bacteria | 1412 |
| 546 | Ga0466959_0003014 | 3300045049 | Bacteria | 10882 |
| 547 | Ga0466959_0021412 | 3300045049 | Bacteria | 4768 |
| 548 | Ga0466958_0114633 | 3300045836 | Bacteria | 1684 |
| 549 | Ga0495617_010752 | 3300046452 | Bacteria | 3133 |
| 550 | Ga0495592_0010346 | 3300046454 | Bacteria | 7034 |
| 551 | Ga0495592_0027945 | 3300046454 | Bacteria | 4273 |
| 552 | Ga0495592_0028244 | 3300046454 | Bacteria | 4250 |
| 553 | Ga0495592_0052072 | 3300046454 | Bacteria | 3040 |
| 554 | Ga0495592_0123676 | 3300046454 | Bacteria | 1817 |
| 555 | Ga0495603_0000229 | 3300046455 | Bacteria | 29318 |
| 556 | Ga0495603_0026846 | 3300046455 | Bacteria | 3478 |
| 557 | Ga0495603_0084959 | 3300046455 | Bacteria | 1853 |
| 558 | Ga0495629_0000170 | 3300046459 | Bacteria | 57733 |
| 559 | Ga0495629_0001699 | 3300046459 | Bacteria | 17299 |
| 560 | Ga0495629_0384355 | 3300046459 | Bacteria | 955 |
| 561 | Ga0495629_0401755 | 3300046459 | Bacteria | 931 |
| 562 | Ga0495638_0044353 | 3300046460 | Bacteria | 2801 |
| 563 | Ga0495641_0069940 | 3300046461 | Bacteria | 1577 |
| 564 | Ga0495651_0000472 | 3300046462 | Bacteria | 30989 |
| 565 | Ga0495651_0023589 | 3300046462 | Bacteria | 4784 |
| 566 | Ga0495651_0040970 | 3300046462 | Bacteria | 3598 |
| 567 | Ga0495651_0085092 | 3300046462 | Bacteria | 2382 |
| 568 | Ga0495651_0265358 | 3300046462 | Bacteria | 1166 |
| 569 | Ga0495653_0039871 | 3300046463 | Bacteria | 3676 |
| 570 | Ga0495653_0055700 | 3300046463 | Bacteria | 3016 |
| 571 | Ga0495653_0124868 | 3300046463 | Bacteria | 1829 |
| 572 | Ga0495653_0222213 | 3300046463 | Bacteria | 1269 |
| 573 | Ga0495580_0006642 | 3300046472 | Bacteria | 9398 |
| 574 | Ga0495580_0030917 | 3300046472 | Bacteria | 3873 |
| 575 | Ga0495582_0000053 | 3300046473 | Bacteria | 58155 |
| 576 | Ga0495582_0040602 | 3300046473 | Bacteria | 2563 |
| 577 | Ga0495605_0084319 | 3300046474 | Bacteria | 1482 |
| 578 | Ga0495639_0000057 | 3300046475 | Bacteria | 49641 |
| 579 | Ga0495639_0040997 | 3300046475 | Bacteria | 2085 |
| 580 | Ga0495639_0099981 | 3300046475 | Bacteria | 1369 |
| 581 | Ga0495639_0123940 | 3300046475 | Bacteria | 1234 |
| 582 | Ga0495662_0002078 | 3300046476 | Bacteria | 10042 |
| 583 | Ga0495662_0079133 | 3300046476 | Bacteria | 1598 |
| 584 | Ga0495662_0083641 | 3300046476 | Bacteria | 1553 |
| 585 | Ga0495664_0006777 | 3300046477 | Bacteria | 6335 |
| 586 | Ga0495664_0031622 | 3300046477 | Bacteria | 3103 |
| 587 | Ga0495664_0212209 | 3300046477 | Bacteria | 1172 |
| 588 | Ga0495584_0068892 | 3300046491 | Bacteria | 1777 |
| 589 | Ga0495585_0144857 | 3300046492 | Bacteria | 1242 |
| 590 | Ga0495585_0217851 | 3300046492 | Bacteria | 964 |
| 591 | Ga0495594_0000460 | 3300046499 | Bacteria | 20731 |
| 592 | Ga0495606_0005996 | 3300046507 | Bacteria | 11391 |
| 593 | Ga0495606_0237708 | 3300046507 | Bacteria | 1017 |
| 594 | Ga0495606_0305661 | 3300046507 | Bacteria | 860 |
| 595 | Ga0495608_0018937 | 3300046511 | Bacteria | 4745 |
| 596 | Ga0495608_0076289 | 3300046511 | Bacteria | 2183 |
| 597 | Ga0495618_0075509 | 3300046514 | Bacteria | 2147 |
| 598 | Ga0495628_0242716 | 3300046516 | Bacteria | 1347 |
| 599 | Ga0495630_0001122 | 3300046517 | Bacteria | 18446 |
| 600 | Ga0495630_0057730 | 3300046517 | Bacteria | 2909 |
| 601 | Ga0495630_0148560 | 3300046517 | Bacteria | 1783 |
| 602 | Ga0495630_0374557 | 3300046517 | Bacteria | 1090 |
| 603 | Ga0495631_0226238 | 3300046518 | Bacteria | 798 |
| 604 | Ga0495632_0085600 | 3300046519 | Bacteria | 1499 |
| 605 | Ga0495632_0113571 | 3300046519 | Bacteria | 1270 |
| 606 | Ga0495643_0018174 | 3300046522 | Bacteria | 4092 |
| 607 | Ga0495643_0029296 | 3300046522 | Bacteria | 3081 |
| 608 | Ga0495643_0131192 | 3300046522 | Bacteria | 1258 |
| 609 | Ga0495644_0008239 | 3300046523 | Bacteria | 4012 |
| 610 | Ga0495648_0003889 | 3300046524 | Bacteria | 12949 |
| 611 | Ga0495648_0003979 | 3300046524 | Bacteria | 12789 |
| 612 | Ga0495648_0064694 | 3300046524 | Bacteria | 2153 |
| 613 | Ga0495648_0299501 | 3300046524 | Bacteria | 754 |
| 614 | Ga0495666_0071074 | 3300046526 | Bacteria | 1655 |
| 615 | Ga0495666_0254182 | 3300046526 | Bacteria | 800 |
| 616 | Ga0495652_0001339 | 3300046529 | Bacteria | 27421 |
| 617 | Ga0495652_0006658 | 3300046529 | Bacteria | 10722 |
| 618 | Ga0495652_0125363 | 3300046529 | Bacteria | 2041 |
| 619 | Ga0495654_0016091 | 3300046530 | Bacteria | 3962 |
| 620 | Ga0495665_0000197 | 3300046531 | Bacteria | 31107 |
| 621 | Ga0495640_0021032 | 3300046533 | Bacteria | 4796 |
| 622 | Ga0495640_0071777 | 3300046533 | Bacteria | 2322 |
| 623 | Ga0495640_0074865 | 3300046533 | Bacteria | 2262 |
| 624 | Ga0495587_0029630 | 3300046536 | Bacteria | 3322 |
| 625 | Ga0495587_0040242 | 3300046536 | Bacteria | 2794 |
| 626 | Ga0495587_0053040 | 3300046536 | Bacteria | 2391 |
| 627 | Ga0495609_0097413 | 3300046538 | Bacteria | 1276 |
| 628 | Ga0495645_0011359 | 3300046543 | Bacteria | 6264 |
| 629 | Ga0495645_0024020 | 3300046543 | Bacteria | 4419 |
| 630 | Ga0495645_0080421 | 3300046543 | Bacteria | 2339 |
| 631 | Ga0495622_0005868 | 3300046557 | Bacteria | 5701 |
| 632 | Ga0495622_0180853 | 3300046557 | Bacteria | 945 |
| 633 | Ga0495633_0211818 | 3300046558 | Bacteria | 888 |
| 634 | Ga0495667_0007621 | 3300046559 | Bacteria | 7343 |
| 635 | Ga0495667_0076163 | 3300046559 | Bacteria | 2182 |
| 636 | Ga0495656_0001067 | 3300046615 | Bacteria | 8878 |
| 637 | Ga0495668_0024598 | 3300046616 | Bacteria | 3425 |
| 638 | Ga0495668_0083145 | 3300046616 | Bacteria | 1756 |
| 639 | Ga0495634_0001079 | 3300046642 | Bacteria | 25459 |
| 640 | Ga0495634_0013513 | 3300046642 | Bacteria | 5898 |
| 641 | Ga0495634_0038510 | 3300046642 | Bacteria | 3260 |
| 642 | Ga0495634_0054064 | 3300046642 | Bacteria | 2688 |
| 643 | Ga0495634_0134573 | 3300046642 | Bacteria | 1573 |
| 644 | Ga0495611_0121658 | 3300046648 | Bacteria | 1217 |
| 645 | Ga0495625_0068527 | 3300046660 | Bacteria | 2494 |
| 646 | Ga0495635_0000738 | 3300046663 | Bacteria | 21137 |
| 647 | Ga0495635_0000892 | 3300046663 | Bacteria | 19578 |
| 648 | Ga0495635_0003199 | 3300046663 | Bacteria | 11290 |
| 649 | Ga0495635_0045942 | 3300046663 | Bacteria | 3012 |
| 650 | Ga0495635_0074879 | 3300046663 | Bacteria | 2319 |
| 651 | Ga0495635_0101910 | 3300046663 | Bacteria | 1962 |
| 652 | Ga0495661_0155262 | 3300046665 | Bacteria | 1233 |
| 653 | Ga0495588_0020306 | 3300046674 | Bacteria | 3263 |
| 654 | Ga0495588_0140358 | 3300046674 | Bacteria | 1276 |
| 655 | Ga0495588_0152363 | 3300046674 | Bacteria | 1222 |
| 656 | Ga0495657_0001505 | 3300046675 | Bacteria | 20049 |
| 657 | Ga0495657_0005672 | 3300046675 | Bacteria | 9843 |
| 658 | Ga0495599_0055688 | 3300046678 | Bacteria | 2476 |
| 659 | Ga0495599_0117936 | 3300046678 | Bacteria | 1650 |
| 660 | Ga0495599_0191652 | 3300046678 | Bacteria | 1257 |
| 661 | Ga0495623_0002081 | 3300046679 | Bacteria | 13394 |
| 662 | Ga0495623_0024183 | 3300046679 | Bacteria | 3918 |
| 663 | Ga0495623_0081994 | 3300046679 | Bacteria | 1994 |
| 664 | Ga0495646_0003426 | 3300046680 | Bacteria | 9862 |
| 665 | Ga0495646_0013081 | 3300046680 | Bacteria | 5275 |
| 666 | Ga0495646_0196454 | 3300046680 | Bacteria | 1100 |
| 667 | Ga0495646_0259682 | 3300046680 | Bacteria | 928 |
| 668 | Ga0495647_0007031 | 3300046681 | Bacteria | 3751 |
| 669 | Ga0495647_0102394 | 3300046681 | Bacteria | 1187 |
| 670 | Ga0495658_0000217 | 3300046683 | Bacteria | 32918 |
| 671 | Ga0495613_0008961 | 3300046689 | Bacteria | 7427 |
| 672 | Ga0495613_0027045 | 3300046689 | Bacteria | 4270 |
| 673 | Ga0495613_0038530 | 3300046689 | Bacteria | 3543 |
| 674 | Ga0495624_0000394 | 3300046690 | Bacteria | 34712 |
| 675 | Ga0495624_0016604 | 3300046690 | Bacteria | 4954 |
| 676 | Ga0495624_0042045 | 3300046690 | Bacteria | 2921 |
| 677 | Ga0495670_0138809 | 3300046691 | Bacteria | 1270 |
| 678 | Ga0495649_0170489 | 3300046694 | Bacteria | 1139 |
| 679 | Ga0495649_0171476 | 3300046694 | Bacteria | 1135 |
| 680 | Ga0495589_0128172 | 3300046794 | Bacteria | 1219 |
| 681 | Ga0495600_0000845 | 3300046809 | Bacteria | 16327 |
| 682 | Ga0495600_0005855 | 3300046809 | Bacteria | 7434 |
| 683 | Ga0495600_0006605 | 3300046809 | Bacteria | 7066 |
| 684 | Ga0495600_0078209 | 3300046809 | Bacteria | 2160 |
| 685 | Ga0495600_0324747 | 3300046809 | Bacteria | 967 |
| 686 | Ga0495660_0171581 | 3300046810 | Bacteria | 1056 |
| 687 | Ga0495581_0004436 | 3300047315 | Bacteria | 8110 |
| 688 | Ga0495581_0021807 | 3300047315 | Bacteria | 3711 |
| 689 | Ga0495581_0055929 | 3300047315 | Bacteria | 2277 |
| 690 | Ga0495581_0214688 | 3300047315 | Bacteria | 1125 |
| 691 | Ga0495604_0000953 | 3300047317 | Bacteria | 24133 |
| 692 | Ga0495604_0017761 | 3300047317 | Bacteria | 5691 |
| 693 | Ga0495604_0039800 | 3300047317 | Bacteria | 3693 |
| 694 | Ga0495604_0238094 | 3300047317 | Bacteria | 1246 |
| 695 | Ga0495674_0004978 | 3300047319 | Bacteria | 12789 |
| 696 | Ga0495674_0008322 | 3300047319 | Bacteria | 9890 |
| 697 | Ga0495674_0509477 | 3300047319 | Bacteria | 962 |
| 698 | Ga0495672_0015872 | 3300047320 | Bacteria | 5099 |
| 699 | Ga0495676_0014964 | 3300047321 | Bacteria | 6924 |
| 700 | Ga0495676_0047061 | 3300047321 | Bacteria | 3493 |
| 701 | Ga0495676_0054936 | 3300047321 | Bacteria | 3162 |
| 702 | Ga0495680_0001642 | 3300047322 | Bacteria | 23759 |
| 703 | Ga0495680_0001893 | 3300047322 | Bacteria | 21968 |
| 704 | Ga0495680_0098619 | 3300047322 | Bacteria | 2180 |
| 705 | Ga0495680_0161306 | 3300047322 | Bacteria | 1628 |
| 706 | Ga0495683_0131456 | 3300047323 | Bacteria | 1180 |
| 707 | Ga0495687_042211 | 3300047443 | Bacteria | 1995 |
| 708 | Ga0495675_0093671 | 3300047444 | Bacteria | 1884 |
| 709 | Ga0495685_085870 | 3300047447 | Bacteria | 1046 |
| 710 | Ga0495684_0006728 | 3300047471 | Bacteria | 8925 |
| 711 | Ga0495684_0009403 | 3300047471 | Bacteria | 7546 |
| 712 | Ga0495684_0024938 | 3300047471 | Bacteria | 4599 |
| 713 | Ga0495684_0053583 | 3300047471 | Bacteria | 3078 |
| 714 | Ga0495684_0109772 | 3300047471 | Bacteria | 2083 |
| 715 | Ga0495686_0253536 | 3300047472 | Bacteria | 988 |
| 716 | Ga0495593_0002757 | 3300047673 | Bacteria | 10572 |
| 717 | Ga0495593_0002873 | 3300047673 | Bacteria | 10388 |
| 718 | Ga0495593_0015866 | 3300047673 | Bacteria | 4256 |
| 719 | Ga0495602_0020256 | 3300048088 | Bacteria | 6577 |
| 720 | Ga0495602_0389292 | 3300048088 | Bacteria | 996 |
| 721 | Ga0495614_0091285 | 3300048089 | Bacteria | 1325 |
| 722 | Ga0496100_0319100 | 3300048903 | Bacteria | 1167 |
| 723 | Ga0496101_0065804 | 3300048904 | Bacteria | 2642 |
| 724 | Ga0496101_0090109 | 3300048904 | Bacteria | 2280 |
| 725 | Ga0496101_0109387 | 3300048904 | Bacteria | 2079 |
| 726 | Ga0496102_0001946 | 3300048905 | Bacteria | 17805 |
| 727 | Ga0496102_0064657 | 3300048905 | Bacteria | 3351 |
| 728 | Ga0496102_0201037 | 3300048905 | Bacteria | 1878 |
| 729 | Ga0496103_0012612 | 3300048906 | Bacteria | 5013 |
| 730 | Ga0496103_0027762 | 3300048906 | Bacteria | 3432 |
| 731 | Ga0496103_0066527 | 3300048906 | Bacteria | 2249 |
| 732 | Ga0496103_0078239 | 3300048906 | Bacteria | 2077 |
| 733 | Ga0496103_0169812 | 3300048906 | Bacteria | 1400 |
| 734 | Ga0496104_0078088 | 3300048907 | Bacteria | 3154 |
| 735 | Ga0496104_0240491 | 3300048907 | Bacteria | 1722 |
| 736 | Ga0496104_0386154 | 3300048907 | Bacteria | 1312 |
| 737 | Ga0496105_0037440 | 3300048908 | Bacteria | 3994 |
| 738 | Ga0496105_0040337 | 3300048908 | Bacteria | 3849 |
| 739 | Ga0496105_0295863 | 3300048908 | Bacteria | 1302 |
| 740 | Ga0496105_0353630 | 3300048908 | Bacteria | 1173 |
| 741 | Ga0496105_0436935 | 3300048908 | Bacteria | 1034 |
| 742 | Ga0496106_0124135 | 3300048909 | Bacteria | 2020 |
| 743 | Ga0496106_0315095 | 3300048909 | Bacteria | 1255 |
| 744 | Ga0496106_0685904 | 3300048909 | Bacteria | 817 |
| 745 | Ga0496107_0038935 | 3300048910 | Bacteria | 3410 |
| 746 | Ga0496107_0337572 | 3300048910 | Bacteria | 1121 |
| 747 | Ga0496108_0015476 | 3300048911 | Bacteria | 6222 |
| 748 | Ga0496108_0116701 | 3300048911 | Bacteria | 2287 |
| 749 | Ga0496108_0213485 | 3300048911 | Bacteria | 1675 |
| 750 | Ga0496109_0118736 | 3300048912 | Bacteria | 2462 |
| 751 | Ga0496109_0613430 | 3300048912 | Bacteria | 1024 |
| 752 | Ga0496109_0760537 | 3300048912 | Bacteria | 907 |
| 753 | Ga0496110_0067716 | 3300048913 | Bacteria | 3159 |
| 754 | Ga0496110_0074209 | 3300048913 | Bacteria | 3020 |
| 755 | Ga0496110_0090694 | 3300048913 | Bacteria | 2733 |
| 756 | Ga0496110_0132515 | 3300048913 | Bacteria | 2251 |
| 757 | Ga0496110_0156028 | 3300048913 | Bacteria | 2068 |
| 758 | Ga0496111_0110305 | 3300048914 | Bacteria | 2026 |
| 759 | Ga0496111_0558727 | 3300048914 | Bacteria | 840 |
| 760 | Ga0496111_0658788 | 3300048914 | Bacteria | 763 |
| 761 | Ga0496112_0000016 | 3300048915 | Bacteria | 194634 |
| 762 | Ga0496112_0042140 | 3300048915 | Bacteria | 4466 |
| 763 | Ga0496112_0151402 | 3300048915 | Bacteria | 2287 |
| 764 | Ga0496112_0271389 | 3300048915 | Bacteria | 1644 |
| 765 | Ga0496112_0321199 | 3300048915 | Bacteria | 1492 |
| 766 | Ga0496112_1053061 | 3300048915 | Bacteria | 732 |
| 767 | Ga0496113_0027119 | 3300048916 | Bacteria | 4102 |
| 768 | Ga0496113_0063686 | 3300048916 | Bacteria | 2787 |
| 769 | Ga0496113_0149844 | 3300048916 | Bacteria | 1839 |
| 770 | Ga0496113_0280656 | 3300048916 | Bacteria | 1332 |
| 771 | Ga0496113_0554159 | 3300048916 | Bacteria | 922 |
| 772 | Ga0496114_0134105 | 3300048917 | Bacteria | 2140 |
| 773 | Ga0496114_0207996 | 3300048917 | Bacteria | 1715 |
| 774 | Ga0496115_0063037 | 3300048918 | Bacteria | 2991 |
| 775 | Ga0496115_0068284 | 3300048918 | Bacteria | 2878 |
| 776 | Ga0496115_0084672 | 3300048918 | Bacteria | 2585 |
| 777 | Ga0496115_0225860 | 3300048918 | Bacteria | 1544 |
| 778 | Ga0496115_0272850 | 3300048918 | Bacteria | 1389 |
| 779 | Ga0496116_0102580 | 3300048919 | Bacteria | 1705 |
| 780 | Ga0496116_0174117 | 3300048919 | Bacteria | 1162 |
| 781 | Ga0496117_0042466 | 3300048920 | Bacteria | 3318 |
| 782 | Ga0496117_0116534 | 3300048920 | Bacteria | 1651 |
| 783 | Ga0496117_0275281 | 3300048920 | Bacteria | 904 |
| 784 | Ga0496118_0021551 | 3300048921 | Bacteria | 5667 |
| 785 | Ga0496118_0343118 | 3300048921 | Bacteria | 799 |
| 786 | Ga0496119_0056679 | 3300048922 | Bacteria | 2373 |
| 787 | Ga0496120_0246339 | 3300048923 | Bacteria | 841 |
| 788 | Ga0496121_0001005 | 3300048924 | Bacteria | 50368 |
| 789 | Ga0496121_0001443 | 3300048924 | Bacteria | 40145 |
| 790 | Ga0496121_0001527 | 3300048924 | Bacteria | 38742 |
| 791 | Ga0496121_0002968 | 3300048924 | Bacteria | 24705 |
| 792 | Ga0496121_0032132 | 3300048924 | Bacteria | 4777 |
| 793 | Ga0496121_0034058 | 3300048924 | Bacteria | 4592 |
| 794 | Ga0496121_0048069 | 3300048924 | Bacteria | 3634 |
| 795 | Ga0496121_0066938 | 3300048924 | Bacteria | 2914 |
| 796 | Ga0496121_0080247 | 3300048924 | Bacteria | 2587 |
| 797 | Ga0496121_0157224 | 3300048924 | Bacteria | 1667 |
| 798 | Ga0496121_0247362 | 3300048924 | Bacteria | 1238 |
| 799 | Ga0496121_0430673 | 3300048924 | Bacteria | 856 |
| 800 | Ga0496124_0002203 | 3300048927 | Bacteria | 25990 |
| 801 | Ga0496124_0059503 | 3300048927 | Bacteria | 3209 |
| 802 | Ga0496124_0258264 | 3300048927 | Bacteria | 1284 |
| 803 | Ga0496124_0286066 | 3300048927 | Bacteria | 1199 |
| 804 | Ga0496125_0016021 | 3300048928 | Bacteria | 7217 |
| 805 | Ga0496125_0052963 | 3300048928 | Bacteria | 3332 |
| 806 | Ga0496125_0094966 | 3300048928 | Bacteria | 2219 |
| 807 | Ga0496125_0339978 | 3300048928 | Bacteria | 901 |
| 808 | Ga0496126_0006684 | 3300048929 | Bacteria | 12815 |
| 809 | Ga0496126_0008612 | 3300048929 | Bacteria | 10970 |
| 810 | Ga0496126_0039188 | 3300048929 | Bacteria | 4399 |
| 811 | Ga0496126_0044454 | 3300048929 | Bacteria | 4090 |
| 812 | Ga0496126_0158878 | 3300048929 | Bacteria | 1933 |
| 813 | Ga0496126_0185158 | 3300048929 | Bacteria | 1766 |
| 814 | Ga0496126_0205651 | 3300048929 | Bacteria | 1660 |
| 815 | Ga0496126_0218476 | 3300048929 | Bacteria | 1602 |
| 816 | Ga0496126_0257761 | 3300048929 | Bacteria | 1451 |
| 817 | Ga0496126_0317843 | 3300048929 | Bacteria | 1281 |
| 818 | Ga0496126_0469135 | 3300048929 | Bacteria | 1010 |
| 819 | Ga0496126_0543136 | 3300048929 | Bacteria | 923 |
| 820 | Ga0495682_0010078 | 3300049460 | Bacteria | 3670 |
| 821 | Ga0501031_0000392 | 3300049568 | Bacteria | 25655 |
| 822 | Ga0501031_0035853 | 3300049568 | Bacteria | 3236 |
| 823 | Ga0501032_0000120 | 3300049569 | Bacteria | 64900 |
| 824 | Ga0501032_0000224 | 3300049569 | Bacteria | 46893 |
| 825 | Ga0501033_0000095 | 3300049570 | Bacteria | 84522 |
| 826 | Ga0501033_0002325 | 3300049570 | Bacteria | 16196 |
| 827 | Ga0501033_0039437 | 3300049570 | Bacteria | 3528 |
| 828 | Ga0501033_0053301 | 3300049570 | Bacteria | 2996 |
| 829 | Ga0501034_0000061 | 3300049571 | Bacteria | 195178 |
| 830 | Ga0501034_0001606 | 3300049571 | Bacteria | 29373 |
| 831 | Ga0501036_0000007 | 3300049572 | Bacteria | 240500 |
| 832 | Ga0501036_0000054 | 3300049572 | Bacteria | 74190 |
| 833 | Ga0501036_0083706 | 3300049572 | Bacteria | 2697 |
| 834 | Ga0501037_0000093 | 3300049573 | Bacteria | 83246 |
| 835 | Ga0501037_0000159 | 3300049573 | Bacteria | 63178 |
| 836 | Ga0501037_0102481 | 3300049573 | Bacteria | 2064 |
| 837 | Ga0501038_0000028 | 3300049574 | Bacteria | 144481 |
| 838 | Ga0501038_0000066 | 3300049574 | Bacteria | 86216 |
| 839 | Ga0501038_0480427 | 3300049574 | Bacteria | 952 |
| 840 | Ga0501038_0716543 | 3300049574 | Bacteria | 748 |
| 841 | Ga0501039_0000005 | 3300049575 | Bacteria | 295471 |
| 842 | Ga0501039_0001528 | 3300049575 | Bacteria | 17054 |
| 843 | Ga0501040_0000178 | 3300049576 | Bacteria | 36163 |
| 844 | Ga0501040_0310093 | 3300049576 | Bacteria | 1128 |
| 845 | Ga0501041_0100216 | 3300049577 | Bacteria | 1793 |
| 846 | Ga0501042_0002439 | 3300049578 | Bacteria | 11408 |
| 847 | Ga0501043_0000127 | 3300049579 | Bacteria | 70587 |
| 848 | Ga0501043_0000161 | 3300049579 | Bacteria | 60738 |
| 849 | Ga0501043_0007172 | 3300049579 | Bacteria | 8858 |
| 850 | Ga0501046_0000032 | 3300049580 | Bacteria | 180265 |
| 851 | Ga0501046_0000487 | 3300049580 | Bacteria | 39622 |
| 852 | Ga0501047_0000077 | 3300049581 | Bacteria | 123480 |
| 853 | Ga0501047_0000122 | 3300049581 | Bacteria | 95307 |
| 854 | Ga0501047_0221890 | 3300049581 | Bacteria | 1746 |
| 855 | Ga0501048_0000053 | 3300049582 | Bacteria | 57136 |
| 856 | Ga0501048_0000693 | 3300049582 | Bacteria | 24501 |
| 857 | Ga0501048_0274289 | 3300049582 | Bacteria | 1199 |
| 858 | Ga0501067_0000387 | 3300049583 | Bacteria | 23972 |
| 859 | Ga0501067_0002698 | 3300049583 | Bacteria | 9791 |
| 860 | Ga0501067_0069156 | 3300049583 | Bacteria | 1955 |
| 861 | Ga0501068_0003190 | 3300049584 | Bacteria | 8780 |
| 862 | Ga0501068_0575651 | 3300049584 | Bacteria | 733 |
| 863 | Ga0501069_0025455 | 3300049585 | Bacteria | 3234 |
| 864 | Ga0501070_0000070 | 3300049586 | Bacteria | 86706 |
| 865 | Ga0501070_0001577 | 3300049586 | Bacteria | 20268 |
| 866 | Ga0501070_0052424 | 3300049586 | Bacteria | 3386 |
| 867 | Ga0501070_0170080 | 3300049586 | Bacteria | 1795 |
| 868 | Ga0501070_0291090 | 3300049586 | Bacteria | 1331 |
| 869 | Ga0501072_0021593 | 3300049588 | Bacteria | 4992 |
| 870 | Ga0501072_0360152 | 3300049588 | Bacteria | 1155 |
| 871 | Ga0501073_0000146 | 3300049589 | Bacteria | 46947 |
| 872 | Ga0501073_0002706 | 3300049589 | Bacteria | 13270 |
| 873 | Ga0501074_0000302 | 3300049590 | Bacteria | 28413 |
| 874 | Ga0501074_0000712 | 3300049590 | Bacteria | 20837 |
| 875 | Ga0501079_0042171 | 3300049741 | Bacteria | 3525 |
| 876 | Ga0501079_0749853 | 3300049741 | Bacteria | 768 |
| 877 | Ga0501080_0000035 | 3300049742 | Bacteria | 83220 |
| 878 | Ga0501080_0001268 | 3300049742 | Bacteria | 21004 |
| 879 | Ga0501083_0001199 | 3300049744 | Bacteria | 17528 |
| 880 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 881 | Ga0501035_0000099 | 3300049822 | Bacteria | 108224 |
| 882 | Ga0501035_0017185 | 3300049822 | Bacteria | 6667 |
| 883 | Ga0501035_0075976 | 3300049822 | Bacteria | 2971 |
| 884 | Ga0501035_0436005 | 3300049822 | Bacteria | 1086 |
| 885 | Ga0501044_0000184 | 3300049823 | Bacteria | 77805 |
| 886 | Ga0501044_0000195 | 3300049823 | Bacteria | 76643 |
| 887 | Ga0501044_0003221 | 3300049823 | Bacteria | 18386 |
| 888 | Ga0501045_0007673 | 3300049824 | Bacteria | 7504 |
| 889 | Ga0501045_0056317 | 3300049824 | Bacteria | 2875 |
| 890 | nmdc:mga03n38_706_c1 | 3300050490 | Bacteria | 8751 |
| 891 | nmdc:mga03n38_88099_c1 | 3300050490 | Bacteria | 1472 |
| 892 | nmdc:mga00v17_28566_c1 | 3300050491 | Bacteria | 3267 |
| 893 | nmdc:mga00v17_72468_c1 | 3300050491 | Bacteria | 2137 |
| 894 | nmdc:mga0yw44_127073_c1 | 3300050492 | Bacteria | 1647 |
| 895 | nmdc:mga0yw44_187503_c1 | 3300050492 | Bacteria | 1363 |
| 896 | nmdc:mga0yw44_243984_c1 | 3300050492 | Bacteria | 1195 |
| 897 | nmdc:mga0k408_62049_c1 | 3300050493 | Bacteria | 2173 |
| 898 | nmdc:mga0k408_66887_c1 | 3300050493 | Bacteria | 2094 |
| 899 | nmdc:mga06z11_21848_c1 | 3300050494 | Bacteria | 2979 |
| 900 | nmdc:mga06z11_228155_c1 | 3300050494 | Bacteria | 1090 |
| 901 | nmdc:mga06z11_31293_c1 | 3300050494 | Bacteria | 2584 |
| 902 | nmdc:mga06z11_326899_c1 | 3300050494 | Bacteria | 915 |
| 903 | nmdc:mga06z11_49391_c1 | 3300050494 | Bacteria | 2146 |
| 904 | nmdc:mga04h51_32121_c1 | 3300050495 | Bacteria | 1663 |
| 905 | nmdc:mga07m45_25157_c1 | 3300050496 | Bacteria | 3263 |
| 906 | nmdc:mga07m45_42469_c1 | 3300050496 | Bacteria | 2549 |
| 907 | nmdc:mga07m45_64176_c1 | 3300050496 | Bacteria | 2084 |
| 908 | nmdc:mga07m45_85363_c1 | 3300050496 | Bacteria | 1805 |
| 909 | nmdc:mga07m45_93490_c1 | 3300050496 | Bacteria | 1724 |
| 910 | nmdc:mga05p37_212739_c1 | 3300050507 | Bacteria | 2336 |
| 911 | nmdc:mga06r32_534461_c1 | 3300050510 | Bacteria | 1147 |
| 912 | nmdc:mga08y16_618560_c1 | 3300050511 | Bacteria | 1090 |
| 913 | nmdc:mga0n895_104311_c1 | 3300050512 | Bacteria | 2847 |
| 914 | nmdc:mga0n895_3366_c1 | 3300050512 | Bacteria | 12859 |
| 915 | nmdc:mga0n895_601180_c1 | 3300050512 | Bacteria | 1102 |
| 916 | nmdc:mga0sz30_44633_c1 | 3300050516 | Bacteria | 1868 |
| 917 | nmdc:mga0sz30_93601_c1 | 3300050516 | Bacteria | 1309 |
| 918 | Ga0495601_0006936 | 3300053077 | Bacteria | 6635 |
| 919 | Ga0495612_0107337 | 3300053078 | Bacteria | 1193 |
| 920 | Ga0500610_0048254 | 3300053079 | Bacteria | 2214 |
| 921 | Ga0500610_0201699 | 3300053079 | Bacteria | 958 |
| 922 | Ga0495655_0101339 | 3300053083 | Bacteria | 853 |
| 923 | Ga0495595_0006154 | 3300053084 | Bacteria | 4878 |
| 924 | Ga0495595_0042423 | 3300053084 | Bacteria | 2084 |
| 925 | Ga0495619_0000394 | 3300053085 | Bacteria | 29767 |
| 926 | Ga0495619_0122341 | 3300053085 | Bacteria | 1784 |
| 927 | Ga0495619_0125308 | 3300053085 | Bacteria | 1763 |
| 928 | Ga0495619_0252328 | 3300053085 | Bacteria | 1222 |
| 929 | Ga0495619_0609520 | 3300053085 | Bacteria | 746 |
| 930 | Ga0500578_0076704 | 3300053086 | Bacteria | 2128 |
| 931 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 932 | Ga0500643_018453 | 3300053087 | Bacteria | 2314 |
| 933 | Ga0500644_0108254 | 3300053088 | Bacteria | 1067 |
| 934 | Ga0500644_0139703 | 3300053088 | Bacteria | 962 |
| 935 | Ga0500583_0118502 | 3300053092 | Bacteria | 1308 |
| 936 | Ga0500566_0000693 | 3300053094 | Bacteria | 18973 |
| 937 | Ga0500566_0003060 | 3300053094 | Bacteria | 9993 |
| 938 | Ga0500650_0197603 | 3300053098 | Bacteria | 917 |
| 939 | Ga0500554_003608 | 3300053102 | Bacteria | 3187 |
| 940 | Ga0500569_009144 | 3300053109 | Bacteria | 2294 |
| 941 | Ga0500592_000534 | 3300053116 | Bacteria | 6290 |
| 942 | Ga0500592_026600 | 3300053116 | Bacteria | 933 |
| 943 | Ga0500595_000478 | 3300053119 | Bacteria | 24694 |
| 944 | Ga0500595_038724 | 3300053119 | Bacteria | 1548 |
| 945 | Ga0500608_164326 | 3300053122 | Bacteria | 959 |
| 946 | Ga0500642_0014156 | 3300053130 | Bacteria | 2959 |
| 947 | Ga0500655_005086 | 3300053133 | Bacteria | 2367 |
| 948 | Ga0500658_0300200 | 3300053134 | Bacteria | 738 |
| 949 | Ga0500559_0151232 | 3300053136 | Bacteria | 1089 |
| 950 | Ga0500568_0017048 | 3300053139 | Bacteria | 3214 |
| 951 | Ga0500568_0025789 | 3300053139 | Bacteria | 2474 |
| 952 | Ga0500577_0001147 | 3300053142 | Bacteria | 6786 |
| 953 | Ga0500588_0207050 | 3300053146 | Bacteria | 728 |
| 954 | Ga0500590_035468 | 3300053148 | Bacteria | 2582 |
| 955 | Ga0500590_104749 | 3300053148 | Bacteria | 1352 |
| 956 | Ga0500603_005174 | 3300053150 | Bacteria | 2797 |
| 957 | Ga0500616_0000085 | 3300053153 | Bacteria | 193192 |
| 958 | Ga0500622_0018556 | 3300053156 | Bacteria | 3698 |
| 959 | Ga0500627_0000040 | 3300053158 | Bacteria | 68950 |
| 960 | Ga0500627_0036963 | 3300053158 | Bacteria | 2082 |
| 961 | Ga0500634_0131780 | 3300053161 | Bacteria | 1199 |
| 962 | Ga0500636_0000410 | 3300053177 | Bacteria | 23626 |
| 963 | Ga0500637_0000245 | 3300053178 | Bacteria | 20132 |
| 964 | Ga0500637_0000260 | 3300053178 | Bacteria | 19731 |
| 965 | Ga0500637_0044618 | 3300053178 | Bacteria | 2512 |
| 966 | Ga0500645_076050 | 3300053730 | Bacteria | 960 |
| 967 | Ga0500601_000120 | 3300053737 | Bacteria | 16487 |
| 968 | Ga0501084_0002556 | 3300054114 | Bacteria | 14660 |
| 969 | Ga0500661_042459 | 3300055283 | Bacteria | 806 |
| 970 | Ga0501082_0027232 | 3300060353 | Bacteria | 4922 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053134 | Ga0500658_0300200 | Ga0500658_0300200_129_728 | 196 |
| 2 | 3300021388 | Ga0213875_10000651 | Ga0213875_1000065110 | 205 |
| 3 | 3300037853 | Ga0436364_1423953 | Ga0436364_1423953_8524_9144 | 205 |
| 4 | 3300005336 | Ga0070680_100046138 | Ga0070680_1000461383 | 223 |
| 5 | 3300005458 | Ga0070681_10146132 | Ga0070681_101461322 | 223 |
| 6 | 3300005535 | Ga0070684_100908407 | Ga0070684_1009084071 | 223 |
| 7 | 3300005539 | Ga0068853_100216372 | Ga0068853_1002163722 | 223 |
| 8 | 3300005563 | Ga0068855_100000788 | Ga0068855_1000007889 | 223 |
| 9 | 3300005578 | Ga0068854_100352473 | Ga0068854_1003524732 | 223 |
| 10 | 3300005614 | Ga0068856_100023174 | Ga0068856_1000231745 | 223 |
| 11 | 3300005937 | Ga0081455_10000453 | Ga0081455_100004532 | 223 |
| 12 | 3300005937 | Ga0081455_10021358 | Ga0081455_100213584 | 223 |
| 13 | 3300006237 | Ga0097621_100438501 | Ga0097621_1004385012 | 223 |
| 14 | 3300009093 | Ga0105240_10074926 | Ga0105240_100749262 | 223 |
| 15 | 3300009551 | Ga0105238_10097198 | Ga0105238_100971983 | 223 |
| 16 | 3300025912 | Ga0207707_10117177 | Ga0207707_101171773 | 223 |
| 17 | 3300025913 | Ga0207695_10280482 | Ga0207695_102804823 | 223 |
| 18 | 3300025924 | Ga0207694_10104292 | Ga0207694_101042923 | 223 |
| 19 | 3300025949 | Ga0207667_10011988 | Ga0207667_100119885 | 223 |
| 20 | 3300025981 | Ga0207640_10067614 | Ga0207640_100676142 | 223 |
| 21 | 3300026041 | Ga0207639_10226599 | Ga0207639_102265993 | 223 |
| 22 | 3300026078 | Ga0207702_10037088 | Ga0207702_100370883 | 223 |
| 23 | 3300026142 | Ga0207698_10062768 | Ga0207698_100627683 | 223 |
| 24 | 3300035083 | Ga0373926_0077713 | Ga0373926_0077713_262_1050 | 223 |
| 25 | 3300036401 | Ga0373937_0232231 | Ga0373937_0232231_226_1014 | 223 |
| 26 | 3300046454 | Ga0495592_0052072 | Ga0495592_0052072_872_1660 | 223 |
| 27 | 3300046477 | Ga0495664_0031622 | Ga0495664_0031622_889_1677 | 223 |
| 28 | 3300046517 | Ga0495630_0057730 | Ga0495630_0057730_2109_2897 | 223 |
| 29 | 3300046533 | Ga0495640_0074865 | Ga0495640_0074865_547_1335 | 223 |
| 30 | 3300046678 | Ga0495599_0055688 | Ga0495599_0055688_1678_2466 | 223 |
| 31 | 3300046809 | Ga0495600_0324747 | Ga0495600_0324747_140_928 | 223 |
| 32 | 3300047315 | Ga0495581_0021807 | Ga0495581_0021807_687_1475 | 223 |
| 33 | 3300047471 | Ga0495684_0009403 | Ga0495684_0009403_302_1090 | 223 |
| 34 | 3300009545 | Ga0105237_10009769 | Ga0105237_1000976910 | 224 |
| 35 | 3300025914 | Ga0207671_10001548 | Ga0207671_1000154825 | 224 |
| 36 | 3300025981 | Ga0207640_10044979 | Ga0207640_100449792 | 224 |
| 37 | 3300033180 | Ga0307510_10067265 | Ga0307510_100672653 | 224 |
| 38 | 3300046530 | Ga0495654_0016091 | Ga0495654_0016091_830_1513 | 224 |
| 39 | 3300046694 | Ga0495649_0171476 | Ga0495649_0171476_360_1043 | 224 |
| 40 | 3300053116 | Ga0500592_000534 | Ga0500592_000534_4747_5430 | 224 |
| 41 | 3300053158 | Ga0500627_0000040 | Ga0500627_0000040_4374_5057 | 224 |
| 42 | 3300053158 | Ga0500627_0036963 | Ga0500627_0036963_68_751 | 224 |
| 43 | 3300005328 | Ga0070676_10290013 | Ga0070676_102900132 | 225 |
| 44 | 3300005614 | Ga0068856_100524033 | Ga0068856_1005240331 | 225 |
| 45 | 3300006051 | Ga0075364_10375182 | Ga0075364_103751822 | 225 |
| 46 | 3300009093 | Ga0105240_10699128 | Ga0105240_106991281 | 225 |
| 47 | 3300026078 | Ga0207702_10596596 | Ga0207702_105965961 | 225 |
| 48 | 3300050491 | nmdc:mga00v17_72468_c1 | nmdc:mga00v17_72468_c1_1341_2033 | 225 |
| 49 | 3300049576 | Ga0501040_0000178 | Ga0501040_0000178_21961_22650 | 226 |
| 50 | 3300049576 | Ga0501040_0310093 | Ga0501040_0310093_69_758 | 226 |
| 51 | 3300049578 | Ga0501042_0002439 | Ga0501042_0002439_9541_10230 | 226 |
| 52 | 3300048924 | Ga0496121_0048069 | Ga0496121_0048069_1009_1707 | 227 |
| 53 | 3300053142 | Ga0500577_0001147 | Ga0500577_0001147_4120_4818 | 227 |
| 54 | 3300021320 | Ga0214544_1003487 | Ga0214544_100348710 | 228 |
| 55 | 3300025297 | Ga0209758_1001514 | Ga0209758_100151421 | 228 |
| 56 | 3300025893 | Ga0207682_10166149 | Ga0207682_101661492 | 228 |
| 57 | 3300031251 | Ga0265327_10001405 | Ga0265327_1000140514 | 228 |
| 58 | 3300031548 | Ga0307408_100917284 | Ga0307408_1009172841 | 228 |
| 59 | 3300046524 | Ga0495648_0064694 | Ga0495648_0064694_865_1566 | 228 |
| 60 | 3300048924 | Ga0496121_0001527 | Ga0496121_0001527_13855_14541 | 228 |
| 61 | iso_pu_bacteria | 2876808645 | 2876811735 | 228 |
| 62 | iso_pu_bacteria | 2879110137 | 2879118782 | 228 |
| 63 | 3300006178 | Ga0075367_10067317 | Ga0075367_100673172 | 229 |
| 64 | 3300042004 | Ga0439445_0043448 | Ga0439445_0043448_358_1068 | 229 |
| 65 | 3300042115 | Ga0450911_001143 | Ga0450911_001143_3685_4395 | 229 |
| 66 | 3300048924 | Ga0496121_0002968 | Ga0496121_0002968_6239_6946 | 229 |
| 67 | 3300048928 | Ga0496125_0016021 | Ga0496125_0016021_859_1563 | 229 |
| 68 | 3300050494 | nmdc:mga06z11_49391_c1 | nmdc:mga06z11_49391_c1_791_1576 | 229 |
| 69 | 3300053119 | Ga0500595_038724 | Ga0500595_038724_450_1154 | 229 |
| 70 | iso_pu_bacteria | 2508501128 | 2509147609 | 229 |
| 71 | iso_pu_bacteria | 2513237095 | 2513652263 | 229 |
| 72 | iso_pu_bacteria | 2513237098 | 2513676381 | 229 |
| 73 | iso_pu_bacteria | 2513237102 | 2513700259 | 229 |
| 74 | iso_pu_bacteria | 2513237139 | 2513876070 | 229 |
| 75 | iso_pu_bacteria | 2513237161 | 2514011271 | 229 |
| 76 | iso_pu_bacteria | 2517093001 | 2517103274 | 229 |
| 77 | iso_pu_bacteria | 2524023205 | 2524439006 | 229 |
| 78 | iso_pu_bacteria | 2528768022 | 2528852736 | 229 |
| 79 | iso_pu_bacteria | 2617270735 | 2617353444 | 229 |
| 80 | iso_pu_bacteria | 2617270741 | 2617377995 | 229 |
| 81 | iso_pu_bacteria | 2744054633 | 2745078881 | 229 |
| 82 | iso_pu_bacteria | 2791355196 | 2793060039 | 229 |
| 83 | iso_pu_bacteria | 2791355199 | 2793083269 | 229 |
| 84 | iso_pu_bacteria | 2802429603 | 2805917397 | 229 |
| 85 | iso_pu_bacteria | 2816332527 | 2818242488 | 229 |
| 86 | iso_pu_bacteria | 2824600985 | 2824605655 | 229 |
| 87 | iso_pu_bacteria | 2824609381 | 2824609906 | 229 |
| 88 | iso_pu_bacteria | 2824617872 | 2824625285 | 229 |
| 89 | iso_pu_bacteria | 2824626560 | 2824634103 | 229 |
| 90 | iso_pu_bacteria | 2824635225 | 2824639831 | 229 |
| 91 | iso_pu_bacteria | 2824644064 | 2824648414 | 229 |
| 92 | iso_pu_bacteria | 2824653114 | 2824655695 | 229 |
| 93 | iso_pu_bacteria | 2824661429 | 2824666581 | 229 |
| 94 | iso_pu_bacteria | 2824671348 | 2824674152 | 229 |
| 95 | iso_pu_bacteria | 2824679649 | 2824686622 | 229 |
| 96 | iso_pu_bacteria | 2824687955 | 2824693206 | 229 |
| 97 | iso_pu_bacteria | 2824696289 | 2824698949 | 229 |
| 98 | iso_pu_bacteria | 2824704595 | 2824707784 | 229 |
| 99 | iso_pu_bacteria | 2824714736 | 2824718340 | 229 |
| 100 | iso_pu_bacteria | 2824723954 | 2824728406 | 229 |
| 101 | iso_pu_bacteria | 2824732956 | 2824736826 | 229 |
| 102 | iso_pu_bacteria | 2824746037 | 2824751080 | 229 |
| 103 | iso_pu_bacteria | 2824753945 | 2824758093 | 229 |
| 104 | iso_pu_bacteria | 2824763712 | 2824766231 | 229 |
| 105 | iso_pu_bacteria | 2824773399 | 2824774248 | 229 |
| 106 | iso_pu_bacteria | 2838122688 | 2838127581 | 229 |
| 107 | iso_pu_bacteria | 2841941048 | 2841941468 | 229 |
| 108 | iso_pu_bacteria | 2841949485 | 2841952521 | 229 |
| 109 | iso_pu_bacteria | 2841957949 | 2841959539 | 229 |
| 110 | iso_pu_bacteria | 2841966195 | 2841967609 | 229 |
| 111 | iso_pu_bacteria | 2841974524 | 2841979000 | 229 |
| 112 | iso_pu_bacteria | 2841983080 | 2841986542 | 229 |
| 113 | iso_pu_bacteria | 2842038055 | 2842038310 | 229 |
| 114 | iso_pu_bacteria | 2842045827 | 2842048745 | 229 |
| 115 | iso_pu_bacteria | 2844315083 | 2844317782 | 229 |
| 116 | iso_pu_bacteria | 2847939898 | 2847945181 | 229 |
| 117 | iso_pu_bacteria | 2849076700 | 2849080639 | 229 |
| 118 | iso_pu_bacteria | 2874620515 | 2874623259 | 229 |
| 119 | iso_pu_bacteria | 2874628541 | 2874635963 | 229 |
| 120 | iso_pu_bacteria | 2879099564 | 2879104034 | 229 |
| 121 | iso_pu_bacteria | 2881364244 | 2881365630 | 229 |
| 122 | iso_pu_bacteria | 2885366525 | 2885372480 | 229 |
| 123 | iso_pu_bacteria | 2885409591 | 2885411797 | 229 |
| 124 | iso_pu_bacteria | 2888378607 | 2888382517 | 229 |
| 125 | iso_pu_bacteria | 2888388044 | 2888388181 | 229 |
| 126 | iso_pu_bacteria | 2888419890 | 2888423094 | 229 |
| 127 | iso_pu_bacteria | 2889033259 | 2889039172 | 229 |
| 128 | iso_pu_bacteria | 2903727486 | 2903735460 | 229 |
| 129 | iso_pu_bacteria | 2903768456 | 2903775945 | 229 |
| 130 | iso_pu_bacteria | 2904666416 | 2904670079 | 229 |
| 131 | iso_pu_bacteria | 2904711408 | 2904718417 | 229 |
| 132 | iso_pu_bacteria | 2906602504 | 2906607534 | 229 |
| 133 | iso_pu_bacteria | 2908775508 | 2908778758 | 229 |
| 134 | iso_pu_bacteria | 2922368715 | 2922375441 | 229 |
| 135 | iso_pu_bacteria | 2922393267 | 2922395034 | 229 |
| 136 | iso_pu_bacteria | 2929615660 | 2929616178 | 229 |
| 137 | iso_pu_bacteria | 2929624759 | 2929624922 | 229 |
| 138 | iso_pu_bacteria | 2932784394 | 2932787157 | 229 |
| 139 | iso_pu_bacteria | 2932809354 | 2932811350 | 229 |
| 140 | iso_pu_bacteria | 2932828146 | 2932835774 | 229 |
| 141 | iso_pu_bacteria | 2933577622 | 2933578538 | 229 |
| 142 | iso_pu_bacteria | 2935616580 | 2935618963 | 229 |
| 143 | iso_pu_bacteria | 2935638405 | 2935643220 | 229 |
| 144 | iso_pu_bacteria | 2935665750 | 2935669846 | 229 |
| 145 | iso_pu_bacteria | 2935675223 | 2935677013 | 229 |
| 146 | iso_pu_bacteria | 2935684952 | 2935693054 | 229 |
| 147 | iso_pu_bacteria | 2935694250 | 2935695454 | 229 |
| 148 | iso_pu_bacteria | 2935703347 | 2935709435 | 229 |
| 149 | iso_pu_bacteria | 2935713505 | 2935719662 | 229 |
| 150 | iso_pu_bacteria | 2935722832 | 2935729571 | 229 |
| 151 | iso_pu_bacteria | 2935732158 | 2935739545 | 229 |
| 152 | iso_pu_bacteria | 2935741537 | 2935748583 | 229 |
| 153 | iso_pu_bacteria | 2935750917 | 2935756830 | 229 |
| 154 | iso_pu_bacteria | 2935760218 | 2935761182 | 229 |
| 155 | iso_pu_bacteria | 2935801545 | 2935807363 | 229 |
| 156 | iso_pu_bacteria | 2935810662 | 2935812503 | 229 |
| 157 | iso_pu_bacteria | 2935827899 | 2935832636 | 229 |
| 158 | iso_pu_bacteria | 2935837841 | 2935839285 | 229 |
| 159 | iso_pu_bacteria | 2935855204 | 2935857328 | 229 |
| 160 | iso_pu_bacteria | 2935864058 | 2935864857 | 229 |
| 161 | iso_pu_bacteria | 2935873716 | 2935876635 | 229 |
| 162 | iso_pu_bacteria | 2936002035 | 2936008229 | 229 |
| 163 | iso_pu_bacteria | 2936037263 | 2936039096 | 229 |
| 164 | iso_pu_bacteria | 2940556831 | 2940562744 | 229 |
| 165 | iso_pu_bacteria | 2941531003 | 2941536419 | 229 |
| 166 | iso_pu_bacteria | 2941538514 | 2941539975 | 229 |
| 167 | iso_pu_bacteria | 3005506211 | 3005508687 | 229 |
| 168 | iso_pu_bacteria | 3005594810 | 3005597535 | 229 |
| 169 | iso_pu_bacteria | 3005710791 | 3005713557 | 229 |
| 170 | iso_pu_bacteria | 3005718088 | 3005720959 | 229 |
| 171 | iso_pu_bacteria | 8006984368 | 8006991938 | 229 |
| 172 | iso_pu_bacteria | 8016511872 | 8016515049 | 229 |
| 173 | iso_pu_bacteria | 8017057580 | 8017061404 | 229 |
| 174 | iso_pu_bacteria | 8019576017 | 8019580879 | 229 |
| 175 | iso_pu_bacteria | 8019597564 | 8019602722 | 229 |
| 176 | iso_pu_bacteria | 8019608314 | 8019615837 | 229 |
| 177 | iso_pu_bacteria | 8055742211 | 8055747825 | 229 |
| 178 | iso_pu_bacteria | 8056967851 | 8056970027 | 229 |
| 179 | 3300025904 | Ga0207647_10013822 | Ga0207647_100138222 | 230 |
| 180 | 3300048924 | Ga0496121_0001005 | Ga0496121_0001005_44803_45510 | 230 |
| 181 | iso_pu_bacteria | 2524023228 | 2524537737 | 230 |
| 182 | iso_pu_bacteria | 2643221683 | 2644464691 | 230 |
| 183 | iso_pu_bacteria | 2667528175 | 2671124123 | 230 |
| 184 | iso_pu_bacteria | 2728368998 | 2728752931 | 230 |
| 185 | iso_pu_bacteria | 2791355197 | 2793070711 | 230 |
| 186 | iso_pu_bacteria | 2904690495 | 2904691559 | 230 |
| 187 | iso_pu_bacteria | 2906610324 | 2906610673 | 230 |
| 188 | iso_pu_bacteria | 2908739725 | 2908744196 | 230 |
| 189 | iso_pu_bacteria | 2908756301 | 2908761630 | 230 |
| 190 | iso_pu_bacteria | 2922425934 | 2922428651 | 230 |
| 191 | iso_pu_bacteria | 3005474847 | 3005478782 | 230 |
| 192 | iso_pu_bacteria | 8016583857 | 8016593919 | 230 |
| 193 | iso_pu_bacteria | 8056689827 | 8056695936 | 230 |
| 194 | 3300001989 | JGI24739J22299_10059542 | JGI24739J22299_100595422 | 231 |
| 195 | 3300005331 | Ga0070670_100192058 | Ga0070670_1001920582 | 231 |
| 196 | 3300005335 | Ga0070666_10335761 | Ga0070666_103357611 | 231 |
| 197 | 3300005345 | Ga0070692_10245797 | Ga0070692_102457971 | 231 |
| 198 | 3300005347 | Ga0070668_100033764 | Ga0070668_1000337642 | 231 |
| 199 | 3300005347 | Ga0070668_100128620 | Ga0070668_1001286202 | 231 |
| 200 | 3300005441 | Ga0070700_100104231 | Ga0070700_1001042312 | 231 |
| 201 | 3300005455 | Ga0070663_100040886 | Ga0070663_1000408862 | 231 |
| 202 | 3300005455 | Ga0070663_100063505 | Ga0070663_1000635052 | 231 |
| 203 | 3300005456 | Ga0070678_100031497 | Ga0070678_1000314972 | 231 |
| 204 | 3300005457 | Ga0070662_100146152 | Ga0070662_1001461522 | 231 |
| 205 | 3300005548 | Ga0070665_100018629 | Ga0070665_1000186293 | 231 |
| 206 | 3300005563 | Ga0068855_100032750 | Ga0068855_1000327504 | 231 |
| 207 | 3300005563 | Ga0068855_100398314 | Ga0068855_1003983142 | 231 |
| 208 | 3300005577 | Ga0068857_100042265 | Ga0068857_1000422652 | 231 |
| 209 | 3300005615 | Ga0070702_100140659 | Ga0070702_1001406592 | 231 |
| 210 | 3300005616 | Ga0068852_100290646 | Ga0068852_1002906462 | 231 |
| 211 | 3300005617 | Ga0068859_100126365 | Ga0068859_1001263652 | 231 |
| 212 | 3300005618 | Ga0068864_100210122 | Ga0068864_1002101222 | 231 |
| 213 | 3300005719 | Ga0068861_100019782 | Ga0068861_1000197822 | 231 |
| 214 | 3300005842 | Ga0068858_100035309 | Ga0068858_1000353092 | 231 |
| 215 | 3300005843 | Ga0068860_100233567 | Ga0068860_1002335672 | 231 |
| 216 | 3300006038 | Ga0075365_10220722 | Ga0075365_102207221 | 231 |
| 217 | 3300006042 | Ga0075368_10038059 | Ga0075368_100380592 | 231 |
| 218 | 3300006048 | Ga0075363_100008449 | Ga0075363_1000084494 | 231 |
| 219 | 3300006051 | Ga0075364_10035998 | Ga0075364_100359982 | 231 |
| 220 | 3300006178 | Ga0075367_10007429 | Ga0075367_100074293 | 231 |
| 221 | 3300006178 | Ga0075367_10119164 | Ga0075367_101191642 | 231 |
| 222 | 3300006186 | Ga0075369_10029112 | Ga0075369_100291122 | 231 |
| 223 | 3300006353 | Ga0075370_10015506 | Ga0075370_100155062 | 231 |
| 224 | 3300006353 | Ga0075370_10080532 | Ga0075370_100805322 | 231 |
| 225 | 3300006353 | Ga0075370_10236658 | Ga0075370_102366582 | 231 |
| 226 | 3300006931 | Ga0097620_100126373 | Ga0097620_1001263732 | 231 |
| 227 | 3300009093 | Ga0105240_10000427 | Ga0105240_1000042729 | 231 |
| 228 | 3300009098 | Ga0105245_10174177 | Ga0105245_101741772 | 231 |
| 229 | 3300009101 | Ga0105247_10041247 | Ga0105247_100412471 | 231 |
| 230 | 3300009174 | Ga0105241_10051616 | Ga0105241_100516162 | 231 |
| 231 | 3300009176 | Ga0105242_10088622 | Ga0105242_100886222 | 231 |
| 232 | 3300009177 | Ga0105248_10325701 | Ga0105248_103257012 | 231 |
| 233 | 3300009545 | Ga0105237_10000653 | Ga0105237_100006533 | 231 |
| 234 | 3300009545 | Ga0105237_10215301 | Ga0105237_102153012 | 231 |
| 235 | 3300009545 | Ga0105237_10607693 | Ga0105237_106076932 | 231 |
| 236 | 3300009551 | Ga0105238_10146154 | Ga0105238_101461542 | 231 |
| 237 | 3300009551 | Ga0105238_10194981 | Ga0105238_101949811 | 231 |
| 238 | 3300010375 | Ga0105239_10074545 | Ga0105239_100745452 | 231 |
| 239 | 3300010375 | Ga0105239_10106169 | Ga0105239_101061692 | 231 |
| 240 | 3300011119 | Ga0105246_10098918 | Ga0105246_100989182 | 231 |
| 241 | 3300013296 | Ga0157374_10353677 | Ga0157374_103536772 | 231 |
| 242 | 3300013296 | Ga0157374_11004044 | Ga0157374_110040441 | 231 |
| 243 | 3300013297 | Ga0157378_10020146 | Ga0157378_100201463 | 231 |
| 244 | 3300013308 | Ga0157375_11277906 | Ga0157375_112779061 | 231 |
| 245 | 3300014325 | Ga0163163_10311906 | Ga0163163_103119062 | 231 |
| 246 | 3300014745 | Ga0157377_10100591 | Ga0157377_101005912 | 231 |
| 247 | 3300025900 | Ga0207710_10188708 | Ga0207710_101887081 | 231 |
| 248 | 3300025900 | Ga0207710_10271083 | Ga0207710_102710831 | 231 |
| 249 | 3300025911 | Ga0207654_10002540 | Ga0207654_100025402 | 231 |
| 250 | 3300025913 | Ga0207695_10000062 | Ga0207695_1000006254 | 231 |
| 251 | 3300025914 | Ga0207671_10000377 | Ga0207671_1000037740 | 231 |
| 252 | 3300025914 | Ga0207671_10404529 | Ga0207671_104045292 | 231 |
| 253 | 3300025917 | Ga0207660_10733662 | Ga0207660_107336621 | 231 |
| 254 | 3300025920 | Ga0207649_10229032 | Ga0207649_102290322 | 231 |
| 255 | 3300025925 | Ga0207650_10081695 | Ga0207650_100816952 | 231 |
| 256 | 3300025925 | Ga0207650_10548749 | Ga0207650_105487491 | 231 |
| 257 | 3300025927 | Ga0207687_10079388 | Ga0207687_100793882 | 231 |
| 258 | 3300025933 | Ga0207706_10051480 | Ga0207706_100514801 | 231 |
| 259 | 3300025944 | Ga0207661_10876265 | Ga0207661_108762651 | 231 |
| 260 | 3300025949 | Ga0207667_10362496 | Ga0207667_103624962 | 231 |
| 261 | 3300026023 | Ga0207677_10115054 | Ga0207677_101150542 | 231 |
| 262 | 3300026035 | Ga0207703_10015407 | Ga0207703_100154072 | 231 |
| 263 | 3300026067 | Ga0207678_10027645 | Ga0207678_100276453 | 231 |
| 264 | 3300026067 | Ga0207678_10206812 | Ga0207678_102068122 | 231 |
| 265 | 3300026075 | Ga0207708_10271099 | Ga0207708_102710991 | 231 |
| 266 | 3300026095 | Ga0207676_10315740 | Ga0207676_103157401 | 231 |
| 267 | 3300026121 | Ga0207683_10246075 | Ga0207683_102460752 | 231 |
| 268 | 3300026142 | Ga0207698_10301479 | Ga0207698_103014792 | 231 |
| 269 | 3300028379 | Ga0268266_10001551 | Ga0268266_100015513 | 231 |
| 270 | 3300028379 | Ga0268266_10008591 | Ga0268266_100085916 | 231 |
| 271 | 3300028381 | Ga0268264_10225841 | Ga0268264_102258412 | 231 |
| 272 | 3300031250 | Ga0265331_10142584 | Ga0265331_101425841 | 231 |
| 273 | 3300031507 | Ga0307509_10082486 | Ga0307509_100824862 | 231 |
| 274 | 3300032126 | Ga0307415_100017135 | Ga0307415_1000171352 | 231 |
| 275 | 3300033180 | Ga0307510_10018748 | Ga0307510_100187488 | 231 |
| 276 | 3300033180 | Ga0307510_10052699 | Ga0307510_100526993 | 231 |
| 277 | 3300035695 | Ga0373927_0121760 | Ga0373927_0121760_540_1235 | 231 |
| 278 | 3300046452 | Ga0495617_010752 | Ga0495617_010752_1378_2073 | 231 |
| 279 | 3300046455 | Ga0495603_0026846 | Ga0495603_0026846_1999_2694 | 231 |
| 280 | 3300046461 | Ga0495641_0069940 | Ga0495641_0069940_12_707 | 231 |
| 281 | 3300046491 | Ga0495584_0068892 | Ga0495584_0068892_567_1262 | 231 |
| 282 | 3300046492 | Ga0495585_0144857 | Ga0495585_0144857_196_891 | 231 |
| 283 | 3300046519 | Ga0495632_0085600 | Ga0495632_0085600_133_828 | 231 |
| 284 | 3300046522 | Ga0495643_0018174 | Ga0495643_0018174_67_762 | 231 |
| 285 | 3300046523 | Ga0495644_0008239 | Ga0495644_0008239_68_763 | 231 |
| 286 | 3300046615 | Ga0495656_0001067 | Ga0495656_0001067_7643_8338 | 231 |
| 287 | 3300046674 | Ga0495588_0152363 | Ga0495588_0152363_511_1206 | 231 |
| 288 | 3300046794 | Ga0495589_0128172 | Ga0495589_0128172_92_787 | 231 |
| 289 | 3300047315 | Ga0495581_0055929 | Ga0495581_0055929_506_1201 | 231 |
| 290 | 3300047323 | Ga0495683_0131456 | Ga0495683_0131456_457_1152 | 231 |
| 291 | 3300047443 | Ga0495687_042211 | Ga0495687_042211_1088_1783 | 231 |
| 292 | 3300047447 | Ga0495685_085870 | Ga0495685_085870_13_708 | 231 |
| 293 | 3300048905 | Ga0496102_0001946 | Ga0496102_0001946_12403_13098 | 231 |
| 294 | 3300048906 | Ga0496103_0012612 | Ga0496103_0012612_3691_4386 | 231 |
| 295 | 3300048908 | Ga0496105_0295863 | Ga0496105_0295863_542_1237 | 231 |
| 296 | 3300048908 | Ga0496105_0353630 | Ga0496105_0353630_97_792 | 231 |
| 297 | 3300048912 | Ga0496109_0118736 | Ga0496109_0118736_550_1245 | 231 |
| 298 | 3300048913 | Ga0496110_0156028 | Ga0496110_0156028_979_1674 | 231 |
| 299 | 3300048915 | Ga0496112_1053061 | Ga0496112_1053061_16_711 | 231 |
| 300 | 3300048916 | Ga0496113_0280656 | Ga0496113_0280656_177_872 | 231 |
| 301 | 3300048918 | Ga0496115_0272850 | Ga0496115_0272850_656_1351 | 231 |
| 302 | 3300048924 | Ga0496121_0034058 | Ga0496121_0034058_1132_1827 | 231 |
| 303 | 3300048924 | Ga0496121_0430673 | Ga0496121_0430673_24_719 | 231 |
| 304 | 3300048929 | Ga0496126_0218476 | Ga0496126_0218476_500_1195 | 231 |
| 305 | 3300049570 | Ga0501033_0053301 | Ga0501033_0053301_321_1016 | 231 |
| 306 | 3300049583 | Ga0501067_0069156 | Ga0501067_0069156_62_757 | 231 |
| 307 | 3300050490 | nmdc:mga03n38_706_c1 | nmdc:mga03n38_706_c1_2099_2794 | 231 |
| 308 | 3300050490 | nmdc:mga03n38_88099_c1 | nmdc:mga03n38_88099_c1_16_711 | 231 |
| 309 | 3300050491 | nmdc:mga00v17_28566_c1 | nmdc:mga00v17_28566_c1_555_1250 | 231 |
| 310 | 3300050492 | nmdc:mga0yw44_187503_c1 | nmdc:mga0yw44_187503_c1_568_1263 | 231 |
| 311 | 3300050494 | nmdc:mga06z11_21848_c1 | nmdc:mga06z11_21848_c1_802_1497 | 231 |
| 312 | 3300050494 | nmdc:mga06z11_31293_c1 | nmdc:mga06z11_31293_c1_1184_1879 | 231 |
| 313 | 3300050495 | nmdc:mga04h51_32121_c1 | nmdc:mga04h51_32121_c1_234_929 | 231 |
| 314 | 3300050496 | nmdc:mga07m45_25157_c1 | nmdc:mga07m45_25157_c1_2102_2797 | 231 |
| 315 | 3300050496 | nmdc:mga07m45_42469_c1 | nmdc:mga07m45_42469_c1_937_1632 | 231 |
| 316 | 3300050512 | nmdc:mga0n895_104311_c1 | nmdc:mga0n895_104311_c1_1603_2298 | 231 |
| 317 | 3300053086 | Ga0500578_0076704 | Ga0500578_0076704_499_1194 | 231 |
| 318 | 3300053088 | Ga0500644_0108254 | Ga0500644_0108254_58_753 | 231 |
| 319 | 3300053102 | Ga0500554_003608 | Ga0500554_003608_2422_3117 | 231 |
| 320 | 3300053133 | Ga0500655_005086 | Ga0500655_005086_145_840 | 231 |
| 321 | 3300053139 | Ga0500568_0025789 | Ga0500568_0025789_1166_1861 | 231 |
| 322 | 3300053150 | Ga0500603_005174 | Ga0500603_005174_1994_2689 | 231 |
| 323 | 3300053153 | Ga0500616_0000085 | Ga0500616_0000085_218_913 | 231 |
| 324 | 3300053178 | Ga0500637_0000260 | Ga0500637_0000260_17082_17777 | 231 |
| 325 | 3300005539 | Ga0068853_100259998 | Ga0068853_1002599982 | 232 |
| 326 | 3300006028 | Ga0070717_10017227 | Ga0070717_100172271 | 232 |
| 327 | 3300006844 | Ga0075428_101011838 | Ga0075428_1010118381 | 232 |
| 328 | 3300031616 | Ga0307508_10000532 | Ga0307508_1000053220 | 232 |
| 329 | 3300048918 | Ga0496115_0084672 | Ga0496115_0084672_1763_2461 | 232 |
| 330 | 3300001990 | JGI24737J22298_10033372 | JGI24737J22298_100333722 | 233 |
| 331 | 3300002075 | JGI24738J21930_10055969 | JGI24738J21930_100559691 | 233 |
| 332 | 3300003203 | JGI25406J46586_10000169 | JGI25406J46586_1000016932 | 233 |
| 333 | 3300003203 | JGI25406J46586_10000649 | JGI25406J46586_100006491 | 233 |
| 334 | 3300003215 | JGI25153J46596_10001707 | JGI25153J46596_1000170710 | 233 |
| 335 | 3300003215 | JGI25153J46596_10006992 | JGI25153J46596_100069924 | 233 |
| 336 | 3300003215 | JGI25153J46596_10008439 | JGI25153J46596_100084396 | 233 |
| 337 | 3300003354 | JGI25160J50197_1003053 | JGI25160J50197_10030534 | 233 |
| 338 | 3300003354 | JGI25160J50197_1008288 | JGI25160J50197_10082883 | 233 |
| 339 | 3300003354 | JGI25160J50197_1008476 | JGI25160J50197_10084765 | 233 |
| 340 | 3300003752 | Ga0055539_1011509 | Ga0055539_10115091 | 233 |
| 341 | 3300005262 | Ga0065165_1003321 | Ga0065165_10033212 | 233 |
| 342 | 3300005262 | Ga0065165_1020904 | Ga0065165_10209043 | 233 |
| 343 | 3300005289 | Ga0065704_10239132 | Ga0065704_102391321 | 233 |
| 344 | 3300005327 | Ga0070658_10364883 | Ga0070658_103648831 | 233 |
| 345 | 3300005329 | Ga0070683_100097821 | Ga0070683_1000978212 | 233 |
| 346 | 3300005329 | Ga0070683_100385969 | Ga0070683_1003859691 | 233 |
| 347 | 3300005331 | Ga0070670_100365218 | Ga0070670_1003652182 | 233 |
| 348 | 3300005334 | Ga0068869_100334157 | Ga0068869_1003341572 | 233 |
| 349 | 3300005336 | Ga0070680_100023477 | Ga0070680_1000234774 | 233 |
| 350 | 3300005336 | Ga0070680_100124919 | Ga0070680_1001249192 | 233 |
| 351 | 3300005337 | Ga0070682_100077343 | Ga0070682_1000773432 | 233 |
| 352 | 3300005339 | Ga0070660_100046974 | Ga0070660_1000469742 | 233 |
| 353 | 3300005347 | Ga0070668_100031965 | Ga0070668_1000319654 | 233 |
| 354 | 3300005347 | Ga0070668_100200452 | Ga0070668_1002004522 | 233 |
| 355 | 3300005347 | Ga0070668_100219133 | Ga0070668_1002191332 | 233 |
| 356 | 3300005347 | Ga0070668_100224269 | Ga0070668_1002242692 | 233 |
| 357 | 3300005354 | Ga0070675_100825607 | Ga0070675_1008256071 | 233 |
| 358 | 3300005355 | Ga0070671_100040085 | Ga0070671_1000400854 | 233 |
| 359 | 3300005366 | Ga0070659_100087281 | Ga0070659_1000872812 | 233 |
| 360 | 3300005366 | Ga0070659_100333063 | Ga0070659_1003330631 | 233 |
| 361 | 3300005366 | Ga0070659_100476292 | Ga0070659_1004762922 | 233 |
| 362 | 3300005367 | Ga0070667_100227901 | Ga0070667_1002279012 | 233 |
| 363 | 3300005434 | Ga0070709_10206931 | Ga0070709_102069312 | 233 |
| 364 | 3300005435 | Ga0070714_100100246 | Ga0070714_1001002463 | 233 |
| 365 | 3300005435 | Ga0070714_100192957 | Ga0070714_1001929572 | 233 |
| 366 | 3300005436 | Ga0070713_100027904 | Ga0070713_1000279045 | 233 |
| 367 | 3300005436 | Ga0070713_100396813 | Ga0070713_1003968131 | 233 |
| 368 | 3300005436 | Ga0070713_100451308 | Ga0070713_1004513082 | 233 |
| 369 | 3300005441 | Ga0070700_100117878 | Ga0070700_1001178781 | 233 |
| 370 | 3300005441 | Ga0070700_100220087 | Ga0070700_1002200871 | 233 |
| 371 | 3300005444 | Ga0070694_100134244 | Ga0070694_1001342443 | 233 |
| 372 | 3300005455 | Ga0070663_100067318 | Ga0070663_1000673183 | 233 |
| 373 | 3300005455 | Ga0070663_100269348 | Ga0070663_1002693482 | 233 |
| 374 | 3300005456 | Ga0070678_100170663 | Ga0070678_1001706632 | 233 |
| 375 | 3300005456 | Ga0070678_100253457 | Ga0070678_1002534572 | 233 |
| 376 | 3300005457 | Ga0070662_100187747 | Ga0070662_1001877472 | 233 |
| 377 | 3300005458 | Ga0070681_10017761 | Ga0070681_100177612 | 233 |
| 378 | 3300005458 | Ga0070681_10092691 | Ga0070681_100926912 | 233 |
| 379 | 3300005471 | Ga0070698_100118647 | Ga0070698_1001186473 | 233 |
| 380 | 3300005471 | Ga0070698_100219634 | Ga0070698_1002196343 | 233 |
| 381 | 3300005518 | Ga0070699_100116665 | Ga0070699_1001166652 | 233 |
| 382 | 3300005518 | Ga0070699_100297398 | Ga0070699_1002973982 | 233 |
| 383 | 3300005530 | Ga0070679_100006433 | Ga0070679_1000064339 | 233 |
| 384 | 3300005530 | Ga0070679_100061259 | Ga0070679_1000612592 | 233 |
| 385 | 3300005535 | Ga0070684_100374133 | Ga0070684_1003741332 | 233 |
| 386 | 3300005536 | Ga0070697_100465339 | Ga0070697_1004653391 | 233 |
| 387 | 3300005539 | Ga0068853_100043317 | Ga0068853_1000433172 | 233 |
| 388 | 3300005539 | Ga0068853_100394271 | Ga0068853_1003942712 | 233 |
| 389 | 3300005543 | Ga0070672_100654552 | Ga0070672_1006545521 | 233 |
| 390 | 3300005546 | Ga0070696_100328123 | Ga0070696_1003281231 | 233 |
| 391 | 3300005548 | Ga0070665_100152028 | Ga0070665_1001520283 | 233 |
| 392 | 3300005548 | Ga0070665_100431006 | Ga0070665_1004310062 | 233 |
| 393 | 3300005563 | Ga0068855_100083449 | Ga0068855_1000834494 | 233 |
| 394 | 3300005563 | Ga0068855_100492029 | Ga0068855_1004920292 | 233 |
| 395 | 3300005564 | Ga0070664_100515091 | Ga0070664_1005150911 | 233 |
| 396 | 3300005564 | Ga0070664_100519623 | Ga0070664_1005196231 | 233 |
| 397 | 3300005577 | Ga0068857_100252354 | Ga0068857_1002523542 | 233 |
| 398 | 3300005614 | Ga0068856_100000236 | Ga0068856_10000023617 | 233 |
| 399 | 3300005614 | Ga0068856_100155121 | Ga0068856_1001551214 | 233 |
| 400 | 3300005614 | Ga0068856_100481100 | Ga0068856_1004811001 | 233 |
| 401 | 3300005616 | Ga0068852_100157324 | Ga0068852_1001573242 | 233 |
| 402 | 3300005616 | Ga0068852_100264170 | Ga0068852_1002641701 | 233 |
| 403 | 3300005618 | Ga0068864_100236316 | Ga0068864_1002363162 | 233 |
| 404 | 3300005718 | Ga0068866_10409721 | Ga0068866_104097211 | 233 |
| 405 | 3300005719 | Ga0068861_100216382 | Ga0068861_1002163822 | 233 |
| 406 | 3300005834 | Ga0068851_10008459 | Ga0068851_100084594 | 233 |
| 407 | 3300005841 | Ga0068863_100539719 | Ga0068863_1005397192 | 233 |
| 408 | 3300005842 | Ga0068858_100245808 | Ga0068858_1002458082 | 233 |
| 409 | 3300005843 | Ga0068860_100063240 | Ga0068860_1000632402 | 233 |
| 410 | 3300005844 | Ga0068862_100145605 | Ga0068862_1001456052 | 233 |
| 411 | 3300005844 | Ga0068862_100368564 | Ga0068862_1003685641 | 233 |
| 412 | 3300005937 | Ga0081455_10007549 | Ga0081455_100075498 | 233 |
| 413 | 3300005937 | Ga0081455_10040180 | Ga0081455_100401804 | 233 |
| 414 | 3300005981 | Ga0081538_10069452 | Ga0081538_100694523 | 233 |
| 415 | 3300005983 | Ga0081540_1007278 | Ga0081540_10072785 | 233 |
| 416 | 3300005983 | Ga0081540_1011806 | Ga0081540_10118065 | 233 |
| 417 | 3300005985 | Ga0081539_10000255 | Ga0081539_1000025531 | 233 |
| 418 | 3300005985 | Ga0081539_10039521 | Ga0081539_100395213 | 233 |
| 419 | 3300006028 | Ga0070717_10060144 | Ga0070717_100601442 | 233 |
| 420 | 3300006028 | Ga0070717_10720248 | Ga0070717_107202481 | 233 |
| 421 | 3300006038 | Ga0075365_10145580 | Ga0075365_101455801 | 233 |
| 422 | 3300006038 | Ga0075365_10210394 | Ga0075365_102103942 | 233 |
| 423 | 3300006038 | Ga0075365_10260931 | Ga0075365_102609312 | 233 |
| 424 | 3300006042 | Ga0075368_10046123 | Ga0075368_100461232 | 233 |
| 425 | 3300006048 | Ga0075363_100020741 | Ga0075363_1000207414 | 233 |
| 426 | 3300006051 | Ga0075364_10070087 | Ga0075364_100700873 | 233 |
| 427 | 3300006173 | Ga0070716_100084726 | Ga0070716_1000847261 | 233 |
| 428 | 3300006173 | Ga0070716_100332479 | Ga0070716_1003324792 | 233 |
| 429 | 3300006177 | Ga0075362_10028091 | Ga0075362_100280913 | 233 |
| 430 | 3300006178 | Ga0075367_10327419 | Ga0075367_103274191 | 233 |
| 431 | 3300006186 | Ga0075369_10065530 | Ga0075369_100655302 | 233 |
| 432 | 3300006195 | Ga0075366_10030200 | Ga0075366_100302004 | 233 |
| 433 | 3300006237 | Ga0097621_100410591 | Ga0097621_1004105912 | 233 |
| 434 | 3300006353 | Ga0075370_10135918 | Ga0075370_101359182 | 233 |
| 435 | 3300007265 | Ga0099794_10043146 | Ga0099794_100431462 | 233 |
| 436 | 3300007265 | Ga0099794_10054942 | Ga0099794_100549422 | 233 |
| 437 | 3300007265 | Ga0099794_10239654 | Ga0099794_102396541 | 233 |
| 438 | 3300007788 | Ga0099795_10209060 | Ga0099795_102090601 | 233 |
| 439 | 3300009092 | Ga0105250_10032509 | Ga0105250_100325092 | 233 |
| 440 | 3300009093 | Ga0105240_10010641 | Ga0105240_100106417 | 233 |
| 441 | 3300009093 | Ga0105240_10562070 | Ga0105240_105620702 | 233 |
| 442 | 3300009094 | Ga0111539_11024603 | Ga0111539_110246032 | 233 |
| 443 | 3300009101 | Ga0105247_10045143 | Ga0105247_100451432 | 233 |
| 444 | 3300009101 | Ga0105247_10063966 | Ga0105247_100639662 | 233 |
| 445 | 3300009101 | Ga0105247_10453023 | Ga0105247_104530231 | 233 |
| 446 | 3300009147 | Ga0114129_10386990 | Ga0114129_103869902 | 233 |
| 447 | 3300009174 | Ga0105241_10054907 | Ga0105241_100549073 | 233 |
| 448 | 3300009174 | Ga0105241_10171949 | Ga0105241_101719492 | 233 |
| 449 | 3300009174 | Ga0105241_10697018 | Ga0105241_106970181 | 233 |
| 450 | 3300009545 | Ga0105237_10004145 | Ga0105237_100041458 | 233 |
| 451 | 3300009545 | Ga0105237_10020210 | Ga0105237_100202102 | 233 |
| 452 | 3300009545 | Ga0105237_10732091 | Ga0105237_107320911 | 233 |
| 453 | 3300009551 | Ga0105238_10009050 | Ga0105238_100090508 | 233 |
| 454 | 3300009551 | Ga0105238_10285722 | Ga0105238_102857222 | 233 |
| 455 | 3300009551 | Ga0105238_11187230 | Ga0105238_111872301 | 233 |
| 456 | 3300009553 | Ga0105249_10148072 | Ga0105249_101480722 | 233 |
| 457 | 3300010159 | Ga0099796_10011391 | Ga0099796_100113913 | 233 |
| 458 | 3300010159 | Ga0099796_10048120 | Ga0099796_100481201 | 233 |
| 459 | 3300010375 | Ga0105239_10046661 | Ga0105239_100466614 | 233 |
| 460 | 3300010375 | Ga0105239_10083618 | Ga0105239_100836183 | 233 |
| 461 | 3300010375 | Ga0105239_10098988 | Ga0105239_100989884 | 233 |
| 462 | 3300010375 | Ga0105239_10141128 | Ga0105239_101411282 | 233 |
| 463 | 3300010375 | Ga0105239_10681398 | Ga0105239_106813982 | 233 |
| 464 | 3300013104 | Ga0157370_10171667 | Ga0157370_101716672 | 233 |
| 465 | 3300013104 | Ga0157370_10310123 | Ga0157370_103101232 | 233 |
| 466 | 3300013105 | Ga0157369_10022335 | Ga0157369_100223357 | 233 |
| 467 | 3300013105 | Ga0157369_10422186 | Ga0157369_104221862 | 233 |
| 468 | 3300013297 | Ga0157378_10401252 | Ga0157378_104012522 | 233 |
| 469 | 3300013306 | Ga0163162_10094550 | Ga0163162_100945503 | 233 |
| 470 | 3300013306 | Ga0163162_10215841 | Ga0163162_102158413 | 233 |
| 471 | 3300013306 | Ga0163162_10585239 | Ga0163162_105852392 | 233 |
| 472 | 3300014325 | Ga0163163_10108183 | Ga0163163_101081832 | 233 |
| 473 | 3300014325 | Ga0163163_10429042 | Ga0163163_104290422 | 233 |
| 474 | 3300014326 | Ga0157380_10207632 | Ga0157380_102076322 | 233 |
| 475 | 3300014745 | Ga0157377_10204491 | Ga0157377_102044912 | 233 |
| 476 | 3300021320 | Ga0214544_1000006 | Ga0214544_1000006362 | 233 |
| 477 | 3300021321 | Ga0214542_1000002 | Ga0214542_100000212 | 233 |
| 478 | 3300021324 | Ga0214545_1000002 | Ga0214545_1000002707 | 233 |
| 479 | 3300021327 | Ga0214543_1000017 | Ga0214543_1000017310 | 233 |
| 480 | 3300025230 | Ga0209563_105456 | Ga0209563_1054562 | 233 |
| 481 | 3300025253 | Ga0209677_109696 | Ga0209677_1096961 | 233 |
| 482 | 3300025253 | Ga0209677_110235 | Ga0209677_1102352 | 233 |
| 483 | 3300025273 | Ga0209673_1038688 | Ga0209673_10386882 | 233 |
| 484 | 3300025295 | Ga0209564_1003910 | Ga0209564_10039107 | 233 |
| 485 | 3300025297 | Ga0209758_1002429 | Ga0209758_100242911 | 233 |
| 486 | 3300025297 | Ga0209758_1003622 | Ga0209758_10036226 | 233 |
| 487 | 3300025297 | Ga0209758_1022116 | Ga0209758_10221163 | 233 |
| 488 | 3300025299 | Ga0209256_1011253 | Ga0209256_10112536 | 233 |
| 489 | 3300025302 | Ga0207426_1000554 | Ga0207426_10005549 | 233 |
| 490 | 3300025302 | Ga0207426_1000561 | Ga0207426_100056130 | 233 |
| 491 | 3300025302 | Ga0207426_1002946 | Ga0207426_10029466 | 233 |
| 492 | 3300025302 | Ga0207426_1025498 | Ga0207426_10254983 | 233 |
| 493 | 3300025304 | Ga0209257_1016614 | Ga0209257_10166143 | 233 |
| 494 | 3300025304 | Ga0209257_1034974 | Ga0209257_10349741 | 233 |
| 495 | 3300025304 | Ga0209257_1051630 | Ga0209257_10516301 | 233 |
| 496 | 3300025321 | Ga0207656_10006228 | Ga0207656_100062282 | 233 |
| 497 | 3300025885 | Ga0207653_10021834 | Ga0207653_100218341 | 233 |
| 498 | 3300025899 | Ga0207642_10288260 | Ga0207642_102882601 | 233 |
| 499 | 3300025900 | Ga0207710_10021248 | Ga0207710_100212483 | 233 |
| 500 | 3300025901 | Ga0207688_10006431 | Ga0207688_100064312 | 233 |
| 501 | 3300025903 | Ga0207680_10126979 | Ga0207680_101269792 | 233 |
| 502 | 3300025904 | Ga0207647_10034768 | Ga0207647_100347682 | 233 |
| 503 | 3300025905 | Ga0207685_10044592 | Ga0207685_100445922 | 233 |
| 504 | 3300025910 | Ga0207684_10416237 | Ga0207684_104162372 | 233 |
| 505 | 3300025911 | Ga0207654_10095614 | Ga0207654_100956142 | 233 |
| 506 | 3300025911 | Ga0207654_10194886 | Ga0207654_101948862 | 233 |
| 507 | 3300025912 | Ga0207707_10000651 | Ga0207707_1000065115 | 233 |
| 508 | 3300025912 | Ga0207707_10003041 | Ga0207707_1000304110 | 233 |
| 509 | 3300025913 | Ga0207695_10000029 | Ga0207695_1000002939 | 233 |
| 510 | 3300025914 | Ga0207671_10060773 | Ga0207671_100607732 | 233 |
| 511 | 3300025914 | Ga0207671_10091814 | Ga0207671_100918142 | 233 |
| 512 | 3300025917 | Ga0207660_10010504 | Ga0207660_100105045 | 233 |
| 513 | 3300025917 | Ga0207660_10090240 | Ga0207660_100902403 | 233 |
| 514 | 3300025917 | Ga0207660_10122975 | Ga0207660_101229752 | 233 |
| 515 | 3300025917 | Ga0207660_10589950 | Ga0207660_105899501 | 233 |
| 516 | 3300025919 | Ga0207657_10009798 | Ga0207657_100097983 | 233 |
| 517 | 3300025921 | Ga0207652_10002746 | Ga0207652_1000274612 | 233 |
| 518 | 3300025921 | Ga0207652_10009136 | Ga0207652_100091363 | 233 |
| 519 | 3300025924 | Ga0207694_10012382 | Ga0207694_100123824 | 233 |
| 520 | 3300025924 | Ga0207694_10125630 | Ga0207694_101256302 | 233 |
| 521 | 3300025924 | Ga0207694_10269767 | Ga0207694_102697672 | 233 |
| 522 | 3300025926 | Ga0207659_10711480 | Ga0207659_107114801 | 233 |
| 523 | 3300025928 | Ga0207700_10042530 | Ga0207700_100425302 | 233 |
| 524 | 3300025929 | Ga0207664_10069205 | Ga0207664_100692054 | 233 |
| 525 | 3300025929 | Ga0207664_10303249 | Ga0207664_103032491 | 233 |
| 526 | 3300025932 | Ga0207690_10087143 | Ga0207690_100871432 | 233 |
| 527 | 3300025932 | Ga0207690_10237875 | Ga0207690_102378752 | 233 |
| 528 | 3300025933 | Ga0207706_10551840 | Ga0207706_105518402 | 233 |
| 529 | 3300025934 | Ga0207686_10261035 | Ga0207686_102610352 | 233 |
| 530 | 3300025934 | Ga0207686_10319646 | Ga0207686_103196462 | 233 |
| 531 | 3300025937 | Ga0207669_10509925 | Ga0207669_105099251 | 233 |
| 532 | 3300025938 | Ga0207704_10144127 | Ga0207704_101441273 | 233 |
| 533 | 3300025939 | Ga0207665_10473251 | Ga0207665_104732512 | 233 |
| 534 | 3300025941 | Ga0207711_10198030 | Ga0207711_101980301 | 233 |
| 535 | 3300025941 | Ga0207711_10202717 | Ga0207711_102027172 | 233 |
| 536 | 3300025942 | Ga0207689_10163744 | Ga0207689_101637442 | 233 |
| 537 | 3300025944 | Ga0207661_10073974 | Ga0207661_100739742 | 233 |
| 538 | 3300025944 | Ga0207661_10350829 | Ga0207661_103508292 | 233 |
| 539 | 3300025945 | Ga0207679_10266034 | Ga0207679_102660342 | 233 |
| 540 | 3300025949 | Ga0207667_10282458 | Ga0207667_102824581 | 233 |
| 541 | 3300025961 | Ga0207712_10209129 | Ga0207712_102091292 | 233 |
| 542 | 3300025972 | Ga0207668_10046894 | Ga0207668_100468943 | 233 |
| 543 | 3300025972 | Ga0207668_10137309 | Ga0207668_101373092 | 233 |
| 544 | 3300025972 | Ga0207668_10159620 | Ga0207668_101596202 | 233 |
| 545 | 3300025981 | Ga0207640_10176400 | Ga0207640_101764002 | 233 |
| 546 | 3300025981 | Ga0207640_10245816 | Ga0207640_102458161 | 233 |
| 547 | 3300025986 | Ga0207658_10156458 | Ga0207658_101564582 | 233 |
| 548 | 3300026023 | Ga0207677_10137085 | Ga0207677_101370852 | 233 |
| 549 | 3300026023 | Ga0207677_10210359 | Ga0207677_102103591 | 233 |
| 550 | 3300026035 | Ga0207703_10351452 | Ga0207703_103514522 | 233 |
| 551 | 3300026041 | Ga0207639_10016887 | Ga0207639_100168872 | 233 |
| 552 | 3300026041 | Ga0207639_10221559 | Ga0207639_102215592 | 233 |
| 553 | 3300026041 | Ga0207639_10499882 | Ga0207639_104998822 | 233 |
| 554 | 3300026067 | Ga0207678_10069743 | Ga0207678_100697433 | 233 |
| 555 | 3300026067 | Ga0207678_10183305 | Ga0207678_101833052 | 233 |
| 556 | 3300026075 | Ga0207708_10164478 | Ga0207708_101644782 | 233 |
| 557 | 3300026075 | Ga0207708_10282753 | Ga0207708_102827531 | 233 |
| 558 | 3300026078 | Ga0207702_10000081 | Ga0207702_10000081114 | 233 |
| 559 | 3300026078 | Ga0207702_10170274 | Ga0207702_101702742 | 233 |
| 560 | 3300026088 | Ga0207641_10783844 | Ga0207641_107838442 | 233 |
| 561 | 3300026089 | Ga0207648_10097768 | Ga0207648_100977683 | 233 |
| 562 | 3300026089 | Ga0207648_10546069 | Ga0207648_105460691 | 233 |
| 563 | 3300026095 | Ga0207676_10319315 | Ga0207676_103193152 | 233 |
| 564 | 3300026116 | Ga0207674_10077170 | Ga0207674_100771702 | 233 |
| 565 | 3300026116 | Ga0207674_10198565 | Ga0207674_101985652 | 233 |
| 566 | 3300026118 | Ga0207675_100215702 | Ga0207675_1002157022 | 233 |
| 567 | 3300026142 | Ga0207698_10155529 | Ga0207698_101555292 | 233 |
| 568 | 3300027671 | Ga0209588_1097887 | Ga0209588_10978871 | 233 |
| 569 | 3300028379 | Ga0268266_10033130 | Ga0268266_100331301 | 233 |
| 570 | 3300028379 | Ga0268266_10158615 | Ga0268266_101586151 | 233 |
| 571 | 3300028379 | Ga0268266_10179360 | Ga0268266_101793602 | 233 |
| 572 | 3300028380 | Ga0268265_10029366 | Ga0268265_100293665 | 233 |
| 573 | 3300028380 | Ga0268265_10224043 | Ga0268265_102240432 | 233 |
| 574 | 3300028380 | Ga0268265_10266094 | Ga0268265_102660942 | 233 |
| 575 | 3300028381 | Ga0268264_10125311 | Ga0268264_101253112 | 233 |
| 576 | 3300031235 | Ga0265330_10020621 | Ga0265330_100206214 | 233 |
| 577 | 3300031238 | Ga0265332_10011685 | Ga0265332_100116853 | 233 |
| 578 | 3300031247 | Ga0265340_10001013 | Ga0265340_100010134 | 233 |
| 579 | 3300031247 | Ga0265340_10192352 | Ga0265340_101923521 | 233 |
| 580 | 3300031249 | Ga0265339_10001466 | Ga0265339_100014668 | 233 |
| 581 | 3300031249 | Ga0265339_10207486 | Ga0265339_102074861 | 233 |
| 582 | 3300031548 | Ga0307408_100271564 | Ga0307408_1002715642 | 233 |
| 583 | 3300031711 | Ga0265314_10043780 | Ga0265314_100437803 | 233 |
| 584 | 3300031730 | Ga0307516_10012214 | Ga0307516_100122146 | 233 |
| 585 | 3300031731 | Ga0307405_10254792 | Ga0307405_102547922 | 233 |
| 586 | 3300031889 | Ga0326468_10004453 | Ga0326468_100044531 | 233 |
| 587 | 3300031911 | Ga0307412_10330192 | Ga0307412_103301922 | 233 |
| 588 | 3300032005 | Ga0307411_10076597 | Ga0307411_100765972 | 233 |
| 589 | 3300032126 | Ga0307415_100242030 | Ga0307415_1002420301 | 233 |
| 590 | 3300033180 | Ga0307510_10122729 | Ga0307510_101227294 | 233 |
| 591 | 3300033180 | Ga0307510_10339700 | Ga0307510_103397001 | 233 |
| 592 | 3300034816 | Ga0373930_0017264 | Ga0373930_0017264_610_1311 | 233 |
| 593 | 3300035089 | Ga0373944_0067857 | Ga0373944_0067857_324_1025 | 233 |
| 594 | 3300035092 | Ga0373952_0007593 | Ga0373952_0007593_1197_1898 | 233 |
| 595 | 3300035116 | Ga0373945_0004658 | Ga0373945_0004658_3208_3909 | 233 |
| 596 | 3300035116 | Ga0373945_0014225 | Ga0373945_0014225_127_828 | 233 |
| 597 | 3300035117 | Ga0373953_0097503 | Ga0373953_0097503_500_1201 | 233 |
| 598 | 3300035118 | Ga0373954_0052354 | Ga0373954_0052354_513_1214 | 233 |
| 599 | 3300035118 | Ga0373954_0099021 | Ga0373954_0099021_437_1138 | 233 |
| 600 | 3300035119 | Ga0373956_0014527 | Ga0373956_0014527_467_1168 | 233 |
| 601 | 3300035120 | Ga0373957_0026516 | Ga0373957_0026516_867_1568 | 233 |
| 602 | 3300035170 | Ga0373943_0072512 | Ga0373943_0072512_338_1039 | 233 |
| 603 | 3300035171 | Ga0373946_0010036 | Ga0373946_0010036_135_836 | 233 |
| 604 | 3300035171 | Ga0373946_0024734 | Ga0373946_0024734_907_1608 | 233 |
| 605 | 3300035172 | Ga0373955_0036800 | Ga0373955_0036800_1683_2384 | 233 |
| 606 | 3300035410 | Ga0373924_0037707 | Ga0373924_0037707_908_1609 | 233 |
| 607 | 3300035410 | Ga0373924_0114045 | Ga0373924_0114045_65_766 | 233 |
| 608 | 3300035692 | Ga0373935_0014439 | Ga0373935_0014439_728_1429 | 233 |
| 609 | 3300035692 | Ga0373935_0376978 | Ga0373935_0376978_251_952 | 233 |
| 610 | 3300035695 | Ga0373927_0000308 | Ga0373927_0000308_36775_37476 | 233 |
| 611 | 3300035695 | Ga0373927_0017790 | Ga0373927_0017790_2260_2961 | 233 |
| 612 | 3300035695 | Ga0373927_0041318 | Ga0373927_0041318_1920_2621 | 233 |
| 613 | 3300035695 | Ga0373927_0121267 | Ga0373927_0121267_783_1484 | 233 |
| 614 | 3300035695 | Ga0373927_0433870 | Ga0373927_0433870_26_727 | 233 |
| 615 | 3300035724 | Ga0373933_0000167 | Ga0373933_0000167_22904_23605 | 233 |
| 616 | 3300035724 | Ga0373933_0131148 | Ga0373933_0131148_226_927 | 233 |
| 617 | 3300035724 | Ga0373933_0355857 | Ga0373933_0355857_239_940 | 233 |
| 618 | 3300035725 | Ga0373947_0005045 | Ga0373947_0005045_439_1140 | 233 |
| 619 | 3300035725 | Ga0373947_0207985 | Ga0373947_0207985_391_1092 | 233 |
| 620 | 3300036401 | Ga0373937_0032925 | Ga0373937_0032925_379_1080 | 233 |
| 621 | 3300036401 | Ga0373937_0111275 | Ga0373937_0111275_1123_1824 | 233 |
| 622 | 3300036401 | Ga0373937_0468026 | Ga0373937_0468026_287_988 | 233 |
| 623 | 3300036401 | Ga0373937_0577469 | Ga0373937_0577469_344_1045 | 233 |
| 624 | 3300037068 | Ga0373925_0011523 | Ga0373925_0011523_2354_3055 | 233 |
| 625 | 3300037068 | Ga0373925_0057967 | Ga0373925_0057967_624_1325 | 233 |
| 626 | 3300037068 | Ga0373925_0450282 | Ga0373925_0450282_314_1015 | 233 |
| 627 | 3300037466 | Ga0395898_0202367 | Ga0395898_0202367_508_1209 | 233 |
| 628 | 3300037471 | Ga0395905_0007709 | Ga0395905_0007709_112_813 | 233 |
| 629 | 3300038443 | Ga0395901_0100247 | Ga0395901_0100247_633_1334 | 233 |
| 630 | 3300039437 | Ga0436365_0839146 | Ga0436365_0839146_68_769 | 233 |
| 631 | 3300041441 | Ga0451787_806274 | Ga0451787_806274_13_714 | 233 |
| 632 | 3300041512 | Ga0451853_1239521 | Ga0451853_1239521_73_774 | 233 |
| 633 | 3300044656 | Ga0466969_0014160 | Ga0466969_0014160_3056_3757 | 233 |
| 634 | 3300044684 | Ga0466966_0000148 | Ga0466966_0000148_35160_35861 | 233 |
| 635 | 3300044693 | Ga0466961_0000045 | Ga0466961_0000045_66502_67203 | 233 |
| 636 | 3300045049 | Ga0466959_0003014 | Ga0466959_0003014_2548_3249 | 233 |
| 637 | 3300045836 | Ga0466958_0114633 | Ga0466958_0114633_673_1374 | 233 |
| 638 | 3300046454 | Ga0495592_0010346 | Ga0495592_0010346_1278_1979 | 233 |
| 639 | 3300046454 | Ga0495592_0027945 | Ga0495592_0027945_1711_2412 | 233 |
| 640 | 3300046454 | Ga0495592_0028244 | Ga0495592_0028244_676_1377 | 233 |
| 641 | 3300046454 | Ga0495592_0123676 | Ga0495592_0123676_608_1309 | 233 |
| 642 | 3300046455 | Ga0495603_0000229 | Ga0495603_0000229_20030_20731 | 233 |
| 643 | 3300046459 | Ga0495629_0000170 | Ga0495629_0000170_9643_10344 | 233 |
| 644 | 3300046459 | Ga0495629_0384355 | Ga0495629_0384355_234_935 | 233 |
| 645 | 3300046459 | Ga0495629_0401755 | Ga0495629_0401755_38_739 | 233 |
| 646 | 3300046460 | Ga0495638_0044353 | Ga0495638_0044353_1848_2549 | 233 |
| 647 | 3300046462 | Ga0495651_0000472 | Ga0495651_0000472_18325_19041 | 233 |
| 648 | 3300046462 | Ga0495651_0023589 | Ga0495651_0023589_2177_2878 | 233 |
| 649 | 3300046462 | Ga0495651_0265358 | Ga0495651_0265358_318_1019 | 233 |
| 650 | 3300046463 | Ga0495653_0039871 | Ga0495653_0039871_2382_3098 | 233 |
| 651 | 3300046463 | Ga0495653_0124868 | Ga0495653_0124868_1016_1717 | 233 |
| 652 | 3300046463 | Ga0495653_0222213 | Ga0495653_0222213_502_1203 | 233 |
| 653 | 3300046472 | Ga0495580_0006642 | Ga0495580_0006642_1354_2055 | 233 |
| 654 | 3300046472 | Ga0495580_0030917 | Ga0495580_0030917_2344_3045 | 233 |
| 655 | 3300046473 | Ga0495582_0000053 | Ga0495582_0000053_6726_7427 | 233 |
| 656 | 3300046473 | Ga0495582_0040602 | Ga0495582_0040602_908_1609 | 233 |
| 657 | 3300046474 | Ga0495605_0084319 | Ga0495605_0084319_68_769 | 233 |
| 658 | 3300046475 | Ga0495639_0000057 | Ga0495639_0000057_21781_22482 | 233 |
| 659 | 3300046475 | Ga0495639_0040997 | Ga0495639_0040997_47_748 | 233 |
| 660 | 3300046475 | Ga0495639_0099981 | Ga0495639_0099981_537_1238 | 233 |
| 661 | 3300046475 | Ga0495639_0123940 | Ga0495639_0123940_476_1177 | 233 |
| 662 | 3300046476 | Ga0495662_0002078 | Ga0495662_0002078_8979_9680 | 233 |
| 663 | 3300046476 | Ga0495662_0079133 | Ga0495662_0079133_32_748 | 233 |
| 664 | 3300046476 | Ga0495662_0083641 | Ga0495662_0083641_432_1133 | 233 |
| 665 | 3300046477 | Ga0495664_0006777 | Ga0495664_0006777_5212_5913 | 233 |
| 666 | 3300046477 | Ga0495664_0212209 | Ga0495664_0212209_411_1112 | 233 |
| 667 | 3300046492 | Ga0495585_0217851 | Ga0495585_0217851_240_941 | 233 |
| 668 | 3300046499 | Ga0495594_0000460 | Ga0495594_0000460_10172_10873 | 233 |
| 669 | 3300046507 | Ga0495606_0005996 | Ga0495606_0005996_4888_5589 | 233 |
| 670 | 3300046507 | Ga0495606_0237708 | Ga0495606_0237708_81_782 | 233 |
| 671 | 3300046511 | Ga0495608_0018937 | Ga0495608_0018937_93_809 | 233 |
| 672 | 3300046514 | Ga0495618_0075509 | Ga0495618_0075509_1367_2068 | 233 |
| 673 | 3300046516 | Ga0495628_0242716 | Ga0495628_0242716_87_803 | 233 |
| 674 | 3300046517 | Ga0495630_0001122 | Ga0495630_0001122_17102_17803 | 233 |
| 675 | 3300046517 | Ga0495630_0148560 | Ga0495630_0148560_823_1524 | 233 |
| 676 | 3300046517 | Ga0495630_0374557 | Ga0495630_0374557_201_902 | 233 |
| 677 | 3300046518 | Ga0495631_0226238 | Ga0495631_0226238_49_750 | 233 |
| 678 | 3300046519 | Ga0495632_0113571 | Ga0495632_0113571_469_1170 | 233 |
| 679 | 3300046522 | Ga0495643_0029296 | Ga0495643_0029296_2153_2854 | 233 |
| 680 | 3300046522 | Ga0495643_0131192 | Ga0495643_0131192_19_720 | 233 |
| 681 | 3300046524 | Ga0495648_0003889 | Ga0495648_0003889_515_1216 | 233 |
| 682 | 3300046524 | Ga0495648_0003979 | Ga0495648_0003979_4230_4931 | 233 |
| 683 | 3300046524 | Ga0495648_0299501 | Ga0495648_0299501_24_725 | 233 |
| 684 | 3300046526 | Ga0495666_0071074 | Ga0495666_0071074_321_1022 | 233 |
| 685 | 3300046526 | Ga0495666_0254182 | Ga0495666_0254182_42_743 | 233 |
| 686 | 3300046529 | Ga0495652_0001339 | Ga0495652_0001339_18900_19616 | 233 |
| 687 | 3300046529 | Ga0495652_0006658 | Ga0495652_0006658_6521_7222 | 233 |
| 688 | 3300046529 | Ga0495652_0125363 | Ga0495652_0125363_844_1545 | 233 |
| 689 | 3300046531 | Ga0495665_0000197 | Ga0495665_0000197_10184_10885 | 233 |
| 690 | 3300046533 | Ga0495640_0021032 | Ga0495640_0021032_2840_3556 | 233 |
| 691 | 3300046536 | Ga0495587_0040242 | Ga0495587_0040242_1373_2089 | 233 |
| 692 | 3300046536 | Ga0495587_0053040 | Ga0495587_0053040_134_835 | 233 |
| 693 | 3300046538 | Ga0495609_0097413 | Ga0495609_0097413_558_1259 | 233 |
| 694 | 3300046543 | Ga0495645_0011359 | Ga0495645_0011359_1981_2682 | 233 |
| 695 | 3300046543 | Ga0495645_0024020 | Ga0495645_0024020_726_1427 | 233 |
| 696 | 3300046543 | Ga0495645_0080421 | Ga0495645_0080421_586_1302 | 233 |
| 697 | 3300046557 | Ga0495622_0005868 | Ga0495622_0005868_1632_2333 | 233 |
| 698 | 3300046557 | Ga0495622_0180853 | Ga0495622_0180853_198_899 | 233 |
| 699 | 3300046558 | Ga0495633_0211818 | Ga0495633_0211818_117_818 | 233 |
| 700 | 3300046559 | Ga0495667_0007621 | Ga0495667_0007621_3084_3800 | 233 |
| 701 | 3300046559 | Ga0495667_0076163 | Ga0495667_0076163_1375_2076 | 233 |
| 702 | 3300046616 | Ga0495668_0024598 | Ga0495668_0024598_450_1151 | 233 |
| 703 | 3300046642 | Ga0495634_0001079 | Ga0495634_0001079_9859_10560 | 233 |
| 704 | 3300046642 | Ga0495634_0013513 | Ga0495634_0013513_4225_4941 | 233 |
| 705 | 3300046642 | Ga0495634_0038510 | Ga0495634_0038510_2103_2804 | 233 |
| 706 | 3300046642 | Ga0495634_0054064 | Ga0495634_0054064_1268_1969 | 233 |
| 707 | 3300046642 | Ga0495634_0134573 | Ga0495634_0134573_685_1386 | 233 |
| 708 | 3300046648 | Ga0495611_0121658 | Ga0495611_0121658_31_732 | 233 |
| 709 | 3300046660 | Ga0495625_0068527 | Ga0495625_0068527_505_1206 | 233 |
| 710 | 3300046663 | Ga0495635_0000738 | Ga0495635_0000738_20136_20837 | 233 |
| 711 | 3300046663 | Ga0495635_0003199 | Ga0495635_0003199_2207_2908 | 233 |
| 712 | 3300046663 | Ga0495635_0045942 | Ga0495635_0045942_1943_2644 | 233 |
| 713 | 3300046663 | Ga0495635_0074879 | Ga0495635_0074879_125_841 | 233 |
| 714 | 3300046663 | Ga0495635_0101910 | Ga0495635_0101910_1171_1872 | 233 |
| 715 | 3300046665 | Ga0495661_0155262 | Ga0495661_0155262_25_726 | 233 |
| 716 | 3300046674 | Ga0495588_0020306 | Ga0495588_0020306_1464_2165 | 233 |
| 717 | 3300046674 | Ga0495588_0140358 | Ga0495588_0140358_58_759 | 233 |
| 718 | 3300046675 | Ga0495657_0005672 | Ga0495657_0005672_6598_7314 | 233 |
| 719 | 3300046678 | Ga0495599_0117936 | Ga0495599_0117936_118_819 | 233 |
| 720 | 3300046679 | Ga0495623_0024183 | Ga0495623_0024183_324_1040 | 233 |
| 721 | 3300046680 | Ga0495646_0013081 | Ga0495646_0013081_839_1555 | 233 |
| 722 | 3300046680 | Ga0495646_0196454 | Ga0495646_0196454_366_1067 | 233 |
| 723 | 3300046680 | Ga0495646_0259682 | Ga0495646_0259682_26_727 | 233 |
| 724 | 3300046681 | Ga0495647_0007031 | Ga0495647_0007031_2039_2740 | 233 |
| 725 | 3300046681 | Ga0495647_0102394 | Ga0495647_0102394_406_1107 | 233 |
| 726 | 3300046683 | Ga0495658_0000217 | Ga0495658_0000217_18602_19303 | 233 |
| 727 | 3300046689 | Ga0495613_0008961 | Ga0495613_0008961_4327_5028 | 233 |
| 728 | 3300046689 | Ga0495613_0027045 | Ga0495613_0027045_3183_3899 | 233 |
| 729 | 3300046690 | Ga0495624_0000394 | Ga0495624_0000394_6840_7541 | 233 |
| 730 | 3300046690 | Ga0495624_0016604 | Ga0495624_0016604_2143_2844 | 233 |
| 731 | 3300046690 | Ga0495624_0042045 | Ga0495624_0042045_1777_2478 | 233 |
| 732 | 3300046691 | Ga0495670_0138809 | Ga0495670_0138809_349_1050 | 233 |
| 733 | 3300046694 | Ga0495649_0170489 | Ga0495649_0170489_321_1022 | 233 |
| 734 | 3300046809 | Ga0495600_0005855 | Ga0495600_0005855_5819_6520 | 233 |
| 735 | 3300046809 | Ga0495600_0006605 | Ga0495600_0006605_3096_3812 | 233 |
| 736 | 3300046809 | Ga0495600_0078209 | Ga0495600_0078209_1308_2009 | 233 |
| 737 | 3300046810 | Ga0495660_0171581 | Ga0495660_0171581_194_895 | 233 |
| 738 | 3300047315 | Ga0495581_0004436 | Ga0495581_0004436_6865_7566 | 233 |
| 739 | 3300047315 | Ga0495581_0214688 | Ga0495581_0214688_12_716 | 233 |
| 740 | 3300047317 | Ga0495604_0000953 | Ga0495604_0000953_14878_15594 | 233 |
| 741 | 3300047317 | Ga0495604_0017761 | Ga0495604_0017761_3358_4059 | 233 |
| 742 | 3300047317 | Ga0495604_0039800 | Ga0495604_0039800_2352_3053 | 233 |
| 743 | 3300047317 | Ga0495604_0238094 | Ga0495604_0238094_103_804 | 233 |
| 744 | 3300047319 | Ga0495674_0004978 | Ga0495674_0004978_2452_3153 | 233 |
| 745 | 3300047319 | Ga0495674_0008322 | Ga0495674_0008322_930_1646 | 233 |
| 746 | 3300047319 | Ga0495674_0509477 | Ga0495674_0509477_210_923 | 233 |
| 747 | 3300047320 | Ga0495672_0015872 | Ga0495672_0015872_307_1008 | 233 |
| 748 | 3300047321 | Ga0495676_0014964 | Ga0495676_0014964_4372_5073 | 233 |
| 749 | 3300047321 | Ga0495676_0047061 | Ga0495676_0047061_1044_1745 | 233 |
| 750 | 3300047321 | Ga0495676_0054936 | Ga0495676_0054936_462_1163 | 233 |
| 751 | 3300047322 | Ga0495680_0001642 | Ga0495680_0001642_18669_19385 | 233 |
| 752 | 3300047322 | Ga0495680_0098619 | Ga0495680_0098619_76_777 | 233 |
| 753 | 3300047322 | Ga0495680_0161306 | Ga0495680_0161306_194_895 | 233 |
| 754 | 3300047444 | Ga0495675_0093671 | Ga0495675_0093671_343_1059 | 233 |
| 755 | 3300047471 | Ga0495684_0024938 | Ga0495684_0024938_2425_3126 | 233 |
| 756 | 3300047471 | Ga0495684_0053583 | Ga0495684_0053583_1391_2107 | 233 |
| 757 | 3300047471 | Ga0495684_0109772 | Ga0495684_0109772_1078_1779 | 233 |
| 758 | 3300047472 | Ga0495686_0253536 | Ga0495686_0253536_242_943 | 233 |
| 759 | 3300047673 | Ga0495593_0002757 | Ga0495593_0002757_8714_9415 | 233 |
| 760 | 3300047673 | Ga0495593_0015866 | Ga0495593_0015866_1648_2349 | 233 |
| 761 | 3300048088 | Ga0495602_0389292 | Ga0495602_0389292_122_823 | 233 |
| 762 | 3300048089 | Ga0495614_0091285 | Ga0495614_0091285_550_1251 | 233 |
| 763 | 3300048903 | Ga0496100_0319100 | Ga0496100_0319100_390_1091 | 233 |
| 764 | 3300048904 | Ga0496101_0065804 | Ga0496101_0065804_1816_2517 | 233 |
| 765 | 3300048904 | Ga0496101_0090109 | Ga0496101_0090109_1451_2152 | 233 |
| 766 | 3300048904 | Ga0496101_0109387 | Ga0496101_0109387_933_1634 | 233 |
| 767 | 3300048905 | Ga0496102_0064657 | Ga0496102_0064657_886_1587 | 233 |
| 768 | 3300048905 | Ga0496102_0201037 | Ga0496102_0201037_489_1190 | 233 |
| 769 | 3300048906 | Ga0496103_0027762 | Ga0496103_0027762_200_901 | 233 |
| 770 | 3300048906 | Ga0496103_0066527 | Ga0496103_0066527_1478_2179 | 233 |
| 771 | 3300048906 | Ga0496103_0078239 | Ga0496103_0078239_165_866 | 233 |
| 772 | 3300048906 | Ga0496103_0169812 | Ga0496103_0169812_566_1267 | 233 |
| 773 | 3300048907 | Ga0496104_0078088 | Ga0496104_0078088_388_1089 | 233 |
| 774 | 3300048907 | Ga0496104_0240491 | Ga0496104_0240491_250_951 | 233 |
| 775 | 3300048907 | Ga0496104_0386154 | Ga0496104_0386154_523_1224 | 233 |
| 776 | 3300048908 | Ga0496105_0037440 | Ga0496105_0037440_1844_2545 | 233 |
| 777 | 3300048908 | Ga0496105_0040337 | Ga0496105_0040337_1769_2470 | 233 |
| 778 | 3300048908 | Ga0496105_0436935 | Ga0496105_0436935_323_1024 | 233 |
| 779 | 3300048909 | Ga0496106_0124135 | Ga0496106_0124135_163_864 | 233 |
| 780 | 3300048909 | Ga0496106_0315095 | Ga0496106_0315095_234_935 | 233 |
| 781 | 3300048909 | Ga0496106_0685904 | Ga0496106_0685904_56_757 | 233 |
| 782 | 3300048910 | Ga0496107_0038935 | Ga0496107_0038935_740_1441 | 233 |
| 783 | 3300048910 | Ga0496107_0337572 | Ga0496107_0337572_168_869 | 233 |
| 784 | 3300048911 | Ga0496108_0015476 | Ga0496108_0015476_543_1244 | 233 |
| 785 | 3300048911 | Ga0496108_0116701 | Ga0496108_0116701_771_1472 | 233 |
| 786 | 3300048911 | Ga0496108_0213485 | Ga0496108_0213485_635_1336 | 233 |
| 787 | 3300048912 | Ga0496109_0613430 | Ga0496109_0613430_263_964 | 233 |
| 788 | 3300048913 | Ga0496110_0067716 | Ga0496110_0067716_2096_2797 | 233 |
| 789 | 3300048913 | Ga0496110_0074209 | Ga0496110_0074209_176_877 | 233 |
| 790 | 3300048913 | Ga0496110_0090694 | Ga0496110_0090694_878_1579 | 233 |
| 791 | 3300048913 | Ga0496110_0132515 | Ga0496110_0132515_1378_2079 | 233 |
| 792 | 3300048914 | Ga0496111_0110305 | Ga0496111_0110305_57_758 | 233 |
| 793 | 3300048914 | Ga0496111_0558727 | Ga0496111_0558727_119_820 | 233 |
| 794 | 3300048914 | Ga0496111_0658788 | Ga0496111_0658788_34_735 | 233 |
| 795 | 3300048915 | Ga0496112_0000016 | Ga0496112_0000016_85806_86507 | 233 |
| 796 | 3300048915 | Ga0496112_0042140 | Ga0496112_0042140_418_1119 | 233 |
| 797 | 3300048915 | Ga0496112_0151402 | Ga0496112_0151402_1318_2019 | 233 |
| 798 | 3300048915 | Ga0496112_0271389 | Ga0496112_0271389_669_1370 | 233 |
| 799 | 3300048915 | Ga0496112_0321199 | Ga0496112_0321199_538_1239 | 233 |
| 800 | 3300048916 | Ga0496113_0027119 | Ga0496113_0027119_933_1634 | 233 |
| 801 | 3300048916 | Ga0496113_0063686 | Ga0496113_0063686_57_758 | 233 |
| 802 | 3300048916 | Ga0496113_0149844 | Ga0496113_0149844_776_1477 | 233 |
| 803 | 3300048916 | Ga0496113_0554159 | Ga0496113_0554159_141_842 | 233 |
| 804 | 3300048917 | Ga0496114_0134105 | Ga0496114_0134105_1391_2092 | 233 |
| 805 | 3300048917 | Ga0496114_0207996 | Ga0496114_0207996_166_867 | 233 |
| 806 | 3300048918 | Ga0496115_0068284 | Ga0496115_0068284_658_1359 | 233 |
| 807 | 3300048918 | Ga0496115_0225860 | Ga0496115_0225860_649_1350 | 233 |
| 808 | 3300048919 | Ga0496116_0102580 | Ga0496116_0102580_353_1054 | 233 |
| 809 | 3300048919 | Ga0496116_0174117 | Ga0496116_0174117_316_1035 | 233 |
| 810 | 3300048920 | Ga0496117_0042466 | Ga0496117_0042466_1770_2489 | 233 |
| 811 | 3300048920 | Ga0496117_0116534 | Ga0496117_0116534_430_1167 | 233 |
| 812 | 3300048920 | Ga0496117_0275281 | Ga0496117_0275281_17_718 | 233 |
| 813 | 3300048921 | Ga0496118_0021551 | Ga0496118_0021551_2007_2726 | 233 |
| 814 | 3300048921 | Ga0496118_0343118 | Ga0496118_0343118_65_766 | 233 |
| 815 | 3300048922 | Ga0496119_0056679 | Ga0496119_0056679_1313_2014 | 233 |
| 816 | 3300048923 | Ga0496120_0246339 | Ga0496120_0246339_53_790 | 233 |
| 817 | 3300048924 | Ga0496121_0001443 | Ga0496121_0001443_22496_23215 | 233 |
| 818 | 3300048924 | Ga0496121_0032132 | Ga0496121_0032132_384_1085 | 233 |
| 819 | 3300048924 | Ga0496121_0080247 | Ga0496121_0080247_377_1078 | 233 |
| 820 | 3300048924 | Ga0496121_0157224 | Ga0496121_0157224_867_1568 | 233 |
| 821 | 3300048924 | Ga0496121_0247362 | Ga0496121_0247362_450_1151 | 233 |
| 822 | 3300048927 | Ga0496124_0002203 | Ga0496124_0002203_2259_2978 | 233 |
| 823 | 3300048927 | Ga0496124_0059503 | Ga0496124_0059503_1087_1839 | 233 |
| 824 | 3300048927 | Ga0496124_0258264 | Ga0496124_0258264_556_1257 | 233 |
| 825 | 3300048928 | Ga0496125_0052963 | Ga0496125_0052963_887_1606 | 233 |
| 826 | 3300048928 | Ga0496125_0094966 | Ga0496125_0094966_1412_2164 | 233 |
| 827 | 3300048928 | Ga0496125_0339978 | Ga0496125_0339978_98_799 | 233 |
| 828 | 3300048929 | Ga0496126_0006684 | Ga0496126_0006684_1837_2556 | 233 |
| 829 | 3300048929 | Ga0496126_0039188 | Ga0496126_0039188_2518_3219 | 233 |
| 830 | 3300048929 | Ga0496126_0158878 | Ga0496126_0158878_1213_1914 | 233 |
| 831 | 3300048929 | Ga0496126_0185158 | Ga0496126_0185158_786_1487 | 233 |
| 832 | 3300048929 | Ga0496126_0205651 | Ga0496126_0205651_447_1148 | 233 |
| 833 | 3300048929 | Ga0496126_0257761 | Ga0496126_0257761_428_1129 | 233 |
| 834 | 3300048929 | Ga0496126_0317843 | Ga0496126_0317843_467_1222 | 233 |
| 835 | 3300048929 | Ga0496126_0469135 | Ga0496126_0469135_40_741 | 233 |
| 836 | 3300048929 | Ga0496126_0543136 | Ga0496126_0543136_107_808 | 233 |
| 837 | 3300049460 | Ga0495682_0010078 | Ga0495682_0010078_2353_3054 | 233 |
| 838 | 3300049568 | Ga0501031_0000392 | Ga0501031_0000392_17511_18212 | 233 |
| 839 | 3300049569 | Ga0501032_0000224 | Ga0501032_0000224_18583_19284 | 233 |
| 840 | 3300049570 | Ga0501033_0000095 | Ga0501033_0000095_15094_15795 | 233 |
| 841 | 3300049570 | Ga0501033_0039437 | Ga0501033_0039437_1584_2285 | 233 |
| 842 | 3300049571 | Ga0501034_0001606 | Ga0501034_0001606_10883_11584 | 233 |
| 843 | 3300049572 | Ga0501036_0000007 | Ga0501036_0000007_77800_78501 | 233 |
| 844 | 3300049572 | Ga0501036_0083706 | Ga0501036_0083706_23_724 | 233 |
| 845 | 3300049573 | Ga0501037_0000159 | Ga0501037_0000159_40891_41592 | 233 |
| 846 | 3300049573 | Ga0501037_0102481 | Ga0501037_0102481_721_1422 | 233 |
| 847 | 3300049574 | Ga0501038_0000028 | Ga0501038_0000028_21977_22678 | 233 |
| 848 | 3300049574 | Ga0501038_0480427 | Ga0501038_0480427_117_818 | 233 |
| 849 | 3300049575 | Ga0501039_0000005 | Ga0501039_0000005_173690_174391 | 233 |
| 850 | 3300049577 | Ga0501041_0100216 | Ga0501041_0100216_445_1161 | 233 |
| 851 | 3300049579 | Ga0501043_0000127 | Ga0501043_0000127_17464_18165 | 233 |
| 852 | 3300049579 | Ga0501043_0007172 | Ga0501043_0007172_7448_8149 | 233 |
| 853 | 3300049580 | Ga0501046_0000032 | Ga0501046_0000032_120633_121334 | 233 |
| 854 | 3300049581 | Ga0501047_0000077 | Ga0501047_0000077_77692_78393 | 233 |
| 855 | 3300049581 | Ga0501047_0221890 | Ga0501047_0221890_732_1433 | 233 |
| 856 | 3300049582 | Ga0501048_0000693 | Ga0501048_0000693_11042_11743 | 233 |
| 857 | 3300049583 | Ga0501067_0002698 | Ga0501067_0002698_2221_2922 | 233 |
| 858 | 3300049584 | Ga0501068_0575651 | Ga0501068_0575651_22_723 | 233 |
| 859 | 3300049586 | Ga0501070_0000070 | Ga0501070_0000070_20964_21665 | 233 |
| 860 | 3300049586 | Ga0501070_0170080 | Ga0501070_0170080_680_1381 | 233 |
| 861 | 3300049588 | Ga0501072_0360152 | Ga0501072_0360152_334_1035 | 233 |
| 862 | 3300049589 | Ga0501073_0002706 | Ga0501073_0002706_7194_7895 | 233 |
| 863 | 3300049590 | Ga0501074_0000302 | Ga0501074_0000302_10947_11648 | 233 |
| 864 | 3300049741 | Ga0501079_0749853 | Ga0501079_0749853_23_724 | 233 |
| 865 | 3300049742 | Ga0501080_0000035 | Ga0501080_0000035_14271_14972 | 233 |
| 866 | 3300049822 | Ga0501035_0000016 | Ga0501035_0000016_115673_116374 | 233 |
| 867 | 3300049822 | Ga0501035_0017185 | Ga0501035_0017185_5402_6103 | 233 |
| 868 | 3300049822 | Ga0501035_0436005 | Ga0501035_0436005_247_963 | 233 |
| 869 | 3300049823 | Ga0501044_0000184 | Ga0501044_0000184_59635_60336 | 233 |
| 870 | 3300049823 | Ga0501044_0003221 | Ga0501044_0003221_11514_12215 | 233 |
| 871 | 3300049824 | Ga0501045_0056317 | Ga0501045_0056317_1920_2621 | 233 |
| 872 | 3300050492 | nmdc:mga0yw44_127073_c1 | nmdc:mga0yw44_127073_c1_574_1275 | 233 |
| 873 | 3300050492 | nmdc:mga0yw44_243984_c1 | nmdc:mga0yw44_243984_c1_118_819 | 233 |
| 874 | 3300050493 | nmdc:mga0k408_62049_c1 | nmdc:mga0k408_62049_c1_189_890 | 233 |
| 875 | 3300050493 | nmdc:mga0k408_66887_c1 | nmdc:mga0k408_66887_c1_961_1662 | 233 |
| 876 | 3300050494 | nmdc:mga06z11_228155_c1 | nmdc:mga06z11_228155_c1_47_748 | 233 |
| 877 | 3300050494 | nmdc:mga06z11_326899_c1 | nmdc:mga06z11_326899_c1_123_863 | 233 |
| 878 | 3300050496 | nmdc:mga07m45_64176_c1 | nmdc:mga07m45_64176_c1_549_1250 | 233 |
| 879 | 3300050496 | nmdc:mga07m45_85363_c1 | nmdc:mga07m45_85363_c1_299_1000 | 233 |
| 880 | 3300050496 | nmdc:mga07m45_93490_c1 | nmdc:mga07m45_93490_c1_394_1095 | 233 |
| 881 | 3300050507 | nmdc:mga05p37_212739_c1 | nmdc:mga05p37_212739_c1_834_1535 | 233 |
| 882 | 3300050510 | nmdc:mga06r32_534461_c1 | nmdc:mga06r32_534461_c1_198_899 | 233 |
| 883 | 3300050511 | nmdc:mga08y16_618560_c1 | nmdc:mga08y16_618560_c1_256_957 | 233 |
| 884 | 3300050512 | nmdc:mga0n895_3366_c1 | nmdc:mga0n895_3366_c1_4718_5419 | 233 |
| 885 | 3300050516 | nmdc:mga0sz30_44633_c1 | nmdc:mga0sz30_44633_c1_1014_1715 | 233 |
| 886 | 3300050516 | nmdc:mga0sz30_93601_c1 | nmdc:mga0sz30_93601_c1_282_983 | 233 |
| 887 | 3300053078 | Ga0495612_0107337 | Ga0495612_0107337_395_1096 | 233 |
| 888 | 3300053079 | Ga0500610_0048254 | Ga0500610_0048254_1051_1752 | 233 |
| 889 | 3300053079 | Ga0500610_0201699 | Ga0500610_0201699_133_834 | 233 |
| 890 | 3300053083 | Ga0495655_0101339 | Ga0495655_0101339_19_720 | 233 |
| 891 | 3300053084 | Ga0495595_0042423 | Ga0495595_0042423_931_1647 | 233 |
| 892 | 3300053085 | Ga0495619_0122341 | Ga0495619_0122341_697_1398 | 233 |
| 893 | 3300053085 | Ga0495619_0125308 | Ga0495619_0125308_989_1690 | 233 |
| 894 | 3300053085 | Ga0495619_0252328 | Ga0495619_0252328_98_799 | 233 |
| 895 | 3300053087 | Ga0500643_000019 | Ga0500643_000019_19836_20651 | 233 |
| 896 | 3300053087 | Ga0500643_018453 | Ga0500643_018453_1468_2253 | 233 |
| 897 | 3300053088 | Ga0500644_0139703 | Ga0500644_0139703_26_727 | 233 |
| 898 | 3300053092 | Ga0500583_0118502 | Ga0500583_0118502_542_1243 | 233 |
| 899 | 3300053094 | Ga0500566_0000693 | Ga0500566_0000693_2052_2753 | 233 |
| 900 | 3300053098 | Ga0500650_0197603 | Ga0500650_0197603_44_745 | 233 |
| 901 | 3300053109 | Ga0500569_009144 | Ga0500569_009144_291_992 | 233 |
| 902 | 3300053116 | Ga0500592_026600 | Ga0500592_026600_55_756 | 233 |
| 903 | 3300053122 | Ga0500608_164326 | Ga0500608_164326_76_777 | 233 |
| 904 | 3300053130 | Ga0500642_0014156 | Ga0500642_0014156_1819_2520 | 233 |
| 905 | 3300053136 | Ga0500559_0151232 | Ga0500559_0151232_262_963 | 233 |
| 906 | 3300053139 | Ga0500568_0017048 | Ga0500568_0017048_2498_3199 | 233 |
| 907 | 3300053146 | Ga0500588_0207050 | Ga0500588_0207050_17_718 | 233 |
| 908 | 3300053148 | Ga0500590_035468 | Ga0500590_035468_644_1345 | 233 |
| 909 | 3300053148 | Ga0500590_104749 | Ga0500590_104749_364_1092 | 233 |
| 910 | 3300053156 | Ga0500622_0018556 | Ga0500622_0018556_1595_2296 | 233 |
| 911 | 3300053161 | Ga0500634_0131780 | Ga0500634_0131780_217_1005 | 233 |
| 912 | 3300053177 | Ga0500636_0000410 | Ga0500636_0000410_5363_6103 | 233 |
| 913 | 3300053178 | Ga0500637_0044618 | Ga0500637_0044618_1128_1829 | 233 |
| 914 | 3300053730 | Ga0500645_076050 | Ga0500645_076050_25_726 | 233 |
| 915 | 3300053737 | Ga0500601_000120 | Ga0500601_000120_7107_7808 | 233 |
| 916 | 3300055283 | Ga0500661_042459 | Ga0500661_042459_28_729 | 233 |
| 917 | iso_pu_bacteria | 2511231028 | 2511400364 | 233 |
| 918 | iso_pu_bacteria | 2524023210 | 2524469413 | 233 |
| 919 | iso_pu_bacteria | 2935959822 | 2935963399 | 233 |
| 920 | 3300001979 | JGI24740J21852_10017791 | JGI24740J21852_100177912 | 234 |
| 921 | 3300003203 | JGI25406J46586_10001342 | JGI25406J46586_1000134210 | 234 |
| 922 | 3300003659 | JGI25404J52841_10007600 | JGI25404J52841_100076003 | 234 |
| 923 | 3300003659 | JGI25404J52841_10013992 | JGI25404J52841_100139921 | 234 |
| 924 | 3300005336 | Ga0070680_100375836 | Ga0070680_1003758362 | 234 |
| 925 | 3300005339 | Ga0070660_100280581 | Ga0070660_1002805812 | 234 |
| 926 | 3300005434 | Ga0070709_10023604 | Ga0070709_100236041 | 234 |
| 927 | 3300005435 | Ga0070714_100004718 | Ga0070714_1000047184 | 234 |
| 928 | 3300005435 | Ga0070714_100024383 | Ga0070714_1000243832 | 234 |
| 929 | 3300005436 | Ga0070713_100004489 | Ga0070713_1000044898 | 234 |
| 930 | 3300005436 | Ga0070713_100032765 | Ga0070713_1000327654 | 234 |
| 931 | 3300005437 | Ga0070710_10013160 | Ga0070710_100131605 | 234 |
| 932 | 3300005439 | Ga0070711_100011056 | Ga0070711_1000110566 | 234 |
| 933 | 3300005455 | Ga0070663_100053297 | Ga0070663_1000532973 | 234 |
| 934 | 3300005455 | Ga0070663_100183660 | Ga0070663_1001836601 | 234 |
| 935 | 3300005535 | Ga0070684_100275159 | Ga0070684_1002751591 | 234 |
| 936 | 3300005539 | Ga0068853_100071780 | Ga0068853_1000717803 | 234 |
| 937 | 3300005539 | Ga0068853_100621687 | Ga0068853_1006216871 | 234 |
| 938 | 3300005563 | Ga0068855_100035339 | Ga0068855_1000353396 | 234 |
| 939 | 3300005563 | Ga0068855_100696105 | Ga0068855_1006961052 | 234 |
| 940 | 3300005577 | Ga0068857_100367882 | Ga0068857_1003678822 | 234 |
| 941 | 3300005614 | Ga0068856_100033788 | Ga0068856_1000337885 | 234 |
| 942 | 3300005614 | Ga0068856_100059957 | Ga0068856_1000599573 | 234 |
| 943 | 3300005614 | Ga0068856_100290162 | Ga0068856_1002901622 | 234 |
| 944 | 3300005616 | Ga0068852_100140619 | Ga0068852_1001406192 | 234 |
| 945 | 3300005618 | Ga0068864_100215190 | Ga0068864_1002151902 | 234 |
| 946 | 3300005937 | Ga0081455_10049019 | Ga0081455_100490194 | 234 |
| 947 | 3300005937 | Ga0081455_10119021 | Ga0081455_101190212 | 234 |
| 948 | 3300005983 | Ga0081540_1001498 | Ga0081540_100149813 | 234 |
| 949 | 3300005983 | Ga0081540_1010330 | Ga0081540_10103308 | 234 |
| 950 | 3300005983 | Ga0081540_1025933 | Ga0081540_10259334 | 234 |
| 951 | 3300005983 | Ga0081540_1034728 | Ga0081540_10347281 | 234 |
| 952 | 3300005985 | Ga0081539_10000726 | Ga0081539_1000072637 | 234 |
| 953 | 3300006038 | Ga0075365_10366819 | Ga0075365_103668191 | 234 |
| 954 | 3300006163 | Ga0070715_10146529 | Ga0070715_101465292 | 234 |
| 955 | 3300006175 | Ga0070712_100477898 | Ga0070712_1004778982 | 234 |
| 956 | 3300006175 | Ga0070712_100641460 | Ga0070712_1006414602 | 234 |
| 957 | 3300009093 | Ga0105240_10036405 | Ga0105240_100364055 | 234 |
| 958 | 3300009093 | Ga0105240_10063064 | Ga0105240_100630643 | 234 |
| 959 | 3300009093 | Ga0105240_10126908 | Ga0105240_101269083 | 234 |
| 960 | 3300009093 | Ga0105240_10383467 | Ga0105240_103834672 | 234 |
| 961 | 3300009551 | Ga0105238_10038672 | Ga0105238_100386723 | 234 |
| 962 | 3300009551 | Ga0105238_10050078 | Ga0105238_100500785 | 234 |
| 963 | 3300010375 | Ga0105239_10089022 | Ga0105239_100890224 | 234 |
| 964 | 3300013104 | Ga0157370_10079560 | Ga0157370_100795602 | 234 |
| 965 | 3300013104 | Ga0157370_10311510 | Ga0157370_103115102 | 234 |
| 966 | 3300013105 | Ga0157369_10003596 | Ga0157369_1000359613 | 234 |
| 967 | 3300013105 | Ga0157369_10037100 | Ga0157369_100371006 | 234 |
| 968 | 3300021384 | Ga0213876_10001081 | Ga0213876_1000108116 | 234 |
| 969 | 3300021388 | Ga0213875_10053548 | Ga0213875_100535482 | 234 |
| 970 | 3300022467 | Ga0224712_10018155 | Ga0224712_100181553 | 234 |
| 971 | 3300025261 | Ga0209233_1003327 | Ga0209233_10033273 | 234 |
| 972 | 3300025297 | Ga0209758_1064190 | Ga0209758_10641902 | 234 |
| 973 | 3300025321 | Ga0207656_10136174 | Ga0207656_101361741 | 234 |
| 974 | 3300025898 | Ga0207692_10273636 | Ga0207692_102736361 | 234 |
| 975 | 3300025904 | Ga0207647_10013302 | Ga0207647_100133022 | 234 |
| 976 | 3300025905 | Ga0207685_10030001 | Ga0207685_100300011 | 234 |
| 977 | 3300025906 | Ga0207699_10023095 | Ga0207699_100230952 | 234 |
| 978 | 3300025908 | Ga0207643_10076610 | Ga0207643_100766101 | 234 |
| 979 | 3300025911 | Ga0207654_10000803 | Ga0207654_1000080315 | 234 |
| 980 | 3300025912 | Ga0207707_10116849 | Ga0207707_101168492 | 234 |
| 981 | 3300025913 | Ga0207695_10001543 | Ga0207695_1000154311 | 234 |
| 982 | 3300025913 | Ga0207695_10028927 | Ga0207695_100289275 | 234 |
| 983 | 3300025913 | Ga0207695_10148018 | Ga0207695_101480182 | 234 |
| 984 | 3300025913 | Ga0207695_10234406 | Ga0207695_102344062 | 234 |
| 985 | 3300025914 | Ga0207671_10222544 | Ga0207671_102225442 | 234 |
| 986 | 3300025914 | Ga0207671_10276956 | Ga0207671_102769562 | 234 |
| 987 | 3300025915 | Ga0207693_10002906 | Ga0207693_1000290610 | 234 |
| 988 | 3300025916 | Ga0207663_10003355 | Ga0207663_100033554 | 234 |
| 989 | 3300025916 | Ga0207663_10394774 | Ga0207663_103947741 | 234 |
| 990 | 3300025924 | Ga0207694_10001371 | Ga0207694_100013712 | 234 |
| 991 | 3300025924 | Ga0207694_10063906 | Ga0207694_100639063 | 234 |
| 992 | 3300025928 | Ga0207700_10111939 | Ga0207700_101119391 | 234 |
| 993 | 3300025929 | Ga0207664_10044034 | Ga0207664_100440342 | 234 |
| 994 | 3300025939 | Ga0207665_10000992 | Ga0207665_1000099218 | 234 |
| 995 | 3300025939 | Ga0207665_10497186 | Ga0207665_104971861 | 234 |
| 996 | 3300025949 | Ga0207667_10004319 | Ga0207667_1000431918 | 234 |
| 997 | 3300025949 | Ga0207667_10036266 | Ga0207667_100362664 | 234 |
| 998 | 3300025981 | Ga0207640_10083757 | Ga0207640_100837572 | 234 |
| 999 | 3300025981 | Ga0207640_10199915 | Ga0207640_101999152 | 234 |
| 1000 | 3300026041 | Ga0207639_10849609 | Ga0207639_108496091 | 234 |
| 1001 | 3300026067 | Ga0207678_10087953 | Ga0207678_100879532 | 234 |
| 1002 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005295 | 234 |
| 1003 | 3300026078 | Ga0207702_10414482 | Ga0207702_104144821 | 234 |
| 1004 | 3300026078 | Ga0207702_10556733 | Ga0207702_105567332 | 234 |
| 1005 | 3300026116 | Ga0207674_10011138 | Ga0207674_1001113811 | 234 |
| 1006 | 3300028573 | Ga0265334_10026414 | Ga0265334_100264142 | 234 |
| 1007 | 3300028786 | Ga0307517_10000062 | Ga0307517_1000006232 | 234 |
| 1008 | 3300031238 | Ga0265332_10047997 | Ga0265332_100479972 | 234 |
| 1009 | 3300031250 | Ga0265331_10026429 | Ga0265331_100264293 | 234 |
| 1010 | 3300031548 | Ga0307408_100057151 | Ga0307408_1000571512 | 234 |
| 1011 | 3300031711 | Ga0265314_10138884 | Ga0265314_101388842 | 234 |
| 1012 | 3300031712 | Ga0265342_10009526 | Ga0265342_100095263 | 234 |
| 1013 | 3300033442 | Ga0315911_1000009 | Ga0315911_1000009376 | 234 |
| 1014 | 3300035111 | Ga0373923_0026123 | Ga0373923_0026123_841_1545 | 234 |
| 1015 | 3300035117 | Ga0373953_0000670 | Ga0373953_0000670_3190_3894 | 234 |
| 1016 | 3300035118 | Ga0373954_0022528 | Ga0373954_0022528_1432_2136 | 234 |
| 1017 | 3300035119 | Ga0373956_0049899 | Ga0373956_0049899_91_795 | 234 |
| 1018 | 3300035172 | Ga0373955_0000447 | Ga0373955_0000447_12894_13598 | 234 |
| 1019 | 3300035692 | Ga0373935_0363639 | Ga0373935_0363639_279_983 | 234 |
| 1020 | 3300035724 | Ga0373933_0002005 | Ga0373933_0002005_3244_3948 | 234 |
| 1021 | 3300036401 | Ga0373937_0121748 | Ga0373937_0121748_1321_2025 | 234 |
| 1022 | 3300037418 | Ga0395900_0079214 | Ga0395900_0079214_2418_3122 | 234 |
| 1023 | 3300037466 | Ga0395898_0011573 | Ga0395898_0011573_5745_6449 | 234 |
| 1024 | 3300037853 | Ga0436364_1499714 | Ga0436364_1499714_939_1643 | 234 |
| 1025 | 3300039437 | Ga0436365_0675790 | Ga0436365_0675790_15748_16452 | 234 |
| 1026 | 3300039450 | Ga0436363_0632867 | Ga0436363_0632867_177_881 | 234 |
| 1027 | 3300044684 | Ga0466966_0048886 | Ga0466966_0048886_445_1149 | 234 |
| 1028 | 3300044719 | Ga0466971_0089100 | Ga0466971_0089100_489_1193 | 234 |
| 1029 | 3300045049 | Ga0466959_0021412 | Ga0466959_0021412_459_1163 | 234 |
| 1030 | 3300046455 | Ga0495603_0084959 | Ga0495603_0084959_16_720 | 234 |
| 1031 | 3300046459 | Ga0495629_0001699 | Ga0495629_0001699_16005_16709 | 234 |
| 1032 | 3300046462 | Ga0495651_0040970 | Ga0495651_0040970_438_1142 | 234 |
| 1033 | 3300046462 | Ga0495651_0085092 | Ga0495651_0085092_430_1134 | 234 |
| 1034 | 3300046463 | Ga0495653_0055700 | Ga0495653_0055700_1906_2610 | 234 |
| 1035 | 3300046507 | Ga0495606_0305661 | Ga0495606_0305661_132_836 | 234 |
| 1036 | 3300046511 | Ga0495608_0076289 | Ga0495608_0076289_888_1592 | 234 |
| 1037 | 3300046533 | Ga0495640_0071777 | Ga0495640_0071777_671_1375 | 234 |
| 1038 | 3300046536 | Ga0495587_0029630 | Ga0495587_0029630_1323_2027 | 234 |
| 1039 | 3300046616 | Ga0495668_0083145 | Ga0495668_0083145_896_1600 | 234 |
| 1040 | 3300046663 | Ga0495635_0000892 | Ga0495635_0000892_15588_16292 | 234 |
| 1041 | 3300046675 | Ga0495657_0001505 | Ga0495657_0001505_10814_11518 | 234 |
| 1042 | 3300046678 | Ga0495599_0191652 | Ga0495599_0191652_334_1038 | 234 |
| 1043 | 3300046679 | Ga0495623_0002081 | Ga0495623_0002081_11186_11890 | 234 |
| 1044 | 3300046679 | Ga0495623_0081994 | Ga0495623_0081994_1019_1723 | 234 |
| 1045 | 3300046680 | Ga0495646_0003426 | Ga0495646_0003426_2160_2864 | 234 |
| 1046 | 3300046689 | Ga0495613_0038530 | Ga0495613_0038530_113_817 | 234 |
| 1047 | 3300046809 | Ga0495600_0000845 | Ga0495600_0000845_599_1303 | 234 |
| 1048 | 3300047322 | Ga0495680_0001893 | Ga0495680_0001893_8612_9316 | 234 |
| 1049 | 3300047471 | Ga0495684_0006728 | Ga0495684_0006728_114_818 | 234 |
| 1050 | 3300047673 | Ga0495593_0002873 | Ga0495593_0002873_6549_7253 | 234 |
| 1051 | 3300048088 | Ga0495602_0020256 | Ga0495602_0020256_438_1142 | 234 |
| 1052 | 3300048912 | Ga0496109_0760537 | Ga0496109_0760537_165_869 | 234 |
| 1053 | 3300048918 | Ga0496115_0063037 | Ga0496115_0063037_469_1173 | 234 |
| 1054 | 3300048924 | Ga0496121_0066938 | Ga0496121_0066938_796_1500 | 234 |
| 1055 | 3300048927 | Ga0496124_0286066 | Ga0496124_0286066_91_795 | 234 |
| 1056 | 3300048929 | Ga0496126_0008612 | Ga0496126_0008612_8465_9169 | 234 |
| 1057 | 3300048929 | Ga0496126_0044454 | Ga0496126_0044454_2126_2830 | 234 |
| 1058 | 3300049568 | Ga0501031_0035853 | Ga0501031_0035853_193_906 | 234 |
| 1059 | 3300049569 | Ga0501032_0000120 | Ga0501032_0000120_16339_17052 | 234 |
| 1060 | 3300049570 | Ga0501033_0002325 | Ga0501033_0002325_9951_10664 | 234 |
| 1061 | 3300049571 | Ga0501034_0000061 | Ga0501034_0000061_73868_74581 | 234 |
| 1062 | 3300049572 | Ga0501036_0000054 | Ga0501036_0000054_16790_17503 | 234 |
| 1063 | 3300049573 | Ga0501037_0000093 | Ga0501037_0000093_16430_17143 | 234 |
| 1064 | 3300049574 | Ga0501038_0000066 | Ga0501038_0000066_5309_6022 | 234 |
| 1065 | 3300049574 | Ga0501038_0716543 | Ga0501038_0716543_16_726 | 234 |
| 1066 | 3300049575 | Ga0501039_0001528 | Ga0501039_0001528_379_1092 | 234 |
| 1067 | 3300049579 | Ga0501043_0000161 | Ga0501043_0000161_54450_55163 | 234 |
| 1068 | 3300049580 | Ga0501046_0000487 | Ga0501046_0000487_19609_20322 | 234 |
| 1069 | 3300049581 | Ga0501047_0000122 | Ga0501047_0000122_67635_68348 | 234 |
| 1070 | 3300049582 | Ga0501048_0000053 | Ga0501048_0000053_31580_32293 | 234 |
| 1071 | 3300049582 | Ga0501048_0274289 | Ga0501048_0274289_337_1116 | 234 |
| 1072 | 3300049583 | Ga0501067_0000387 | Ga0501067_0000387_20770_21483 | 234 |
| 1073 | 3300049584 | Ga0501068_0003190 | Ga0501068_0003190_5869_6582 | 234 |
| 1074 | 3300049585 | Ga0501069_0025455 | Ga0501069_0025455_165_878 | 234 |
| 1075 | 3300049586 | Ga0501070_0001577 | Ga0501070_0001577_11133_11846 | 234 |
| 1076 | 3300049586 | Ga0501070_0052424 | Ga0501070_0052424_1851_2573 | 234 |
| 1077 | 3300049586 | Ga0501070_0291090 | Ga0501070_0291090_210_989 | 234 |
| 1078 | 3300049588 | Ga0501072_0021593 | Ga0501072_0021593_1975_2688 | 234 |
| 1079 | 3300049589 | Ga0501073_0000146 | Ga0501073_0000146_10512_11225 | 234 |
| 1080 | 3300049590 | Ga0501074_0000712 | Ga0501074_0000712_10338_11051 | 234 |
| 1081 | 3300049741 | Ga0501079_0042171 | Ga0501079_0042171_2751_3464 | 234 |
| 1082 | 3300049742 | Ga0501080_0001268 | Ga0501080_0001268_10701_11414 | 234 |
| 1083 | 3300049744 | Ga0501083_0001199 | Ga0501083_0001199_11625_12338 | 234 |
| 1084 | 3300049822 | Ga0501035_0000099 | Ga0501035_0000099_52127_52840 | 234 |
| 1085 | 3300049822 | Ga0501035_0075976 | Ga0501035_0075976_862_1641 | 234 |
| 1086 | 3300049823 | Ga0501044_0000195 | Ga0501044_0000195_23801_24514 | 234 |
| 1087 | 3300049824 | Ga0501045_0007673 | Ga0501045_0007673_4669_5382 | 234 |
| 1088 | 3300050512 | nmdc:mga0n895_601180_c1 | nmdc:mga0n895_601180_c1_90_794 | 234 |
| 1089 | 3300053077 | Ga0495601_0006936 | Ga0495601_0006936_4969_5673 | 234 |
| 1090 | 3300053084 | Ga0495595_0006154 | Ga0495595_0006154_2852_3556 | 234 |
| 1091 | 3300053085 | Ga0495619_0000394 | Ga0495619_0000394_14483_15187 | 234 |
| 1092 | 3300053085 | Ga0495619_0609520 | Ga0495619_0609520_10_714 | 234 |
| 1093 | 3300053094 | Ga0500566_0003060 | Ga0500566_0003060_640_1344 | 234 |
| 1094 | 3300053119 | Ga0500595_000478 | Ga0500595_000478_12851_13555 | 234 |
| 1095 | 3300053178 | Ga0500637_0000245 | Ga0500637_0000245_8773_9477 | 234 |
| 1096 | 3300054114 | Ga0501084_0002556 | Ga0501084_0002556_11615_12328 | 234 |
| 1097 | 3300060353 | Ga0501082_0027232 | Ga0501082_0027232_2970_3683 | 234 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hfk-assembly1.cif.gz_B | crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione | 0.9884 | 1 | 204 |
| 3gx0-assembly1.cif.gz_A-2 | crystal structure of gsh-dependent disulfide bond oxidoreductase | 0.9862 | 1 | 204 |
| 3gx0-assembly1.cif.gz_A-2 | crystal structure of gsh-dependent disulfide bond oxidoreductase | 0.9767 | 1 | 204 |
| 4l8e-assembly1.cif.gz_A-2 | crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit | 0.9764 | 3 | 203 |
| 4ecj-assembly1.cif.gz_B | crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione | 0.9757 | 1 | 208 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 1.001 | 1 | 84 | 3.40.30.10 |
| 4l8eA01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9957 | 3 | 86 | 3.40.30.10 |
| af_P77526_93_209_1.20.1050.130 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9781 | 94 | 204 | 1.20.1050.130 |
| af_P77526_1_85_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9775 | 1 | 84 | 3.40.30.10 |
| af_P77526_87_192_1.20.1050.10 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9759 | 87 | 192 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522J4D5-F1-model_v4 | Thiol:disulfide oxidoreductase | 1.002 | 1 | 84 |
|
| AF-A0A379S1X3-F1-model_v4 | Glutathione-S transferase | 1.001 | 1 | 84 |
GO:0015036
GO:0016740 |
| AF-A0A3D5Y447-F1-model_v4 | Thiol:disulfide oxidoreductase | 1.001 | 1 | 71 |
|
| AF-A0A0S8AWI8-F1-model_v4 | Glutathione S-transferase | 0.9979 | 1 | 100 |
GO:0016740
|
| AF-A0A379VPV5-F1-model_v4 | Glutathione-S transferase | 0.9962 | 1 | 149 |
GO:0015036
GO:0016740 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar