F490000

General Info

Members Datasets Scaffolds Average Seq Length
1097 547 970 233

Family's Representative Sequence

Representative Sequence 3300009092|Ga0105250_10032509|Ga0105250_100325092
Length 273
Sequence MGASRSVLIERLSAMSYDRGTEQQKSAIAGNIPAAAARGAMIDLHYAPTPNGWKISIMLEELGLPYQVIPVNIRAGEQFRSEFLAISPNNRIPAIVDHEPADGQGPFSVFETGAILIYLADKTGRFLPKAARPRSRVMEWLMWQMSGLGPMLGQHGHFALYAAEKIPYAIERYRDEAARLYRVLDTQLGKTGAYVAGDYSIVDIACFPWTMTHKAQGFTLDDYPNVKRWYAEVRARPQVQAGLAIGKFVKEPFDEEARRNMFGARAKEMALRK

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
3 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
7 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
8 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
9 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
12 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
13 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
14 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
15 2643221683 Variovorax sp. Root473 Isolate Unclassified
16 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
17 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
18 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
19 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
20 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
21 2791355199
22 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
23 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
24 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
25 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
26 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
27 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
28 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
29 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
30 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
31 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
32 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
33 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
34 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
35 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
36 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
37 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
38 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
39 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
40 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
41 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
42 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
43 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
44 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
45 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
46 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
47 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
48 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
49 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
50 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
51 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
52 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
53 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
54 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
55 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
56 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
57 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
58 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
59 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
60 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
61 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
62 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
63 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
64 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
65 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
66 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
67 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
68 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
69 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
70 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
71 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
72 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
73 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
74 2906610324
75 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
76 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
77 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
78 2922368715
79 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
80 2922425934
81 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
82 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
83 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
84 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
85 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
86 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
87 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
88 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
89 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
90 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
91 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
92 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
93 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
94 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
95 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
96 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
97 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
98 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
99 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
100 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
101 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
102 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
103 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
104 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
105 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
106 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
107 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
108 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
109 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
110 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
111 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
112 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
113 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
114 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
115 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
116 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
117 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
118 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
119 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
120 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
121 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
122 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
123 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
124 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
125 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
126 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
127 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
128 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
129 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
130 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
131 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
132 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
133 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
134 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
135 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
136 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
137 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
138 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
139 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
140 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
141 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
142 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
143 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
144 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
145 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
146 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
147 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
148 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
149 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
150 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
151 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
152 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
153 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
154 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
155 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
156 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
157 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
158 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
159 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
160 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
161 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
162 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
163 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
164 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
165 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
166 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
167 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
168 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
169 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
170 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
171 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
172 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
173 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
174 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
175 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
176 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
177 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
178 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
179 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
180 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
181 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
182 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
183 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
184 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
185 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
186 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
187 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
188 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
189 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
190 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
191 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
192 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
193 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
194 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
195 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
196 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
197 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
198 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
199 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
200 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
201 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
202 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
203 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
204 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
205 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
206 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
207 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
208 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
209 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
210 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
211 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
212 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
213 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
214 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
215 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
216 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
217 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
218 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
219 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
220 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
221 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
222 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
223 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
224 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
225 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
226 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
227 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
228 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
229 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
230 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
231 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
232 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
233 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
235 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
236 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
237 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
238 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
239 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
240 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
241 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
299 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
304 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
305 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
306 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
307 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
308 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
309 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
310 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
311 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
312 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
313 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
314 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
315 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
316 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
317 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
318 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
319 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
320 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
321 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
322 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
323 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
324 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
325 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
326 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
327 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
328 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
329 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
330 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
331 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
332 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
333 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
334 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
335 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
336 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
337 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
338 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
339 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
340 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
341 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
342 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
343 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
344 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
345 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
346 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
347 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
348 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
349 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
350 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
351 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
352 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
353 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
354 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
355 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
356 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
357 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
358 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
359 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
360 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
361 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
362 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
363 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
364 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
365 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
366 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
367 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
368 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
369 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
370 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
371 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
372 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
373 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
374 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
375 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
376 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
377 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
378 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
379 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
380 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
381 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
382 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
383 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
384 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
385 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
386 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
387 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
388 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
389 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
390 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
391 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
392 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
393 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
394 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
395 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
396 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
397 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
398 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
399 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
400 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
401 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
402 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
403 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
404 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
405 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
406 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
407 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
408 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
409 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
410 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
411 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
412 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
413 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
414 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
415 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
416 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
417 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
418 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
419 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
420 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
421 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
422 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
423 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
424 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
425 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
426 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
427 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
428 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
429 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
430 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
431 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
432 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
433 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
434 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
435 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
436 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
437 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
438 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
439 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
440 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
441 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
442 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
443 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
444 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
445 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
446 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
447 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
448 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
449 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
450 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
451 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
452 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
453 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
454 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
455 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
456 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
457 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
458 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
459 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
460 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
461 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
474 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
475 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
476 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
477 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
478 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
479 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
480 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
481 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
482 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
483 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
484 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
485 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
486 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
487 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
489 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
490 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
491 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
492 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
493 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
494 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
495 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
496 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
497 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
498 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
499 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
500 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
501 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
502 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
503 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
504 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
505 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
506 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
507 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
508 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
509 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
510 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
511 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
512 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
513 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
514 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
515 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
516 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
517 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
518 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
519 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
520 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
521 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
522 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
523 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
524 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
525 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
526 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
527 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
528 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
529 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
530 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
531 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
532 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
533 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
534 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
535 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
536 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
537 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
538 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
539 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
540 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
541 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
542 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
543 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
544 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
545 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
546 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
547 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.66
Metatranscriptomes 0.09
Isolates 11.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.48
Nodule 7.66
Rhizoplane 5.38
Rhizosphere 66.82
Stem 0
Stem Tuber 0
Unclassified 9.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017791 3300001979 Bacteria 2534
2 JGI24739J22299_10059542 3300001989 Bacteria 1210
3 JGI24737J22298_10033372 3300001990 Bacteria 1599
4 JGI24738J21930_10055969 3300002075 Bacteria 807
5 JGI25406J46586_10000169 3300003203 Bacteria 29128
6 JGI25406J46586_10000649 3300003203 Bacteria 16248
7 JGI25406J46586_10001342 3300003203 Bacteria 11588
8 JGI25153J46596_10001707 3300003215 Bacteria 13020
9 JGI25153J46596_10006992 3300003215 Bacteria 5622
10 JGI25153J46596_10008439 3300003215 Bacteria 4923
11 JGI25160J50197_1003053 3300003354 Bacteria 7635
12 JGI25160J50197_1008288 3300003354 Bacteria 3970
13 JGI25160J50197_1008476 3300003354 Bacteria 3913
14 JGI25404J52841_10007600 3300003659 Bacteria 2296
15 JGI25404J52841_10013992 3300003659 Bacteria 1740
16 Ga0055539_1011509 3300003752 Bacteria 1089
17 Ga0065165_1003321 3300005262 Bacteria 11502
18 Ga0065165_1020904 3300005262 Bacteria 2287
19 Ga0065704_10239132 3300005289 Bacteria 1012
20 Ga0070658_10364883 3300005327 Bacteria 1237
21 Ga0070676_10290013 3300005328 Bacteria 1105
22 Ga0070683_100097821 3300005329 Bacteria 2761
23 Ga0070683_100385969 3300005329 Bacteria 1335
24 Ga0070670_100192058 3300005331 Bacteria 1774
25 Ga0070670_100365218 3300005331 Bacteria 1270
26 Ga0068869_100334157 3300005334 Bacteria 1232
27 Ga0070666_10335761 3300005335 Bacteria 1080
28 Ga0070680_100023477 3300005336 Bacteria 4918
29 Ga0070680_100046138 3300005336 Bacteria 3544
30 Ga0070680_100124919 3300005336 Bacteria 2149
31 Ga0070680_100375836 3300005336 Bacteria 1210
32 Ga0070682_100077343 3300005337 Bacteria 2144
33 Ga0070660_100046974 3300005339 Bacteria 3310
34 Ga0070660_100280581 3300005339 Bacteria 1363
35 Ga0070692_10245797 3300005345 Bacteria 1068
36 Ga0070668_100031965 3300005347 Bacteria 4005
37 Ga0070668_100033764 3300005347 Bacteria 3898
38 Ga0070668_100128620 3300005347 Bacteria 2031
39 Ga0070668_100200452 3300005347 Bacteria 1638
40 Ga0070668_100219133 3300005347 Bacteria 1569
41 Ga0070668_100224269 3300005347 Bacteria 1551
42 Ga0070675_100825607 3300005354 Bacteria 848
43 Ga0070671_100040085 3300005355 Bacteria 3888
44 Ga0070659_100087281 3300005366 Bacteria 2497
45 Ga0070659_100333063 3300005366 Bacteria 1271
46 Ga0070659_100476292 3300005366 Bacteria 1062
47 Ga0070667_100227901 3300005367 Bacteria 1660
48 Ga0070709_10023604 3300005434 Bacteria 3614
49 Ga0070709_10206931 3300005434 Bacteria 1393
50 Ga0070714_100004718 3300005435 Bacteria 10310
51 Ga0070714_100024383 3300005435 Bacteria 4981
52 Ga0070714_100100246 3300005435 Bacteria 2551
53 Ga0070714_100192957 3300005435 Bacteria 1860
54 Ga0070713_100004489 3300005436 Bacteria 9384
55 Ga0070713_100027904 3300005436 Bacteria 4452
56 Ga0070713_100032765 3300005436 Bacteria 4155
57 Ga0070713_100396813 3300005436 Bacteria 1288
58 Ga0070713_100451308 3300005436 Bacteria 1208
59 Ga0070710_10013160 3300005437 Bacteria 4134
60 Ga0070711_100011056 3300005439 Bacteria 5599
61 Ga0070700_100104231 3300005441 Bacteria 1874
62 Ga0070700_100117878 3300005441 Bacteria 1774
63 Ga0070700_100220087 3300005441 Bacteria 1345
64 Ga0070694_100134244 3300005444 Bacteria 1792
65 Ga0070663_100040886 3300005455 Bacteria 3248
66 Ga0070663_100053297 3300005455 Bacteria 2887
67 Ga0070663_100063505 3300005455 Bacteria 2667
68 Ga0070663_100067318 3300005455 Bacteria 2597
69 Ga0070663_100183660 3300005455 Bacteria 1624
70 Ga0070663_100269348 3300005455 Bacteria 1353
71 Ga0070678_100031497 3300005456 Bacteria 3659
72 Ga0070678_100170663 3300005456 Bacteria 1771
73 Ga0070678_100253457 3300005456 Bacteria 1477
74 Ga0070662_100146152 3300005457 Bacteria 1837
75 Ga0070662_100187747 3300005457 Bacteria 1632
76 Ga0070681_10017761 3300005458 Bacteria 7108
77 Ga0070681_10092691 3300005458 Bacteria 2969
78 Ga0070681_10146132 3300005458 Bacteria 2293
79 Ga0070698_100118647 3300005471 Bacteria 2606
80 Ga0070698_100219634 3300005471 Bacteria 1834
81 Ga0070699_100116665 3300005518 Bacteria 2346
82 Ga0070699_100297398 3300005518 Bacteria 1448
83 Ga0070679_100006433 3300005530 Bacteria 10944
84 Ga0070679_100061259 3300005530 Bacteria 3750
85 Ga0070684_100275159 3300005535 Bacteria 1542
86 Ga0070684_100374133 3300005535 Bacteria 1312
87 Ga0070684_100908407 3300005535 Bacteria 825
88 Ga0070697_100465339 3300005536 Bacteria 1103
89 Ga0068853_100043317 3300005539 Bacteria 3850
90 Ga0068853_100071780 3300005539 Bacteria 3015
91 Ga0068853_100216372 3300005539 Bacteria 1748
92 Ga0068853_100259998 3300005539 Bacteria 1595
93 Ga0068853_100394271 3300005539 Bacteria 1295
94 Ga0068853_100621687 3300005539 Bacteria 1027
95 Ga0070672_100654552 3300005543 Bacteria 918
96 Ga0070696_100328123 3300005546 Bacteria 1179
97 Ga0070665_100018629 3300005548 Bacteria 6958
98 Ga0070665_100152028 3300005548 Bacteria 2317
99 Ga0070665_100431006 3300005548 Bacteria 1327
100 Ga0068855_100000788 3300005563 Bacteria 39153
101 Ga0068855_100032750 3300005563 Bacteria 6206
102 Ga0068855_100035339 3300005563 Bacteria 5953
103 Ga0068855_100083449 3300005563 Bacteria 3701
104 Ga0068855_100398314 3300005563 Bacteria 1509
105 Ga0068855_100492029 3300005563 Bacteria 1334
106 Ga0068855_100696105 3300005563 Bacteria 1088
107 Ga0070664_100515091 3300005564 Bacteria 1104
108 Ga0070664_100519623 3300005564 Bacteria 1099
109 Ga0068857_100042265 3300005577 Bacteria 4043
110 Ga0068857_100252354 3300005577 Bacteria 1617
111 Ga0068857_100367882 3300005577 Bacteria 1334
112 Ga0068854_100352473 3300005578 Bacteria 1205
113 Ga0068856_100000236 3300005614 Bacteria 60041
114 Ga0068856_100023174 3300005614 Bacteria 6039
115 Ga0068856_100033788 3300005614 Bacteria 5008
116 Ga0068856_100059957 3300005614 Bacteria 3759
117 Ga0068856_100155121 3300005614 Bacteria 2300
118 Ga0068856_100290162 3300005614 Bacteria 1653
119 Ga0068856_100481100 3300005614 Bacteria 1263
120 Ga0068856_100524033 3300005614 Bacteria 1206
121 Ga0070702_100140659 3300005615 Bacteria 1537
122 Ga0068852_100140619 3300005616 Bacteria 2233
123 Ga0068852_100157324 3300005616 Bacteria 2118
124 Ga0068852_100264170 3300005616 Bacteria 1654
125 Ga0068852_100290646 3300005616 Bacteria 1579
126 Ga0068859_100126365 3300005617 Bacteria 2626
127 Ga0068864_100210122 3300005618 Bacteria 1791
128 Ga0068864_100215190 3300005618 Bacteria 1771
129 Ga0068864_100236316 3300005618 Bacteria 1692
130 Ga0068866_10409721 3300005718 Bacteria 877
131 Ga0068861_100019782 3300005719 Bacteria 4811
132 Ga0068861_100216382 3300005719 Bacteria 1616
133 Ga0068851_10008459 3300005834 Bacteria 4757
134 Ga0068863_100539719 3300005841 Bacteria 1151
135 Ga0068858_100035309 3300005842 Bacteria 4637
136 Ga0068858_100245808 3300005842 Bacteria 1698
137 Ga0068860_100063240 3300005843 Bacteria 3515
138 Ga0068860_100233567 3300005843 Bacteria 1787
139 Ga0068862_100145605 3300005844 Bacteria 2105
140 Ga0068862_100368564 3300005844 Bacteria 1336
141 Ga0081455_10000453 3300005937 Bacteria 53921
142 Ga0081455_10007549 3300005937 Bacteria 11436
143 Ga0081455_10021358 3300005937 Bacteria 6074
144 Ga0081455_10040180 3300005937 Bacteria 4128
145 Ga0081455_10049019 3300005937 Bacteria 3644
146 Ga0081455_10119021 3300005937 Bacteria 2084
147 Ga0081538_10069452 3300005981 Bacteria 1951
148 Ga0081540_1001498 3300005983 Bacteria 20120
149 Ga0081540_1007278 3300005983 Bacteria 7924
150 Ga0081540_1010330 3300005983 Bacteria 6331
151 Ga0081540_1011806 3300005983 Bacteria 5806
152 Ga0081540_1025933 3300005983 Bacteria 3359
153 Ga0081540_1034728 3300005983 Bacteria 2714
154 Ga0081539_10000255 3300005985 Bacteria 123054
155 Ga0081539_10000726 3300005985 Bacteria 66051
156 Ga0081539_10039521 3300005985 Bacteria 2782
157 Ga0070717_10017227 3300006028 Bacteria 5616
158 Ga0070717_10060144 3300006028 Bacteria 3145
159 Ga0070717_10720248 3300006028 Bacteria 907
160 Ga0075365_10145580 3300006038 Bacteria 1646
161 Ga0075365_10210394 3300006038 Bacteria 1363
162 Ga0075365_10220722 3300006038 Bacteria 1330
163 Ga0075365_10260931 3300006038 Bacteria 1218
164 Ga0075365_10366819 3300006038 Bacteria 1015
165 Ga0075368_10038059 3300006042 Bacteria 1882
166 Ga0075368_10046123 3300006042 Bacteria 1723
167 Ga0075363_100008449 3300006048 Bacteria 4793
168 Ga0075363_100020741 3300006048 Bacteria 3299
169 Ga0075364_10035998 3300006051 Bacteria 3200
170 Ga0075364_10070087 3300006051 Bacteria 2307
171 Ga0075364_10375182 3300006051 Bacteria 970
172 Ga0070715_10146529 3300006163 Bacteria 1152
173 Ga0070716_100084726 3300006173 Bacteria 1902
174 Ga0070716_100332479 3300006173 Bacteria 1069
175 Ga0070712_100477898 3300006175 Bacteria 1041
176 Ga0070712_100641460 3300006175 Bacteria 902
177 Ga0075362_10028091 3300006177 Bacteria 2414
178 Ga0075367_10007429 3300006178 Bacteria 5609
179 Ga0075367_10067317 3300006178 Bacteria 2147
180 Ga0075367_10119164 3300006178 Bacteria 1625
181 Ga0075367_10327419 3300006178 Bacteria 966
182 Ga0075369_10029112 3300006186 Bacteria 2318
183 Ga0075369_10065530 3300006186 Bacteria 1592
184 Ga0075366_10030200 3300006195 Bacteria 3185
185 Ga0097621_100410591 3300006237 Bacteria 1214
186 Ga0097621_100438501 3300006237 Bacteria 1175
187 Ga0075370_10015506 3300006353 Bacteria 4081
188 Ga0075370_10080532 3300006353 Bacteria 1871
189 Ga0075370_10135918 3300006353 Bacteria 1436
190 Ga0075370_10236658 3300006353 Bacteria 1081
191 Ga0075428_101011838 3300006844 Bacteria 880
192 Ga0097620_100126373 3300006931 Bacteria 2626
193 Ga0099794_10043146 3300007265 Bacteria 2152
194 Ga0099794_10054942 3300007265 Bacteria 1923
195 Ga0099794_10239654 3300007265 Bacteria 934
196 Ga0099795_10209060 3300007788 Bacteria 826
197 Ga0105250_10032509 3300009092 Bacteria 2095
198 Ga0105240_10000427 3300009093 Bacteria 78108
199 Ga0105240_10010641 3300009093 Bacteria 12917
200 Ga0105240_10036405 3300009093 Bacteria 6331
201 Ga0105240_10063064 3300009093 Bacteria 4612
202 Ga0105240_10074926 3300009093 Bacteria 4176
203 Ga0105240_10126908 3300009093 Bacteria 3064
204 Ga0105240_10383467 3300009093 Bacteria 1587
205 Ga0105240_10562070 3300009093 Bacteria 1261
206 Ga0105240_10699128 3300009093 Bacteria 1107
207 Ga0111539_11024603 3300009094 Bacteria 960
208 Ga0105245_10174177 3300009098 Bacteria 2051
209 Ga0105247_10041247 3300009101 Bacteria 2824
210 Ga0105247_10045143 3300009101 Bacteria 2704
211 Ga0105247_10063966 3300009101 Bacteria 2285
212 Ga0105247_10453023 3300009101 Bacteria 925
213 Ga0114129_10386990 3300009147 Bacteria 1846
214 Ga0105241_10051616 3300009174 Bacteria 3137
215 Ga0105241_10054907 3300009174 Bacteria 3051
216 Ga0105241_10171949 3300009174 Bacteria 1790
217 Ga0105241_10697018 3300009174 Bacteria 927
218 Ga0105242_10088622 3300009176 Bacteria 2600
219 Ga0105248_10325701 3300009177 Bacteria 1730
220 Ga0105237_10000653 3300009545 Bacteria 48464
221 Ga0105237_10004145 3300009545 Bacteria 16891
222 Ga0105237_10009769 3300009545 Bacteria 10262
223 Ga0105237_10020210 3300009545 Bacteria 6873
224 Ga0105237_10215301 3300009545 Bacteria 1921
225 Ga0105237_10607693 3300009545 Bacteria 1100
226 Ga0105237_10732091 3300009545 Bacteria 995
227 Ga0105238_10009050 3300009551 Bacteria 9961
228 Ga0105238_10038672 3300009551 Bacteria 4844
229 Ga0105238_10050078 3300009551 Bacteria 4205
230 Ga0105238_10097198 3300009551 Bacteria 2931
231 Ga0105238_10146154 3300009551 Bacteria 2341
232 Ga0105238_10194981 3300009551 Bacteria 2001
233 Ga0105238_10285722 3300009551 Bacteria 1631
234 Ga0105238_11187230 3300009551 Bacteria 787
235 Ga0105249_10148072 3300009553 Bacteria 2257
236 Ga0099796_10011391 3300010159 Bacteria 2480
237 Ga0099796_10048120 3300010159 Bacteria 1469
238 Ga0105239_10046661 3300010375 Bacteria 4747
239 Ga0105239_10074545 3300010375 Bacteria 3731
240 Ga0105239_10083618 3300010375 Bacteria 3515
241 Ga0105239_10089022 3300010375 Bacteria 3404
242 Ga0105239_10098988 3300010375 Bacteria 3224
243 Ga0105239_10106169 3300010375 Bacteria 3111
244 Ga0105239_10141128 3300010375 Bacteria 2684
245 Ga0105239_10681398 3300010375 Bacteria 1175
246 Ga0105246_10098918 3300011119 Bacteria 2120
247 Ga0157370_10079560 3300013104 Bacteria 3086
248 Ga0157370_10171667 3300013104 Bacteria 2016
249 Ga0157370_10310123 3300013104 Bacteria 1456
250 Ga0157370_10311510 3300013104 Bacteria 1452
251 Ga0157369_10003596 3300013105 Bacteria 18418
252 Ga0157369_10022335 3300013105 Bacteria 7062
253 Ga0157369_10037100 3300013105 Bacteria 5338
254 Ga0157369_10422186 3300013105 Bacteria 1382
255 Ga0157374_10353677 3300013296 Bacteria 1460
256 Ga0157374_11004044 3300013296 Bacteria 854
257 Ga0157378_10020146 3300013297 Bacteria 5866
258 Ga0157378_10401252 3300013297 Bacteria 1351
259 Ga0163162_10094550 3300013306 Bacteria 3075
260 Ga0163162_10215841 3300013306 Bacteria 2048
261 Ga0163162_10585239 3300013306 Bacteria 1243
262 Ga0157375_11277906 3300013308 Bacteria 862
263 Ga0163163_10108183 3300014325 Bacteria 2807
264 Ga0163163_10311906 3300014325 Bacteria 1626
265 Ga0163163_10429042 3300014325 Bacteria 1381
266 Ga0157380_10207632 3300014326 Bacteria 1743
267 Ga0157377_10100591 3300014745 Bacteria 1722
268 Ga0157377_10204491 3300014745 Bacteria 1256
269 Ga0214544_1000006 3300021320 Bacteria 380728
270 Ga0214544_1003487 3300021320 Bacteria 32432
271 Ga0214542_1000002 3300021321 Bacteria 720798
272 Ga0214545_1000002 3300021324 Bacteria 727485
273 Ga0214543_1000017 3300021327 Bacteria 290109
274 Ga0213876_10001081 3300021384 Bacteria 17491
275 Ga0213875_10000651 3300021388 Bacteria 27647
276 Ga0213875_10053548 3300021388 Bacteria 1890
277 Ga0224712_10018155 3300022467 Bacteria 2346
278 Ga0209563_105456 3300025230 Bacteria 2304
279 Ga0209677_109696 3300025253 Bacteria 1692
280 Ga0209677_110235 3300025253 Bacteria 1584
281 Ga0209233_1003327 3300025261 Bacteria 5697
282 Ga0209673_1038688 3300025273 Bacteria 1385
283 Ga0209564_1003910 3300025295 Bacteria 9545
284 Ga0209758_1001514 3300025297 Bacteria 26963
285 Ga0209758_1002429 3300025297 Bacteria 19044
286 Ga0209758_1003622 3300025297 Bacteria 13820
287 Ga0209758_1022116 3300025297 Bacteria 2933
288 Ga0209758_1064190 3300025297 Bacteria 1191
289 Ga0209256_1011253 3300025299 Bacteria 3607
290 Ga0207426_1000554 3300025302 Bacteria 51521
291 Ga0207426_1000561 3300025302 Bacteria 50758
292 Ga0207426_1002946 3300025302 Bacteria 9999
293 Ga0207426_1025498 3300025302 Bacteria 1990
294 Ga0209257_1016614 3300025304 Bacteria 2962
295 Ga0209257_1034974 3300025304 Bacteria 1559
296 Ga0209257_1051630 3300025304 Bacteria 1158
297 Ga0207656_10006228 3300025321 Bacteria 4276
298 Ga0207656_10136174 3300025321 Bacteria 1154
299 Ga0207653_10021834 3300025885 Bacteria 2031
300 Ga0207682_10166149 3300025893 Bacteria 1002
301 Ga0207692_10273636 3300025898 Bacteria 1019
302 Ga0207642_10288260 3300025899 Bacteria 947
303 Ga0207710_10021248 3300025900 Bacteria 2779
304 Ga0207710_10188708 3300025900 Bacteria 1014
305 Ga0207710_10271083 3300025900 Bacteria 852
306 Ga0207688_10006431 3300025901 Bacteria 6399
307 Ga0207680_10126979 3300025903 Bacteria 1676
308 Ga0207647_10013302 3300025904 Bacteria 5710
309 Ga0207647_10013822 3300025904 Bacteria 5590
310 Ga0207647_10034768 3300025904 Bacteria 3215
311 Ga0207685_10030001 3300025905 Bacteria 1932
312 Ga0207685_10044592 3300025905 Bacteria 1677
313 Ga0207699_10023095 3300025906 Bacteria 3380
314 Ga0207643_10076610 3300025908 Bacteria 1932
315 Ga0207684_10416237 3300025910 Bacteria 1155
316 Ga0207654_10000803 3300025911 Bacteria 17284
317 Ga0207654_10002540 3300025911 Bacteria 9257
318 Ga0207654_10095614 3300025911 Bacteria 1820
319 Ga0207654_10194886 3300025911 Bacteria 1330
320 Ga0207707_10000651 3300025912 Bacteria 34364
321 Ga0207707_10003041 3300025912 Bacteria 14909
322 Ga0207707_10116849 3300025912 Bacteria 2331
323 Ga0207707_10117177 3300025912 Bacteria 2328
324 Ga0207695_10000029 3300025913 Bacteria 548364
325 Ga0207695_10000062 3300025913 Bacteria 351979
326 Ga0207695_10001543 3300025913 Bacteria 37956
327 Ga0207695_10028927 3300025913 Bacteria 6134
328 Ga0207695_10148018 3300025913 Bacteria 2290
329 Ga0207695_10234406 3300025913 Bacteria 1738
330 Ga0207695_10280482 3300025913 Bacteria 1560
331 Ga0207671_10000377 3300025914 Bacteria 63306
332 Ga0207671_10001548 3300025914 Bacteria 26304
333 Ga0207671_10060773 3300025914 Bacteria 2803
334 Ga0207671_10091814 3300025914 Bacteria 2289
335 Ga0207671_10222544 3300025914 Bacteria 1479
336 Ga0207671_10276956 3300025914 Bacteria 1323
337 Ga0207671_10404529 3300025914 Bacteria 1086
338 Ga0207693_10002906 3300025915 Bacteria 14827
339 Ga0207663_10003355 3300025916 Bacteria 7820
340 Ga0207663_10394774 3300025916 Bacteria 1057
341 Ga0207660_10010504 3300025917 Bacteria 6013
342 Ga0207660_10090240 3300025917 Bacteria 2270
343 Ga0207660_10122975 3300025917 Bacteria 1967
344 Ga0207660_10589950 3300025917 Bacteria 905
345 Ga0207660_10733662 3300025917 Bacteria 806
346 Ga0207657_10009798 3300025919 Bacteria 9604
347 Ga0207649_10229032 3300025920 Bacteria 1328
348 Ga0207652_10002746 3300025921 Bacteria 14780
349 Ga0207652_10009136 3300025921 Bacteria 7979
350 Ga0207694_10001371 3300025924 Bacteria 20975
351 Ga0207694_10012382 3300025924 Bacteria 6428
352 Ga0207694_10063906 3300025924 Bacteria 2867
353 Ga0207694_10104292 3300025924 Bacteria 2250
354 Ga0207694_10125630 3300025924 Bacteria 2052
355 Ga0207694_10269767 3300025924 Bacteria 1396
356 Ga0207650_10081695 3300025925 Bacteria 2452
357 Ga0207650_10548749 3300025925 Bacteria 969
358 Ga0207659_10711480 3300025926 Bacteria 860
359 Ga0207687_10079388 3300025927 Bacteria 2366
360 Ga0207700_10042530 3300025928 Bacteria 3332
361 Ga0207700_10111939 3300025928 Bacteria 2198
362 Ga0207664_10044034 3300025929 Bacteria 3493
363 Ga0207664_10069205 3300025929 Bacteria 2838
364 Ga0207664_10303249 3300025929 Bacteria 1406
365 Ga0207690_10087143 3300025932 Bacteria 2196
366 Ga0207690_10237875 3300025932 Bacteria 1401
367 Ga0207706_10051480 3300025933 Bacteria 3636
368 Ga0207706_10551840 3300025933 Bacteria 992
369 Ga0207686_10261035 3300025934 Bacteria 1270
370 Ga0207686_10319646 3300025934 Bacteria 1159
371 Ga0207669_10509925 3300025937 Bacteria 964
372 Ga0207704_10144127 3300025938 Bacteria 1671
373 Ga0207665_10000992 3300025939 Bacteria 19173
374 Ga0207665_10473251 3300025939 Bacteria 964
375 Ga0207665_10497186 3300025939 Bacteria 942
376 Ga0207711_10198030 3300025941 Bacteria 1832
377 Ga0207711_10202717 3300025941 Bacteria 1811
378 Ga0207689_10163744 3300025942 Bacteria 1832
379 Ga0207661_10073974 3300025944 Bacteria 2792
380 Ga0207661_10350829 3300025944 Bacteria 1331
381 Ga0207661_10876265 3300025944 Bacteria 827
382 Ga0207679_10266034 3300025945 Bacteria 1464
383 Ga0207667_10004319 3300025949 Bacteria 17403
384 Ga0207667_10011988 3300025949 Bacteria 10035
385 Ga0207667_10036266 3300025949 Bacteria 5286
386 Ga0207667_10282458 3300025949 Bacteria 1696
387 Ga0207667_10362496 3300025949 Bacteria 1478
388 Ga0207712_10209129 3300025961 Bacteria 1553
389 Ga0207668_10046894 3300025972 Bacteria 2955
390 Ga0207668_10137309 3300025972 Bacteria 1875
391 Ga0207668_10159620 3300025972 Bacteria 1755
392 Ga0207640_10044979 3300025981 Bacteria 2832
393 Ga0207640_10067614 3300025981 Bacteria 2392
394 Ga0207640_10083757 3300025981 Bacteria 2187
395 Ga0207640_10176400 3300025981 Bacteria 1598
396 Ga0207640_10199915 3300025981 Bacteria 1514
397 Ga0207640_10245816 3300025981 Bacteria 1385
398 Ga0207658_10156458 3300025986 Bacteria 1863
399 Ga0207677_10115054 3300026023 Bacteria 2011
400 Ga0207677_10137085 3300026023 Bacteria 1868
401 Ga0207677_10210359 3300026023 Bacteria 1553
402 Ga0207703_10015407 3300026035 Bacteria 5963
403 Ga0207703_10351452 3300026035 Bacteria 1357
404 Ga0207639_10016887 3300026041 Bacteria 5171
405 Ga0207639_10221559 3300026041 Bacteria 1634
406 Ga0207639_10226599 3300026041 Bacteria 1617
407 Ga0207639_10499882 3300026041 Bacteria 1111
408 Ga0207639_10849609 3300026041 Bacteria 852
409 Ga0207678_10027645 3300026067 Bacteria 4950
410 Ga0207678_10069743 3300026067 Bacteria 3014
411 Ga0207678_10087953 3300026067 Bacteria 2655
412 Ga0207678_10183305 3300026067 Bacteria 1788
413 Ga0207678_10206812 3300026067 Bacteria 1679
414 Ga0207708_10164478 3300026075 Bacteria 1754
415 Ga0207708_10271099 3300026075 Bacteria 1373
416 Ga0207708_10282753 3300026075 Bacteria 1345
417 Ga0207702_10000005 3300026078 Bacteria 420296
418 Ga0207702_10000081 3300026078 Bacteria 108009
419 Ga0207702_10037088 3300026078 Bacteria 4079
420 Ga0207702_10170274 3300026078 Bacteria 1996
421 Ga0207702_10414482 3300026078 Bacteria 1301
422 Ga0207702_10556733 3300026078 Bacteria 1122
423 Ga0207702_10596596 3300026078 Bacteria 1083
424 Ga0207641_10783844 3300026088 Bacteria 942
425 Ga0207648_10097768 3300026089 Bacteria 2569
426 Ga0207648_10546069 3300026089 Bacteria 1064
427 Ga0207676_10315740 3300026095 Bacteria 1432
428 Ga0207676_10319315 3300026095 Bacteria 1425
429 Ga0207674_10011138 3300026116 Bacteria 10114
430 Ga0207674_10077170 3300026116 Bacteria 3338
431 Ga0207674_10198565 3300026116 Bacteria 1955
432 Ga0207675_100215702 3300026118 Bacteria 1848
433 Ga0207683_10246075 3300026121 Bacteria 1631
434 Ga0207698_10062768 3300026142 Bacteria 2904
435 Ga0207698_10155529 3300026142 Bacteria 1991
436 Ga0207698_10301479 3300026142 Bacteria 1492
437 Ga0209588_1097887 3300027671 Bacteria 944
438 Ga0268266_10001551 3300028379 Bacteria 26890
439 Ga0268266_10008591 3300028379 Bacteria 9072
440 Ga0268266_10033130 3300028379 Bacteria 4393
441 Ga0268266_10158615 3300028379 Bacteria 2045
442 Ga0268266_10179360 3300028379 Bacteria 1927
443 Ga0268265_10029366 3300028380 Bacteria 3945
444 Ga0268265_10224043 3300028380 Bacteria 1647
445 Ga0268265_10266094 3300028380 Bacteria 1527
446 Ga0268264_10125311 3300028381 Bacteria 2269
447 Ga0268264_10225841 3300028381 Bacteria 1726
448 Ga0265334_10026414 3300028573 Bacteria 2344
449 Ga0307517_10000062 3300028786 Bacteria 145054
450 Ga0265330_10020621 3300031235 Bacteria 3012
451 Ga0265332_10011685 3300031238 Bacteria 3901
452 Ga0265332_10047997 3300031238 Bacteria 1837
453 Ga0265340_10001013 3300031247 Bacteria 15991
454 Ga0265340_10192352 3300031247 Bacteria 920
455 Ga0265339_10001466 3300031249 Bacteria 17422
456 Ga0265339_10207486 3300031249 Bacteria 964
457 Ga0265331_10026429 3300031250 Bacteria 2918
458 Ga0265331_10142584 3300031250 Bacteria 1089
459 Ga0265327_10001405 3300031251 Bacteria 30666
460 Ga0307509_10082486 3300031507 Bacteria 3317
461 Ga0307408_100057151 3300031548 Bacteria 2831
462 Ga0307408_100271564 3300031548 Bacteria 1408
463 Ga0307408_100917284 3300031548 Bacteria 803
464 Ga0307508_10000532 3300031616 Bacteria 45338
465 Ga0265314_10043780 3300031711 Bacteria 3179
466 Ga0265314_10138884 3300031711 Bacteria 1505
467 Ga0265342_10009526 3300031712 Bacteria 6827
468 Ga0307516_10012214 3300031730 Bacteria 9273
469 Ga0307405_10254792 3300031731 Bacteria 1308
470 Ga0326468_10004453 3300031889 Bacteria 1225
471 Ga0307412_10330192 3300031911 Bacteria 1217
472 Ga0307411_10076597 3300032005 Bacteria 2287
473 Ga0307415_100017135 3300032126 Bacteria 4338
474 Ga0307415_100242030 3300032126 Bacteria 1460
475 Ga0307510_10018748 3300033180 Bacteria 8132
476 Ga0307510_10052699 3300033180 Bacteria 4284
477 Ga0307510_10067265 3300033180 Bacteria 3609
478 Ga0307510_10122729 3300033180 Bacteria 2296
479 Ga0307510_10339700 3300033180 Bacteria 954
480 Ga0315911_1000009 3300033442 Bacteria 379354
481 Ga0373930_0017264 3300034816 Bacteria 1374
482 Ga0373926_0077713 3300035083 Bacteria 1225
483 Ga0373944_0067857 3300035089 Bacteria 1156
484 Ga0373952_0007593 3300035092 Bacteria 2037
485 Ga0373923_0026123 3300035111 Bacteria 2321
486 Ga0373945_0004658 3300035116 Bacteria 4371
487 Ga0373945_0014225 3300035116 Bacteria 2662
488 Ga0373953_0000670 3300035117 Bacteria 9477
489 Ga0373953_0097503 3300035117 Bacteria 1235
490 Ga0373954_0022528 3300035118 Bacteria 2858
491 Ga0373954_0052354 3300035118 Bacteria 1918
492 Ga0373954_0099021 3300035118 Bacteria 1405
493 Ga0373956_0014527 3300035119 Bacteria 3292
494 Ga0373956_0049899 3300035119 Bacteria 1877
495 Ga0373957_0026516 3300035120 Bacteria 2097
496 Ga0373943_0072512 3300035170 Bacteria 1747
497 Ga0373946_0010036 3300035171 Bacteria 3502
498 Ga0373946_0024734 3300035171 Bacteria 2356
499 Ga0373955_0000447 3300035172 Bacteria 17475
500 Ga0373955_0036800 3300035172 Bacteria 2599
501 Ga0373924_0037707 3300035410 Bacteria 1969
502 Ga0373924_0114045 3300035410 Bacteria 1170
503 Ga0373935_0014439 3300035692 Bacteria 4765
504 Ga0373935_0363639 3300035692 Bacteria 1034
505 Ga0373935_0376978 3300035692 Bacteria 1015
506 Ga0373927_0000308 3300035695 Bacteria 38418
507 Ga0373927_0017790 3300035695 Bacteria 4676
508 Ga0373927_0041318 3300035695 Bacteria 2991
509 Ga0373927_0121267 3300035695 Bacteria 1706
510 Ga0373927_0121760 3300035695 Bacteria 1702
511 Ga0373927_0433870 3300035695 Bacteria 867
512 Ga0373933_0000167 3300035724 Bacteria 42851
513 Ga0373933_0002005 3300035724 Bacteria 11741
514 Ga0373933_0131148 3300035724 Bacteria 1576
515 Ga0373933_0355857 3300035724 Bacteria 951
516 Ga0373947_0005045 3300035725 Bacteria 7731
517 Ga0373947_0207985 3300035725 Bacteria 1282
518 Ga0373937_0032925 3300036401 Bacteria 4703
519 Ga0373937_0111275 3300036401 Bacteria 2547
520 Ga0373937_0121748 3300036401 Bacteria 2431
521 Ga0373937_0232231 3300036401 Bacteria 1737
522 Ga0373937_0468026 3300036401 Bacteria 1197
523 Ga0373937_0577469 3300036401 Bacteria 1067
524 Ga0373925_0011523 3300037068 Bacteria 6397
525 Ga0373925_0057967 3300037068 Bacteria 2903
526 Ga0373925_0450282 3300037068 Bacteria 1054
527 Ga0395900_0079214 3300037418 Bacteria 3376
528 Ga0395898_0011573 3300037466 Bacteria 9161
529 Ga0395898_0202367 3300037466 Bacteria 1895
530 Ga0395905_0007709 3300037471 Bacteria 10683
531 Ga0436364_1423953 3300037853 Bacteria 39549
532 Ga0436364_1499714 3300037853 Bacteria 1769
533 Ga0395901_0100247 3300038443 Bacteria 3038
534 Ga0436365_0675790 3300039437 Bacteria 17254
535 Ga0436365_0839146 3300039437 Bacteria 5690
536 Ga0436363_0632867 3300039450 Bacteria 940
537 Ga0451787_806274 3300041441 Bacteria 832
538 Ga0451853_1239521 3300041512 Bacteria 1088
539 Ga0439445_0043448 3300042004 Bacteria 1199
540 Ga0450911_001143 3300042115 Bacteria 6561
541 Ga0466969_0014160 3300044656 Bacteria 4195
542 Ga0466966_0000148 3300044684 Bacteria 44828
543 Ga0466966_0048886 3300044684 Bacteria 2694
544 Ga0466961_0000045 3300044693 Bacteria 75331
545 Ga0466971_0089100 3300044719 Bacteria 1412
546 Ga0466959_0003014 3300045049 Bacteria 10882
547 Ga0466959_0021412 3300045049 Bacteria 4768
548 Ga0466958_0114633 3300045836 Bacteria 1684
549 Ga0495617_010752 3300046452 Bacteria 3133
550 Ga0495592_0010346 3300046454 Bacteria 7034
551 Ga0495592_0027945 3300046454 Bacteria 4273
552 Ga0495592_0028244 3300046454 Bacteria 4250
553 Ga0495592_0052072 3300046454 Bacteria 3040
554 Ga0495592_0123676 3300046454 Bacteria 1817
555 Ga0495603_0000229 3300046455 Bacteria 29318
556 Ga0495603_0026846 3300046455 Bacteria 3478
557 Ga0495603_0084959 3300046455 Bacteria 1853
558 Ga0495629_0000170 3300046459 Bacteria 57733
559 Ga0495629_0001699 3300046459 Bacteria 17299
560 Ga0495629_0384355 3300046459 Bacteria 955
561 Ga0495629_0401755 3300046459 Bacteria 931
562 Ga0495638_0044353 3300046460 Bacteria 2801
563 Ga0495641_0069940 3300046461 Bacteria 1577
564 Ga0495651_0000472 3300046462 Bacteria 30989
565 Ga0495651_0023589 3300046462 Bacteria 4784
566 Ga0495651_0040970 3300046462 Bacteria 3598
567 Ga0495651_0085092 3300046462 Bacteria 2382
568 Ga0495651_0265358 3300046462 Bacteria 1166
569 Ga0495653_0039871 3300046463 Bacteria 3676
570 Ga0495653_0055700 3300046463 Bacteria 3016
571 Ga0495653_0124868 3300046463 Bacteria 1829
572 Ga0495653_0222213 3300046463 Bacteria 1269
573 Ga0495580_0006642 3300046472 Bacteria 9398
574 Ga0495580_0030917 3300046472 Bacteria 3873
575 Ga0495582_0000053 3300046473 Bacteria 58155
576 Ga0495582_0040602 3300046473 Bacteria 2563
577 Ga0495605_0084319 3300046474 Bacteria 1482
578 Ga0495639_0000057 3300046475 Bacteria 49641
579 Ga0495639_0040997 3300046475 Bacteria 2085
580 Ga0495639_0099981 3300046475 Bacteria 1369
581 Ga0495639_0123940 3300046475 Bacteria 1234
582 Ga0495662_0002078 3300046476 Bacteria 10042
583 Ga0495662_0079133 3300046476 Bacteria 1598
584 Ga0495662_0083641 3300046476 Bacteria 1553
585 Ga0495664_0006777 3300046477 Bacteria 6335
586 Ga0495664_0031622 3300046477 Bacteria 3103
587 Ga0495664_0212209 3300046477 Bacteria 1172
588 Ga0495584_0068892 3300046491 Bacteria 1777
589 Ga0495585_0144857 3300046492 Bacteria 1242
590 Ga0495585_0217851 3300046492 Bacteria 964
591 Ga0495594_0000460 3300046499 Bacteria 20731
592 Ga0495606_0005996 3300046507 Bacteria 11391
593 Ga0495606_0237708 3300046507 Bacteria 1017
594 Ga0495606_0305661 3300046507 Bacteria 860
595 Ga0495608_0018937 3300046511 Bacteria 4745
596 Ga0495608_0076289 3300046511 Bacteria 2183
597 Ga0495618_0075509 3300046514 Bacteria 2147
598 Ga0495628_0242716 3300046516 Bacteria 1347
599 Ga0495630_0001122 3300046517 Bacteria 18446
600 Ga0495630_0057730 3300046517 Bacteria 2909
601 Ga0495630_0148560 3300046517 Bacteria 1783
602 Ga0495630_0374557 3300046517 Bacteria 1090
603 Ga0495631_0226238 3300046518 Bacteria 798
604 Ga0495632_0085600 3300046519 Bacteria 1499
605 Ga0495632_0113571 3300046519 Bacteria 1270
606 Ga0495643_0018174 3300046522 Bacteria 4092
607 Ga0495643_0029296 3300046522 Bacteria 3081
608 Ga0495643_0131192 3300046522 Bacteria 1258
609 Ga0495644_0008239 3300046523 Bacteria 4012
610 Ga0495648_0003889 3300046524 Bacteria 12949
611 Ga0495648_0003979 3300046524 Bacteria 12789
612 Ga0495648_0064694 3300046524 Bacteria 2153
613 Ga0495648_0299501 3300046524 Bacteria 754
614 Ga0495666_0071074 3300046526 Bacteria 1655
615 Ga0495666_0254182 3300046526 Bacteria 800
616 Ga0495652_0001339 3300046529 Bacteria 27421
617 Ga0495652_0006658 3300046529 Bacteria 10722
618 Ga0495652_0125363 3300046529 Bacteria 2041
619 Ga0495654_0016091 3300046530 Bacteria 3962
620 Ga0495665_0000197 3300046531 Bacteria 31107
621 Ga0495640_0021032 3300046533 Bacteria 4796
622 Ga0495640_0071777 3300046533 Bacteria 2322
623 Ga0495640_0074865 3300046533 Bacteria 2262
624 Ga0495587_0029630 3300046536 Bacteria 3322
625 Ga0495587_0040242 3300046536 Bacteria 2794
626 Ga0495587_0053040 3300046536 Bacteria 2391
627 Ga0495609_0097413 3300046538 Bacteria 1276
628 Ga0495645_0011359 3300046543 Bacteria 6264
629 Ga0495645_0024020 3300046543 Bacteria 4419
630 Ga0495645_0080421 3300046543 Bacteria 2339
631 Ga0495622_0005868 3300046557 Bacteria 5701
632 Ga0495622_0180853 3300046557 Bacteria 945
633 Ga0495633_0211818 3300046558 Bacteria 888
634 Ga0495667_0007621 3300046559 Bacteria 7343
635 Ga0495667_0076163 3300046559 Bacteria 2182
636 Ga0495656_0001067 3300046615 Bacteria 8878
637 Ga0495668_0024598 3300046616 Bacteria 3425
638 Ga0495668_0083145 3300046616 Bacteria 1756
639 Ga0495634_0001079 3300046642 Bacteria 25459
640 Ga0495634_0013513 3300046642 Bacteria 5898
641 Ga0495634_0038510 3300046642 Bacteria 3260
642 Ga0495634_0054064 3300046642 Bacteria 2688
643 Ga0495634_0134573 3300046642 Bacteria 1573
644 Ga0495611_0121658 3300046648 Bacteria 1217
645 Ga0495625_0068527 3300046660 Bacteria 2494
646 Ga0495635_0000738 3300046663 Bacteria 21137
647 Ga0495635_0000892 3300046663 Bacteria 19578
648 Ga0495635_0003199 3300046663 Bacteria 11290
649 Ga0495635_0045942 3300046663 Bacteria 3012
650 Ga0495635_0074879 3300046663 Bacteria 2319
651 Ga0495635_0101910 3300046663 Bacteria 1962
652 Ga0495661_0155262 3300046665 Bacteria 1233
653 Ga0495588_0020306 3300046674 Bacteria 3263
654 Ga0495588_0140358 3300046674 Bacteria 1276
655 Ga0495588_0152363 3300046674 Bacteria 1222
656 Ga0495657_0001505 3300046675 Bacteria 20049
657 Ga0495657_0005672 3300046675 Bacteria 9843
658 Ga0495599_0055688 3300046678 Bacteria 2476
659 Ga0495599_0117936 3300046678 Bacteria 1650
660 Ga0495599_0191652 3300046678 Bacteria 1257
661 Ga0495623_0002081 3300046679 Bacteria 13394
662 Ga0495623_0024183 3300046679 Bacteria 3918
663 Ga0495623_0081994 3300046679 Bacteria 1994
664 Ga0495646_0003426 3300046680 Bacteria 9862
665 Ga0495646_0013081 3300046680 Bacteria 5275
666 Ga0495646_0196454 3300046680 Bacteria 1100
667 Ga0495646_0259682 3300046680 Bacteria 928
668 Ga0495647_0007031 3300046681 Bacteria 3751
669 Ga0495647_0102394 3300046681 Bacteria 1187
670 Ga0495658_0000217 3300046683 Bacteria 32918
671 Ga0495613_0008961 3300046689 Bacteria 7427
672 Ga0495613_0027045 3300046689 Bacteria 4270
673 Ga0495613_0038530 3300046689 Bacteria 3543
674 Ga0495624_0000394 3300046690 Bacteria 34712
675 Ga0495624_0016604 3300046690 Bacteria 4954
676 Ga0495624_0042045 3300046690 Bacteria 2921
677 Ga0495670_0138809 3300046691 Bacteria 1270
678 Ga0495649_0170489 3300046694 Bacteria 1139
679 Ga0495649_0171476 3300046694 Bacteria 1135
680 Ga0495589_0128172 3300046794 Bacteria 1219
681 Ga0495600_0000845 3300046809 Bacteria 16327
682 Ga0495600_0005855 3300046809 Bacteria 7434
683 Ga0495600_0006605 3300046809 Bacteria 7066
684 Ga0495600_0078209 3300046809 Bacteria 2160
685 Ga0495600_0324747 3300046809 Bacteria 967
686 Ga0495660_0171581 3300046810 Bacteria 1056
687 Ga0495581_0004436 3300047315 Bacteria 8110
688 Ga0495581_0021807 3300047315 Bacteria 3711
689 Ga0495581_0055929 3300047315 Bacteria 2277
690 Ga0495581_0214688 3300047315 Bacteria 1125
691 Ga0495604_0000953 3300047317 Bacteria 24133
692 Ga0495604_0017761 3300047317 Bacteria 5691
693 Ga0495604_0039800 3300047317 Bacteria 3693
694 Ga0495604_0238094 3300047317 Bacteria 1246
695 Ga0495674_0004978 3300047319 Bacteria 12789
696 Ga0495674_0008322 3300047319 Bacteria 9890
697 Ga0495674_0509477 3300047319 Bacteria 962
698 Ga0495672_0015872 3300047320 Bacteria 5099
699 Ga0495676_0014964 3300047321 Bacteria 6924
700 Ga0495676_0047061 3300047321 Bacteria 3493
701 Ga0495676_0054936 3300047321 Bacteria 3162
702 Ga0495680_0001642 3300047322 Bacteria 23759
703 Ga0495680_0001893 3300047322 Bacteria 21968
704 Ga0495680_0098619 3300047322 Bacteria 2180
705 Ga0495680_0161306 3300047322 Bacteria 1628
706 Ga0495683_0131456 3300047323 Bacteria 1180
707 Ga0495687_042211 3300047443 Bacteria 1995
708 Ga0495675_0093671 3300047444 Bacteria 1884
709 Ga0495685_085870 3300047447 Bacteria 1046
710 Ga0495684_0006728 3300047471 Bacteria 8925
711 Ga0495684_0009403 3300047471 Bacteria 7546
712 Ga0495684_0024938 3300047471 Bacteria 4599
713 Ga0495684_0053583 3300047471 Bacteria 3078
714 Ga0495684_0109772 3300047471 Bacteria 2083
715 Ga0495686_0253536 3300047472 Bacteria 988
716 Ga0495593_0002757 3300047673 Bacteria 10572
717 Ga0495593_0002873 3300047673 Bacteria 10388
718 Ga0495593_0015866 3300047673 Bacteria 4256
719 Ga0495602_0020256 3300048088 Bacteria 6577
720 Ga0495602_0389292 3300048088 Bacteria 996
721 Ga0495614_0091285 3300048089 Bacteria 1325
722 Ga0496100_0319100 3300048903 Bacteria 1167
723 Ga0496101_0065804 3300048904 Bacteria 2642
724 Ga0496101_0090109 3300048904 Bacteria 2280
725 Ga0496101_0109387 3300048904 Bacteria 2079
726 Ga0496102_0001946 3300048905 Bacteria 17805
727 Ga0496102_0064657 3300048905 Bacteria 3351
728 Ga0496102_0201037 3300048905 Bacteria 1878
729 Ga0496103_0012612 3300048906 Bacteria 5013
730 Ga0496103_0027762 3300048906 Bacteria 3432
731 Ga0496103_0066527 3300048906 Bacteria 2249
732 Ga0496103_0078239 3300048906 Bacteria 2077
733 Ga0496103_0169812 3300048906 Bacteria 1400
734 Ga0496104_0078088 3300048907 Bacteria 3154
735 Ga0496104_0240491 3300048907 Bacteria 1722
736 Ga0496104_0386154 3300048907 Bacteria 1312
737 Ga0496105_0037440 3300048908 Bacteria 3994
738 Ga0496105_0040337 3300048908 Bacteria 3849
739 Ga0496105_0295863 3300048908 Bacteria 1302
740 Ga0496105_0353630 3300048908 Bacteria 1173
741 Ga0496105_0436935 3300048908 Bacteria 1034
742 Ga0496106_0124135 3300048909 Bacteria 2020
743 Ga0496106_0315095 3300048909 Bacteria 1255
744 Ga0496106_0685904 3300048909 Bacteria 817
745 Ga0496107_0038935 3300048910 Bacteria 3410
746 Ga0496107_0337572 3300048910 Bacteria 1121
747 Ga0496108_0015476 3300048911 Bacteria 6222
748 Ga0496108_0116701 3300048911 Bacteria 2287
749 Ga0496108_0213485 3300048911 Bacteria 1675
750 Ga0496109_0118736 3300048912 Bacteria 2462
751 Ga0496109_0613430 3300048912 Bacteria 1024
752 Ga0496109_0760537 3300048912 Bacteria 907
753 Ga0496110_0067716 3300048913 Bacteria 3159
754 Ga0496110_0074209 3300048913 Bacteria 3020
755 Ga0496110_0090694 3300048913 Bacteria 2733
756 Ga0496110_0132515 3300048913 Bacteria 2251
757 Ga0496110_0156028 3300048913 Bacteria 2068
758 Ga0496111_0110305 3300048914 Bacteria 2026
759 Ga0496111_0558727 3300048914 Bacteria 840
760 Ga0496111_0658788 3300048914 Bacteria 763
761 Ga0496112_0000016 3300048915 Bacteria 194634
762 Ga0496112_0042140 3300048915 Bacteria 4466
763 Ga0496112_0151402 3300048915 Bacteria 2287
764 Ga0496112_0271389 3300048915 Bacteria 1644
765 Ga0496112_0321199 3300048915 Bacteria 1492
766 Ga0496112_1053061 3300048915 Bacteria 732
767 Ga0496113_0027119 3300048916 Bacteria 4102
768 Ga0496113_0063686 3300048916 Bacteria 2787
769 Ga0496113_0149844 3300048916 Bacteria 1839
770 Ga0496113_0280656 3300048916 Bacteria 1332
771 Ga0496113_0554159 3300048916 Bacteria 922
772 Ga0496114_0134105 3300048917 Bacteria 2140
773 Ga0496114_0207996 3300048917 Bacteria 1715
774 Ga0496115_0063037 3300048918 Bacteria 2991
775 Ga0496115_0068284 3300048918 Bacteria 2878
776 Ga0496115_0084672 3300048918 Bacteria 2585
777 Ga0496115_0225860 3300048918 Bacteria 1544
778 Ga0496115_0272850 3300048918 Bacteria 1389
779 Ga0496116_0102580 3300048919 Bacteria 1705
780 Ga0496116_0174117 3300048919 Bacteria 1162
781 Ga0496117_0042466 3300048920 Bacteria 3318
782 Ga0496117_0116534 3300048920 Bacteria 1651
783 Ga0496117_0275281 3300048920 Bacteria 904
784 Ga0496118_0021551 3300048921 Bacteria 5667
785 Ga0496118_0343118 3300048921 Bacteria 799
786 Ga0496119_0056679 3300048922 Bacteria 2373
787 Ga0496120_0246339 3300048923 Bacteria 841
788 Ga0496121_0001005 3300048924 Bacteria 50368
789 Ga0496121_0001443 3300048924 Bacteria 40145
790 Ga0496121_0001527 3300048924 Bacteria 38742
791 Ga0496121_0002968 3300048924 Bacteria 24705
792 Ga0496121_0032132 3300048924 Bacteria 4777
793 Ga0496121_0034058 3300048924 Bacteria 4592
794 Ga0496121_0048069 3300048924 Bacteria 3634
795 Ga0496121_0066938 3300048924 Bacteria 2914
796 Ga0496121_0080247 3300048924 Bacteria 2587
797 Ga0496121_0157224 3300048924 Bacteria 1667
798 Ga0496121_0247362 3300048924 Bacteria 1238
799 Ga0496121_0430673 3300048924 Bacteria 856
800 Ga0496124_0002203 3300048927 Bacteria 25990
801 Ga0496124_0059503 3300048927 Bacteria 3209
802 Ga0496124_0258264 3300048927 Bacteria 1284
803 Ga0496124_0286066 3300048927 Bacteria 1199
804 Ga0496125_0016021 3300048928 Bacteria 7217
805 Ga0496125_0052963 3300048928 Bacteria 3332
806 Ga0496125_0094966 3300048928 Bacteria 2219
807 Ga0496125_0339978 3300048928 Bacteria 901
808 Ga0496126_0006684 3300048929 Bacteria 12815
809 Ga0496126_0008612 3300048929 Bacteria 10970
810 Ga0496126_0039188 3300048929 Bacteria 4399
811 Ga0496126_0044454 3300048929 Bacteria 4090
812 Ga0496126_0158878 3300048929 Bacteria 1933
813 Ga0496126_0185158 3300048929 Bacteria 1766
814 Ga0496126_0205651 3300048929 Bacteria 1660
815 Ga0496126_0218476 3300048929 Bacteria 1602
816 Ga0496126_0257761 3300048929 Bacteria 1451
817 Ga0496126_0317843 3300048929 Bacteria 1281
818 Ga0496126_0469135 3300048929 Bacteria 1010
819 Ga0496126_0543136 3300048929 Bacteria 923
820 Ga0495682_0010078 3300049460 Bacteria 3670
821 Ga0501031_0000392 3300049568 Bacteria 25655
822 Ga0501031_0035853 3300049568 Bacteria 3236
823 Ga0501032_0000120 3300049569 Bacteria 64900
824 Ga0501032_0000224 3300049569 Bacteria 46893
825 Ga0501033_0000095 3300049570 Bacteria 84522
826 Ga0501033_0002325 3300049570 Bacteria 16196
827 Ga0501033_0039437 3300049570 Bacteria 3528
828 Ga0501033_0053301 3300049570 Bacteria 2996
829 Ga0501034_0000061 3300049571 Bacteria 195178
830 Ga0501034_0001606 3300049571 Bacteria 29373
831 Ga0501036_0000007 3300049572 Bacteria 240500
832 Ga0501036_0000054 3300049572 Bacteria 74190
833 Ga0501036_0083706 3300049572 Bacteria 2697
834 Ga0501037_0000093 3300049573 Bacteria 83246
835 Ga0501037_0000159 3300049573 Bacteria 63178
836 Ga0501037_0102481 3300049573 Bacteria 2064
837 Ga0501038_0000028 3300049574 Bacteria 144481
838 Ga0501038_0000066 3300049574 Bacteria 86216
839 Ga0501038_0480427 3300049574 Bacteria 952
840 Ga0501038_0716543 3300049574 Bacteria 748
841 Ga0501039_0000005 3300049575 Bacteria 295471
842 Ga0501039_0001528 3300049575 Bacteria 17054
843 Ga0501040_0000178 3300049576 Bacteria 36163
844 Ga0501040_0310093 3300049576 Bacteria 1128
845 Ga0501041_0100216 3300049577 Bacteria 1793
846 Ga0501042_0002439 3300049578 Bacteria 11408
847 Ga0501043_0000127 3300049579 Bacteria 70587
848 Ga0501043_0000161 3300049579 Bacteria 60738
849 Ga0501043_0007172 3300049579 Bacteria 8858
850 Ga0501046_0000032 3300049580 Bacteria 180265
851 Ga0501046_0000487 3300049580 Bacteria 39622
852 Ga0501047_0000077 3300049581 Bacteria 123480
853 Ga0501047_0000122 3300049581 Bacteria 95307
854 Ga0501047_0221890 3300049581 Bacteria 1746
855 Ga0501048_0000053 3300049582 Bacteria 57136
856 Ga0501048_0000693 3300049582 Bacteria 24501
857 Ga0501048_0274289 3300049582 Bacteria 1199
858 Ga0501067_0000387 3300049583 Bacteria 23972
859 Ga0501067_0002698 3300049583 Bacteria 9791
860 Ga0501067_0069156 3300049583 Bacteria 1955
861 Ga0501068_0003190 3300049584 Bacteria 8780
862 Ga0501068_0575651 3300049584 Bacteria 733
863 Ga0501069_0025455 3300049585 Bacteria 3234
864 Ga0501070_0000070 3300049586 Bacteria 86706
865 Ga0501070_0001577 3300049586 Bacteria 20268
866 Ga0501070_0052424 3300049586 Bacteria 3386
867 Ga0501070_0170080 3300049586 Bacteria 1795
868 Ga0501070_0291090 3300049586 Bacteria 1331
869 Ga0501072_0021593 3300049588 Bacteria 4992
870 Ga0501072_0360152 3300049588 Bacteria 1155
871 Ga0501073_0000146 3300049589 Bacteria 46947
872 Ga0501073_0002706 3300049589 Bacteria 13270
873 Ga0501074_0000302 3300049590 Bacteria 28413
874 Ga0501074_0000712 3300049590 Bacteria 20837
875 Ga0501079_0042171 3300049741 Bacteria 3525
876 Ga0501079_0749853 3300049741 Bacteria 768
877 Ga0501080_0000035 3300049742 Bacteria 83220
878 Ga0501080_0001268 3300049742 Bacteria 21004
879 Ga0501083_0001199 3300049744 Bacteria 17528
880 Ga0501035_0000016 3300049822 Bacteria 243412
881 Ga0501035_0000099 3300049822 Bacteria 108224
882 Ga0501035_0017185 3300049822 Bacteria 6667
883 Ga0501035_0075976 3300049822 Bacteria 2971
884 Ga0501035_0436005 3300049822 Bacteria 1086
885 Ga0501044_0000184 3300049823 Bacteria 77805
886 Ga0501044_0000195 3300049823 Bacteria 76643
887 Ga0501044_0003221 3300049823 Bacteria 18386
888 Ga0501045_0007673 3300049824 Bacteria 7504
889 Ga0501045_0056317 3300049824 Bacteria 2875
890 nmdc:mga03n38_706_c1 3300050490 Bacteria 8751
891 nmdc:mga03n38_88099_c1 3300050490 Bacteria 1472
892 nmdc:mga00v17_28566_c1 3300050491 Bacteria 3267
893 nmdc:mga00v17_72468_c1 3300050491 Bacteria 2137
894 nmdc:mga0yw44_127073_c1 3300050492 Bacteria 1647
895 nmdc:mga0yw44_187503_c1 3300050492 Bacteria 1363
896 nmdc:mga0yw44_243984_c1 3300050492 Bacteria 1195
897 nmdc:mga0k408_62049_c1 3300050493 Bacteria 2173
898 nmdc:mga0k408_66887_c1 3300050493 Bacteria 2094
899 nmdc:mga06z11_21848_c1 3300050494 Bacteria 2979
900 nmdc:mga06z11_228155_c1 3300050494 Bacteria 1090
901 nmdc:mga06z11_31293_c1 3300050494 Bacteria 2584
902 nmdc:mga06z11_326899_c1 3300050494 Bacteria 915
903 nmdc:mga06z11_49391_c1 3300050494 Bacteria 2146
904 nmdc:mga04h51_32121_c1 3300050495 Bacteria 1663
905 nmdc:mga07m45_25157_c1 3300050496 Bacteria 3263
906 nmdc:mga07m45_42469_c1 3300050496 Bacteria 2549
907 nmdc:mga07m45_64176_c1 3300050496 Bacteria 2084
908 nmdc:mga07m45_85363_c1 3300050496 Bacteria 1805
909 nmdc:mga07m45_93490_c1 3300050496 Bacteria 1724
910 nmdc:mga05p37_212739_c1 3300050507 Bacteria 2336
911 nmdc:mga06r32_534461_c1 3300050510 Bacteria 1147
912 nmdc:mga08y16_618560_c1 3300050511 Bacteria 1090
913 nmdc:mga0n895_104311_c1 3300050512 Bacteria 2847
914 nmdc:mga0n895_3366_c1 3300050512 Bacteria 12859
915 nmdc:mga0n895_601180_c1 3300050512 Bacteria 1102
916 nmdc:mga0sz30_44633_c1 3300050516 Bacteria 1868
917 nmdc:mga0sz30_93601_c1 3300050516 Bacteria 1309
918 Ga0495601_0006936 3300053077 Bacteria 6635
919 Ga0495612_0107337 3300053078 Bacteria 1193
920 Ga0500610_0048254 3300053079 Bacteria 2214
921 Ga0500610_0201699 3300053079 Bacteria 958
922 Ga0495655_0101339 3300053083 Bacteria 853
923 Ga0495595_0006154 3300053084 Bacteria 4878
924 Ga0495595_0042423 3300053084 Bacteria 2084
925 Ga0495619_0000394 3300053085 Bacteria 29767
926 Ga0495619_0122341 3300053085 Bacteria 1784
927 Ga0495619_0125308 3300053085 Bacteria 1763
928 Ga0495619_0252328 3300053085 Bacteria 1222
929 Ga0495619_0609520 3300053085 Bacteria 746
930 Ga0500578_0076704 3300053086 Bacteria 2128
931 Ga0500643_000019 3300053087 Bacteria 294301
932 Ga0500643_018453 3300053087 Bacteria 2314
933 Ga0500644_0108254 3300053088 Bacteria 1067
934 Ga0500644_0139703 3300053088 Bacteria 962
935 Ga0500583_0118502 3300053092 Bacteria 1308
936 Ga0500566_0000693 3300053094 Bacteria 18973
937 Ga0500566_0003060 3300053094 Bacteria 9993
938 Ga0500650_0197603 3300053098 Bacteria 917
939 Ga0500554_003608 3300053102 Bacteria 3187
940 Ga0500569_009144 3300053109 Bacteria 2294
941 Ga0500592_000534 3300053116 Bacteria 6290
942 Ga0500592_026600 3300053116 Bacteria 933
943 Ga0500595_000478 3300053119 Bacteria 24694
944 Ga0500595_038724 3300053119 Bacteria 1548
945 Ga0500608_164326 3300053122 Bacteria 959
946 Ga0500642_0014156 3300053130 Bacteria 2959
947 Ga0500655_005086 3300053133 Bacteria 2367
948 Ga0500658_0300200 3300053134 Bacteria 738
949 Ga0500559_0151232 3300053136 Bacteria 1089
950 Ga0500568_0017048 3300053139 Bacteria 3214
951 Ga0500568_0025789 3300053139 Bacteria 2474
952 Ga0500577_0001147 3300053142 Bacteria 6786
953 Ga0500588_0207050 3300053146 Bacteria 728
954 Ga0500590_035468 3300053148 Bacteria 2582
955 Ga0500590_104749 3300053148 Bacteria 1352
956 Ga0500603_005174 3300053150 Bacteria 2797
957 Ga0500616_0000085 3300053153 Bacteria 193192
958 Ga0500622_0018556 3300053156 Bacteria 3698
959 Ga0500627_0000040 3300053158 Bacteria 68950
960 Ga0500627_0036963 3300053158 Bacteria 2082
961 Ga0500634_0131780 3300053161 Bacteria 1199
962 Ga0500636_0000410 3300053177 Bacteria 23626
963 Ga0500637_0000245 3300053178 Bacteria 20132
964 Ga0500637_0000260 3300053178 Bacteria 19731
965 Ga0500637_0044618 3300053178 Bacteria 2512
966 Ga0500645_076050 3300053730 Bacteria 960
967 Ga0500601_000120 3300053737 Bacteria 16487
968 Ga0501084_0002556 3300054114 Bacteria 14660
969 Ga0500661_042459 3300055283 Bacteria 806
970 Ga0501082_0027232 3300060353 Bacteria 4922

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053134 Ga0500658_0300200 Ga0500658_0300200_129_728 196
2 3300021388 Ga0213875_10000651 Ga0213875_1000065110 205
3 3300037853 Ga0436364_1423953 Ga0436364_1423953_8524_9144 205
4 3300005336 Ga0070680_100046138 Ga0070680_1000461383 223
5 3300005458 Ga0070681_10146132 Ga0070681_101461322 223
6 3300005535 Ga0070684_100908407 Ga0070684_1009084071 223
7 3300005539 Ga0068853_100216372 Ga0068853_1002163722 223
8 3300005563 Ga0068855_100000788 Ga0068855_1000007889 223
9 3300005578 Ga0068854_100352473 Ga0068854_1003524732 223
10 3300005614 Ga0068856_100023174 Ga0068856_1000231745 223
11 3300005937 Ga0081455_10000453 Ga0081455_100004532 223
12 3300005937 Ga0081455_10021358 Ga0081455_100213584 223
13 3300006237 Ga0097621_100438501 Ga0097621_1004385012 223
14 3300009093 Ga0105240_10074926 Ga0105240_100749262 223
15 3300009551 Ga0105238_10097198 Ga0105238_100971983 223
16 3300025912 Ga0207707_10117177 Ga0207707_101171773 223
17 3300025913 Ga0207695_10280482 Ga0207695_102804823 223
18 3300025924 Ga0207694_10104292 Ga0207694_101042923 223
19 3300025949 Ga0207667_10011988 Ga0207667_100119885 223
20 3300025981 Ga0207640_10067614 Ga0207640_100676142 223
21 3300026041 Ga0207639_10226599 Ga0207639_102265993 223
22 3300026078 Ga0207702_10037088 Ga0207702_100370883 223
23 3300026142 Ga0207698_10062768 Ga0207698_100627683 223
24 3300035083 Ga0373926_0077713 Ga0373926_0077713_262_1050 223
25 3300036401 Ga0373937_0232231 Ga0373937_0232231_226_1014 223
26 3300046454 Ga0495592_0052072 Ga0495592_0052072_872_1660 223
27 3300046477 Ga0495664_0031622 Ga0495664_0031622_889_1677 223
28 3300046517 Ga0495630_0057730 Ga0495630_0057730_2109_2897 223
29 3300046533 Ga0495640_0074865 Ga0495640_0074865_547_1335 223
30 3300046678 Ga0495599_0055688 Ga0495599_0055688_1678_2466 223
31 3300046809 Ga0495600_0324747 Ga0495600_0324747_140_928 223
32 3300047315 Ga0495581_0021807 Ga0495581_0021807_687_1475 223
33 3300047471 Ga0495684_0009403 Ga0495684_0009403_302_1090 223
34 3300009545 Ga0105237_10009769 Ga0105237_1000976910 224
35 3300025914 Ga0207671_10001548 Ga0207671_1000154825 224
36 3300025981 Ga0207640_10044979 Ga0207640_100449792 224
37 3300033180 Ga0307510_10067265 Ga0307510_100672653 224
38 3300046530 Ga0495654_0016091 Ga0495654_0016091_830_1513 224
39 3300046694 Ga0495649_0171476 Ga0495649_0171476_360_1043 224
40 3300053116 Ga0500592_000534 Ga0500592_000534_4747_5430 224
41 3300053158 Ga0500627_0000040 Ga0500627_0000040_4374_5057 224
42 3300053158 Ga0500627_0036963 Ga0500627_0036963_68_751 224
43 3300005328 Ga0070676_10290013 Ga0070676_102900132 225
44 3300005614 Ga0068856_100524033 Ga0068856_1005240331 225
45 3300006051 Ga0075364_10375182 Ga0075364_103751822 225
46 3300009093 Ga0105240_10699128 Ga0105240_106991281 225
47 3300026078 Ga0207702_10596596 Ga0207702_105965961 225
48 3300050491 nmdc:mga00v17_72468_c1 nmdc:mga00v17_72468_c1_1341_2033 225
49 3300049576 Ga0501040_0000178 Ga0501040_0000178_21961_22650 226
50 3300049576 Ga0501040_0310093 Ga0501040_0310093_69_758 226
51 3300049578 Ga0501042_0002439 Ga0501042_0002439_9541_10230 226
52 3300048924 Ga0496121_0048069 Ga0496121_0048069_1009_1707 227
53 3300053142 Ga0500577_0001147 Ga0500577_0001147_4120_4818 227
54 3300021320 Ga0214544_1003487 Ga0214544_100348710 228
55 3300025297 Ga0209758_1001514 Ga0209758_100151421 228
56 3300025893 Ga0207682_10166149 Ga0207682_101661492 228
57 3300031251 Ga0265327_10001405 Ga0265327_1000140514 228
58 3300031548 Ga0307408_100917284 Ga0307408_1009172841 228
59 3300046524 Ga0495648_0064694 Ga0495648_0064694_865_1566 228
60 3300048924 Ga0496121_0001527 Ga0496121_0001527_13855_14541 228
61 iso_pu_bacteria 2876808645 2876811735 228
62 iso_pu_bacteria 2879110137 2879118782 228
63 3300006178 Ga0075367_10067317 Ga0075367_100673172 229
64 3300042004 Ga0439445_0043448 Ga0439445_0043448_358_1068 229
65 3300042115 Ga0450911_001143 Ga0450911_001143_3685_4395 229
66 3300048924 Ga0496121_0002968 Ga0496121_0002968_6239_6946 229
67 3300048928 Ga0496125_0016021 Ga0496125_0016021_859_1563 229
68 3300050494 nmdc:mga06z11_49391_c1 nmdc:mga06z11_49391_c1_791_1576 229
69 3300053119 Ga0500595_038724 Ga0500595_038724_450_1154 229
70 iso_pu_bacteria 2508501128 2509147609 229
71 iso_pu_bacteria 2513237095 2513652263 229
72 iso_pu_bacteria 2513237098 2513676381 229
73 iso_pu_bacteria 2513237102 2513700259 229
74 iso_pu_bacteria 2513237139 2513876070 229
75 iso_pu_bacteria 2513237161 2514011271 229
76 iso_pu_bacteria 2517093001 2517103274 229
77 iso_pu_bacteria 2524023205 2524439006 229
78 iso_pu_bacteria 2528768022 2528852736 229
79 iso_pu_bacteria 2617270735 2617353444 229
80 iso_pu_bacteria 2617270741 2617377995 229
81 iso_pu_bacteria 2744054633 2745078881 229
82 iso_pu_bacteria 2791355196 2793060039 229
83 iso_pu_bacteria 2791355199 2793083269 229
84 iso_pu_bacteria 2802429603 2805917397 229
85 iso_pu_bacteria 2816332527 2818242488 229
86 iso_pu_bacteria 2824600985 2824605655 229
87 iso_pu_bacteria 2824609381 2824609906 229
88 iso_pu_bacteria 2824617872 2824625285 229
89 iso_pu_bacteria 2824626560 2824634103 229
90 iso_pu_bacteria 2824635225 2824639831 229
91 iso_pu_bacteria 2824644064 2824648414 229
92 iso_pu_bacteria 2824653114 2824655695 229
93 iso_pu_bacteria 2824661429 2824666581 229
94 iso_pu_bacteria 2824671348 2824674152 229
95 iso_pu_bacteria 2824679649 2824686622 229
96 iso_pu_bacteria 2824687955 2824693206 229
97 iso_pu_bacteria 2824696289 2824698949 229
98 iso_pu_bacteria 2824704595 2824707784 229
99 iso_pu_bacteria 2824714736 2824718340 229
100 iso_pu_bacteria 2824723954 2824728406 229
101 iso_pu_bacteria 2824732956 2824736826 229
102 iso_pu_bacteria 2824746037 2824751080 229
103 iso_pu_bacteria 2824753945 2824758093 229
104 iso_pu_bacteria 2824763712 2824766231 229
105 iso_pu_bacteria 2824773399 2824774248 229
106 iso_pu_bacteria 2838122688 2838127581 229
107 iso_pu_bacteria 2841941048 2841941468 229
108 iso_pu_bacteria 2841949485 2841952521 229
109 iso_pu_bacteria 2841957949 2841959539 229
110 iso_pu_bacteria 2841966195 2841967609 229
111 iso_pu_bacteria 2841974524 2841979000 229
112 iso_pu_bacteria 2841983080 2841986542 229
113 iso_pu_bacteria 2842038055 2842038310 229
114 iso_pu_bacteria 2842045827 2842048745 229
115 iso_pu_bacteria 2844315083 2844317782 229
116 iso_pu_bacteria 2847939898 2847945181 229
117 iso_pu_bacteria 2849076700 2849080639 229
118 iso_pu_bacteria 2874620515 2874623259 229
119 iso_pu_bacteria 2874628541 2874635963 229
120 iso_pu_bacteria 2879099564 2879104034 229
121 iso_pu_bacteria 2881364244 2881365630 229
122 iso_pu_bacteria 2885366525 2885372480 229
123 iso_pu_bacteria 2885409591 2885411797 229
124 iso_pu_bacteria 2888378607 2888382517 229
125 iso_pu_bacteria 2888388044 2888388181 229
126 iso_pu_bacteria 2888419890 2888423094 229
127 iso_pu_bacteria 2889033259 2889039172 229
128 iso_pu_bacteria 2903727486 2903735460 229
129 iso_pu_bacteria 2903768456 2903775945 229
130 iso_pu_bacteria 2904666416 2904670079 229
131 iso_pu_bacteria 2904711408 2904718417 229
132 iso_pu_bacteria 2906602504 2906607534 229
133 iso_pu_bacteria 2908775508 2908778758 229
134 iso_pu_bacteria 2922368715 2922375441 229
135 iso_pu_bacteria 2922393267 2922395034 229
136 iso_pu_bacteria 2929615660 2929616178 229
137 iso_pu_bacteria 2929624759 2929624922 229
138 iso_pu_bacteria 2932784394 2932787157 229
139 iso_pu_bacteria 2932809354 2932811350 229
140 iso_pu_bacteria 2932828146 2932835774 229
141 iso_pu_bacteria 2933577622 2933578538 229
142 iso_pu_bacteria 2935616580 2935618963 229
143 iso_pu_bacteria 2935638405 2935643220 229
144 iso_pu_bacteria 2935665750 2935669846 229
145 iso_pu_bacteria 2935675223 2935677013 229
146 iso_pu_bacteria 2935684952 2935693054 229
147 iso_pu_bacteria 2935694250 2935695454 229
148 iso_pu_bacteria 2935703347 2935709435 229
149 iso_pu_bacteria 2935713505 2935719662 229
150 iso_pu_bacteria 2935722832 2935729571 229
151 iso_pu_bacteria 2935732158 2935739545 229
152 iso_pu_bacteria 2935741537 2935748583 229
153 iso_pu_bacteria 2935750917 2935756830 229
154 iso_pu_bacteria 2935760218 2935761182 229
155 iso_pu_bacteria 2935801545 2935807363 229
156 iso_pu_bacteria 2935810662 2935812503 229
157 iso_pu_bacteria 2935827899 2935832636 229
158 iso_pu_bacteria 2935837841 2935839285 229
159 iso_pu_bacteria 2935855204 2935857328 229
160 iso_pu_bacteria 2935864058 2935864857 229
161 iso_pu_bacteria 2935873716 2935876635 229
162 iso_pu_bacteria 2936002035 2936008229 229
163 iso_pu_bacteria 2936037263 2936039096 229
164 iso_pu_bacteria 2940556831 2940562744 229
165 iso_pu_bacteria 2941531003 2941536419 229
166 iso_pu_bacteria 2941538514 2941539975 229
167 iso_pu_bacteria 3005506211 3005508687 229
168 iso_pu_bacteria 3005594810 3005597535 229
169 iso_pu_bacteria 3005710791 3005713557 229
170 iso_pu_bacteria 3005718088 3005720959 229
171 iso_pu_bacteria 8006984368 8006991938 229
172 iso_pu_bacteria 8016511872 8016515049 229
173 iso_pu_bacteria 8017057580 8017061404 229
174 iso_pu_bacteria 8019576017 8019580879 229
175 iso_pu_bacteria 8019597564 8019602722 229
176 iso_pu_bacteria 8019608314 8019615837 229
177 iso_pu_bacteria 8055742211 8055747825 229
178 iso_pu_bacteria 8056967851 8056970027 229
179 3300025904 Ga0207647_10013822 Ga0207647_100138222 230
180 3300048924 Ga0496121_0001005 Ga0496121_0001005_44803_45510 230
181 iso_pu_bacteria 2524023228 2524537737 230
182 iso_pu_bacteria 2643221683 2644464691 230
183 iso_pu_bacteria 2667528175 2671124123 230
184 iso_pu_bacteria 2728368998 2728752931 230
185 iso_pu_bacteria 2791355197 2793070711 230
186 iso_pu_bacteria 2904690495 2904691559 230
187 iso_pu_bacteria 2906610324 2906610673 230
188 iso_pu_bacteria 2908739725 2908744196 230
189 iso_pu_bacteria 2908756301 2908761630 230
190 iso_pu_bacteria 2922425934 2922428651 230
191 iso_pu_bacteria 3005474847 3005478782 230
192 iso_pu_bacteria 8016583857 8016593919 230
193 iso_pu_bacteria 8056689827 8056695936 230
194 3300001989 JGI24739J22299_10059542 JGI24739J22299_100595422 231
195 3300005331 Ga0070670_100192058 Ga0070670_1001920582 231
196 3300005335 Ga0070666_10335761 Ga0070666_103357611 231
197 3300005345 Ga0070692_10245797 Ga0070692_102457971 231
198 3300005347 Ga0070668_100033764 Ga0070668_1000337642 231
199 3300005347 Ga0070668_100128620 Ga0070668_1001286202 231
200 3300005441 Ga0070700_100104231 Ga0070700_1001042312 231
201 3300005455 Ga0070663_100040886 Ga0070663_1000408862 231
202 3300005455 Ga0070663_100063505 Ga0070663_1000635052 231
203 3300005456 Ga0070678_100031497 Ga0070678_1000314972 231
204 3300005457 Ga0070662_100146152 Ga0070662_1001461522 231
205 3300005548 Ga0070665_100018629 Ga0070665_1000186293 231
206 3300005563 Ga0068855_100032750 Ga0068855_1000327504 231
207 3300005563 Ga0068855_100398314 Ga0068855_1003983142 231
208 3300005577 Ga0068857_100042265 Ga0068857_1000422652 231
209 3300005615 Ga0070702_100140659 Ga0070702_1001406592 231
210 3300005616 Ga0068852_100290646 Ga0068852_1002906462 231
211 3300005617 Ga0068859_100126365 Ga0068859_1001263652 231
212 3300005618 Ga0068864_100210122 Ga0068864_1002101222 231
213 3300005719 Ga0068861_100019782 Ga0068861_1000197822 231
214 3300005842 Ga0068858_100035309 Ga0068858_1000353092 231
215 3300005843 Ga0068860_100233567 Ga0068860_1002335672 231
216 3300006038 Ga0075365_10220722 Ga0075365_102207221 231
217 3300006042 Ga0075368_10038059 Ga0075368_100380592 231
218 3300006048 Ga0075363_100008449 Ga0075363_1000084494 231
219 3300006051 Ga0075364_10035998 Ga0075364_100359982 231
220 3300006178 Ga0075367_10007429 Ga0075367_100074293 231
221 3300006178 Ga0075367_10119164 Ga0075367_101191642 231
222 3300006186 Ga0075369_10029112 Ga0075369_100291122 231
223 3300006353 Ga0075370_10015506 Ga0075370_100155062 231
224 3300006353 Ga0075370_10080532 Ga0075370_100805322 231
225 3300006353 Ga0075370_10236658 Ga0075370_102366582 231
226 3300006931 Ga0097620_100126373 Ga0097620_1001263732 231
227 3300009093 Ga0105240_10000427 Ga0105240_1000042729 231
228 3300009098 Ga0105245_10174177 Ga0105245_101741772 231
229 3300009101 Ga0105247_10041247 Ga0105247_100412471 231
230 3300009174 Ga0105241_10051616 Ga0105241_100516162 231
231 3300009176 Ga0105242_10088622 Ga0105242_100886222 231
232 3300009177 Ga0105248_10325701 Ga0105248_103257012 231
233 3300009545 Ga0105237_10000653 Ga0105237_100006533 231
234 3300009545 Ga0105237_10215301 Ga0105237_102153012 231
235 3300009545 Ga0105237_10607693 Ga0105237_106076932 231
236 3300009551 Ga0105238_10146154 Ga0105238_101461542 231
237 3300009551 Ga0105238_10194981 Ga0105238_101949811 231
238 3300010375 Ga0105239_10074545 Ga0105239_100745452 231
239 3300010375 Ga0105239_10106169 Ga0105239_101061692 231
240 3300011119 Ga0105246_10098918 Ga0105246_100989182 231
241 3300013296 Ga0157374_10353677 Ga0157374_103536772 231
242 3300013296 Ga0157374_11004044 Ga0157374_110040441 231
243 3300013297 Ga0157378_10020146 Ga0157378_100201463 231
244 3300013308 Ga0157375_11277906 Ga0157375_112779061 231
245 3300014325 Ga0163163_10311906 Ga0163163_103119062 231
246 3300014745 Ga0157377_10100591 Ga0157377_101005912 231
247 3300025900 Ga0207710_10188708 Ga0207710_101887081 231
248 3300025900 Ga0207710_10271083 Ga0207710_102710831 231
249 3300025911 Ga0207654_10002540 Ga0207654_100025402 231
250 3300025913 Ga0207695_10000062 Ga0207695_1000006254 231
251 3300025914 Ga0207671_10000377 Ga0207671_1000037740 231
252 3300025914 Ga0207671_10404529 Ga0207671_104045292 231
253 3300025917 Ga0207660_10733662 Ga0207660_107336621 231
254 3300025920 Ga0207649_10229032 Ga0207649_102290322 231
255 3300025925 Ga0207650_10081695 Ga0207650_100816952 231
256 3300025925 Ga0207650_10548749 Ga0207650_105487491 231
257 3300025927 Ga0207687_10079388 Ga0207687_100793882 231
258 3300025933 Ga0207706_10051480 Ga0207706_100514801 231
259 3300025944 Ga0207661_10876265 Ga0207661_108762651 231
260 3300025949 Ga0207667_10362496 Ga0207667_103624962 231
261 3300026023 Ga0207677_10115054 Ga0207677_101150542 231
262 3300026035 Ga0207703_10015407 Ga0207703_100154072 231
263 3300026067 Ga0207678_10027645 Ga0207678_100276453 231
264 3300026067 Ga0207678_10206812 Ga0207678_102068122 231
265 3300026075 Ga0207708_10271099 Ga0207708_102710991 231
266 3300026095 Ga0207676_10315740 Ga0207676_103157401 231
267 3300026121 Ga0207683_10246075 Ga0207683_102460752 231
268 3300026142 Ga0207698_10301479 Ga0207698_103014792 231
269 3300028379 Ga0268266_10001551 Ga0268266_100015513 231
270 3300028379 Ga0268266_10008591 Ga0268266_100085916 231
271 3300028381 Ga0268264_10225841 Ga0268264_102258412 231
272 3300031250 Ga0265331_10142584 Ga0265331_101425841 231
273 3300031507 Ga0307509_10082486 Ga0307509_100824862 231
274 3300032126 Ga0307415_100017135 Ga0307415_1000171352 231
275 3300033180 Ga0307510_10018748 Ga0307510_100187488 231
276 3300033180 Ga0307510_10052699 Ga0307510_100526993 231
277 3300035695 Ga0373927_0121760 Ga0373927_0121760_540_1235 231
278 3300046452 Ga0495617_010752 Ga0495617_010752_1378_2073 231
279 3300046455 Ga0495603_0026846 Ga0495603_0026846_1999_2694 231
280 3300046461 Ga0495641_0069940 Ga0495641_0069940_12_707 231
281 3300046491 Ga0495584_0068892 Ga0495584_0068892_567_1262 231
282 3300046492 Ga0495585_0144857 Ga0495585_0144857_196_891 231
283 3300046519 Ga0495632_0085600 Ga0495632_0085600_133_828 231
284 3300046522 Ga0495643_0018174 Ga0495643_0018174_67_762 231
285 3300046523 Ga0495644_0008239 Ga0495644_0008239_68_763 231
286 3300046615 Ga0495656_0001067 Ga0495656_0001067_7643_8338 231
287 3300046674 Ga0495588_0152363 Ga0495588_0152363_511_1206 231
288 3300046794 Ga0495589_0128172 Ga0495589_0128172_92_787 231
289 3300047315 Ga0495581_0055929 Ga0495581_0055929_506_1201 231
290 3300047323 Ga0495683_0131456 Ga0495683_0131456_457_1152 231
291 3300047443 Ga0495687_042211 Ga0495687_042211_1088_1783 231
292 3300047447 Ga0495685_085870 Ga0495685_085870_13_708 231
293 3300048905 Ga0496102_0001946 Ga0496102_0001946_12403_13098 231
294 3300048906 Ga0496103_0012612 Ga0496103_0012612_3691_4386 231
295 3300048908 Ga0496105_0295863 Ga0496105_0295863_542_1237 231
296 3300048908 Ga0496105_0353630 Ga0496105_0353630_97_792 231
297 3300048912 Ga0496109_0118736 Ga0496109_0118736_550_1245 231
298 3300048913 Ga0496110_0156028 Ga0496110_0156028_979_1674 231
299 3300048915 Ga0496112_1053061 Ga0496112_1053061_16_711 231
300 3300048916 Ga0496113_0280656 Ga0496113_0280656_177_872 231
301 3300048918 Ga0496115_0272850 Ga0496115_0272850_656_1351 231
302 3300048924 Ga0496121_0034058 Ga0496121_0034058_1132_1827 231
303 3300048924 Ga0496121_0430673 Ga0496121_0430673_24_719 231
304 3300048929 Ga0496126_0218476 Ga0496126_0218476_500_1195 231
305 3300049570 Ga0501033_0053301 Ga0501033_0053301_321_1016 231
306 3300049583 Ga0501067_0069156 Ga0501067_0069156_62_757 231
307 3300050490 nmdc:mga03n38_706_c1 nmdc:mga03n38_706_c1_2099_2794 231
308 3300050490 nmdc:mga03n38_88099_c1 nmdc:mga03n38_88099_c1_16_711 231
309 3300050491 nmdc:mga00v17_28566_c1 nmdc:mga00v17_28566_c1_555_1250 231
310 3300050492 nmdc:mga0yw44_187503_c1 nmdc:mga0yw44_187503_c1_568_1263 231
311 3300050494 nmdc:mga06z11_21848_c1 nmdc:mga06z11_21848_c1_802_1497 231
312 3300050494 nmdc:mga06z11_31293_c1 nmdc:mga06z11_31293_c1_1184_1879 231
313 3300050495 nmdc:mga04h51_32121_c1 nmdc:mga04h51_32121_c1_234_929 231
314 3300050496 nmdc:mga07m45_25157_c1 nmdc:mga07m45_25157_c1_2102_2797 231
315 3300050496 nmdc:mga07m45_42469_c1 nmdc:mga07m45_42469_c1_937_1632 231
316 3300050512 nmdc:mga0n895_104311_c1 nmdc:mga0n895_104311_c1_1603_2298 231
317 3300053086 Ga0500578_0076704 Ga0500578_0076704_499_1194 231
318 3300053088 Ga0500644_0108254 Ga0500644_0108254_58_753 231
319 3300053102 Ga0500554_003608 Ga0500554_003608_2422_3117 231
320 3300053133 Ga0500655_005086 Ga0500655_005086_145_840 231
321 3300053139 Ga0500568_0025789 Ga0500568_0025789_1166_1861 231
322 3300053150 Ga0500603_005174 Ga0500603_005174_1994_2689 231
323 3300053153 Ga0500616_0000085 Ga0500616_0000085_218_913 231
324 3300053178 Ga0500637_0000260 Ga0500637_0000260_17082_17777 231
325 3300005539 Ga0068853_100259998 Ga0068853_1002599982 232
326 3300006028 Ga0070717_10017227 Ga0070717_100172271 232
327 3300006844 Ga0075428_101011838 Ga0075428_1010118381 232
328 3300031616 Ga0307508_10000532 Ga0307508_1000053220 232
329 3300048918 Ga0496115_0084672 Ga0496115_0084672_1763_2461 232
330 3300001990 JGI24737J22298_10033372 JGI24737J22298_100333722 233
331 3300002075 JGI24738J21930_10055969 JGI24738J21930_100559691 233
332 3300003203 JGI25406J46586_10000169 JGI25406J46586_1000016932 233
333 3300003203 JGI25406J46586_10000649 JGI25406J46586_100006491 233
334 3300003215 JGI25153J46596_10001707 JGI25153J46596_1000170710 233
335 3300003215 JGI25153J46596_10006992 JGI25153J46596_100069924 233
336 3300003215 JGI25153J46596_10008439 JGI25153J46596_100084396 233
337 3300003354 JGI25160J50197_1003053 JGI25160J50197_10030534 233
338 3300003354 JGI25160J50197_1008288 JGI25160J50197_10082883 233
339 3300003354 JGI25160J50197_1008476 JGI25160J50197_10084765 233
340 3300003752 Ga0055539_1011509 Ga0055539_10115091 233
341 3300005262 Ga0065165_1003321 Ga0065165_10033212 233
342 3300005262 Ga0065165_1020904 Ga0065165_10209043 233
343 3300005289 Ga0065704_10239132 Ga0065704_102391321 233
344 3300005327 Ga0070658_10364883 Ga0070658_103648831 233
345 3300005329 Ga0070683_100097821 Ga0070683_1000978212 233
346 3300005329 Ga0070683_100385969 Ga0070683_1003859691 233
347 3300005331 Ga0070670_100365218 Ga0070670_1003652182 233
348 3300005334 Ga0068869_100334157 Ga0068869_1003341572 233
349 3300005336 Ga0070680_100023477 Ga0070680_1000234774 233
350 3300005336 Ga0070680_100124919 Ga0070680_1001249192 233
351 3300005337 Ga0070682_100077343 Ga0070682_1000773432 233
352 3300005339 Ga0070660_100046974 Ga0070660_1000469742 233
353 3300005347 Ga0070668_100031965 Ga0070668_1000319654 233
354 3300005347 Ga0070668_100200452 Ga0070668_1002004522 233
355 3300005347 Ga0070668_100219133 Ga0070668_1002191332 233
356 3300005347 Ga0070668_100224269 Ga0070668_1002242692 233
357 3300005354 Ga0070675_100825607 Ga0070675_1008256071 233
358 3300005355 Ga0070671_100040085 Ga0070671_1000400854 233
359 3300005366 Ga0070659_100087281 Ga0070659_1000872812 233
360 3300005366 Ga0070659_100333063 Ga0070659_1003330631 233
361 3300005366 Ga0070659_100476292 Ga0070659_1004762922 233
362 3300005367 Ga0070667_100227901 Ga0070667_1002279012 233
363 3300005434 Ga0070709_10206931 Ga0070709_102069312 233
364 3300005435 Ga0070714_100100246 Ga0070714_1001002463 233
365 3300005435 Ga0070714_100192957 Ga0070714_1001929572 233
366 3300005436 Ga0070713_100027904 Ga0070713_1000279045 233
367 3300005436 Ga0070713_100396813 Ga0070713_1003968131 233
368 3300005436 Ga0070713_100451308 Ga0070713_1004513082 233
369 3300005441 Ga0070700_100117878 Ga0070700_1001178781 233
370 3300005441 Ga0070700_100220087 Ga0070700_1002200871 233
371 3300005444 Ga0070694_100134244 Ga0070694_1001342443 233
372 3300005455 Ga0070663_100067318 Ga0070663_1000673183 233
373 3300005455 Ga0070663_100269348 Ga0070663_1002693482 233
374 3300005456 Ga0070678_100170663 Ga0070678_1001706632 233
375 3300005456 Ga0070678_100253457 Ga0070678_1002534572 233
376 3300005457 Ga0070662_100187747 Ga0070662_1001877472 233
377 3300005458 Ga0070681_10017761 Ga0070681_100177612 233
378 3300005458 Ga0070681_10092691 Ga0070681_100926912 233
379 3300005471 Ga0070698_100118647 Ga0070698_1001186473 233
380 3300005471 Ga0070698_100219634 Ga0070698_1002196343 233
381 3300005518 Ga0070699_100116665 Ga0070699_1001166652 233
382 3300005518 Ga0070699_100297398 Ga0070699_1002973982 233
383 3300005530 Ga0070679_100006433 Ga0070679_1000064339 233
384 3300005530 Ga0070679_100061259 Ga0070679_1000612592 233
385 3300005535 Ga0070684_100374133 Ga0070684_1003741332 233
386 3300005536 Ga0070697_100465339 Ga0070697_1004653391 233
387 3300005539 Ga0068853_100043317 Ga0068853_1000433172 233
388 3300005539 Ga0068853_100394271 Ga0068853_1003942712 233
389 3300005543 Ga0070672_100654552 Ga0070672_1006545521 233
390 3300005546 Ga0070696_100328123 Ga0070696_1003281231 233
391 3300005548 Ga0070665_100152028 Ga0070665_1001520283 233
392 3300005548 Ga0070665_100431006 Ga0070665_1004310062 233
393 3300005563 Ga0068855_100083449 Ga0068855_1000834494 233
394 3300005563 Ga0068855_100492029 Ga0068855_1004920292 233
395 3300005564 Ga0070664_100515091 Ga0070664_1005150911 233
396 3300005564 Ga0070664_100519623 Ga0070664_1005196231 233
397 3300005577 Ga0068857_100252354 Ga0068857_1002523542 233
398 3300005614 Ga0068856_100000236 Ga0068856_10000023617 233
399 3300005614 Ga0068856_100155121 Ga0068856_1001551214 233
400 3300005614 Ga0068856_100481100 Ga0068856_1004811001 233
401 3300005616 Ga0068852_100157324 Ga0068852_1001573242 233
402 3300005616 Ga0068852_100264170 Ga0068852_1002641701 233
403 3300005618 Ga0068864_100236316 Ga0068864_1002363162 233
404 3300005718 Ga0068866_10409721 Ga0068866_104097211 233
405 3300005719 Ga0068861_100216382 Ga0068861_1002163822 233
406 3300005834 Ga0068851_10008459 Ga0068851_100084594 233
407 3300005841 Ga0068863_100539719 Ga0068863_1005397192 233
408 3300005842 Ga0068858_100245808 Ga0068858_1002458082 233
409 3300005843 Ga0068860_100063240 Ga0068860_1000632402 233
410 3300005844 Ga0068862_100145605 Ga0068862_1001456052 233
411 3300005844 Ga0068862_100368564 Ga0068862_1003685641 233
412 3300005937 Ga0081455_10007549 Ga0081455_100075498 233
413 3300005937 Ga0081455_10040180 Ga0081455_100401804 233
414 3300005981 Ga0081538_10069452 Ga0081538_100694523 233
415 3300005983 Ga0081540_1007278 Ga0081540_10072785 233
416 3300005983 Ga0081540_1011806 Ga0081540_10118065 233
417 3300005985 Ga0081539_10000255 Ga0081539_1000025531 233
418 3300005985 Ga0081539_10039521 Ga0081539_100395213 233
419 3300006028 Ga0070717_10060144 Ga0070717_100601442 233
420 3300006028 Ga0070717_10720248 Ga0070717_107202481 233
421 3300006038 Ga0075365_10145580 Ga0075365_101455801 233
422 3300006038 Ga0075365_10210394 Ga0075365_102103942 233
423 3300006038 Ga0075365_10260931 Ga0075365_102609312 233
424 3300006042 Ga0075368_10046123 Ga0075368_100461232 233
425 3300006048 Ga0075363_100020741 Ga0075363_1000207414 233
426 3300006051 Ga0075364_10070087 Ga0075364_100700873 233
427 3300006173 Ga0070716_100084726 Ga0070716_1000847261 233
428 3300006173 Ga0070716_100332479 Ga0070716_1003324792 233
429 3300006177 Ga0075362_10028091 Ga0075362_100280913 233
430 3300006178 Ga0075367_10327419 Ga0075367_103274191 233
431 3300006186 Ga0075369_10065530 Ga0075369_100655302 233
432 3300006195 Ga0075366_10030200 Ga0075366_100302004 233
433 3300006237 Ga0097621_100410591 Ga0097621_1004105912 233
434 3300006353 Ga0075370_10135918 Ga0075370_101359182 233
435 3300007265 Ga0099794_10043146 Ga0099794_100431462 233
436 3300007265 Ga0099794_10054942 Ga0099794_100549422 233
437 3300007265 Ga0099794_10239654 Ga0099794_102396541 233
438 3300007788 Ga0099795_10209060 Ga0099795_102090601 233
439 3300009092 Ga0105250_10032509 Ga0105250_100325092 233
440 3300009093 Ga0105240_10010641 Ga0105240_100106417 233
441 3300009093 Ga0105240_10562070 Ga0105240_105620702 233
442 3300009094 Ga0111539_11024603 Ga0111539_110246032 233
443 3300009101 Ga0105247_10045143 Ga0105247_100451432 233
444 3300009101 Ga0105247_10063966 Ga0105247_100639662 233
445 3300009101 Ga0105247_10453023 Ga0105247_104530231 233
446 3300009147 Ga0114129_10386990 Ga0114129_103869902 233
447 3300009174 Ga0105241_10054907 Ga0105241_100549073 233
448 3300009174 Ga0105241_10171949 Ga0105241_101719492 233
449 3300009174 Ga0105241_10697018 Ga0105241_106970181 233
450 3300009545 Ga0105237_10004145 Ga0105237_100041458 233
451 3300009545 Ga0105237_10020210 Ga0105237_100202102 233
452 3300009545 Ga0105237_10732091 Ga0105237_107320911 233
453 3300009551 Ga0105238_10009050 Ga0105238_100090508 233
454 3300009551 Ga0105238_10285722 Ga0105238_102857222 233
455 3300009551 Ga0105238_11187230 Ga0105238_111872301 233
456 3300009553 Ga0105249_10148072 Ga0105249_101480722 233
457 3300010159 Ga0099796_10011391 Ga0099796_100113913 233
458 3300010159 Ga0099796_10048120 Ga0099796_100481201 233
459 3300010375 Ga0105239_10046661 Ga0105239_100466614 233
460 3300010375 Ga0105239_10083618 Ga0105239_100836183 233
461 3300010375 Ga0105239_10098988 Ga0105239_100989884 233
462 3300010375 Ga0105239_10141128 Ga0105239_101411282 233
463 3300010375 Ga0105239_10681398 Ga0105239_106813982 233
464 3300013104 Ga0157370_10171667 Ga0157370_101716672 233
465 3300013104 Ga0157370_10310123 Ga0157370_103101232 233
466 3300013105 Ga0157369_10022335 Ga0157369_100223357 233
467 3300013105 Ga0157369_10422186 Ga0157369_104221862 233
468 3300013297 Ga0157378_10401252 Ga0157378_104012522 233
469 3300013306 Ga0163162_10094550 Ga0163162_100945503 233
470 3300013306 Ga0163162_10215841 Ga0163162_102158413 233
471 3300013306 Ga0163162_10585239 Ga0163162_105852392 233
472 3300014325 Ga0163163_10108183 Ga0163163_101081832 233
473 3300014325 Ga0163163_10429042 Ga0163163_104290422 233
474 3300014326 Ga0157380_10207632 Ga0157380_102076322 233
475 3300014745 Ga0157377_10204491 Ga0157377_102044912 233
476 3300021320 Ga0214544_1000006 Ga0214544_1000006362 233
477 3300021321 Ga0214542_1000002 Ga0214542_100000212 233
478 3300021324 Ga0214545_1000002 Ga0214545_1000002707 233
479 3300021327 Ga0214543_1000017 Ga0214543_1000017310 233
480 3300025230 Ga0209563_105456 Ga0209563_1054562 233
481 3300025253 Ga0209677_109696 Ga0209677_1096961 233
482 3300025253 Ga0209677_110235 Ga0209677_1102352 233
483 3300025273 Ga0209673_1038688 Ga0209673_10386882 233
484 3300025295 Ga0209564_1003910 Ga0209564_10039107 233
485 3300025297 Ga0209758_1002429 Ga0209758_100242911 233
486 3300025297 Ga0209758_1003622 Ga0209758_10036226 233
487 3300025297 Ga0209758_1022116 Ga0209758_10221163 233
488 3300025299 Ga0209256_1011253 Ga0209256_10112536 233
489 3300025302 Ga0207426_1000554 Ga0207426_10005549 233
490 3300025302 Ga0207426_1000561 Ga0207426_100056130 233
491 3300025302 Ga0207426_1002946 Ga0207426_10029466 233
492 3300025302 Ga0207426_1025498 Ga0207426_10254983 233
493 3300025304 Ga0209257_1016614 Ga0209257_10166143 233
494 3300025304 Ga0209257_1034974 Ga0209257_10349741 233
495 3300025304 Ga0209257_1051630 Ga0209257_10516301 233
496 3300025321 Ga0207656_10006228 Ga0207656_100062282 233
497 3300025885 Ga0207653_10021834 Ga0207653_100218341 233
498 3300025899 Ga0207642_10288260 Ga0207642_102882601 233
499 3300025900 Ga0207710_10021248 Ga0207710_100212483 233
500 3300025901 Ga0207688_10006431 Ga0207688_100064312 233
501 3300025903 Ga0207680_10126979 Ga0207680_101269792 233
502 3300025904 Ga0207647_10034768 Ga0207647_100347682 233
503 3300025905 Ga0207685_10044592 Ga0207685_100445922 233
504 3300025910 Ga0207684_10416237 Ga0207684_104162372 233
505 3300025911 Ga0207654_10095614 Ga0207654_100956142 233
506 3300025911 Ga0207654_10194886 Ga0207654_101948862 233
507 3300025912 Ga0207707_10000651 Ga0207707_1000065115 233
508 3300025912 Ga0207707_10003041 Ga0207707_1000304110 233
509 3300025913 Ga0207695_10000029 Ga0207695_1000002939 233
510 3300025914 Ga0207671_10060773 Ga0207671_100607732 233
511 3300025914 Ga0207671_10091814 Ga0207671_100918142 233
512 3300025917 Ga0207660_10010504 Ga0207660_100105045 233
513 3300025917 Ga0207660_10090240 Ga0207660_100902403 233
514 3300025917 Ga0207660_10122975 Ga0207660_101229752 233
515 3300025917 Ga0207660_10589950 Ga0207660_105899501 233
516 3300025919 Ga0207657_10009798 Ga0207657_100097983 233
517 3300025921 Ga0207652_10002746 Ga0207652_1000274612 233
518 3300025921 Ga0207652_10009136 Ga0207652_100091363 233
519 3300025924 Ga0207694_10012382 Ga0207694_100123824 233
520 3300025924 Ga0207694_10125630 Ga0207694_101256302 233
521 3300025924 Ga0207694_10269767 Ga0207694_102697672 233
522 3300025926 Ga0207659_10711480 Ga0207659_107114801 233
523 3300025928 Ga0207700_10042530 Ga0207700_100425302 233
524 3300025929 Ga0207664_10069205 Ga0207664_100692054 233
525 3300025929 Ga0207664_10303249 Ga0207664_103032491 233
526 3300025932 Ga0207690_10087143 Ga0207690_100871432 233
527 3300025932 Ga0207690_10237875 Ga0207690_102378752 233
528 3300025933 Ga0207706_10551840 Ga0207706_105518402 233
529 3300025934 Ga0207686_10261035 Ga0207686_102610352 233
530 3300025934 Ga0207686_10319646 Ga0207686_103196462 233
531 3300025937 Ga0207669_10509925 Ga0207669_105099251 233
532 3300025938 Ga0207704_10144127 Ga0207704_101441273 233
533 3300025939 Ga0207665_10473251 Ga0207665_104732512 233
534 3300025941 Ga0207711_10198030 Ga0207711_101980301 233
535 3300025941 Ga0207711_10202717 Ga0207711_102027172 233
536 3300025942 Ga0207689_10163744 Ga0207689_101637442 233
537 3300025944 Ga0207661_10073974 Ga0207661_100739742 233
538 3300025944 Ga0207661_10350829 Ga0207661_103508292 233
539 3300025945 Ga0207679_10266034 Ga0207679_102660342 233
540 3300025949 Ga0207667_10282458 Ga0207667_102824581 233
541 3300025961 Ga0207712_10209129 Ga0207712_102091292 233
542 3300025972 Ga0207668_10046894 Ga0207668_100468943 233
543 3300025972 Ga0207668_10137309 Ga0207668_101373092 233
544 3300025972 Ga0207668_10159620 Ga0207668_101596202 233
545 3300025981 Ga0207640_10176400 Ga0207640_101764002 233
546 3300025981 Ga0207640_10245816 Ga0207640_102458161 233
547 3300025986 Ga0207658_10156458 Ga0207658_101564582 233
548 3300026023 Ga0207677_10137085 Ga0207677_101370852 233
549 3300026023 Ga0207677_10210359 Ga0207677_102103591 233
550 3300026035 Ga0207703_10351452 Ga0207703_103514522 233
551 3300026041 Ga0207639_10016887 Ga0207639_100168872 233
552 3300026041 Ga0207639_10221559 Ga0207639_102215592 233
553 3300026041 Ga0207639_10499882 Ga0207639_104998822 233
554 3300026067 Ga0207678_10069743 Ga0207678_100697433 233
555 3300026067 Ga0207678_10183305 Ga0207678_101833052 233
556 3300026075 Ga0207708_10164478 Ga0207708_101644782 233
557 3300026075 Ga0207708_10282753 Ga0207708_102827531 233
558 3300026078 Ga0207702_10000081 Ga0207702_10000081114 233
559 3300026078 Ga0207702_10170274 Ga0207702_101702742 233
560 3300026088 Ga0207641_10783844 Ga0207641_107838442 233
561 3300026089 Ga0207648_10097768 Ga0207648_100977683 233
562 3300026089 Ga0207648_10546069 Ga0207648_105460691 233
563 3300026095 Ga0207676_10319315 Ga0207676_103193152 233
564 3300026116 Ga0207674_10077170 Ga0207674_100771702 233
565 3300026116 Ga0207674_10198565 Ga0207674_101985652 233
566 3300026118 Ga0207675_100215702 Ga0207675_1002157022 233
567 3300026142 Ga0207698_10155529 Ga0207698_101555292 233
568 3300027671 Ga0209588_1097887 Ga0209588_10978871 233
569 3300028379 Ga0268266_10033130 Ga0268266_100331301 233
570 3300028379 Ga0268266_10158615 Ga0268266_101586151 233
571 3300028379 Ga0268266_10179360 Ga0268266_101793602 233
572 3300028380 Ga0268265_10029366 Ga0268265_100293665 233
573 3300028380 Ga0268265_10224043 Ga0268265_102240432 233
574 3300028380 Ga0268265_10266094 Ga0268265_102660942 233
575 3300028381 Ga0268264_10125311 Ga0268264_101253112 233
576 3300031235 Ga0265330_10020621 Ga0265330_100206214 233
577 3300031238 Ga0265332_10011685 Ga0265332_100116853 233
578 3300031247 Ga0265340_10001013 Ga0265340_100010134 233
579 3300031247 Ga0265340_10192352 Ga0265340_101923521 233
580 3300031249 Ga0265339_10001466 Ga0265339_100014668 233
581 3300031249 Ga0265339_10207486 Ga0265339_102074861 233
582 3300031548 Ga0307408_100271564 Ga0307408_1002715642 233
583 3300031711 Ga0265314_10043780 Ga0265314_100437803 233
584 3300031730 Ga0307516_10012214 Ga0307516_100122146 233
585 3300031731 Ga0307405_10254792 Ga0307405_102547922 233
586 3300031889 Ga0326468_10004453 Ga0326468_100044531 233
587 3300031911 Ga0307412_10330192 Ga0307412_103301922 233
588 3300032005 Ga0307411_10076597 Ga0307411_100765972 233
589 3300032126 Ga0307415_100242030 Ga0307415_1002420301 233
590 3300033180 Ga0307510_10122729 Ga0307510_101227294 233
591 3300033180 Ga0307510_10339700 Ga0307510_103397001 233
592 3300034816 Ga0373930_0017264 Ga0373930_0017264_610_1311 233
593 3300035089 Ga0373944_0067857 Ga0373944_0067857_324_1025 233
594 3300035092 Ga0373952_0007593 Ga0373952_0007593_1197_1898 233
595 3300035116 Ga0373945_0004658 Ga0373945_0004658_3208_3909 233
596 3300035116 Ga0373945_0014225 Ga0373945_0014225_127_828 233
597 3300035117 Ga0373953_0097503 Ga0373953_0097503_500_1201 233
598 3300035118 Ga0373954_0052354 Ga0373954_0052354_513_1214 233
599 3300035118 Ga0373954_0099021 Ga0373954_0099021_437_1138 233
600 3300035119 Ga0373956_0014527 Ga0373956_0014527_467_1168 233
601 3300035120 Ga0373957_0026516 Ga0373957_0026516_867_1568 233
602 3300035170 Ga0373943_0072512 Ga0373943_0072512_338_1039 233
603 3300035171 Ga0373946_0010036 Ga0373946_0010036_135_836 233
604 3300035171 Ga0373946_0024734 Ga0373946_0024734_907_1608 233
605 3300035172 Ga0373955_0036800 Ga0373955_0036800_1683_2384 233
606 3300035410 Ga0373924_0037707 Ga0373924_0037707_908_1609 233
607 3300035410 Ga0373924_0114045 Ga0373924_0114045_65_766 233
608 3300035692 Ga0373935_0014439 Ga0373935_0014439_728_1429 233
609 3300035692 Ga0373935_0376978 Ga0373935_0376978_251_952 233
610 3300035695 Ga0373927_0000308 Ga0373927_0000308_36775_37476 233
611 3300035695 Ga0373927_0017790 Ga0373927_0017790_2260_2961 233
612 3300035695 Ga0373927_0041318 Ga0373927_0041318_1920_2621 233
613 3300035695 Ga0373927_0121267 Ga0373927_0121267_783_1484 233
614 3300035695 Ga0373927_0433870 Ga0373927_0433870_26_727 233
615 3300035724 Ga0373933_0000167 Ga0373933_0000167_22904_23605 233
616 3300035724 Ga0373933_0131148 Ga0373933_0131148_226_927 233
617 3300035724 Ga0373933_0355857 Ga0373933_0355857_239_940 233
618 3300035725 Ga0373947_0005045 Ga0373947_0005045_439_1140 233
619 3300035725 Ga0373947_0207985 Ga0373947_0207985_391_1092 233
620 3300036401 Ga0373937_0032925 Ga0373937_0032925_379_1080 233
621 3300036401 Ga0373937_0111275 Ga0373937_0111275_1123_1824 233
622 3300036401 Ga0373937_0468026 Ga0373937_0468026_287_988 233
623 3300036401 Ga0373937_0577469 Ga0373937_0577469_344_1045 233
624 3300037068 Ga0373925_0011523 Ga0373925_0011523_2354_3055 233
625 3300037068 Ga0373925_0057967 Ga0373925_0057967_624_1325 233
626 3300037068 Ga0373925_0450282 Ga0373925_0450282_314_1015 233
627 3300037466 Ga0395898_0202367 Ga0395898_0202367_508_1209 233
628 3300037471 Ga0395905_0007709 Ga0395905_0007709_112_813 233
629 3300038443 Ga0395901_0100247 Ga0395901_0100247_633_1334 233
630 3300039437 Ga0436365_0839146 Ga0436365_0839146_68_769 233
631 3300041441 Ga0451787_806274 Ga0451787_806274_13_714 233
632 3300041512 Ga0451853_1239521 Ga0451853_1239521_73_774 233
633 3300044656 Ga0466969_0014160 Ga0466969_0014160_3056_3757 233
634 3300044684 Ga0466966_0000148 Ga0466966_0000148_35160_35861 233
635 3300044693 Ga0466961_0000045 Ga0466961_0000045_66502_67203 233
636 3300045049 Ga0466959_0003014 Ga0466959_0003014_2548_3249 233
637 3300045836 Ga0466958_0114633 Ga0466958_0114633_673_1374 233
638 3300046454 Ga0495592_0010346 Ga0495592_0010346_1278_1979 233
639 3300046454 Ga0495592_0027945 Ga0495592_0027945_1711_2412 233
640 3300046454 Ga0495592_0028244 Ga0495592_0028244_676_1377 233
641 3300046454 Ga0495592_0123676 Ga0495592_0123676_608_1309 233
642 3300046455 Ga0495603_0000229 Ga0495603_0000229_20030_20731 233
643 3300046459 Ga0495629_0000170 Ga0495629_0000170_9643_10344 233
644 3300046459 Ga0495629_0384355 Ga0495629_0384355_234_935 233
645 3300046459 Ga0495629_0401755 Ga0495629_0401755_38_739 233
646 3300046460 Ga0495638_0044353 Ga0495638_0044353_1848_2549 233
647 3300046462 Ga0495651_0000472 Ga0495651_0000472_18325_19041 233
648 3300046462 Ga0495651_0023589 Ga0495651_0023589_2177_2878 233
649 3300046462 Ga0495651_0265358 Ga0495651_0265358_318_1019 233
650 3300046463 Ga0495653_0039871 Ga0495653_0039871_2382_3098 233
651 3300046463 Ga0495653_0124868 Ga0495653_0124868_1016_1717 233
652 3300046463 Ga0495653_0222213 Ga0495653_0222213_502_1203 233
653 3300046472 Ga0495580_0006642 Ga0495580_0006642_1354_2055 233
654 3300046472 Ga0495580_0030917 Ga0495580_0030917_2344_3045 233
655 3300046473 Ga0495582_0000053 Ga0495582_0000053_6726_7427 233
656 3300046473 Ga0495582_0040602 Ga0495582_0040602_908_1609 233
657 3300046474 Ga0495605_0084319 Ga0495605_0084319_68_769 233
658 3300046475 Ga0495639_0000057 Ga0495639_0000057_21781_22482 233
659 3300046475 Ga0495639_0040997 Ga0495639_0040997_47_748 233
660 3300046475 Ga0495639_0099981 Ga0495639_0099981_537_1238 233
661 3300046475 Ga0495639_0123940 Ga0495639_0123940_476_1177 233
662 3300046476 Ga0495662_0002078 Ga0495662_0002078_8979_9680 233
663 3300046476 Ga0495662_0079133 Ga0495662_0079133_32_748 233
664 3300046476 Ga0495662_0083641 Ga0495662_0083641_432_1133 233
665 3300046477 Ga0495664_0006777 Ga0495664_0006777_5212_5913 233
666 3300046477 Ga0495664_0212209 Ga0495664_0212209_411_1112 233
667 3300046492 Ga0495585_0217851 Ga0495585_0217851_240_941 233
668 3300046499 Ga0495594_0000460 Ga0495594_0000460_10172_10873 233
669 3300046507 Ga0495606_0005996 Ga0495606_0005996_4888_5589 233
670 3300046507 Ga0495606_0237708 Ga0495606_0237708_81_782 233
671 3300046511 Ga0495608_0018937 Ga0495608_0018937_93_809 233
672 3300046514 Ga0495618_0075509 Ga0495618_0075509_1367_2068 233
673 3300046516 Ga0495628_0242716 Ga0495628_0242716_87_803 233
674 3300046517 Ga0495630_0001122 Ga0495630_0001122_17102_17803 233
675 3300046517 Ga0495630_0148560 Ga0495630_0148560_823_1524 233
676 3300046517 Ga0495630_0374557 Ga0495630_0374557_201_902 233
677 3300046518 Ga0495631_0226238 Ga0495631_0226238_49_750 233
678 3300046519 Ga0495632_0113571 Ga0495632_0113571_469_1170 233
679 3300046522 Ga0495643_0029296 Ga0495643_0029296_2153_2854 233
680 3300046522 Ga0495643_0131192 Ga0495643_0131192_19_720 233
681 3300046524 Ga0495648_0003889 Ga0495648_0003889_515_1216 233
682 3300046524 Ga0495648_0003979 Ga0495648_0003979_4230_4931 233
683 3300046524 Ga0495648_0299501 Ga0495648_0299501_24_725 233
684 3300046526 Ga0495666_0071074 Ga0495666_0071074_321_1022 233
685 3300046526 Ga0495666_0254182 Ga0495666_0254182_42_743 233
686 3300046529 Ga0495652_0001339 Ga0495652_0001339_18900_19616 233
687 3300046529 Ga0495652_0006658 Ga0495652_0006658_6521_7222 233
688 3300046529 Ga0495652_0125363 Ga0495652_0125363_844_1545 233
689 3300046531 Ga0495665_0000197 Ga0495665_0000197_10184_10885 233
690 3300046533 Ga0495640_0021032 Ga0495640_0021032_2840_3556 233
691 3300046536 Ga0495587_0040242 Ga0495587_0040242_1373_2089 233
692 3300046536 Ga0495587_0053040 Ga0495587_0053040_134_835 233
693 3300046538 Ga0495609_0097413 Ga0495609_0097413_558_1259 233
694 3300046543 Ga0495645_0011359 Ga0495645_0011359_1981_2682 233
695 3300046543 Ga0495645_0024020 Ga0495645_0024020_726_1427 233
696 3300046543 Ga0495645_0080421 Ga0495645_0080421_586_1302 233
697 3300046557 Ga0495622_0005868 Ga0495622_0005868_1632_2333 233
698 3300046557 Ga0495622_0180853 Ga0495622_0180853_198_899 233
699 3300046558 Ga0495633_0211818 Ga0495633_0211818_117_818 233
700 3300046559 Ga0495667_0007621 Ga0495667_0007621_3084_3800 233
701 3300046559 Ga0495667_0076163 Ga0495667_0076163_1375_2076 233
702 3300046616 Ga0495668_0024598 Ga0495668_0024598_450_1151 233
703 3300046642 Ga0495634_0001079 Ga0495634_0001079_9859_10560 233
704 3300046642 Ga0495634_0013513 Ga0495634_0013513_4225_4941 233
705 3300046642 Ga0495634_0038510 Ga0495634_0038510_2103_2804 233
706 3300046642 Ga0495634_0054064 Ga0495634_0054064_1268_1969 233
707 3300046642 Ga0495634_0134573 Ga0495634_0134573_685_1386 233
708 3300046648 Ga0495611_0121658 Ga0495611_0121658_31_732 233
709 3300046660 Ga0495625_0068527 Ga0495625_0068527_505_1206 233
710 3300046663 Ga0495635_0000738 Ga0495635_0000738_20136_20837 233
711 3300046663 Ga0495635_0003199 Ga0495635_0003199_2207_2908 233
712 3300046663 Ga0495635_0045942 Ga0495635_0045942_1943_2644 233
713 3300046663 Ga0495635_0074879 Ga0495635_0074879_125_841 233
714 3300046663 Ga0495635_0101910 Ga0495635_0101910_1171_1872 233
715 3300046665 Ga0495661_0155262 Ga0495661_0155262_25_726 233
716 3300046674 Ga0495588_0020306 Ga0495588_0020306_1464_2165 233
717 3300046674 Ga0495588_0140358 Ga0495588_0140358_58_759 233
718 3300046675 Ga0495657_0005672 Ga0495657_0005672_6598_7314 233
719 3300046678 Ga0495599_0117936 Ga0495599_0117936_118_819 233
720 3300046679 Ga0495623_0024183 Ga0495623_0024183_324_1040 233
721 3300046680 Ga0495646_0013081 Ga0495646_0013081_839_1555 233
722 3300046680 Ga0495646_0196454 Ga0495646_0196454_366_1067 233
723 3300046680 Ga0495646_0259682 Ga0495646_0259682_26_727 233
724 3300046681 Ga0495647_0007031 Ga0495647_0007031_2039_2740 233
725 3300046681 Ga0495647_0102394 Ga0495647_0102394_406_1107 233
726 3300046683 Ga0495658_0000217 Ga0495658_0000217_18602_19303 233
727 3300046689 Ga0495613_0008961 Ga0495613_0008961_4327_5028 233
728 3300046689 Ga0495613_0027045 Ga0495613_0027045_3183_3899 233
729 3300046690 Ga0495624_0000394 Ga0495624_0000394_6840_7541 233
730 3300046690 Ga0495624_0016604 Ga0495624_0016604_2143_2844 233
731 3300046690 Ga0495624_0042045 Ga0495624_0042045_1777_2478 233
732 3300046691 Ga0495670_0138809 Ga0495670_0138809_349_1050 233
733 3300046694 Ga0495649_0170489 Ga0495649_0170489_321_1022 233
734 3300046809 Ga0495600_0005855 Ga0495600_0005855_5819_6520 233
735 3300046809 Ga0495600_0006605 Ga0495600_0006605_3096_3812 233
736 3300046809 Ga0495600_0078209 Ga0495600_0078209_1308_2009 233
737 3300046810 Ga0495660_0171581 Ga0495660_0171581_194_895 233
738 3300047315 Ga0495581_0004436 Ga0495581_0004436_6865_7566 233
739 3300047315 Ga0495581_0214688 Ga0495581_0214688_12_716 233
740 3300047317 Ga0495604_0000953 Ga0495604_0000953_14878_15594 233
741 3300047317 Ga0495604_0017761 Ga0495604_0017761_3358_4059 233
742 3300047317 Ga0495604_0039800 Ga0495604_0039800_2352_3053 233
743 3300047317 Ga0495604_0238094 Ga0495604_0238094_103_804 233
744 3300047319 Ga0495674_0004978 Ga0495674_0004978_2452_3153 233
745 3300047319 Ga0495674_0008322 Ga0495674_0008322_930_1646 233
746 3300047319 Ga0495674_0509477 Ga0495674_0509477_210_923 233
747 3300047320 Ga0495672_0015872 Ga0495672_0015872_307_1008 233
748 3300047321 Ga0495676_0014964 Ga0495676_0014964_4372_5073 233
749 3300047321 Ga0495676_0047061 Ga0495676_0047061_1044_1745 233
750 3300047321 Ga0495676_0054936 Ga0495676_0054936_462_1163 233
751 3300047322 Ga0495680_0001642 Ga0495680_0001642_18669_19385 233
752 3300047322 Ga0495680_0098619 Ga0495680_0098619_76_777 233
753 3300047322 Ga0495680_0161306 Ga0495680_0161306_194_895 233
754 3300047444 Ga0495675_0093671 Ga0495675_0093671_343_1059 233
755 3300047471 Ga0495684_0024938 Ga0495684_0024938_2425_3126 233
756 3300047471 Ga0495684_0053583 Ga0495684_0053583_1391_2107 233
757 3300047471 Ga0495684_0109772 Ga0495684_0109772_1078_1779 233
758 3300047472 Ga0495686_0253536 Ga0495686_0253536_242_943 233
759 3300047673 Ga0495593_0002757 Ga0495593_0002757_8714_9415 233
760 3300047673 Ga0495593_0015866 Ga0495593_0015866_1648_2349 233
761 3300048088 Ga0495602_0389292 Ga0495602_0389292_122_823 233
762 3300048089 Ga0495614_0091285 Ga0495614_0091285_550_1251 233
763 3300048903 Ga0496100_0319100 Ga0496100_0319100_390_1091 233
764 3300048904 Ga0496101_0065804 Ga0496101_0065804_1816_2517 233
765 3300048904 Ga0496101_0090109 Ga0496101_0090109_1451_2152 233
766 3300048904 Ga0496101_0109387 Ga0496101_0109387_933_1634 233
767 3300048905 Ga0496102_0064657 Ga0496102_0064657_886_1587 233
768 3300048905 Ga0496102_0201037 Ga0496102_0201037_489_1190 233
769 3300048906 Ga0496103_0027762 Ga0496103_0027762_200_901 233
770 3300048906 Ga0496103_0066527 Ga0496103_0066527_1478_2179 233
771 3300048906 Ga0496103_0078239 Ga0496103_0078239_165_866 233
772 3300048906 Ga0496103_0169812 Ga0496103_0169812_566_1267 233
773 3300048907 Ga0496104_0078088 Ga0496104_0078088_388_1089 233
774 3300048907 Ga0496104_0240491 Ga0496104_0240491_250_951 233
775 3300048907 Ga0496104_0386154 Ga0496104_0386154_523_1224 233
776 3300048908 Ga0496105_0037440 Ga0496105_0037440_1844_2545 233
777 3300048908 Ga0496105_0040337 Ga0496105_0040337_1769_2470 233
778 3300048908 Ga0496105_0436935 Ga0496105_0436935_323_1024 233
779 3300048909 Ga0496106_0124135 Ga0496106_0124135_163_864 233
780 3300048909 Ga0496106_0315095 Ga0496106_0315095_234_935 233
781 3300048909 Ga0496106_0685904 Ga0496106_0685904_56_757 233
782 3300048910 Ga0496107_0038935 Ga0496107_0038935_740_1441 233
783 3300048910 Ga0496107_0337572 Ga0496107_0337572_168_869 233
784 3300048911 Ga0496108_0015476 Ga0496108_0015476_543_1244 233
785 3300048911 Ga0496108_0116701 Ga0496108_0116701_771_1472 233
786 3300048911 Ga0496108_0213485 Ga0496108_0213485_635_1336 233
787 3300048912 Ga0496109_0613430 Ga0496109_0613430_263_964 233
788 3300048913 Ga0496110_0067716 Ga0496110_0067716_2096_2797 233
789 3300048913 Ga0496110_0074209 Ga0496110_0074209_176_877 233
790 3300048913 Ga0496110_0090694 Ga0496110_0090694_878_1579 233
791 3300048913 Ga0496110_0132515 Ga0496110_0132515_1378_2079 233
792 3300048914 Ga0496111_0110305 Ga0496111_0110305_57_758 233
793 3300048914 Ga0496111_0558727 Ga0496111_0558727_119_820 233
794 3300048914 Ga0496111_0658788 Ga0496111_0658788_34_735 233
795 3300048915 Ga0496112_0000016 Ga0496112_0000016_85806_86507 233
796 3300048915 Ga0496112_0042140 Ga0496112_0042140_418_1119 233
797 3300048915 Ga0496112_0151402 Ga0496112_0151402_1318_2019 233
798 3300048915 Ga0496112_0271389 Ga0496112_0271389_669_1370 233
799 3300048915 Ga0496112_0321199 Ga0496112_0321199_538_1239 233
800 3300048916 Ga0496113_0027119 Ga0496113_0027119_933_1634 233
801 3300048916 Ga0496113_0063686 Ga0496113_0063686_57_758 233
802 3300048916 Ga0496113_0149844 Ga0496113_0149844_776_1477 233
803 3300048916 Ga0496113_0554159 Ga0496113_0554159_141_842 233
804 3300048917 Ga0496114_0134105 Ga0496114_0134105_1391_2092 233
805 3300048917 Ga0496114_0207996 Ga0496114_0207996_166_867 233
806 3300048918 Ga0496115_0068284 Ga0496115_0068284_658_1359 233
807 3300048918 Ga0496115_0225860 Ga0496115_0225860_649_1350 233
808 3300048919 Ga0496116_0102580 Ga0496116_0102580_353_1054 233
809 3300048919 Ga0496116_0174117 Ga0496116_0174117_316_1035 233
810 3300048920 Ga0496117_0042466 Ga0496117_0042466_1770_2489 233
811 3300048920 Ga0496117_0116534 Ga0496117_0116534_430_1167 233
812 3300048920 Ga0496117_0275281 Ga0496117_0275281_17_718 233
813 3300048921 Ga0496118_0021551 Ga0496118_0021551_2007_2726 233
814 3300048921 Ga0496118_0343118 Ga0496118_0343118_65_766 233
815 3300048922 Ga0496119_0056679 Ga0496119_0056679_1313_2014 233
816 3300048923 Ga0496120_0246339 Ga0496120_0246339_53_790 233
817 3300048924 Ga0496121_0001443 Ga0496121_0001443_22496_23215 233
818 3300048924 Ga0496121_0032132 Ga0496121_0032132_384_1085 233
819 3300048924 Ga0496121_0080247 Ga0496121_0080247_377_1078 233
820 3300048924 Ga0496121_0157224 Ga0496121_0157224_867_1568 233
821 3300048924 Ga0496121_0247362 Ga0496121_0247362_450_1151 233
822 3300048927 Ga0496124_0002203 Ga0496124_0002203_2259_2978 233
823 3300048927 Ga0496124_0059503 Ga0496124_0059503_1087_1839 233
824 3300048927 Ga0496124_0258264 Ga0496124_0258264_556_1257 233
825 3300048928 Ga0496125_0052963 Ga0496125_0052963_887_1606 233
826 3300048928 Ga0496125_0094966 Ga0496125_0094966_1412_2164 233
827 3300048928 Ga0496125_0339978 Ga0496125_0339978_98_799 233
828 3300048929 Ga0496126_0006684 Ga0496126_0006684_1837_2556 233
829 3300048929 Ga0496126_0039188 Ga0496126_0039188_2518_3219 233
830 3300048929 Ga0496126_0158878 Ga0496126_0158878_1213_1914 233
831 3300048929 Ga0496126_0185158 Ga0496126_0185158_786_1487 233
832 3300048929 Ga0496126_0205651 Ga0496126_0205651_447_1148 233
833 3300048929 Ga0496126_0257761 Ga0496126_0257761_428_1129 233
834 3300048929 Ga0496126_0317843 Ga0496126_0317843_467_1222 233
835 3300048929 Ga0496126_0469135 Ga0496126_0469135_40_741 233
836 3300048929 Ga0496126_0543136 Ga0496126_0543136_107_808 233
837 3300049460 Ga0495682_0010078 Ga0495682_0010078_2353_3054 233
838 3300049568 Ga0501031_0000392 Ga0501031_0000392_17511_18212 233
839 3300049569 Ga0501032_0000224 Ga0501032_0000224_18583_19284 233
840 3300049570 Ga0501033_0000095 Ga0501033_0000095_15094_15795 233
841 3300049570 Ga0501033_0039437 Ga0501033_0039437_1584_2285 233
842 3300049571 Ga0501034_0001606 Ga0501034_0001606_10883_11584 233
843 3300049572 Ga0501036_0000007 Ga0501036_0000007_77800_78501 233
844 3300049572 Ga0501036_0083706 Ga0501036_0083706_23_724 233
845 3300049573 Ga0501037_0000159 Ga0501037_0000159_40891_41592 233
846 3300049573 Ga0501037_0102481 Ga0501037_0102481_721_1422 233
847 3300049574 Ga0501038_0000028 Ga0501038_0000028_21977_22678 233
848 3300049574 Ga0501038_0480427 Ga0501038_0480427_117_818 233
849 3300049575 Ga0501039_0000005 Ga0501039_0000005_173690_174391 233
850 3300049577 Ga0501041_0100216 Ga0501041_0100216_445_1161 233
851 3300049579 Ga0501043_0000127 Ga0501043_0000127_17464_18165 233
852 3300049579 Ga0501043_0007172 Ga0501043_0007172_7448_8149 233
853 3300049580 Ga0501046_0000032 Ga0501046_0000032_120633_121334 233
854 3300049581 Ga0501047_0000077 Ga0501047_0000077_77692_78393 233
855 3300049581 Ga0501047_0221890 Ga0501047_0221890_732_1433 233
856 3300049582 Ga0501048_0000693 Ga0501048_0000693_11042_11743 233
857 3300049583 Ga0501067_0002698 Ga0501067_0002698_2221_2922 233
858 3300049584 Ga0501068_0575651 Ga0501068_0575651_22_723 233
859 3300049586 Ga0501070_0000070 Ga0501070_0000070_20964_21665 233
860 3300049586 Ga0501070_0170080 Ga0501070_0170080_680_1381 233
861 3300049588 Ga0501072_0360152 Ga0501072_0360152_334_1035 233
862 3300049589 Ga0501073_0002706 Ga0501073_0002706_7194_7895 233
863 3300049590 Ga0501074_0000302 Ga0501074_0000302_10947_11648 233
864 3300049741 Ga0501079_0749853 Ga0501079_0749853_23_724 233
865 3300049742 Ga0501080_0000035 Ga0501080_0000035_14271_14972 233
866 3300049822 Ga0501035_0000016 Ga0501035_0000016_115673_116374 233
867 3300049822 Ga0501035_0017185 Ga0501035_0017185_5402_6103 233
868 3300049822 Ga0501035_0436005 Ga0501035_0436005_247_963 233
869 3300049823 Ga0501044_0000184 Ga0501044_0000184_59635_60336 233
870 3300049823 Ga0501044_0003221 Ga0501044_0003221_11514_12215 233
871 3300049824 Ga0501045_0056317 Ga0501045_0056317_1920_2621 233
872 3300050492 nmdc:mga0yw44_127073_c1 nmdc:mga0yw44_127073_c1_574_1275 233
873 3300050492 nmdc:mga0yw44_243984_c1 nmdc:mga0yw44_243984_c1_118_819 233
874 3300050493 nmdc:mga0k408_62049_c1 nmdc:mga0k408_62049_c1_189_890 233
875 3300050493 nmdc:mga0k408_66887_c1 nmdc:mga0k408_66887_c1_961_1662 233
876 3300050494 nmdc:mga06z11_228155_c1 nmdc:mga06z11_228155_c1_47_748 233
877 3300050494 nmdc:mga06z11_326899_c1 nmdc:mga06z11_326899_c1_123_863 233
878 3300050496 nmdc:mga07m45_64176_c1 nmdc:mga07m45_64176_c1_549_1250 233
879 3300050496 nmdc:mga07m45_85363_c1 nmdc:mga07m45_85363_c1_299_1000 233
880 3300050496 nmdc:mga07m45_93490_c1 nmdc:mga07m45_93490_c1_394_1095 233
881 3300050507 nmdc:mga05p37_212739_c1 nmdc:mga05p37_212739_c1_834_1535 233
882 3300050510 nmdc:mga06r32_534461_c1 nmdc:mga06r32_534461_c1_198_899 233
883 3300050511 nmdc:mga08y16_618560_c1 nmdc:mga08y16_618560_c1_256_957 233
884 3300050512 nmdc:mga0n895_3366_c1 nmdc:mga0n895_3366_c1_4718_5419 233
885 3300050516 nmdc:mga0sz30_44633_c1 nmdc:mga0sz30_44633_c1_1014_1715 233
886 3300050516 nmdc:mga0sz30_93601_c1 nmdc:mga0sz30_93601_c1_282_983 233
887 3300053078 Ga0495612_0107337 Ga0495612_0107337_395_1096 233
888 3300053079 Ga0500610_0048254 Ga0500610_0048254_1051_1752 233
889 3300053079 Ga0500610_0201699 Ga0500610_0201699_133_834 233
890 3300053083 Ga0495655_0101339 Ga0495655_0101339_19_720 233
891 3300053084 Ga0495595_0042423 Ga0495595_0042423_931_1647 233
892 3300053085 Ga0495619_0122341 Ga0495619_0122341_697_1398 233
893 3300053085 Ga0495619_0125308 Ga0495619_0125308_989_1690 233
894 3300053085 Ga0495619_0252328 Ga0495619_0252328_98_799 233
895 3300053087 Ga0500643_000019 Ga0500643_000019_19836_20651 233
896 3300053087 Ga0500643_018453 Ga0500643_018453_1468_2253 233
897 3300053088 Ga0500644_0139703 Ga0500644_0139703_26_727 233
898 3300053092 Ga0500583_0118502 Ga0500583_0118502_542_1243 233
899 3300053094 Ga0500566_0000693 Ga0500566_0000693_2052_2753 233
900 3300053098 Ga0500650_0197603 Ga0500650_0197603_44_745 233
901 3300053109 Ga0500569_009144 Ga0500569_009144_291_992 233
902 3300053116 Ga0500592_026600 Ga0500592_026600_55_756 233
903 3300053122 Ga0500608_164326 Ga0500608_164326_76_777 233
904 3300053130 Ga0500642_0014156 Ga0500642_0014156_1819_2520 233
905 3300053136 Ga0500559_0151232 Ga0500559_0151232_262_963 233
906 3300053139 Ga0500568_0017048 Ga0500568_0017048_2498_3199 233
907 3300053146 Ga0500588_0207050 Ga0500588_0207050_17_718 233
908 3300053148 Ga0500590_035468 Ga0500590_035468_644_1345 233
909 3300053148 Ga0500590_104749 Ga0500590_104749_364_1092 233
910 3300053156 Ga0500622_0018556 Ga0500622_0018556_1595_2296 233
911 3300053161 Ga0500634_0131780 Ga0500634_0131780_217_1005 233
912 3300053177 Ga0500636_0000410 Ga0500636_0000410_5363_6103 233
913 3300053178 Ga0500637_0044618 Ga0500637_0044618_1128_1829 233
914 3300053730 Ga0500645_076050 Ga0500645_076050_25_726 233
915 3300053737 Ga0500601_000120 Ga0500601_000120_7107_7808 233
916 3300055283 Ga0500661_042459 Ga0500661_042459_28_729 233
917 iso_pu_bacteria 2511231028 2511400364 233
918 iso_pu_bacteria 2524023210 2524469413 233
919 iso_pu_bacteria 2935959822 2935963399 233
920 3300001979 JGI24740J21852_10017791 JGI24740J21852_100177912 234
921 3300003203 JGI25406J46586_10001342 JGI25406J46586_1000134210 234
922 3300003659 JGI25404J52841_10007600 JGI25404J52841_100076003 234
923 3300003659 JGI25404J52841_10013992 JGI25404J52841_100139921 234
924 3300005336 Ga0070680_100375836 Ga0070680_1003758362 234
925 3300005339 Ga0070660_100280581 Ga0070660_1002805812 234
926 3300005434 Ga0070709_10023604 Ga0070709_100236041 234
927 3300005435 Ga0070714_100004718 Ga0070714_1000047184 234
928 3300005435 Ga0070714_100024383 Ga0070714_1000243832 234
929 3300005436 Ga0070713_100004489 Ga0070713_1000044898 234
930 3300005436 Ga0070713_100032765 Ga0070713_1000327654 234
931 3300005437 Ga0070710_10013160 Ga0070710_100131605 234
932 3300005439 Ga0070711_100011056 Ga0070711_1000110566 234
933 3300005455 Ga0070663_100053297 Ga0070663_1000532973 234
934 3300005455 Ga0070663_100183660 Ga0070663_1001836601 234
935 3300005535 Ga0070684_100275159 Ga0070684_1002751591 234
936 3300005539 Ga0068853_100071780 Ga0068853_1000717803 234
937 3300005539 Ga0068853_100621687 Ga0068853_1006216871 234
938 3300005563 Ga0068855_100035339 Ga0068855_1000353396 234
939 3300005563 Ga0068855_100696105 Ga0068855_1006961052 234
940 3300005577 Ga0068857_100367882 Ga0068857_1003678822 234
941 3300005614 Ga0068856_100033788 Ga0068856_1000337885 234
942 3300005614 Ga0068856_100059957 Ga0068856_1000599573 234
943 3300005614 Ga0068856_100290162 Ga0068856_1002901622 234
944 3300005616 Ga0068852_100140619 Ga0068852_1001406192 234
945 3300005618 Ga0068864_100215190 Ga0068864_1002151902 234
946 3300005937 Ga0081455_10049019 Ga0081455_100490194 234
947 3300005937 Ga0081455_10119021 Ga0081455_101190212 234
948 3300005983 Ga0081540_1001498 Ga0081540_100149813 234
949 3300005983 Ga0081540_1010330 Ga0081540_10103308 234
950 3300005983 Ga0081540_1025933 Ga0081540_10259334 234
951 3300005983 Ga0081540_1034728 Ga0081540_10347281 234
952 3300005985 Ga0081539_10000726 Ga0081539_1000072637 234
953 3300006038 Ga0075365_10366819 Ga0075365_103668191 234
954 3300006163 Ga0070715_10146529 Ga0070715_101465292 234
955 3300006175 Ga0070712_100477898 Ga0070712_1004778982 234
956 3300006175 Ga0070712_100641460 Ga0070712_1006414602 234
957 3300009093 Ga0105240_10036405 Ga0105240_100364055 234
958 3300009093 Ga0105240_10063064 Ga0105240_100630643 234
959 3300009093 Ga0105240_10126908 Ga0105240_101269083 234
960 3300009093 Ga0105240_10383467 Ga0105240_103834672 234
961 3300009551 Ga0105238_10038672 Ga0105238_100386723 234
962 3300009551 Ga0105238_10050078 Ga0105238_100500785 234
963 3300010375 Ga0105239_10089022 Ga0105239_100890224 234
964 3300013104 Ga0157370_10079560 Ga0157370_100795602 234
965 3300013104 Ga0157370_10311510 Ga0157370_103115102 234
966 3300013105 Ga0157369_10003596 Ga0157369_1000359613 234
967 3300013105 Ga0157369_10037100 Ga0157369_100371006 234
968 3300021384 Ga0213876_10001081 Ga0213876_1000108116 234
969 3300021388 Ga0213875_10053548 Ga0213875_100535482 234
970 3300022467 Ga0224712_10018155 Ga0224712_100181553 234
971 3300025261 Ga0209233_1003327 Ga0209233_10033273 234
972 3300025297 Ga0209758_1064190 Ga0209758_10641902 234
973 3300025321 Ga0207656_10136174 Ga0207656_101361741 234
974 3300025898 Ga0207692_10273636 Ga0207692_102736361 234
975 3300025904 Ga0207647_10013302 Ga0207647_100133022 234
976 3300025905 Ga0207685_10030001 Ga0207685_100300011 234
977 3300025906 Ga0207699_10023095 Ga0207699_100230952 234
978 3300025908 Ga0207643_10076610 Ga0207643_100766101 234
979 3300025911 Ga0207654_10000803 Ga0207654_1000080315 234
980 3300025912 Ga0207707_10116849 Ga0207707_101168492 234
981 3300025913 Ga0207695_10001543 Ga0207695_1000154311 234
982 3300025913 Ga0207695_10028927 Ga0207695_100289275 234
983 3300025913 Ga0207695_10148018 Ga0207695_101480182 234
984 3300025913 Ga0207695_10234406 Ga0207695_102344062 234
985 3300025914 Ga0207671_10222544 Ga0207671_102225442 234
986 3300025914 Ga0207671_10276956 Ga0207671_102769562 234
987 3300025915 Ga0207693_10002906 Ga0207693_1000290610 234
988 3300025916 Ga0207663_10003355 Ga0207663_100033554 234
989 3300025916 Ga0207663_10394774 Ga0207663_103947741 234
990 3300025924 Ga0207694_10001371 Ga0207694_100013712 234
991 3300025924 Ga0207694_10063906 Ga0207694_100639063 234
992 3300025928 Ga0207700_10111939 Ga0207700_101119391 234
993 3300025929 Ga0207664_10044034 Ga0207664_100440342 234
994 3300025939 Ga0207665_10000992 Ga0207665_1000099218 234
995 3300025939 Ga0207665_10497186 Ga0207665_104971861 234
996 3300025949 Ga0207667_10004319 Ga0207667_1000431918 234
997 3300025949 Ga0207667_10036266 Ga0207667_100362664 234
998 3300025981 Ga0207640_10083757 Ga0207640_100837572 234
999 3300025981 Ga0207640_10199915 Ga0207640_101999152 234
1000 3300026041 Ga0207639_10849609 Ga0207639_108496091 234
1001 3300026067 Ga0207678_10087953 Ga0207678_100879532 234
1002 3300026078 Ga0207702_10000005 Ga0207702_10000005295 234
1003 3300026078 Ga0207702_10414482 Ga0207702_104144821 234
1004 3300026078 Ga0207702_10556733 Ga0207702_105567332 234
1005 3300026116 Ga0207674_10011138 Ga0207674_1001113811 234
1006 3300028573 Ga0265334_10026414 Ga0265334_100264142 234
1007 3300028786 Ga0307517_10000062 Ga0307517_1000006232 234
1008 3300031238 Ga0265332_10047997 Ga0265332_100479972 234
1009 3300031250 Ga0265331_10026429 Ga0265331_100264293 234
1010 3300031548 Ga0307408_100057151 Ga0307408_1000571512 234
1011 3300031711 Ga0265314_10138884 Ga0265314_101388842 234
1012 3300031712 Ga0265342_10009526 Ga0265342_100095263 234
1013 3300033442 Ga0315911_1000009 Ga0315911_1000009376 234
1014 3300035111 Ga0373923_0026123 Ga0373923_0026123_841_1545 234
1015 3300035117 Ga0373953_0000670 Ga0373953_0000670_3190_3894 234
1016 3300035118 Ga0373954_0022528 Ga0373954_0022528_1432_2136 234
1017 3300035119 Ga0373956_0049899 Ga0373956_0049899_91_795 234
1018 3300035172 Ga0373955_0000447 Ga0373955_0000447_12894_13598 234
1019 3300035692 Ga0373935_0363639 Ga0373935_0363639_279_983 234
1020 3300035724 Ga0373933_0002005 Ga0373933_0002005_3244_3948 234
1021 3300036401 Ga0373937_0121748 Ga0373937_0121748_1321_2025 234
1022 3300037418 Ga0395900_0079214 Ga0395900_0079214_2418_3122 234
1023 3300037466 Ga0395898_0011573 Ga0395898_0011573_5745_6449 234
1024 3300037853 Ga0436364_1499714 Ga0436364_1499714_939_1643 234
1025 3300039437 Ga0436365_0675790 Ga0436365_0675790_15748_16452 234
1026 3300039450 Ga0436363_0632867 Ga0436363_0632867_177_881 234
1027 3300044684 Ga0466966_0048886 Ga0466966_0048886_445_1149 234
1028 3300044719 Ga0466971_0089100 Ga0466971_0089100_489_1193 234
1029 3300045049 Ga0466959_0021412 Ga0466959_0021412_459_1163 234
1030 3300046455 Ga0495603_0084959 Ga0495603_0084959_16_720 234
1031 3300046459 Ga0495629_0001699 Ga0495629_0001699_16005_16709 234
1032 3300046462 Ga0495651_0040970 Ga0495651_0040970_438_1142 234
1033 3300046462 Ga0495651_0085092 Ga0495651_0085092_430_1134 234
1034 3300046463 Ga0495653_0055700 Ga0495653_0055700_1906_2610 234
1035 3300046507 Ga0495606_0305661 Ga0495606_0305661_132_836 234
1036 3300046511 Ga0495608_0076289 Ga0495608_0076289_888_1592 234
1037 3300046533 Ga0495640_0071777 Ga0495640_0071777_671_1375 234
1038 3300046536 Ga0495587_0029630 Ga0495587_0029630_1323_2027 234
1039 3300046616 Ga0495668_0083145 Ga0495668_0083145_896_1600 234
1040 3300046663 Ga0495635_0000892 Ga0495635_0000892_15588_16292 234
1041 3300046675 Ga0495657_0001505 Ga0495657_0001505_10814_11518 234
1042 3300046678 Ga0495599_0191652 Ga0495599_0191652_334_1038 234
1043 3300046679 Ga0495623_0002081 Ga0495623_0002081_11186_11890 234
1044 3300046679 Ga0495623_0081994 Ga0495623_0081994_1019_1723 234
1045 3300046680 Ga0495646_0003426 Ga0495646_0003426_2160_2864 234
1046 3300046689 Ga0495613_0038530 Ga0495613_0038530_113_817 234
1047 3300046809 Ga0495600_0000845 Ga0495600_0000845_599_1303 234
1048 3300047322 Ga0495680_0001893 Ga0495680_0001893_8612_9316 234
1049 3300047471 Ga0495684_0006728 Ga0495684_0006728_114_818 234
1050 3300047673 Ga0495593_0002873 Ga0495593_0002873_6549_7253 234
1051 3300048088 Ga0495602_0020256 Ga0495602_0020256_438_1142 234
1052 3300048912 Ga0496109_0760537 Ga0496109_0760537_165_869 234
1053 3300048918 Ga0496115_0063037 Ga0496115_0063037_469_1173 234
1054 3300048924 Ga0496121_0066938 Ga0496121_0066938_796_1500 234
1055 3300048927 Ga0496124_0286066 Ga0496124_0286066_91_795 234
1056 3300048929 Ga0496126_0008612 Ga0496126_0008612_8465_9169 234
1057 3300048929 Ga0496126_0044454 Ga0496126_0044454_2126_2830 234
1058 3300049568 Ga0501031_0035853 Ga0501031_0035853_193_906 234
1059 3300049569 Ga0501032_0000120 Ga0501032_0000120_16339_17052 234
1060 3300049570 Ga0501033_0002325 Ga0501033_0002325_9951_10664 234
1061 3300049571 Ga0501034_0000061 Ga0501034_0000061_73868_74581 234
1062 3300049572 Ga0501036_0000054 Ga0501036_0000054_16790_17503 234
1063 3300049573 Ga0501037_0000093 Ga0501037_0000093_16430_17143 234
1064 3300049574 Ga0501038_0000066 Ga0501038_0000066_5309_6022 234
1065 3300049574 Ga0501038_0716543 Ga0501038_0716543_16_726 234
1066 3300049575 Ga0501039_0001528 Ga0501039_0001528_379_1092 234
1067 3300049579 Ga0501043_0000161 Ga0501043_0000161_54450_55163 234
1068 3300049580 Ga0501046_0000487 Ga0501046_0000487_19609_20322 234
1069 3300049581 Ga0501047_0000122 Ga0501047_0000122_67635_68348 234
1070 3300049582 Ga0501048_0000053 Ga0501048_0000053_31580_32293 234
1071 3300049582 Ga0501048_0274289 Ga0501048_0274289_337_1116 234
1072 3300049583 Ga0501067_0000387 Ga0501067_0000387_20770_21483 234
1073 3300049584 Ga0501068_0003190 Ga0501068_0003190_5869_6582 234
1074 3300049585 Ga0501069_0025455 Ga0501069_0025455_165_878 234
1075 3300049586 Ga0501070_0001577 Ga0501070_0001577_11133_11846 234
1076 3300049586 Ga0501070_0052424 Ga0501070_0052424_1851_2573 234
1077 3300049586 Ga0501070_0291090 Ga0501070_0291090_210_989 234
1078 3300049588 Ga0501072_0021593 Ga0501072_0021593_1975_2688 234
1079 3300049589 Ga0501073_0000146 Ga0501073_0000146_10512_11225 234
1080 3300049590 Ga0501074_0000712 Ga0501074_0000712_10338_11051 234
1081 3300049741 Ga0501079_0042171 Ga0501079_0042171_2751_3464 234
1082 3300049742 Ga0501080_0001268 Ga0501080_0001268_10701_11414 234
1083 3300049744 Ga0501083_0001199 Ga0501083_0001199_11625_12338 234
1084 3300049822 Ga0501035_0000099 Ga0501035_0000099_52127_52840 234
1085 3300049822 Ga0501035_0075976 Ga0501035_0075976_862_1641 234
1086 3300049823 Ga0501044_0000195 Ga0501044_0000195_23801_24514 234
1087 3300049824 Ga0501045_0007673 Ga0501045_0007673_4669_5382 234
1088 3300050512 nmdc:mga0n895_601180_c1 nmdc:mga0n895_601180_c1_90_794 234
1089 3300053077 Ga0495601_0006936 Ga0495601_0006936_4969_5673 234
1090 3300053084 Ga0495595_0006154 Ga0495595_0006154_2852_3556 234
1091 3300053085 Ga0495619_0000394 Ga0495619_0000394_14483_15187 234
1092 3300053085 Ga0495619_0609520 Ga0495619_0609520_10_714 234
1093 3300053094 Ga0500566_0003060 Ga0500566_0003060_640_1344 234
1094 3300053119 Ga0500595_000478 Ga0500595_000478_12851_13555 234
1095 3300053178 Ga0500637_0000245 Ga0500637_0000245_8773_9477 234
1096 3300054114 Ga0501084_0002556 Ga0501084_0002556_11615_12328 234
1097 3300060353 Ga0501082_0027232 Ga0501082_0027232_2970_3683 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

40

121

0.93

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

49

122

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

167

232

0.91

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

150

237

0.88

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

159

244

0.83

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

44

126

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hfk-assembly1.cif.gz_B crystal structure of a glutathione s-transferase protein from escherichia coli och 157:h7 str. sakai (ecs3186, target efi-507414) with bound glutathione 0.9884 1 204
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9862 1 204
3gx0-assembly1.cif.gz_A-2 crystal structure of gsh-dependent disulfide bond oxidoreductase 0.9767 1 204
4l8e-assembly1.cif.gz_A-2 crystal structure of a glutathione transferase family member from xenorhabdus nematophila, target efi-507418, with two gsh per subunit 0.9764 3 203
4ecj-assembly1.cif.gz_B crystal structure of glutathione s-transferase prk13972 (target efi-501853) from pseudomonas aeruginosa pacs2 complexed with glutathione 0.9757 1 208
ID Description Score Start End Superfamily
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 1.001 1 84 3.40.30.10
4l8eA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9957 3 86 3.40.30.10
af_P77526_93_209_1.20.1050.130 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9781 94 204 1.20.1050.130
af_P77526_1_85_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9775 1 84 3.40.30.10
af_P77526_87_192_1.20.1050.10 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9759 87 192 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A522J4D5-F1-model_v4 Thiol:disulfide oxidoreductase 1.002 1 84
AF-A0A379S1X3-F1-model_v4 Glutathione-S transferase 1.001 1 84 GO:0015036
GO:0016740
AF-A0A3D5Y447-F1-model_v4 Thiol:disulfide oxidoreductase 1.001 1 71
AF-A0A0S8AWI8-F1-model_v4 Glutathione S-transferase 0.9979 1 100 GO:0016740
AF-A0A379VPV5-F1-model_v4 Glutathione-S transferase 0.9962 1 149 GO:0015036
GO:0016740

Feature Viewer

pLDDT pTM Quality
92.91 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map