F489891

General Info

Members Datasets Scaffolds Average Seq Length
1091 553 893 216

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0024154|Ga0496121_0024154_685_1383
Length 232
Sequence MHQFGYNHVVYLVEAARWTVALSLIAFAGGSILGFFLALARVQPGSGLVRKLALVSMRLFQATPLLMQLFMFYFGLSIIGLELSAWASASIALIVYTGTFLGEIWQGCIQAVPKGQSDAGKALALTYSQRMSRIILPQAVRIALAPSVGFLVQVIKSTSLASIVGFAELIRASQMVNNVTLRPLLVYSIVMLIYFVLCWPLSLWSRHLERRLAAKGRTVDATVKPELQVVAV

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
7 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
8 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
9 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
10 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
11 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
12 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
13 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
14 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
15 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
16 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
17 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
18 2643221570 Acidovorax sp. Root568 Isolate Unclassified
19 2643221582 Rhizobium sp. Root651 Isolate Unclassified
20 2643221596 Acidovorax sp. Root70 Isolate Unclassified
21 2643221609 Acidovorax sp. Root217 Isolate Unclassified
22 2643221611 Acidovorax sp. Root219 Isolate Unclassified
23 2643221652 Acidovorax sp. Root402 Isolate Unclassified
24 2643221658 Variovorax sp. Root411 Isolate Unclassified
25 2643221672 Variovorax sp. Root434 Isolate Unclassified
26 2643221674 Devosia sp. Root436 Isolate Unclassified
27 2643221683 Variovorax sp. Root473 Isolate Unclassified
28 2643221693 Rhizobium sp. Root491 Isolate Unclassified
29 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
30 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
31 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
32 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
33 2738541277 Variovorax sp. GV051 Isolate Unclassified
34 2738541307 Variovorax sp. GV008 Isolate Unclassified
35 2738543012 Acidovorax sp. CF301 Isolate Unclassified
36 2738543013 Variovorax sp. BT01 Isolate Unclassified
37 2738543019 Variovorax sp. GV040 Isolate Unclassified
38 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
39 2791355256 Rhizobium sp. M10 Isolate Nodule
40 2791355262 Rhizobium sp. M1 Isolate Nodule
41 2791355265 Rhizobium sp. H4 Isolate Nodule
42 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
43 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
44 2802429633 Rhizobium anhuiense J3 Isolate Nodule
45 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
46 2802429637 Rhizobium anhuiense C15 Isolate Nodule
47 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
48 2816332133 Acidovorax radicis 2721A Isolate Unclassified
49 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
50 2818991446 Variovorax sp. 1180 Isolate Unclassified
51 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
52 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
53 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
54 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
55 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
56 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
57 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
58 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
59 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
60 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
61 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
62 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
63 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
64 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
65 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
66 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
67 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
68 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
69 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
70 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
71 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
72 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
73 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
74 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
75 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
76 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
77 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
78 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
79 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
80 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
81 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
82 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
83 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
84 2842677519 Variovorax sp. R-72495 Isolate Unclassified
85 2842733646 Variovorax sp. R-72446 Isolate Unclassified
86 2842747753 Variovorax sp. R-72060 Isolate Unclassified
87 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
88 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
89 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
90 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
91 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
92 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
93 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
94 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
95 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
96 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
97 2885198086 Variovorax sp. 679 Isolate Unclassified
98 2885211737 Variovorax sp. 553 Isolate Unclassified
99 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
100 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
101 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
102 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
103 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
104 2899924645 Variovorax sp. 369 Isolate Unclassified
105 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
106 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
107 2904456579 Variovorax sp. 2002 Isolate Unclassified
108 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
109 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
110 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
111 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
112 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
113 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
114 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
115 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
116 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
117 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
118 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
119 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
120 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
121 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
122 2928037797 Variovorax sp. 1126 Isolate Unclassified
123 2928044640 Variovorax sp. 1128 Isolate Unclassified
124 2928051484 Variovorax sp. 1133 Isolate Unclassified
125 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
126 2928070936 Variovorax gossypii 1167 Isolate Unclassified
127 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
128 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
129 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
130 2929520902 Variovorax beijingensis 502 Isolate Unclassified
131 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
132 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
133 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
134 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
135 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
136 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
137 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
138 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
139 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
140 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
141 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
142 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
143 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
144 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
145 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
146 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
147 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
148 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
149 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
150 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
151 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
152 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
153 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
154 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
155 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
156 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
157 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
158 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
159 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
160 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
161 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
162 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
163 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
164 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
165 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
166 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
167 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
168 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
169 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
170 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
171 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
172 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
173 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
174 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
175 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
176 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
177 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
178 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
179 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
180 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
181 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
182 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
183 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
184 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
185 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
186 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
187 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
188 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
189 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
190 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
191 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
192 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
193 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
194 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
195 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
196 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
197 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
198 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
199 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
200 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
201 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
202 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
203 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
204 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
205 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
206 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
207 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
208 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
209 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
210 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
211 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
212 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
213 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
214 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
215 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
216 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
217 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
218 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
219 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
220 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
221 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
222 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
223 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
224 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
225 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
226 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
227 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
228 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
229 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
230 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
231 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
232 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
233 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
234 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
235 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
236 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
237 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
238 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
239 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
240 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
241 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
242 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
243 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
244 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
245 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
246 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
247 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
248 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
249 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
250 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
251 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
252 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
253 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
254 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
255 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
256 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
257 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
258 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
259 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
260 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
261 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
262 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
263 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
264 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
265 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
266 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
267 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
268 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
271 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
273 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
274 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
275 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
277 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
278 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
279 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
281 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
283 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
284 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
286 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
287 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
288 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
289 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
290 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
291 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
292 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
293 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
338 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
340 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
341 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
345 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
346 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
347 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
348 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
349 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
350 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
351 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
352 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
353 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
354 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
355 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
356 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
357 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
358 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
359 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
360 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
361 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
362 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
363 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
364 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
365 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
366 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
367 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
368 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
369 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
370 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
371 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
372 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
373 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
374 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
375 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
376 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
377 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
378 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
379 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
380 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
381 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
382 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
383 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
384 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
385 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
386 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
387 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
388 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
389 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
390 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
391 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
392 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
393 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
394 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
395 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
396 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
397 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
398 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
399 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
400 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
401 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
402 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
403 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
404 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
405 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
406 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
407 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
408 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
409 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
410 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
411 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
412 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
413 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
414 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
415 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
416 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
417 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
418 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
419 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
420 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
421 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
422 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
423 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
424 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
425 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
426 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
427 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
428 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
429 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
430 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
431 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
432 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
433 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
434 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
435 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
436 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
437 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
438 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
439 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
440 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
441 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
442 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
443 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
444 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
445 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
446 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
447 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
448 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
449 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
450 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
451 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
452 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
453 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
454 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
455 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
456 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
457 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
458 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
459 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
460 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
461 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
462 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
463 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
464 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
465 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
466 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
467 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
468 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
469 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
470 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
471 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
472 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
473 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
474 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
475 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
476 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
477 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
478 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
479 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
480 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
484 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
485 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
487 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
488 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
490 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
491 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
492 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
493 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
494 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
495 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
496 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
497 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
498 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
499 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
500 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
501 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
502 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
503 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
504 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
505 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
506 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
507 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
508 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
509 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
510 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
511 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
512 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
513 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
514 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
515 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
516 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
517 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
518 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
519 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
520 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
521 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
522 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
523 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
524 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
525 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
526 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
527 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
528 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
529 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
530 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
531 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
532 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
533 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
534 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
535 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
536 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
537 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
538 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
539 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
540 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
541 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
542 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
543 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
544 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
545 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
546 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
547 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
548 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
549 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
550 8018176218 Rhizobium sp. N122 Isolate Nodule
551 8024501048 Rhizobium sp. H4 Isolate Nodule
552 8056382006 Rhizobium croatiense 13T Isolate Nodule
553 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.3
Metatranscriptomes 0.55
Isolates 18.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0
Endosphere 25.11
Nodule 7.79
Rhizoplane 3.48
Rhizosphere 48.67
Stem 0
Stem Tuber 0
Unclassified 14.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10017252 3300001989 Bacteria 2607
2 JGI25156J39149_1000197 3300002705 Bacteria 42157
3 JGI25162J39368_1000069 3300002737 Bacteria 125244
4 JGI25154J39366_1001559 3300002738 Bacteria 7886
5 JGI25158J39367_1002784 3300002739 Bacteria 2776
6 JGI25157J39369_1000239 3300002741 Bacteria 42158
7 JGI25152J39213_1013570 3300002773 Bacteria 1691
8 JGI25152J39213_1020352 3300002773 Bacteria 1186
9 JGI25150J39212_1012541 3300002774 Bacteria 1498
10 JGI25159J45721_1030586 3300002987 Bacteria 873
11 JGI25151J46595_10000912 3300003187 Bacteria 23122
12 JGI25151J46595_10001106 3300003187 Bacteria 19788
13 JGI25151J46595_10002242 3300003187 Bacteria 11876
14 JGI25151J46595_10017903 3300003187 Bacteria 3058
15 JGI25151J46595_10056756 3300003187 Bacteria 1282
16 JGI25151J46595_10076514 3300003187 Bacteria 988
17 JGI25165J46597_1000018 3300003214 Bacteria 374701
18 JGI25153J46596_10016995 3300003215 Bacteria 2885
19 JGI25153J46596_10033586 3300003215 Bacteria 1691
20 rootH1_10031181 3300003316 Bacteria 2128
21 Ga0006562J51391_1048428 3300003578 Bacteria 1460
22 Ga0006562J51391_1089020 3300003578 Bacteria 1303
23 JGI25404J52841_10033220 3300003659 Bacteria 1100
24 Ga0055535_1000625 3300003761 Bacteria 28582
25 Ga0055542_1000087 3300003762 Bacteria 123666
26 Ga0055529_1000904 3300003763 Bacteria 16503
27 Ga0055526_1004955 3300003771 Bacteria 7819
28 Ga0055526_1037798 3300003771 Bacteria 1255
29 Ga0055526_1041428 3300003771 Bacteria 1147
30 Ga0055537_1000544 3300003773 Bacteria 21755
31 Ga0055537_1001201 3300003773 Bacteria 10978
32 Ga0055537_1001648 3300003773 Bacteria 8347
33 Ga0055537_1007410 3300003773 Bacteria 2648
34 Ga0055524_1000973 3300003775 Bacteria 17954
35 Ga0055524_1010583 3300003775 Bacteria 3663
36 Ga0055524_1017548 3300003775 Bacteria 2522
37 Ga0055524_1042099 3300003775 Bacteria 1141
38 Ga0055536_1002305 3300003781 Bacteria 10814
39 Ga0055536_1012752 3300003781 Bacteria 3089
40 Ga0055534_1000273 3300003784 Bacteria 35227
41 Ga0055534_1000470 3300003784 Bacteria 22861
42 Ga0055534_1000494 3300003784 Bacteria 21755
43 Ga0055534_1003656 3300003784 Bacteria 4767
44 Ga0055528_1003260 3300003790 Bacteria 8269
45 Ga0055528_1005515 3300003790 Bacteria 5872
46 Ga0055528_1005551 3300003790 Bacteria 5844
47 Ga0055528_1017013 3300003790 Bacteria 2540
48 Ga0055530_10000492 3300003791 Bacteria 34175
49 Ga0055530_10010401 3300003791 Bacteria 3441
50 Ga0055530_10044594 3300003791 Bacteria 1063
51 Ga0055540_1001711 3300003792 Bacteria 12623
52 Ga0055540_1002128 3300003792 Bacteria 10807
53 Ga0055540_1006032 3300003792 Bacteria 4907
54 Ga0055540_1014097 3300003792 Bacteria 2402
55 Ga0055531_10000397 3300003794 Bacteria 41683
56 Ga0055531_10000729 3300003794 Bacteria 27835
57 Ga0055531_10001138 3300003794 Bacteria 20582
58 Ga0055531_10001242 3300003794 Bacteria 19363
59 Ga0055531_10001938 3300003794 Bacteria 14455
60 Ga0058692_1005109 3300003856 Bacteria 3777
61 Ga0055543_1011426 3300004625 Bacteria 1817
62 Ga0065165_1001097 3300005262 Bacteria 32174
63 Ga0065165_1002200 3300005262 Bacteria 17486
64 Ga0065165_1004159 3300005262 Bacteria 9265
65 Ga0065165_1039354 3300005262 Bacteria 1417
66 Ga0065165_1054412 3300005262 Bacteria 1121
67 Ga0065714_10006671 3300005288 Bacteria 3478
68 Ga0065704_10018558 3300005289 Bacteria 2098
69 Ga0070658_10017213 3300005327 Bacteria 5784
70 Ga0070658_10302886 3300005327 Bacteria 1363
71 Ga0070658_10816950 3300005327 Bacteria 810
72 Ga0070676_10197030 3300005328 Bacteria 1318
73 Ga0070683_100001096 3300005329 Bacteria 20384
74 Ga0070670_100060064 3300005331 Bacteria 3264
75 Ga0070670_100439201 3300005331 Bacteria 1155
76 Ga0068869_100134442 3300005334 Bacteria 1904
77 Ga0070680_100077659 3300005336 Bacteria 2734
78 Ga0070680_100485840 3300005336 Bacteria 1056
79 Ga0068868_100048109 3300005338 Bacteria 3344
80 Ga0070660_100006803 3300005339 Bacteria 7935
81 Ga0070660_100193642 3300005339 Bacteria 1647
82 Ga0070661_100001103 3300005344 Bacteria 18993
83 Ga0070661_100119325 3300005344 Bacteria 1974
84 Ga0070661_100439330 3300005344 Bacteria 1037
85 Ga0070692_10297828 3300005345 Bacteria 984
86 Ga0070669_100126607 3300005353 Bacteria 1955
87 Ga0070669_100493304 3300005353 Bacteria 1015
88 Ga0070671_100001731 3300005355 Bacteria 16589
89 Ga0070671_100007662 3300005355 Bacteria 8632
90 Ga0070674_100322706 3300005356 Bacteria 1238
91 Ga0070673_100002957 3300005364 Bacteria 10477
92 Ga0070659_100007948 3300005366 Bacteria 7728
93 Ga0070659_100017622 3300005366 Bacteria 5379
94 Ga0070659_100217087 3300005366 Bacteria 1578
95 Ga0070667_100025826 3300005367 Bacteria 4885
96 Ga0070709_10391818 3300005434 Bacteria 1035
97 Ga0070678_100331899 3300005456 Bacteria 1302
98 Ga0070678_100579375 3300005456 Bacteria 999
99 Ga0070662_100019503 3300005457 Bacteria 4604
100 Ga0070662_100400495 3300005457 Bacteria 1133
101 Ga0070662_100741545 3300005457 Bacteria 833
102 Ga0068867_100302199 3300005459 Bacteria 1319
103 Ga0070679_100026744 3300005530 Bacteria 5673
104 Ga0070679_100054342 3300005530 Bacteria 3987
105 Ga0070679_100352608 3300005530 Bacteria 1419
106 Ga0070679_100731008 3300005530 Bacteria 933
107 Ga0070679_100949201 3300005530 Bacteria 804
108 Ga0070684_100004228 3300005535 Bacteria 10874
109 Ga0068853_100005290 3300005539 Bacteria 10103
110 Ga0068853_100025317 3300005539 Bacteria 4979
111 Ga0068853_100043331 3300005539 Bacteria 3849
112 Ga0068853_100091642 3300005539 Bacteria 2673
113 Ga0068853_100177581 3300005539 Bacteria 1930
114 Ga0070672_100011366 3300005543 Bacteria 6208
115 Ga0070672_100300081 3300005543 Bacteria 1361
116 Ga0070672_100463449 3300005543 Bacteria 1093
117 Ga0070693_100005182 3300005547 Bacteria 6236
118 Ga0070693_100037504 3300005547 Bacteria 2703
119 Ga0070665_100034493 3300005548 Bacteria 5089
120 Ga0070665_100494019 3300005548 Bacteria 1235
121 Ga0068855_100008931 3300005563 Bacteria 12114
122 Ga0068855_100023191 3300005563 Bacteria 7435
123 Ga0068855_100232591 3300005563 Bacteria 2063
124 Ga0070664_100003886 3300005564 Bacteria 12056
125 Ga0070664_100008256 3300005564 Bacteria 8421
126 Ga0070664_100035223 3300005564 Bacteria 4202
127 Ga0068857_100150767 3300005577 Bacteria 2106
128 Ga0068857_100650792 3300005577 Bacteria 999
129 Ga0068854_100002503 3300005578 Bacteria 11399
130 Ga0068856_100011574 3300005614 Bacteria 8557
131 Ga0068856_100073839 3300005614 Bacteria 3377
132 Ga0068856_100189093 3300005614 Bacteria 2073
133 Ga0068856_100580147 3300005614 Bacteria 1143
134 Ga0068852_100002132 3300005616 Bacteria 13562
135 Ga0068852_100008877 3300005616 Bacteria 7435
136 Ga0068852_100785744 3300005616 Bacteria 965
137 Ga0068859_101566843 3300005617 Bacteria 727
138 Ga0068864_100041516 3300005618 Bacteria 3934
139 Ga0068864_100098816 3300005618 Bacteria 2585
140 Ga0068864_100563475 3300005618 Bacteria 1102
141 Ga0068864_101135215 3300005618 Bacteria 779
142 Ga0068866_10428922 3300005718 Bacteria 859
143 Ga0068851_10001036 3300005834 Bacteria 12077
144 Ga0068851_10013404 3300005834 Bacteria 3881
145 Ga0068863_100387960 3300005841 Bacteria 1364
146 Ga0068860_100498273 3300005843 Bacteria 1216
147 Ga0081540_1000001 3300005983 Bacteria 293507
148 Ga0081539_10011653 3300005985 Bacteria 6918
149 Ga0075365_10119863 3300006038 Bacteria 1814
150 Ga0075365_10514958 3300006038 Bacteria 846
151 Ga0075368_10007452 3300006042 Bacteria 3861
152 Ga0075368_10009279 3300006042 Bacteria 3535
153 Ga0075363_100149641 3300006048 Bacteria 1317
154 Ga0075363_100194871 3300006048 Bacteria 1156
155 Ga0075364_10043751 3300006051 Bacteria 2911
156 Ga0075364_10121371 3300006051 Bacteria 1749
157 Ga0075364_10132498 3300006051 Bacteria 1673
158 Ga0075364_10245132 3300006051 Bacteria 1217
159 Ga0075364_10454599 3300006051 Bacteria 875
160 Ga0075364_10566178 3300006051 Bacteria 777
161 Ga0075432_10011542 3300006058 Bacteria 3002
162 Ga0075432_10097420 3300006058 Bacteria 1083
163 Ga0075362_10008375 3300006177 Bacteria 3951
164 Ga0075362_10015340 3300006177 Bacteria 3114
165 Ga0075362_10068895 3300006177 Bacteria 1612
166 Ga0075362_10125015 3300006177 Bacteria 1220
167 Ga0075362_10131574 3300006177 Bacteria 1190
168 Ga0075367_10020216 3300006178 Bacteria 3704
169 Ga0075367_10228947 3300006178 Bacteria 1164
170 Ga0075367_10378842 3300006178 Bacteria 894
171 Ga0075369_10010312 3300006186 Bacteria 3652
172 Ga0075366_10031124 3300006195 Bacteria 3139
173 Ga0075366_10148815 3300006195 Bacteria 1417
174 Ga0097621_100146079 3300006237 Bacteria 2025
175 Ga0097621_100445735 3300006237 Bacteria 1165
176 Ga0097621_100697246 3300006237 Bacteria 935
177 Ga0075370_10001140 3300006353 Bacteria 11147
178 Ga0075370_10001936 3300006353 Bacteria 9342
179 Ga0075370_10014295 3300006353 Bacteria 4234
180 Ga0075370_10031122 3300006353 Bacteria 2978
181 Ga0075370_10035802 3300006353 Bacteria 2787
182 Ga0068871_100230495 3300006358 Bacteria 1607
183 Ga0068871_100596188 3300006358 Bacteria 1004
184 Ga0079104_1005275 3300006946 Bacteria 5207
185 Ga0099826_10000053 3300006948 Bacteria 72398
186 Ga0099826_10000135 3300006948 Bacteria 31697
187 Ga0099826_10000408 3300006948 Bacteria 20307
188 Ga0099826_10009692 3300006948 Bacteria 7192
189 Ga0099826_10063502 3300006948 Bacteria 2386
190 Ga0105244_10061912 3300009036 Bacteria 1882
191 Ga0105240_10010218 3300009093 Bacteria 13210
192 Ga0105240_10027927 3300009093 Bacteria 7381
193 Ga0105245_10421667 3300009098 Bacteria 1338
194 Ga0105243_10004536 3300009148 Bacteria 10972
195 Ga0105243_10006125 3300009148 Bacteria 9302
196 Ga0105243_10728975 3300009148 Bacteria 969
197 Ga0105241_10197717 3300009174 Bacteria 1677
198 Ga0105242_10116195 3300009176 Bacteria 2289
199 Ga0105242_10182665 3300009176 Bacteria 1851
200 Ga0105248_10022313 3300009177 Bacteria 7019
201 Ga0105248_10405449 3300009177 Bacteria 1535
202 Ga0105237_10197175 3300009545 Bacteria 2013
203 Ga0105237_10214553 3300009545 Bacteria 1924
204 Ga0105237_10582625 3300009545 Bacteria 1126
205 Ga0105238_10010711 3300009551 Bacteria 9210
206 Ga0105238_10051831 3300009551 Bacteria 4126
207 Ga0105238_10083755 3300009551 Bacteria 3178
208 Ga0105239_11155729 3300010375 Bacteria 892
209 Ga0105239_11158671 3300010375 Bacteria 890
210 Ga0105246_10437945 3300011119 Bacteria 1095
211 Ga0157373_10003196 3300013100 Bacteria 12388
212 Ga0157373_10037357 3300013100 Bacteria 3482
213 Ga0157371_10000005 3300013102 Bacteria 416456
214 Ga0157371_10269629 3300013102 Bacteria 1228
215 Ga0157370_10000036 3300013104 Bacteria 136933
216 Ga0157370_10006235 3300013104 Bacteria 13208
217 Ga0157370_10012371 3300013104 Bacteria 8853
218 Ga0157370_10079644 3300013104 Bacteria 3085
219 Ga0157369_10008755 3300013105 Bacteria 11590
220 Ga0157369_10148403 3300013105 Bacteria 2479
221 Ga0157369_10371569 3300013105 Bacteria 1484
222 Ga0157374_10106980 3300013296 Bacteria 2688
223 Ga0163162_10165664 3300013306 Bacteria 2334
224 Ga0163162_10240918 3300013306 Bacteria 1940
225 Ga0163162_10537508 3300013306 Bacteria 1297
226 Ga0163162_10831348 3300013306 Bacteria 1039
227 Ga0157372_10034372 3300013307 Bacteria 5573
228 Ga0157372_10149374 3300013307 Bacteria 2696
229 Ga0157375_10228180 3300013308 Bacteria 2021
230 Ga0157375_10342998 3300013308 Bacteria 1659
231 Ga0157375_10441668 3300013308 Bacteria 1467
232 Ga0157375_10986304 3300013308 Bacteria 983
233 Ga0163163_10274774 3300014325 Bacteria 1736
234 Ga0182008_10001904 3300014497 Bacteria 13501
235 Ga0182008_10004300 3300014497 Bacteria 8340
236 Ga0182008_10004309 3300014497 Bacteria 8328
237 Ga0182008_10018378 3300014497 Bacteria 3620
238 Ga0182008_10026105 3300014497 Bacteria 2963
239 Ga0182008_10033309 3300014497 Bacteria 2585
240 Ga0157379_10196452 3300014968 Bacteria 1823
241 Ga0157376_10100256 3300014969 Bacteria 2528
242 Ga0157376_10385972 3300014969 Bacteria 1350
243 Ga0182006_1038793 3300015261 Bacteria 1882
244 Ga0182006_1055979 3300015261 Bacteria 1503
245 Ga0182006_1098533 3300015261 Bacteria 1041
246 Ga0182006_1113178 3300015261 Bacteria 950
247 Ga0182007_10000278 3300015262 Bacteria 33960
248 Ga0182007_10006630 3300015262 Bacteria 4956
249 Ga0182007_10007196 3300015262 Bacteria 4693
250 Ga0182007_10163702 3300015262 Bacteria 762
251 Ga0182005_1029422 3300015265 Bacteria 1498
252 Ga0182005_1057456 3300015265 Bacteria 1061
253 Ga0183362_10001 3300015683 Bacteria 2046624
254 Ga0183362_10003 3300015683 Bacteria 977584
255 Ga0163161_10000598 3300017792 Bacteria 28842
256 Ga0163161_10002565 3300017792 Bacteria 12976
257 Ga0163161_10008944 3300017792 Bacteria 6925
258 Ga0163161_10010182 3300017792 Bacteria 6509
259 Ga0163161_10082600 3300017792 Bacteria 2367
260 Ga0163161_10088707 3300017792 Bacteria 2286
261 Ga0163161_10131056 3300017792 Bacteria 1891
262 Ga0163161_10219816 3300017792 Bacteria 1471
263 Ga0163161_10263133 3300017792 Bacteria 1347
264 Ga0213872_10000161 3300021361 Bacteria 61406
265 Ga0213872_10001576 3300021361 Bacteria 14538
266 Ga0209435_100089 3300025206 Bacteria 42209
267 Ga0209436_104844 3300025208 Bacteria 3228
268 Ga0209672_101712 3300025228 Bacteria 7040
269 Ga0209672_103043 3300025228 Bacteria 3655
270 Ga0209672_110906 3300025228 Bacteria 1203
271 Ga0209147_100510 3300025229 Bacteria 22609
272 Ga0209147_100652 3300025229 Bacteria 18097
273 Ga0209437_100022 3300025233 Bacteria 625694
274 Ga0209258_100009 3300025242 Bacteria 996276
275 Ga0209258_100199 3300025242 Bacteria 123718
276 Ga0209258_104563 3300025242 Bacteria 2590
277 Ga0207425_1006727 3300025245 Bacteria 3112
278 Ga0207425_1054598 3300025245 Bacteria 719
279 Ga0209646_1000293 3300025246 Bacteria 42209
280 Ga0209026_1000364 3300025250 Bacteria 42209
281 Ga0209148_1000007 3300025254 Bacteria 1592273
282 Ga0209148_1000179 3300025254 Bacteria 126083
283 Ga0209759_1000508 3300025256 Bacteria 42209
284 Ga0209129_1000071 3300025258 Bacteria 210729
285 Ga0209129_1000249 3300025258 Bacteria 56453
286 Ga0209129_1002464 3300025258 Bacteria 9057
287 Ga0209129_1003880 3300025258 Bacteria 6226
288 Ga0209129_1011174 3300025258 Bacteria 2167
289 Ga0209233_1000031 3300025261 Bacteria 624646
290 Ga0209565_1000083 3300025263 Bacteria 154007
291 Ga0209565_1000138 3300025263 Bacteria 101729
292 Ga0209565_1000225 3300025263 Bacteria 63291
293 Ga0209565_1001961 3300025263 Bacteria 8060
294 Ga0209565_1020057 3300025263 Bacteria 1417
295 Ga0209455_1005323 3300025272 Bacteria 4003
296 Ga0209673_1000064 3300025273 Bacteria 254712
297 Ga0209673_1000178 3300025273 Bacteria 128628
298 Ga0209673_1000329 3300025273 Bacteria 87170
299 Ga0209673_1000534 3300025273 Bacteria 62274
300 Ga0209673_1000546 3300025273 Bacteria 61140
301 Ga0209673_1001554 3300025273 Bacteria 20714
302 Ga0209673_1006108 3300025273 Bacteria 5907
303 Ga0209673_1011314 3300025273 Bacteria 3686
304 Ga0209673_1021401 3300025273 Bacteria 2261
305 Ga0209673_1067931 3300025273 Bacteria 860
306 Ga0209130_1000489 3300025284 Bacteria 40639
307 Ga0209130_1000773 3300025284 Bacteria 27625
308 Ga0209130_1000889 3300025284 Bacteria 24355
309 Ga0209130_1002267 3300025284 Bacteria 9923
310 Ga0209130_1010307 3300025284 Bacteria 2586
311 Ga0209675_1000036 3300025291 Bacteria 254712
312 Ga0209675_1000081 3300025291 Bacteria 154007
313 Ga0209675_1000458 3300025291 Bacteria 31329
314 Ga0209675_1000573 3300025291 Bacteria 26547
315 Ga0209675_1000726 3300025291 Bacteria 22391
316 Ga0209675_1001085 3300025291 Bacteria 16755
317 Ga0209675_1004179 3300025291 Bacteria 6532
318 Ga0209675_1032892 3300025291 Bacteria 1209
319 Ga0209676_1000004 3300025292 Bacteria 1138360
320 Ga0209676_1000005 3300025292 Bacteria 1076001
321 Ga0209676_1000162 3300025292 Bacteria 159931
322 Ga0209676_1000757 3300025292 Bacteria 43636
323 Ga0209676_1001007 3300025292 Bacteria 33026
324 Ga0209676_1007094 3300025292 Bacteria 5363
325 Ga0209676_1018153 3300025292 Bacteria 2462
326 Ga0209676_1028115 3300025292 Bacteria 1757
327 Ga0209676_1065877 3300025292 Bacteria 880
328 Ga0209025_1000121 3300025294 Bacteria 208700
329 Ga0209025_1000168 3300025294 Bacteria 162386
330 Ga0209025_1000220 3300025294 Bacteria 136977
331 Ga0209025_1000544 3300025294 Bacteria 70638
332 Ga0209025_1001108 3300025294 Bacteria 38669
333 Ga0209025_1001466 3300025294 Bacteria 30784
334 Ga0209025_1008041 3300025294 Bacteria 7682
335 Ga0209025_1021707 3300025294 Bacteria 3444
336 Ga0209025_1022779 3300025294 Bacteria 3305
337 Ga0209025_1022812 3300025294 Bacteria 3301
338 Ga0209025_1062080 3300025294 Bacteria 1389
339 Ga0209025_1098582 3300025294 Bacteria 932
340 Ga0209564_1000239 3300025295 Bacteria 119761
341 Ga0209564_1000287 3300025295 Bacteria 102328
342 Ga0209564_1002099 3300025295 Bacteria 17049
343 Ga0209564_1004174 3300025295 Bacteria 9027
344 Ga0209564_1020032 3300025295 Bacteria 2471
345 Ga0209758_1000027 3300025297 Bacteria 549650
346 Ga0209758_1002782 3300025297 Bacteria 17126
347 Ga0209758_1005551 3300025297 Bacteria 9617
348 Ga0209758_1012650 3300025297 Bacteria 4696
349 Ga0209758_1012867 3300025297 Bacteria 4634
350 Ga0209050_1000002 3300025298 Bacteria 1792849
351 Ga0209050_1000007 3300025298 Bacteria 1187891
352 Ga0209050_1001089 3300025298 Bacteria 33034
353 Ga0209050_1010883 3300025298 Bacteria 4409
354 Ga0209050_1011437 3300025298 Bacteria 4207
355 Ga0209050_1022072 3300025298 Bacteria 2294
356 Ga0209050_1027972 3300025298 Bacteria 1842
357 Ga0209256_1000081 3300025299 Bacteria 222908
358 Ga0209256_1000470 3300025299 Bacteria 60553
359 Ga0209256_1001206 3300025299 Bacteria 28955
360 Ga0209256_1004326 3300025299 Bacteria 9027
361 Ga0209256_1007583 3300025299 Bacteria 5300
362 Ga0209256_1023119 3300025299 Bacteria 1862
363 Ga0207426_1000027 3300025302 Bacteria 513176
364 Ga0207426_1000095 3300025302 Bacteria 274234
365 Ga0207426_1000176 3300025302 Bacteria 159819
366 Ga0209051_1000002 3300025303 Bacteria 1631846
367 Ga0209051_1000009 3300025303 Bacteria 706778
368 Ga0209051_1000113 3300025303 Bacteria 152417
369 Ga0209051_1000274 3300025303 Bacteria 84662
370 Ga0209051_1000347 3300025303 Bacteria 68841
371 Ga0209051_1000367 3300025303 Bacteria 65677
372 Ga0209051_1000373 3300025303 Bacteria 64348
373 Ga0209051_1000375 3300025303 Bacteria 63742
374 Ga0209051_1000553 3300025303 Bacteria 45537
375 Ga0209051_1000583 3300025303 Bacteria 43428
376 Ga0209051_1010791 3300025303 Bacteria 4572
377 Ga0209257_1000002 3300025304 Bacteria 1767052
378 Ga0209257_1000011 3300025304 Bacteria 1112630
379 Ga0209257_1000012 3300025304 Bacteria 1111138
380 Ga0209257_1000286 3300025304 Bacteria 111738
381 Ga0209257_1000449 3300025304 Bacteria 77522
382 Ga0209257_1000866 3300025304 Bacteria 43105
383 Ga0209257_1006354 3300025304 Bacteria 7670
384 Ga0209257_1008169 3300025304 Bacteria 6058
385 Ga0209257_1015259 3300025304 Bacteria 3215
386 Ga0207656_10000704 3300025321 Bacteria 10951
387 Ga0207656_10014809 3300025321 Bacteria 3012
388 Ga0207656_10063725 3300025321 Bacteria 1623
389 Ga0207655_1002072 3300025728 Bacteria 16828
390 Ga0207682_10053981 3300025893 Bacteria 1668
391 Ga0207688_10164791 3300025901 Bacteria 1316
392 Ga0207680_10363756 3300025903 Bacteria 1018
393 Ga0207645_10375932 3300025907 Bacteria 953
394 Ga0207643_10069814 3300025908 Bacteria 2020
395 Ga0207705_10246089 3300025909 Bacteria 1363
396 Ga0207705_10251493 3300025909 Bacteria 1348
397 Ga0207707_10254859 3300025912 Bacteria 1524
398 Ga0207695_10067576 3300025913 Bacteria 3666
399 Ga0207695_10103057 3300025913 Bacteria 2846
400 Ga0207695_10454631 3300025913 Bacteria 1164
401 Ga0207671_10112041 3300025914 Bacteria 2077
402 Ga0207671_10128694 3300025914 Bacteria 1942
403 Ga0207671_10741066 3300025914 Bacteria 781
404 Ga0207657_10012553 3300025919 Bacteria 8355
405 Ga0207657_10353658 3300025919 Bacteria 1158
406 Ga0207649_10038780 3300025920 Bacteria 2886
407 Ga0207649_10094843 3300025920 Bacteria 1962
408 Ga0207652_10150007 3300025921 Bacteria 2087
409 Ga0207652_10228451 3300025921 Bacteria 1677
410 Ga0207652_10599279 3300025921 Bacteria 988
411 Ga0207694_10014406 3300025924 Bacteria 5960
412 Ga0207694_10057945 3300025924 Bacteria 3013
413 Ga0207650_10008936 3300025925 Bacteria 6846
414 Ga0207650_10227158 3300025925 Bacteria 1504
415 Ga0207659_10173289 3300025926 Bacteria 1703
416 Ga0207687_10186622 3300025927 Bacteria 1610
417 Ga0207687_10324063 3300025927 Bacteria 1248
418 Ga0207687_10821508 3300025927 Bacteria 793
419 Ga0207644_10040844 3300025931 Bacteria 3279
420 Ga0207706_10075641 3300025933 Bacteria 2961
421 Ga0207706_10306336 3300025933 Bacteria 1383
422 Ga0207686_10143107 3300025934 Bacteria 1655
423 Ga0207709_10000205 3300025935 Bacteria 77131
424 Ga0207709_10000775 3300025935 Bacteria 25131
425 Ga0207709_10001443 3300025935 Bacteria 16593
426 Ga0207709_10026435 3300025935 Bacteria 3334
427 Ga0207670_10115274 3300025936 Bacteria 1943
428 Ga0207669_10305795 3300025937 Bacteria 1210
429 Ga0207669_10373259 3300025937 Bacteria 1109
430 Ga0207704_10737480 3300025938 Bacteria 818
431 Ga0207691_10003117 3300025940 Bacteria 16191
432 Ga0207691_10099686 3300025940 Bacteria 2594
433 Ga0207691_10183259 3300025940 Bacteria 1829
434 Ga0207691_10213107 3300025940 Bacteria 1677
435 Ga0207689_10092172 3300025942 Bacteria 2489
436 Ga0207661_10248391 3300025944 Bacteria 1580
437 Ga0207679_10004885 3300025945 Bacteria 8355
438 Ga0207679_10069827 3300025945 Bacteria 2645
439 Ga0207667_10039072 3300025949 Bacteria 5060
440 Ga0207667_10064795 3300025949 Bacteria 3814
441 Ga0207667_10281405 3300025949 Bacteria 1700
442 Ga0207651_10001658 3300025960 Bacteria 10220
443 Ga0207651_10472957 3300025960 Bacteria 1079
444 Ga0207668_10149909 3300025972 Bacteria 1804
445 Ga0207668_10532612 3300025972 Bacteria 1015
446 Ga0207640_10023587 3300025981 Bacteria 3700
447 Ga0207640_10213151 3300025981 Bacteria 1473
448 Ga0207640_10366858 3300025981 Bacteria 1162
449 Ga0207658_10029339 3300025986 Bacteria 3884
450 Ga0207677_10326456 3300026023 Bacteria 1277
451 Ga0207703_10630473 3300026035 Bacteria 1016
452 Ga0207639_10039065 3300026041 Bacteria 3534
453 Ga0207639_10350688 3300026041 Bacteria 1318
454 Ga0207639_10630024 3300026041 Bacteria 991
455 Ga0207678_10002002 3300026067 Bacteria 18551
456 Ga0207702_10016299 3300026078 Bacteria 6151
457 Ga0207702_10054569 3300026078 Bacteria 3387
458 Ga0207702_10363759 3300026078 Bacteria 1387
459 Ga0207702_10381692 3300026078 Bacteria 1355
460 Ga0207641_10183018 3300026088 Bacteria 1920
461 Ga0207641_10226137 3300026088 Bacteria 1737
462 Ga0207648_10105730 3300026089 Bacteria 2469
463 Ga0207676_10030082 3300026095 Bacteria 4072
464 Ga0207676_10034484 3300026095 Bacteria 3832
465 Ga0207676_10135625 3300026095 Bacteria 2099
466 Ga0207674_10007917 3300026116 Bacteria 12341
467 Ga0207674_10157222 3300026116 Bacteria 2228
468 Ga0207674_10195272 3300026116 Bacteria 1974
469 Ga0207698_10002093 3300026142 Bacteria 11776
470 Ga0207698_10004842 3300026142 Bacteria 8245
471 Ga0207698_10992278 3300026142 Bacteria 850
472 Ga0209281_1011677 3300027111 Bacteria 1957
473 Ga0209371_1005256 3300027312 Bacteria 5221
474 Ga0209282_1000521 3300027666 Bacteria 18596
475 Ga0209282_1001174 3300027666 Bacteria 14074
476 Ga0209282_1137457 3300027666 Bacteria 1199
477 Ga0207428_10303229 3300027907 Bacteria 1182
478 Ga0268266_10016386 3300028379 Bacteria 6337
479 Ga0268266_10222780 3300028379 Bacteria 1735
480 Ga0268265_10293161 3300028380 Bacteria 1461
481 Ga0268264_10222893 3300028381 Bacteria 1737
482 Ga0268264_11404748 3300028381 Bacteria 709
483 Ga0307515_10000152 3300028794 Bacteria 167305
484 Ga0307515_10014281 3300028794 Bacteria 14746
485 Ga0307512_10206815 3300030522 Bacteria 1051
486 Ga0316177_1192376 3300030731 Bacteria 3822
487 Ga0314311_1055507 3300030733 Bacteria 11059
488 Ga0316179_1038668 3300030734 Bacteria 3056
489 Ga0316178_1036717 3300030735 Bacteria 5475
490 Ga0316180_1138007 3300030736 Bacteria 1441
491 Ga0316183_1051137 3300030742 Bacteria 5822
492 Ga0316181_1003089 3300030744 Bacteria 973
493 Ga0316182_1122964 3300030745 Bacteria 4127
494 Ga0316182_1388324 3300030745 Bacteria 4148
495 Ga0265328_10097000 3300031239 Bacteria 1090
496 Ga0265325_10004238 3300031241 Bacteria 9105
497 Ga0265331_10098030 3300031250 Bacteria 1351
498 Ga0265327_10000028 3300031251 Bacteria 361066
499 Ga0265327_10000777 3300031251 Bacteria 49259
500 Ga0265327_10008172 3300031251 Bacteria 7854
501 Ga0265327_10036761 3300031251 Bacteria 2688
502 Ga0307513_10065904 3300031456 Bacteria 3809
503 Ga0307513_10090119 3300031456 Bacteria 3129
504 Ga0307408_100003858 3300031548 Bacteria 10198
505 Ga0307408_100111775 3300031548 Bacteria 2099
506 Ga0307408_100177221 3300031548 Bacteria 1706
507 Ga0307408_100332892 3300031548 Bacteria 1283
508 Ga0307408_100355467 3300031548 Bacteria 1244
509 Ga0307408_100444291 3300031548 Bacteria 1123
510 Ga0307408_100665219 3300031548 Bacteria 932
511 Ga0265313_10030042 3300031595 Bacteria 2803
512 Ga0307514_10062787 3300031649 Bacteria 2823
513 Ga0307514_10124915 3300031649 Bacteria 1785
514 Ga0307405_10007105 3300031731 Bacteria 5567
515 Ga0307405_10186499 3300031731 Bacteria 1494
516 Ga0307410_11059536 3300031852 Bacteria 701
517 Ga0307406_10002407 3300031901 Bacteria 10164
518 Ga0307406_10006868 3300031901 Bacteria 6300
519 Ga0307406_10634622 3300031901 Bacteria 885
520 Ga0307407_10200361 3300031903 Bacteria 1337
521 Ga0307412_10011637 3300031911 Bacteria 5101
522 Ga0307412_10029890 3300031911 Bacteria 3423
523 Ga0307412_10052063 3300031911 Bacteria 2709
524 Ga0307412_10081391 3300031911 Bacteria 2239
525 Ga0307412_10090438 3300031911 Bacteria 2139
526 Ga0307412_10544762 3300031911 Bacteria 973
527 Ga0307412_11012476 3300031911 Bacteria 734
528 Ga0307409_100494442 3300031995 Bacteria 1190
529 Ga0307416_100002355 3300032002 Bacteria 10811
530 Ga0307416_100248852 3300032002 Bacteria 1728
531 Ga0307416_100273917 3300032002 Bacteria 1659
532 Ga0307416_100839362 3300032002 Bacteria 1016
533 Ga0307414_10053714 3300032004 Bacteria 2811
534 Ga0307414_10272027 3300032004 Bacteria 1419
535 Ga0307414_10346528 3300032004 Bacteria 1273
536 Ga0307414_10353223 3300032004 Bacteria 1262
537 Ga0307414_10516729 3300032004 Bacteria 1059
538 Ga0307411_10126489 3300032005 Bacteria 1860
539 Ga0307411_10127142 3300032005 Bacteria 1855
540 Ga0307411_10154694 3300032005 Bacteria 1709
541 Ga0307411_10178818 3300032005 Bacteria 1608
542 Ga0307411_10331449 3300032005 Bacteria 1233
543 Ga0307411_10407642 3300032005 Bacteria 1125
544 Ga0307411_10477974 3300032005 Bacteria 1048
545 Ga0307415_100426498 3300032126 Bacteria 1140
546 Ga0307510_10031385 3300033180 Bacteria 6004
547 Ga0395899_0001942 3300037312 Bacteria 17020
548 Ga0395899_0037564 3300037312 Bacteria 3630
549 Ga0395900_0007000 3300037418 Bacteria 11682
550 Ga0395900_0031551 3300037418 Bacteria 5446
551 Ga0395900_0328009 3300037418 Bacteria 1509
552 Ga0395900_0426841 3300037418 Bacteria 1285
553 Ga0395898_0005430 3300037466 Bacteria 13766
554 Ga0395898_0023388 3300037466 Bacteria 6246
555 Ga0395898_0160759 3300037466 Bacteria 2148
556 Ga0395898_0284077 3300037466 Bacteria 1579
557 Ga0395905_0007138 3300037471 Bacteria 11170
558 Ga0395905_0022261 3300037471 Bacteria 5997
559 Ga0395905_0034921 3300037471 Bacteria 4720
560 Ga0395905_0134156 3300037471 Bacteria 2329
561 Ga0395905_0288704 3300037471 Bacteria 1527
562 Ga0395901_0053458 3300038443 Bacteria 4196
563 Ga0395901_0087292 3300038443 Bacteria 3261
564 Ga0395901_0089104 3300038443 Bacteria 3228
565 Ga0395901_0098619 3300038443 Bacteria 3063
566 Ga0395901_0126807 3300038443 Bacteria 2682
567 Ga0395901_0161306 3300038443 Bacteria 2355
568 Ga0395901_0241940 3300038443 Bacteria 1882
569 Ga0395901_0291445 3300038443 Bacteria 1694
570 Ga0400483_082990 3300039062 Bacteria 17925
571 Ga0436361_0042902 3300039447 Bacteria 14654
572 Ga0436361_0481133 3300039447 Bacteria 61506
573 Ga0439436_0040093 3300041404 Bacteria 1343
574 Ga0439439_0125455 3300041406 Bacteria 718
575 Ga0439466_0047929 3300041411 Bacteria 1407
576 Ga0439465_0011629 3300041413 Bacteria 2762
577 Ga0439465_0050689 3300041413 Bacteria 1358
578 Ga0451789_1335968 3300041443 Bacteria 888
579 Ga0451807_1518065 3300041486 Bacteria 1391
580 Ga0451841_0497166 3300041498 Bacteria 881
581 Ga0451849_0678049 3300041505 Bacteria 1012
582 Ga0451843_0558905 3300041509 Bacteria 962
583 Ga0451855_0724113 3300041511 Bacteria 1287
584 Ga0451853_1561911 3300041512 Bacteria 11386
585 Ga0439433_0045643 3300041999 Bacteria 1026
586 Ga0439442_007281 3300042002 Bacteria 2224
587 Ga0439445_0005785 3300042004 Bacteria 2826
588 Ga0439445_0064595 3300042004 Bacteria 1005
589 Ga0439432_018005 3300042006 Bacteria 2365
590 Ga0439432_077720 3300042006 Bacteria 1007
591 Ga0439449_0003797 3300042007 Bacteria 5846
592 Ga0439449_0027720 3300042007 Bacteria 2113
593 Ga0439449_0029793 3300042007 Bacteria 2033
594 Ga0439449_0055546 3300042007 Bacteria 1462
595 Ga0439449_0058086 3300042007 Bacteria 1428
596 Ga0439452_007125 3300042010 Bacteria 3445
597 Ga0439452_053252 3300042010 Bacteria 921
598 Ga0439457_039037 3300042014 Bacteria 1057
599 Ga0439462_0072097 3300042015 Bacteria 938
600 Ga0450911_000935 3300042115 Bacteria 7664
601 Ga0450921_001087 3300042123 Bacteria 1550
602 Ga0450921_007383 3300042123 Bacteria 873
603 Ga0450923_001056 3300042125 Bacteria 3472
604 Ga0450923_025537 3300042125 Bacteria 1178
605 Ga0450890_003439 3300042127 Bacteria 2102
606 Ga0450906_001534 3300042145 Bacteria 5047
607 Ga0450906_011587 3300042145 Bacteria 1646
608 Ga0450907_018413 3300042146 Bacteria 1169
609 Ga0450908_007977 3300042184 Bacteria 1986
610 Ga0450908_018068 3300042184 Bacteria 1249
611 Ga0450908_030656 3300042184 Bacteria 934
612 Ga0450918_000934 3300042531 Bacteria 6099
613 Ga0450918_021669 3300042531 Bacteria 1122
614 Ga0451577_0066420 3300042876 Bacteria 3217
615 Ga0466969_0152924 3300044656 Bacteria 1062
616 Ga0466965_0182478 3300044683 Bacteria 1107
617 Ga0453684_0516077 3300044712 Bacteria 1321
618 Ga0453684_0546791 3300044712 Bacteria 1276
619 Ga0466957_0189471 3300044842 Bacteria 1347
620 Ga0451576_0585814 3300045051 Bacteria 1172
621 Ga0466967_0443681 3300045976 Bacteria 1268
622 Ga0495627_003930 3300046453 Bacteria 6357
623 Ga0495627_013261 3300046453 Bacteria 2902
624 Ga0495603_0165527 3300046455 Bacteria 1282
625 Ga0495629_0352332 3300046459 Bacteria 1004
626 Ga0495638_0007637 3300046460 Bacteria 7732
627 Ga0495650_0015654 3300046471 Bacteria 3880
628 Ga0495582_0153466 3300046473 Bacteria 1308
629 Ga0495639_0003490 3300046475 Bacteria 6800
630 Ga0495607_0000252 3300046501 Bacteria 57555
631 Ga0495606_0173958 3300046507 Bacteria 1247
632 Ga0495606_0196526 3300046507 Bacteria 1152
633 Ga0495610_0080827 3300046512 Bacteria 1493
634 Ga0495610_0080849 3300046512 Bacteria 1493
635 Ga0495616_0000916 3300046513 Bacteria 21218
636 Ga0495616_0023039 3300046513 Bacteria 3356
637 Ga0495618_0286256 3300046514 Bacteria 1027
638 Ga0495620_0008895 3300046515 Bacteria 5367
639 Ga0495628_0380461 3300046516 Bacteria 1034
640 Ga0495630_0222885 3300046517 Bacteria 1440
641 Ga0495631_0000233 3300046518 Bacteria 38235
642 Ga0495631_0095683 3300046518 Bacteria 1278
643 Ga0495637_0008199 3300046520 Bacteria 5138
644 Ga0495637_0010611 3300046520 Bacteria 4449
645 Ga0495637_0140069 3300046520 Bacteria 918
646 Ga0495648_0137089 3300046524 Bacteria 1293
647 Ga0495663_0064363 3300046525 Bacteria 1157
648 Ga0495663_0095518 3300046525 Bacteria 973
649 Ga0495642_0100047 3300046528 Bacteria 1233
650 Ga0495654_0090347 3300046530 Bacteria 1422
651 Ga0495621_0016352 3300046539 Bacteria 2380
652 Ga0495621_0020533 3300046539 Bacteria 2169
653 Ga0495621_0042258 3300046539 Bacteria 1604
654 Ga0495621_0114909 3300046539 Bacteria 1035
655 Ga0495622_0014993 3300046557 Bacteria 3604
656 Ga0495633_0003443 3300046558 Bacteria 10531
657 Ga0495633_0060037 3300046558 Bacteria 1782
658 Ga0495633_0150745 3300046558 Bacteria 1074
659 Ga0495667_0235221 3300046559 Bacteria 1168
660 Ga0495656_0000108 3300046615 Bacteria 33050
661 Ga0495656_0003752 3300046615 Bacteria 5158
662 Ga0495656_0034326 3300046615 Bacteria 2076
663 Ga0495625_0000057 3300046660 Bacteria 181623
664 Ga0495625_0000637 3300046660 Bacteria 50416
665 Ga0495625_0098883 3300046660 Bacteria 2006
666 Ga0495625_0108633 3300046660 Bacteria 1898
667 Ga0495659_0084499 3300046664 Bacteria 1210
668 Ga0495661_0360397 3300046665 Bacteria 714
669 Ga0495588_0018926 3300046674 Bacteria 3366
670 Ga0495588_0039983 3300046674 Bacteria 2390
671 Ga0495647_0085866 3300046681 Bacteria 1283
672 Ga0495647_0133047 3300046681 Bacteria 1055
673 Ga0495670_0155104 3300046691 Bacteria 1201
674 Ga0495671_0001282 3300046692 Bacteria 17146
675 Ga0495671_0020509 3300046692 Bacteria 3482
676 Ga0495636_0116299 3300047318 Bacteria 1180
677 Ga0495676_0007868 3300047321 Bacteria 9777
678 Ga0495677_0028439 3300047445 Bacteria 2030
679 Ga0495681_0002764 3300047470 Bacteria 12417
680 Ga0495684_0583206 3300047471 Bacteria 757
681 Ga0495686_0001297 3300047472 Bacteria 28173
682 Ga0495593_0005660 3300047673 Bacteria 7376
683 Ga0495593_0078652 3300047673 Bacteria 1708
684 Ga0495614_0003894 3300048089 Bacteria 6704
685 Ga0495615_0062668 3300048090 Bacteria 985
686 Ga0496101_0002803 3300048904 Bacteria 10698
687 Ga0496101_0009650 3300048904 Bacteria 6349
688 Ga0496101_0455762 3300048904 Bacteria 1009
689 Ga0496102_0003435 3300048905 Bacteria 13428
690 Ga0496102_0004534 3300048905 Bacteria 11740
691 Ga0496102_0030993 3300048905 Bacteria 4791
692 Ga0496103_0013210 3300048906 Bacteria 4896
693 Ga0496103_0236151 3300048906 Bacteria 1176
694 Ga0496104_0006268 3300048907 Bacteria 10455
695 Ga0496104_0045610 3300048907 Bacteria 4124
696 Ga0496104_0137938 3300048907 Bacteria 2343
697 Ga0496105_0002236 3300048908 Bacteria 14021
698 Ga0496105_0381014 3300048908 Bacteria 1122
699 Ga0496106_0011540 3300048909 Bacteria 6531
700 Ga0496106_0165973 3300048909 Bacteria 1748
701 Ga0496106_0340134 3300048909 Bacteria 1205
702 Ga0496108_0170429 3300048911 Bacteria 1883
703 Ga0496108_0201964 3300048911 Bacteria 1725
704 Ga0496108_0397048 3300048911 Bacteria 1204
705 Ga0496110_0038468 3300048913 Bacteria 4163
706 Ga0496110_0231827 3300048913 Bacteria 1679
707 Ga0496111_0236653 3300048914 Bacteria 1356
708 Ga0496112_0712570 3300048915 Bacteria 931
709 Ga0496113_0159675 3300048916 Bacteria 1782
710 Ga0496114_0102391 3300048917 Bacteria 2446
711 Ga0496114_0179880 3300048917 Bacteria 1846
712 Ga0496116_0022162 3300048919 Bacteria 4769
713 Ga0496116_0026734 3300048919 Bacteria 4210
714 Ga0496116_0035145 3300048919 Bacteria 3524
715 Ga0496116_0145520 3300048919 Bacteria 1325
716 Ga0496116_0192403 3300048919 Bacteria 1078
717 Ga0496117_0000030 3300048920 Bacteria 389141
718 Ga0496117_0002266 3300048920 Bacteria 24847
719 Ga0496117_0016902 3300048920 Bacteria 6120
720 Ga0496117_0086801 3300048920 Bacteria 2031
721 Ga0496117_0116370 3300048920 Bacteria 1652
722 Ga0496117_0173575 3300048920 Bacteria 1248
723 Ga0496118_0003433 3300048921 Bacteria 19953
724 Ga0496118_0003748 3300048921 Bacteria 18793
725 Ga0496118_0011117 3300048921 Bacteria 8829
726 Ga0496118_0079459 3300048921 Bacteria 2314
727 Ga0496118_0101001 3300048921 Bacteria 1949
728 Ga0496119_0006742 3300048922 Bacteria 10543
729 Ga0496119_0024993 3300048922 Bacteria 4182
730 Ga0496120_0000148 3300048923 Bacteria 116605
731 Ga0496120_0247637 3300048923 Bacteria 838
732 Ga0496121_0008570 3300048924 Bacteria 11979
733 Ga0496121_0024154 3300048924 Bacteria 5823
734 Ga0496121_0045401 3300048924 Bacteria 3776
735 Ga0496121_0066020 3300048924 Bacteria 2940
736 Ga0496121_0123171 3300048924 Bacteria 1954
737 Ga0496121_0180394 3300048924 Bacteria 1524
738 Ga0496121_0248526 3300048924 Bacteria 1235
739 Ga0496121_0305559 3300048924 Bacteria 1077
740 Ga0496122_0000050 3300048925 Bacteria 267874
741 Ga0496122_0000565 3300048925 Bacteria 75875
742 Ga0496122_0001461 3300048925 Bacteria 38115
743 Ga0496122_0005040 3300048925 Bacteria 15971
744 Ga0496122_0055769 3300048925 Bacteria 2953
745 Ga0496122_0068837 3300048925 Bacteria 2539
746 Ga0496122_0093644 3300048925 Bacteria 2037
747 Ga0496122_0113078 3300048925 Bacteria 1775
748 Ga0496122_0172882 3300048925 Bacteria 1299
749 Ga0496123_0000023 3300048926 Bacteria 346894
750 Ga0496123_0000179 3300048926 Bacteria 127833
751 Ga0496123_0000247 3300048926 Bacteria 109186
752 Ga0496123_0001600 3300048926 Bacteria 30686
753 Ga0496123_0029502 3300048926 Bacteria 4036
754 Ga0496123_0041436 3300048926 Bacteria 3192
755 Ga0496123_0043777 3300048926 Bacteria 3070
756 Ga0496123_0152383 3300048926 Bacteria 1245
757 Ga0496123_0230881 3300048926 Bacteria 926
758 Ga0496124_0000004 3300048927 Bacteria 976131
759 Ga0496124_0001021 3300048927 Bacteria 44387
760 Ga0496124_0002705 3300048927 Bacteria 22653
761 Ga0496124_0016756 3300048927 Bacteria 6949
762 Ga0496124_0021012 3300048927 Bacteria 6020
763 Ga0496124_0144906 3300048927 Bacteria 1870
764 Ga0496124_0180198 3300048927 Bacteria 1627
765 Ga0496124_0230138 3300048927 Bacteria 1386
766 Ga0496125_0000161 3300048928 Bacteria 150707
767 Ga0496125_0000171 3300048928 Bacteria 145308
768 Ga0496125_0027820 3300048928 Bacteria 5116
769 Ga0496125_0035255 3300048928 Bacteria 4394
770 Ga0496125_0042236 3300048928 Bacteria 3886
771 Ga0496125_0094490 3300048928 Bacteria 2227
772 Ga0496125_0095746 3300048928 Bacteria 2207
773 Ga0496125_0116994 3300048928 Bacteria 1913
774 Ga0496125_0205763 3300048928 Bacteria 1283
775 Ga0496125_0226980 3300048928 Bacteria 1198
776 Ga0496125_0254557 3300048928 Bacteria 1105
777 Ga0496125_0292768 3300048928 Bacteria 1001
778 Ga0496126_0027931 3300048929 Bacteria 5381
779 Ga0501031_0013513 3300049568 Bacteria 5321
780 Ga0501032_0003246 3300049569 Bacteria 12503
781 Ga0501033_0000059 3300049570 Bacteria 105311
782 Ga0501033_0001825 3300049570 Bacteria 18567
783 Ga0501034_0078279 3300049571 Bacteria 3311
784 Ga0501034_0092587 3300049571 Bacteria 3019
785 Ga0501034_0345391 3300049571 Bacteria 1417
786 Ga0501036_0008122 3300049572 Bacteria 8600
787 Ga0501037_0002561 3300049573 Bacteria 13135
788 Ga0501037_0009063 3300049573 Bacteria 7293
789 Ga0501037_0114231 3300049573 Bacteria 1944
790 Ga0501037_0414562 3300049573 Bacteria 922
791 Ga0501037_0456101 3300049573 Bacteria 871
792 Ga0501038_0073454 3300049574 Bacteria 2896
793 Ga0501038_0605245 3300049574 Bacteria 829
794 Ga0501043_0000090 3300049579 Bacteria 81336
795 Ga0501043_0000828 3300049579 Bacteria 27461
796 Ga0501043_0134025 3300049579 Bacteria 1941
797 Ga0501043_0312175 3300049579 Bacteria 1200
798 Ga0501046_0000126 3300049580 Bacteria 81334
799 Ga0501046_0033515 3300049580 Bacteria 4148
800 Ga0501047_0000160 3300049581 Bacteria 81946
801 Ga0501047_0076941 3300049581 Bacteria 3211
802 Ga0501048_0000040 3300049582 Bacteria 63031
803 Ga0501249_009632 3300049679 Bacteria 2010
804 Ga0501252_019446 3300049682 Bacteria 877
805 Ga0501225_0007904 3300049705 Bacteria 3069
806 Ga0501262_000028 3300049759 Bacteria 19106
807 Ga0501262_000393 3300049759 Bacteria 5317
808 Ga0501266_030019 3300049763 Bacteria 773
809 Ga0501035_0000213 3300049822 Bacteria 69670
810 Ga0501035_0002403 3300049822 Bacteria 18351
811 Ga0501035_0169553 3300049822 Bacteria 1886
812 Ga0501035_0304843 3300049822 Bacteria 1341
813 Ga0501035_0395444 3300049822 Bacteria 1150
814 Ga0501044_0000045 3300049823 Bacteria 148353
815 Ga0501044_0009438 3300049823 Bacteria 10627
816 Ga0501044_0198289 3300049823 Bacteria 1966
817 Ga0501045_0035981 3300049824 Bacteria 3595
818 nmdc:mga03683_128261_c1 3300050489 Bacteria 1133
819 nmdc:mga03683_136111_c1 3300050489 Bacteria 1102
820 nmdc:mga03683_205984_c1 3300050489 Bacteria 904
821 nmdc:mga03683_26366_c1 3300050489 Bacteria 2292
822 nmdc:mga03683_34001_c1 3300050489 Bacteria 2061
823 nmdc:mga03683_41053_c1 3300050489 Bacteria 1900
824 nmdc:mga03683_78960_c1 3300050489 Bacteria 1418
825 nmdc:mga03n38_164100_c1 3300050490 Bacteria 1127
826 nmdc:mga03n38_21477_c1 3300050490 Bacteria 2598
827 nmdc:mga00v17_171779_c1 3300050491 Bacteria 1398
828 nmdc:mga00v17_213293_c1 3300050491 Bacteria 1249
829 nmdc:mga00v17_55892_c1 3300050491 Bacteria 2412
830 nmdc:mga00v17_5989_c1 3300050491 Bacteria 6433
831 nmdc:mga00v17_700_c1 3300050491 Bacteria 18378
832 nmdc:mga0yw44_185856_c1 3300050492 Bacteria 1369
833 nmdc:mga0yw44_4974_c1 3300050492 Bacteria 6201
834 nmdc:mga0yw44_76476_c1 3300050492 Bacteria 2090
835 nmdc:mga0k408_140873_c1 3300050493 Bacteria 1435
836 nmdc:mga0k408_264627_c1 3300050493 Bacteria 1027
837 nmdc:mga0k408_29093_c1 3300050493 Bacteria 3143
838 nmdc:mga0k408_78681_c1 3300050493 Bacteria 1929
839 nmdc:mga06z11_1446_c1 3300050494 Bacteria 8826
840 nmdc:mga07m45_1027_c1 3300050496 Bacteria 12374
841 nmdc:mga07m45_278739_c1 3300050496 Bacteria 973
842 nmdc:mga07m45_3652_c1 3300050496 Bacteria 7431
843 nmdc:mga07m45_59_c1 3300050496 Bacteria 45010
844 nmdc:mga07m45_8066_c1 3300050496 Bacteria 5399
845 nmdc:mga08x19_447026_c1 3300050514 Bacteria 909
846 nmdc:mga0sz30_13103_c1 3300050516 Bacteria 3240
847 nmdc:mga0sz30_29872_c1 3300050516 Bacteria 2249
848 nmdc:mga0sz30_5751_c1 3300050516 Bacteria 4565
849 Ga0500643_009198 3300053087 Bacteria 3796
850 Ga0500651_0000029 3300053093 Bacteria 113528
851 Ga0500651_0157988 3300053093 Bacteria 1357
852 Ga0500641_0099616 3300053096 Bacteria 1246
853 Ga0500556_0000102 3300053104 Bacteria 76549
854 Ga0500560_000085 3300053107 Bacteria 9184
855 Ga0500571_000896 3300053110 Bacteria 13015
856 Ga0500572_094070 3300053111 Bacteria 952
857 Ga0500592_025006 3300053116 Bacteria 963
858 Ga0500593_000625 3300053117 Bacteria 13599
859 Ga0500593_109834 3300053117 Bacteria 1135
860 Ga0500594_0003141 3300053118 Bacteria 3611
861 Ga0500594_0014303 3300053118 Bacteria 1898
862 Ga0500608_002231 3300053122 Bacteria 6993
863 Ga0500655_014612 3300053133 Bacteria 1437
864 Ga0500658_0000243 3300053134 Bacteria 25613
865 Ga0500658_0000358 3300053134 Bacteria 20187
866 Ga0500658_0004281 3300053134 Bacteria 5348
867 Ga0500559_0000021 3300053136 Bacteria 129980
868 Ga0500559_0070922 3300053136 Bacteria 1568
869 Ga0500559_0084981 3300053136 Bacteria 1443
870 Ga0500559_0134986 3300053136 Bacteria 1153
871 Ga0500561_0000067 3300053137 Bacteria 20534
872 Ga0500564_037142 3300053138 Bacteria 2246
873 Ga0500568_0004013 3300053139 Bacteria 7983
874 Ga0500573_0216890 3300053140 Bacteria 1006
875 Ga0500574_000803 3300053141 Bacteria 4234
876 Ga0500574_039051 3300053141 Bacteria 1316
877 Ga0500577_0025912 3300053142 Bacteria 1990
878 Ga0500616_0039096 3300053153 Bacteria 2559
879 Ga0500624_000351 3300053157 Bacteria 15016
880 Ga0500627_0000393 3300053158 Bacteria 11732
881 Ga0500627_0008574 3300053158 Bacteria 3640
882 Ga0500633_0078818 3300053160 Bacteria 1189
883 Ga0500634_0054964 3300053161 Bacteria 2132
884 Ga0500634_0117040 3300053161 Bacteria 1304
885 Ga0500634_0167315 3300053161 Bacteria 1006
886 Ga0500636_0000012 3300053177 Bacteria 132207
887 Ga0500645_030395 3300053730 Bacteria 1626
888 Ga0500645_043394 3300053730 Bacteria 1324
889 Ga0500596_009403 3300053735 Bacteria 1526
890 Ga0587090_000032 3300059510 Bacteria 7356
891 Ga0587091_001375 3300059511 Bacteria 2609
892 Ga0587067_000808 3300059640 Bacteria 3050
893 Ga0587072_000287 3300059643 Bacteria 4707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003659 JGI25404J52841_10033220 JGI25404J52841_100332202 181
2 3300025242 Ga0209258_104563 Ga0209258_1045633 204
3 3300005530 Ga0070679_100949201 Ga0070679_1009492011 206
4 3300005539 Ga0068853_100177581 Ga0068853_1001775812 206
5 3300005563 Ga0068855_100232591 Ga0068855_1002325912 206
6 3300005577 Ga0068857_100150767 Ga0068857_1001507672 206
7 3300025949 Ga0207667_10281405 Ga0207667_102814052 206
8 3300026041 Ga0207639_10350688 Ga0207639_103506882 206
9 3300026116 Ga0207674_10157222 Ga0207674_101572223 206
10 3300037418 Ga0395900_0426841 Ga0395900_0426841_128_778 206
11 3300038443 Ga0395901_0089104 Ga0395901_0089104_1055_1705 206
12 iso_pu_bacteria 2643221674 2644413864 207
13 iso_pu_bacteria 2565956521 2566035776 209
14 iso_pu_bacteria 2512047086 2512532045 210
15 iso_pu_bacteria 2513020051 2513230249 210
16 iso_pu_bacteria 2513237084 2513574137 210
17 iso_pu_bacteria 2513237159 2514000133 210
18 iso_pu_bacteria 2537561587 2537873135 210
19 iso_pu_bacteria 2554235003 2554244482 210
20 iso_pu_bacteria 2558860242 2559297673 210
21 iso_pu_bacteria 2599185210 2599603738 210
22 iso_pu_bacteria 2599185214 2599623988 210
23 iso_pu_bacteria 2599185226 2599671999 210
24 iso_pu_bacteria 2599185227 2599681919 210
25 iso_pu_bacteria 2599185229 2599693932 210
26 iso_pu_bacteria 2600255279 2601612467 210
27 iso_pu_bacteria 2600255308 2601749008 210
28 iso_pu_bacteria 2643221570 2643867529 210
29 iso_pu_bacteria 2643221582 2643917498 210
30 iso_pu_bacteria 2643221596 2643990452 210
31 iso_pu_bacteria 2643221609 2644058590 210
32 iso_pu_bacteria 2643221611 2644070794 210
33 iso_pu_bacteria 2643221652 2644295029 210
34 iso_pu_bacteria 2643221658 2644328753 210
35 iso_pu_bacteria 2643221672 2644398078 210
36 iso_pu_bacteria 2643221683 2644469216 210
37 iso_pu_bacteria 2643221693 2644522672 210
38 iso_pu_bacteria 2667528174 2671113082 210
39 iso_pu_bacteria 2718217997 2719667018 210
40 iso_pu_bacteria 2718218199 2720493438 210
41 iso_pu_bacteria 2738541277 2738722098 210
42 iso_pu_bacteria 2738541307 2738881186 210
43 iso_pu_bacteria 2738543012 2739244113 210
44 iso_pu_bacteria 2738543013 2739252603 210
45 iso_pu_bacteria 2738543019 2739282462 210
46 iso_pu_bacteria 2739367655 2739610908 210
47 iso_pu_bacteria 2791355256 2793297141 210
48 iso_pu_bacteria 2791355262 2793337333 210
49 iso_pu_bacteria 2791355265 2793352243 210
50 iso_pu_bacteria 2802429605 2805927572 210
51 iso_pu_bacteria 2802429606 2805936046 210
52 iso_pu_bacteria 2802429633 2806049026 210
53 iso_pu_bacteria 2802429636 2806065806 210
54 iso_pu_bacteria 2802429637 2806077302 210
55 iso_pu_bacteria 2808606387 2808989184 210
56 iso_pu_bacteria 2816332133 2816472439 210
57 iso_pu_bacteria 2818991439 2819557720 210
58 iso_pu_bacteria 2818991446 2819596435 210
59 iso_pu_bacteria 2831265667 2831270230 210
60 iso_pu_bacteria 2838029111 2838031603 210
61 iso_pu_bacteria 2838054893 2838059963 210
62 iso_pu_bacteria 2838675328 2838679893 210
63 iso_pu_bacteria 2838714209 2838717690 210
64 iso_pu_bacteria 2838719591 2838724464 210
65 iso_pu_bacteria 2838724970 2838729594 210
66 iso_pu_bacteria 2841846520 2841850033 210
67 iso_pu_bacteria 2841859092 2841861182 210
68 iso_pu_bacteria 2841864319 2841868056 210
69 iso_pu_bacteria 2842124991 2842128505 210
70 iso_pu_bacteria 2842130223 2842134575 210
71 iso_pu_bacteria 2842152218 2842156593 210
72 iso_pu_bacteria 2842170452 2842173935 210
73 iso_pu_bacteria 2842175837 2842180214 210
74 iso_pu_bacteria 2842187318 2842192213 210
75 iso_pu_bacteria 2842192696 2842197067 210
76 iso_pu_bacteria 2842205361 2842206467 210
77 iso_pu_bacteria 2842211629 2842216507 210
78 iso_pu_bacteria 2842224351 2842229249 210
79 iso_pu_bacteria 2842278818 2842279924 210
80 iso_pu_bacteria 2842285085 2842287553 210
81 iso_pu_bacteria 2842341865 2842345126 210
82 iso_pu_bacteria 2842363717 2842369965 210
83 iso_pu_bacteria 2842395702 2842398401 210
84 iso_pu_bacteria 2842402390 2842404918 210
85 iso_pu_bacteria 2842409023 2842411500 210
86 iso_pu_bacteria 2842415677 2842418049 210
87 iso_pu_bacteria 2842475841 2842478335 210
88 iso_pu_bacteria 2842502639 2842505719 210
89 iso_pu_bacteria 2842515876 2842518551 210
90 iso_pu_bacteria 2842521101 2842523679 210
91 iso_pu_bacteria 2842677519 2842682401 210
92 iso_pu_bacteria 2842733646 2842736041 210
93 iso_pu_bacteria 2842747753 2842748272 210
94 iso_pu_bacteria 2857542790 2857547402 210
95 iso_pu_bacteria 2881927736 2881929425 210
96 iso_pu_bacteria 2885198086 2885199570 210
97 iso_pu_bacteria 2885211737 2885213157 210
98 iso_pu_bacteria 2887375801 2887380275 210
99 iso_pu_bacteria 2891373044 2891374330 210
100 iso_pu_bacteria 2899792073 2899793088 210
101 iso_pu_bacteria 2899845264 2899849710 210
102 iso_pu_bacteria 2899924645 2899931145 210
103 iso_pu_bacteria 2904449895 2904454815 210
104 iso_pu_bacteria 2904456579 2904462612 210
105 iso_pu_bacteria 2904541872 2904546798 210
106 iso_pu_bacteria 2919114240 2919117970 210
107 iso_pu_bacteria 2919408235 2919412869 210
108 iso_pu_bacteria 2919462493 2919464055 210
109 iso_pu_bacteria 2923556063 2923561822 210
110 iso_pu_bacteria 2926754445 2926757739 210
111 iso_pu_bacteria 2926760298 2926764636 210
112 iso_pu_bacteria 2928037797 2928038077 210
113 iso_pu_bacteria 2928044640 2928046317 210
114 iso_pu_bacteria 2928051484 2928054012 210
115 iso_pu_bacteria 2928064002 2928065765 210
116 iso_pu_bacteria 2928070936 2928077909 210
117 iso_pu_bacteria 2928084124 2928088694 210
118 iso_pu_bacteria 2928115317 2928115455 210
119 iso_pu_bacteria 2929160207 2929164271 210
120 iso_pu_bacteria 2929520902 2929523851 210
121 iso_pu_bacteria 2932422444 2932422769 210
122 iso_pu_bacteria 2933006813 2933010354 210
123 iso_pu_bacteria 2933011516 2933014177 210
124 iso_pu_bacteria 2933594066 2933597223 210
125 iso_pu_bacteria 2945909444 2945913031 210
126 iso_pu_bacteria 2945945610 2945946867 210
127 iso_pu_bacteria 2945972063 2945976582 210
128 iso_pu_bacteria 2945984333 2945984684 210
129 iso_pu_bacteria 2954767861 2954768001 210
130 iso_pu_bacteria 2954767861 2954771619 210
131 iso_pu_bacteria 2979089926 2979090253 210
132 iso_pu_bacteria 2979095461 2979095783 210
133 iso_pu_bacteria 2979100975 2979102760 210
134 iso_pu_bacteria 2984509177 2984509351 210
135 iso_pu_bacteria 2984518228 2984519949 210
136 iso_pu_bacteria 2984537506 2984537681 210
137 iso_pu_bacteria 2984601300 2984604429 210
138 iso_pu_bacteria 650716007 650844118 210
139 iso_pu_bacteria 8003570095 8003573306 210
140 iso_pu_bacteria 8005289223 8005294753 210
141 iso_pu_bacteria 8005484373 8005486369 210
142 iso_pu_bacteria 8005645114 8005647488 210
143 iso_pu_bacteria 8005695170 8005700975 210
144 iso_pu_bacteria 8018176218 8018178360 210
145 iso_pu_bacteria 8024501048 8024505167 210
146 iso_pu_bacteria 8056382006 8056387600 210
147 3300025297 Ga0209758_1012650 Ga0209758_10126502 211
148 3300049571 Ga0501034_0092587 Ga0501034_0092587_1200_1847 211
149 3300049573 Ga0501037_0009063 Ga0501037_0009063_932_1573 211
150 3300049573 Ga0501037_0114231 Ga0501037_0114231_441_1088 211
151 3300049579 Ga0501043_0134025 Ga0501043_0134025_995_1642 211
152 3300049581 Ga0501047_0076941 Ga0501047_0076941_1222_1869 211
153 iso_pu_bacteria 2511231221 2512035855 211
154 iso_pu_bacteria 2857576091 2857580357 211
155 iso_pu_bacteria 2869249662 2869252205 211
156 iso_pu_bacteria 2869264136 2869270921 211
157 iso_pu_bacteria 2871459585 2871463899 211
158 iso_pu_bacteria 2874131515 2874132027 211
159 iso_pu_bacteria 2904479285 2904481386 211
160 iso_pu_bacteria 2906363423 2906368560 211
161 iso_pu_bacteria 2906370794 2906372527 211
162 iso_pu_bacteria 2906393657 2906396023 211
163 iso_pu_bacteria 2924710171 2924717677 211
164 iso_pu_bacteria 2965040258 2965043416 211
165 iso_pu_bacteria 2965089291 2965093081 211
166 iso_pu_bacteria 2977950692 2977954330 211
167 iso_pu_bacteria 3004195979 3004200819 211
168 iso_pu_bacteria 8004312739 8004318478 211
169 iso_pu_bacteria 8004361976 8004363284 211
170 3300053142 Ga0500577_0025912 Ga0500577_0025912_1267_1914 212
171 iso_pu_bacteria 2513237101 2513696050 212
172 iso_pu_bacteria 2721755755 2723846283 212
173 iso_pu_bacteria 2828305725 2828306055 212
174 iso_pu_bacteria 2874604998 2874610752 212
175 iso_pu_bacteria 2876808645 2876811676 212
176 iso_pu_bacteria 2879110137 2879118834 212
177 iso_pu_bacteria 2889033259 2889039269 212
178 iso_pu_bacteria 2917699015 2917705653 212
179 iso_pu_bacteria 2922361189 2922362086 212
180 iso_pu_bacteria 8006964411 8006964664 212
181 iso_pu_bacteria 8006984368 8006991986 212
182 iso_pu_bacteria 8006994254 8006999919 212
183 iso_pu_bacteria 8056673599 8056680335 212
184 3300048926 Ga0496123_0230881 Ga0496123_0230881_44_685 213
185 iso_pu_bacteria 2599185214 2599622683 213
186 iso_pu_bacteria 2599185226 2599671162 213
187 iso_pu_bacteria 2599185227 2599679801 213
188 iso_pu_bacteria 2599185229 2599691817 213
189 iso_pu_bacteria 2643221683 2644467422 213
190 iso_pu_bacteria 2738541277 2738718584 213
191 iso_pu_bacteria 2738541307 2738884710 213
192 iso_pu_bacteria 2738543013 2739252449 213
193 iso_pu_bacteria 2738543019 2739280602 213
194 iso_pu_bacteria 2818991446 2819599976 213
195 iso_pu_bacteria 2831265667 2831267148 213
196 iso_pu_bacteria 2838054893 2838056233 213
197 iso_pu_bacteria 2842677519 2842680442 213
198 iso_pu_bacteria 2885198086 2885204827 213
199 iso_pu_bacteria 2885211737 2885218486 213
200 iso_pu_bacteria 2899924645 2899926077 213
201 iso_pu_bacteria 2903748898 2903752807 213
202 iso_pu_bacteria 2904449895 2904452285 213
203 iso_pu_bacteria 2904456579 2904458569 213
204 iso_pu_bacteria 2904541872 2904548652 213
205 iso_pu_bacteria 2919462493 2919466338 213
206 iso_pu_bacteria 2928037797 2928041527 213
207 iso_pu_bacteria 2928044640 2928049091 213
208 iso_pu_bacteria 2928051484 2928052299 213
209 iso_pu_bacteria 2928064002 2928065030 213
210 iso_pu_bacteria 2928070936 2928077433 213
211 iso_pu_bacteria 2928084124 2928087369 213
212 iso_pu_bacteria 2929160207 2929164682 213
213 iso_pu_bacteria 2929520902 2929522213 213
214 iso_pu_bacteria 2945909444 2945910707 213
215 iso_pu_bacteria 2945945610 2945946603 213
216 iso_pu_bacteria 2945972063 2945976326 213
217 iso_pu_bacteria 2945984333 2945987120 213
218 3300002705 JGI25156J39149_1000197 JGI25156J39149_100019725 214
219 3300002737 JGI25162J39368_1000069 JGI25162J39368_100006911 214
220 3300002738 JGI25154J39366_1001559 JGI25154J39366_10015593 214
221 3300002739 JGI25158J39367_1002784 JGI25158J39367_10027842 214
222 3300002741 JGI25157J39369_1000239 JGI25157J39369_100023925 214
223 3300002773 JGI25152J39213_1013570 JGI25152J39213_10135702 214
224 3300002773 JGI25152J39213_1020352 JGI25152J39213_10203522 214
225 3300002774 JGI25150J39212_1012541 JGI25150J39212_10125412 214
226 3300002987 JGI25159J45721_1030586 JGI25159J45721_10305861 214
227 3300003187 JGI25151J46595_10000912 JGI25151J46595_1000091222 214
228 3300003187 JGI25151J46595_10002242 JGI25151J46595_1000224213 214
229 3300003187 JGI25151J46595_10017903 JGI25151J46595_100179034 214
230 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018139 214
231 3300003215 JGI25153J46596_10033586 JGI25153J46596_100335862 214
232 3300003316 rootH1_10031181 rootH1_100311812 214
233 3300003578 Ga0006562J51391_1048428 Ga0006562J51391_10484282 214
234 3300003578 Ga0006562J51391_1089020 Ga0006562J51391_10890202 214
235 3300003761 Ga0055535_1000625 Ga0055535_10006257 214
236 3300003762 Ga0055542_1000087 Ga0055542_100008777 214
237 3300003763 Ga0055529_1000904 Ga0055529_100090411 214
238 3300003771 Ga0055526_1004955 Ga0055526_10049556 214
239 3300003771 Ga0055526_1037798 Ga0055526_10377982 214
240 3300003771 Ga0055526_1041428 Ga0055526_10414282 214
241 3300003773 Ga0055537_1001201 Ga0055537_10012016 214
242 3300003773 Ga0055537_1001648 Ga0055537_10016488 214
243 3300003773 Ga0055537_1007410 Ga0055537_10074103 214
244 3300003775 Ga0055524_1000973 Ga0055524_100097316 214
245 3300003775 Ga0055524_1017548 Ga0055524_10175482 214
246 3300003775 Ga0055524_1042099 Ga0055524_10420991 214
247 3300003781 Ga0055536_1012752 Ga0055536_10127523 214
248 3300003784 Ga0055534_1000273 Ga0055534_10002738 214
249 3300003784 Ga0055534_1003656 Ga0055534_10036562 214
250 3300003790 Ga0055528_1003260 Ga0055528_10032608 214
251 3300003790 Ga0055528_1005515 Ga0055528_10055153 214
252 3300003790 Ga0055528_1005551 Ga0055528_10055516 214
253 3300003790 Ga0055528_1017013 Ga0055528_10170133 214
254 3300003791 Ga0055530_10000492 Ga0055530_1000049213 214
255 3300003791 Ga0055530_10010401 Ga0055530_100104013 214
256 3300003792 Ga0055540_1001711 Ga0055540_10017112 214
257 3300003792 Ga0055540_1014097 Ga0055540_10140972 214
258 3300003794 Ga0055531_10000397 Ga0055531_1000039724 214
259 3300003794 Ga0055531_10000729 Ga0055531_100007297 214
260 3300003794 Ga0055531_10001938 Ga0055531_100019389 214
261 3300003856 Ga0058692_1005109 Ga0058692_10051095 214
262 3300004625 Ga0055543_1011426 Ga0055543_10114262 214
263 3300005262 Ga0065165_1001097 Ga0065165_100109714 214
264 3300005262 Ga0065165_1002200 Ga0065165_100220012 214
265 3300005262 Ga0065165_1004159 Ga0065165_10041599 214
266 3300005262 Ga0065165_1054412 Ga0065165_10544122 214
267 3300005288 Ga0065714_10006671 Ga0065714_100066712 214
268 3300005289 Ga0065704_10018558 Ga0065704_100185582 214
269 3300005327 Ga0070658_10017213 Ga0070658_100172132 214
270 3300005327 Ga0070658_10302886 Ga0070658_103028862 214
271 3300005329 Ga0070683_100001096 Ga0070683_1000010968 214
272 3300005331 Ga0070670_100439201 Ga0070670_1004392012 214
273 3300005334 Ga0068869_100134442 Ga0068869_1001344422 214
274 3300005336 Ga0070680_100077659 Ga0070680_1000776593 214
275 3300005336 Ga0070680_100485840 Ga0070680_1004858402 214
276 3300005338 Ga0068868_100048109 Ga0068868_1000481094 214
277 3300005339 Ga0070660_100006803 Ga0070660_1000068033 214
278 3300005339 Ga0070660_100193642 Ga0070660_1001936422 214
279 3300005344 Ga0070661_100001103 Ga0070661_10000110314 214
280 3300005344 Ga0070661_100119325 Ga0070661_1001193253 214
281 3300005344 Ga0070661_100439330 Ga0070661_1004393302 214
282 3300005345 Ga0070692_10297828 Ga0070692_102978282 214
283 3300005353 Ga0070669_100126607 Ga0070669_1001266072 214
284 3300005353 Ga0070669_100493304 Ga0070669_1004933042 214
285 3300005355 Ga0070671_100001731 Ga0070671_1000017312 214
286 3300005355 Ga0070671_100007662 Ga0070671_1000076621 214
287 3300005356 Ga0070674_100322706 Ga0070674_1003227061 214
288 3300005364 Ga0070673_100002957 Ga0070673_10000295714 214
289 3300005366 Ga0070659_100007948 Ga0070659_1000079487 214
290 3300005366 Ga0070659_100017622 Ga0070659_1000176223 214
291 3300005366 Ga0070659_100217087 Ga0070659_1002170872 214
292 3300005456 Ga0070678_100331899 Ga0070678_1003318991 214
293 3300005456 Ga0070678_100579375 Ga0070678_1005793751 214
294 3300005457 Ga0070662_100019503 Ga0070662_1000195033 214
295 3300005457 Ga0070662_100400495 Ga0070662_1004004952 214
296 3300005457 Ga0070662_100741545 Ga0070662_1007415451 214
297 3300005530 Ga0070679_100026744 Ga0070679_1000267443 214
298 3300005530 Ga0070679_100054342 Ga0070679_1000543423 214
299 3300005530 Ga0070679_100352608 Ga0070679_1003526082 214
300 3300005530 Ga0070679_100731008 Ga0070679_1007310082 214
301 3300005535 Ga0070684_100004228 Ga0070684_1000042289 214
302 3300005539 Ga0068853_100025317 Ga0068853_1000253175 214
303 3300005539 Ga0068853_100043331 Ga0068853_1000433313 214
304 3300005539 Ga0068853_100091642 Ga0068853_1000916421 214
305 3300005543 Ga0070672_100011366 Ga0070672_1000113662 214
306 3300005543 Ga0070672_100300081 Ga0070672_1003000812 214
307 3300005547 Ga0070693_100005182 Ga0070693_1000051827 214
308 3300005547 Ga0070693_100037504 Ga0070693_1000375043 214
309 3300005548 Ga0070665_100034493 Ga0070665_1000344934 214
310 3300005548 Ga0070665_100494019 Ga0070665_1004940192 214
311 3300005563 Ga0068855_100008931 Ga0068855_1000089315 214
312 3300005563 Ga0068855_100023191 Ga0068855_1000231917 214
313 3300005564 Ga0070664_100003886 Ga0070664_1000038867 214
314 3300005564 Ga0070664_100008256 Ga0070664_1000082563 214
315 3300005564 Ga0070664_100035223 Ga0070664_1000352236 214
316 3300005577 Ga0068857_100650792 Ga0068857_1006507922 214
317 3300005578 Ga0068854_100002503 Ga0068854_1000025032 214
318 3300005614 Ga0068856_100011574 Ga0068856_1000115748 214
319 3300005614 Ga0068856_100073839 Ga0068856_1000738392 214
320 3300005614 Ga0068856_100189093 Ga0068856_1001890932 214
321 3300005614 Ga0068856_100580147 Ga0068856_1005801472 214
322 3300005616 Ga0068852_100002132 Ga0068852_1000021328 214
323 3300005616 Ga0068852_100008877 Ga0068852_1000088773 214
324 3300005616 Ga0068852_100785744 Ga0068852_1007857441 214
325 3300005618 Ga0068864_100041516 Ga0068864_1000415163 214
326 3300005618 Ga0068864_100098816 Ga0068864_1000988162 214
327 3300005618 Ga0068864_100563475 Ga0068864_1005634752 214
328 3300005618 Ga0068864_101135215 Ga0068864_1011352152 214
329 3300005834 Ga0068851_10001036 Ga0068851_100010368 214
330 3300005834 Ga0068851_10013404 Ga0068851_100134045 214
331 3300005841 Ga0068863_100387960 Ga0068863_1003879602 214
332 3300006038 Ga0075365_10119863 Ga0075365_101198632 214
333 3300006042 Ga0075368_10007452 Ga0075368_100074522 214
334 3300006048 Ga0075363_100149641 Ga0075363_1001496412 214
335 3300006048 Ga0075363_100194871 Ga0075363_1001948712 214
336 3300006051 Ga0075364_10121371 Ga0075364_101213711 214
337 3300006051 Ga0075364_10245132 Ga0075364_102451322 214
338 3300006058 Ga0075432_10011542 Ga0075432_100115423 214
339 3300006058 Ga0075432_10097420 Ga0075432_100974202 214
340 3300006177 Ga0075362_10008375 Ga0075362_100083753 214
341 3300006177 Ga0075362_10015340 Ga0075362_100153403 214
342 3300006177 Ga0075362_10125015 Ga0075362_101250152 214
343 3300006178 Ga0075367_10228947 Ga0075367_102289472 214
344 3300006178 Ga0075367_10378842 Ga0075367_103788421 214
345 3300006186 Ga0075369_10010312 Ga0075369_100103124 214
346 3300006195 Ga0075366_10148815 Ga0075366_101488152 214
347 3300006237 Ga0097621_100146079 Ga0097621_1001460792 214
348 3300006237 Ga0097621_100445735 Ga0097621_1004457352 214
349 3300006353 Ga0075370_10001140 Ga0075370_100011408 214
350 3300006353 Ga0075370_10035802 Ga0075370_100358023 214
351 3300006358 Ga0068871_100230495 Ga0068871_1002304952 214
352 3300006358 Ga0068871_100596188 Ga0068871_1005961882 214
353 3300006948 Ga0099826_10000053 Ga0099826_100000533 214
354 3300006948 Ga0099826_10000135 Ga0099826_1000013524 214
355 3300006948 Ga0099826_10009692 Ga0099826_100096924 214
356 3300006948 Ga0099826_10063502 Ga0099826_100635023 214
357 3300009036 Ga0105244_10061912 Ga0105244_100619123 214
358 3300009093 Ga0105240_10010218 Ga0105240_100102183 214
359 3300009098 Ga0105245_10421667 Ga0105245_104216672 214
360 3300009148 Ga0105243_10004536 Ga0105243_100045369 214
361 3300009148 Ga0105243_10006125 Ga0105243_100061253 214
362 3300009174 Ga0105241_10197717 Ga0105241_101977173 214
363 3300009176 Ga0105242_10116195 Ga0105242_101161952 214
364 3300009176 Ga0105242_10182665 Ga0105242_101826652 214
365 3300009177 Ga0105248_10022313 Ga0105248_100223132 214
366 3300009177 Ga0105248_10405449 Ga0105248_104054492 214
367 3300009545 Ga0105237_10197175 Ga0105237_101971752 214
368 3300009551 Ga0105238_10010711 Ga0105238_100107112 214
369 3300009551 Ga0105238_10051831 Ga0105238_100518313 214
370 3300009551 Ga0105238_10083755 Ga0105238_100837552 214
371 3300013100 Ga0157373_10003196 Ga0157373_100031964 214
372 3300013100 Ga0157373_10037357 Ga0157373_100373573 214
373 3300013102 Ga0157371_10000005 Ga0157371_10000005298 214
374 3300013102 Ga0157371_10269629 Ga0157371_102696292 214
375 3300013104 Ga0157370_10000036 Ga0157370_1000003684 214
376 3300013104 Ga0157370_10006235 Ga0157370_100062353 214
377 3300013104 Ga0157370_10079644 Ga0157370_100796444 214
378 3300013105 Ga0157369_10008755 Ga0157369_100087552 214
379 3300013105 Ga0157369_10148403 Ga0157369_101484033 214
380 3300013105 Ga0157369_10371569 Ga0157369_103715692 214
381 3300013296 Ga0157374_10106980 Ga0157374_101069802 214
382 3300013306 Ga0163162_10165664 Ga0163162_101656643 214
383 3300013306 Ga0163162_10537508 Ga0163162_105375082 214
384 3300013306 Ga0163162_10831348 Ga0163162_108313482 214
385 3300013307 Ga0157372_10034372 Ga0157372_100343726 214
386 3300013307 Ga0157372_10149374 Ga0157372_101493744 214
387 3300013308 Ga0157375_10228180 Ga0157375_102281803 214
388 3300013308 Ga0157375_10342998 Ga0157375_103429982 214
389 3300013308 Ga0157375_10986304 Ga0157375_109863042 214
390 3300014325 Ga0163163_10274774 Ga0163163_102747742 214
391 3300014497 Ga0182008_10001904 Ga0182008_100019043 214
392 3300014497 Ga0182008_10004300 Ga0182008_1000430010 214
393 3300014497 Ga0182008_10018378 Ga0182008_100183783 214
394 3300014497 Ga0182008_10026105 Ga0182008_100261054 214
395 3300014497 Ga0182008_10033309 Ga0182008_100333093 214
396 3300014968 Ga0157379_10196452 Ga0157379_101964523 214
397 3300014969 Ga0157376_10100256 Ga0157376_101002563 214
398 3300014969 Ga0157376_10385972 Ga0157376_103859722 214
399 3300015261 Ga0182006_1038793 Ga0182006_10387933 214
400 3300015261 Ga0182006_1055979 Ga0182006_10559792 214
401 3300015262 Ga0182007_10000278 Ga0182007_1000027818 214
402 3300015262 Ga0182007_10007196 Ga0182007_100071962 214
403 3300015262 Ga0182007_10163702 Ga0182007_101637021 214
404 3300015265 Ga0182005_1029422 Ga0182005_10294222 214
405 3300015265 Ga0182005_1057456 Ga0182005_10574562 214
406 3300015683 Ga0183362_10003 Ga0183362_1000353 214
407 3300017792 Ga0163161_10002565 Ga0163161_1000256512 214
408 3300017792 Ga0163161_10008944 Ga0163161_100089443 214
409 3300017792 Ga0163161_10082600 Ga0163161_100826003 214
410 3300017792 Ga0163161_10088707 Ga0163161_100887072 214
411 3300017792 Ga0163161_10263133 Ga0163161_102631332 214
412 3300021361 Ga0213872_10001576 Ga0213872_100015769 214
413 3300025206 Ga0209435_100089 Ga0209435_10008924 214
414 3300025208 Ga0209436_104844 Ga0209436_1048443 214
415 3300025228 Ga0209672_101712 Ga0209672_1017126 214
416 3300025228 Ga0209672_110906 Ga0209672_1109062 214
417 3300025229 Ga0209147_100652 Ga0209147_1006522 214
418 3300025233 Ga0209437_100022 Ga0209437_100022201 214
419 3300025242 Ga0209258_100199 Ga0209258_10019930 214
420 3300025245 Ga0207425_1006727 Ga0207425_10067271 214
421 3300025246 Ga0209646_1000293 Ga0209646_100029324 214
422 3300025250 Ga0209026_1000364 Ga0209026_100036424 214
423 3300025254 Ga0209148_1000179 Ga0209148_100017930 214
424 3300025256 Ga0209759_1000508 Ga0209759_100050824 214
425 3300025258 Ga0209129_1000071 Ga0209129_1000071106 214
426 3300025258 Ga0209129_1000249 Ga0209129_100024929 214
427 3300025258 Ga0209129_1011174 Ga0209129_10111743 214
428 3300025261 Ga0209233_1000031 Ga0209233_1000031201 214
429 3300025263 Ga0209565_1000083 Ga0209565_1000083106 214
430 3300025263 Ga0209565_1000225 Ga0209565_100022527 214
431 3300025263 Ga0209565_1001961 Ga0209565_10019617 214
432 3300025272 Ga0209455_1005323 Ga0209455_10053232 214
433 3300025273 Ga0209673_1000178 Ga0209673_100017895 214
434 3300025273 Ga0209673_1000534 Ga0209673_100053441 214
435 3300025273 Ga0209673_1000546 Ga0209673_100054627 214
436 3300025273 Ga0209673_1001554 Ga0209673_10015549 214
437 3300025273 Ga0209673_1006108 Ga0209673_10061085 214
438 3300025273 Ga0209673_1021401 Ga0209673_10214013 214
439 3300025273 Ga0209673_1067931 Ga0209673_10679311 214
440 3300025284 Ga0209130_1000773 Ga0209130_10007736 214
441 3300025284 Ga0209130_1000889 Ga0209130_10008897 214
442 3300025284 Ga0209130_1002267 Ga0209130_10022675 214
443 3300025291 Ga0209675_1000081 Ga0209675_1000081106 214
444 3300025291 Ga0209675_1000458 Ga0209675_10004589 214
445 3300025291 Ga0209675_1000726 Ga0209675_100072610 214
446 3300025291 Ga0209675_1004179 Ga0209675_10041793 214
447 3300025291 Ga0209675_1032892 Ga0209675_10328921 214
448 3300025292 Ga0209676_1000005 Ga0209676_100000577 214
449 3300025292 Ga0209676_1000757 Ga0209676_100075734 214
450 3300025292 Ga0209676_1001007 Ga0209676_100100716 214
451 3300025292 Ga0209676_1018153 Ga0209676_10181532 214
452 3300025292 Ga0209676_1065877 Ga0209676_10658772 214
453 3300025294 Ga0209025_1000121 Ga0209025_100012182 214
454 3300025294 Ga0209025_1000544 Ga0209025_100054433 214
455 3300025294 Ga0209025_1001108 Ga0209025_100110833 214
456 3300025294 Ga0209025_1001466 Ga0209025_10014667 214
457 3300025294 Ga0209025_1021707 Ga0209025_10217074 214
458 3300025294 Ga0209025_1022812 Ga0209025_10228122 214
459 3300025294 Ga0209025_1098582 Ga0209025_10985821 214
460 3300025295 Ga0209564_1000239 Ga0209564_100023929 214
461 3300025295 Ga0209564_1002099 Ga0209564_10020993 214
462 3300025295 Ga0209564_1004174 Ga0209564_10041742 214
463 3300025297 Ga0209758_1000027 Ga0209758_1000027403 214
464 3300025297 Ga0209758_1002782 Ga0209758_100278214 214
465 3300025298 Ga0209050_1000007 Ga0209050_10000071021 214
466 3300025298 Ga0209050_1001089 Ga0209050_100108916 214
467 3300025298 Ga0209050_1010883 Ga0209050_10108833 214
468 3300025299 Ga0209256_1000081 Ga0209256_1000081106 214
469 3300025299 Ga0209256_1004326 Ga0209256_10043262 214
470 3300025299 Ga0209256_1007583 Ga0209256_10075835 214
471 3300025302 Ga0207426_1000027 Ga0207426_1000027368 214
472 3300025302 Ga0207426_1000176 Ga0207426_1000176113 214
473 3300025303 Ga0209051_1000009 Ga0209051_100000977 214
474 3300025303 Ga0209051_1000347 Ga0209051_100034746 214
475 3300025303 Ga0209051_1000373 Ga0209051_100037351 214
476 3300025303 Ga0209051_1000375 Ga0209051_100037548 214
477 3300025303 Ga0209051_1000553 Ga0209051_100055318 214
478 3300025303 Ga0209051_1000583 Ga0209051_100058320 214
479 3300025303 Ga0209051_1010791 Ga0209051_10107915 214
480 3300025304 Ga0209257_1000011 Ga0209257_100001151 214
481 3300025304 Ga0209257_1000449 Ga0209257_100044943 214
482 3300025304 Ga0209257_1000866 Ga0209257_100086620 214
483 3300025304 Ga0209257_1008169 Ga0209257_10081695 214
484 3300025321 Ga0207656_10000704 Ga0207656_1000070413 214
485 3300025321 Ga0207656_10014809 Ga0207656_100148092 214
486 3300025321 Ga0207656_10063725 Ga0207656_100637252 214
487 3300025728 Ga0207655_1002072 Ga0207655_100207214 214
488 3300025893 Ga0207682_10053981 Ga0207682_100539812 214
489 3300025901 Ga0207688_10164791 Ga0207688_101647911 214
490 3300025903 Ga0207680_10363756 Ga0207680_103637562 214
491 3300025907 Ga0207645_10375932 Ga0207645_103759322 214
492 3300025908 Ga0207643_10069814 Ga0207643_100698142 214
493 3300025909 Ga0207705_10246089 Ga0207705_102460892 214
494 3300025909 Ga0207705_10251493 Ga0207705_102514932 214
495 3300025912 Ga0207707_10254859 Ga0207707_102548592 214
496 3300025913 Ga0207695_10067576 Ga0207695_100675765 214
497 3300025913 Ga0207695_10103057 Ga0207695_101030572 214
498 3300025914 Ga0207671_10741066 Ga0207671_107410661 214
499 3300025919 Ga0207657_10012553 Ga0207657_100125538 214
500 3300025919 Ga0207657_10353658 Ga0207657_103536582 214
501 3300025920 Ga0207649_10038780 Ga0207649_100387801 214
502 3300025920 Ga0207649_10094843 Ga0207649_100948432 214
503 3300025921 Ga0207652_10150007 Ga0207652_101500072 214
504 3300025921 Ga0207652_10228451 Ga0207652_102284511 214
505 3300025921 Ga0207652_10599279 Ga0207652_105992792 214
506 3300025924 Ga0207694_10014406 Ga0207694_100144066 214
507 3300025924 Ga0207694_10057945 Ga0207694_100579452 214
508 3300025925 Ga0207650_10008936 Ga0207650_100089368 214
509 3300025927 Ga0207687_10186622 Ga0207687_101866222 214
510 3300025927 Ga0207687_10821508 Ga0207687_108215081 214
511 3300025931 Ga0207644_10040844 Ga0207644_100408444 214
512 3300025933 Ga0207706_10075641 Ga0207706_100756413 214
513 3300025933 Ga0207706_10306336 Ga0207706_103063363 214
514 3300025934 Ga0207686_10143107 Ga0207686_101431072 214
515 3300025935 Ga0207709_10000775 Ga0207709_1000077511 214
516 3300025935 Ga0207709_10001443 Ga0207709_100014433 214
517 3300025935 Ga0207709_10026435 Ga0207709_100264353 214
518 3300025937 Ga0207669_10305795 Ga0207669_103057952 214
519 3300025938 Ga0207704_10737480 Ga0207704_107374801 214
520 3300025940 Ga0207691_10003117 Ga0207691_100031177 214
521 3300025940 Ga0207691_10099686 Ga0207691_100996863 214
522 3300025940 Ga0207691_10213107 Ga0207691_102131072 214
523 3300025942 Ga0207689_10092172 Ga0207689_100921723 214
524 3300025944 Ga0207661_10248391 Ga0207661_102483912 214
525 3300025945 Ga0207679_10004885 Ga0207679_100048856 214
526 3300025945 Ga0207679_10069827 Ga0207679_100698274 214
527 3300025949 Ga0207667_10039072 Ga0207667_100390725 214
528 3300025949 Ga0207667_10064795 Ga0207667_100647954 214
529 3300025960 Ga0207651_10001658 Ga0207651_100016582 214
530 3300025972 Ga0207668_10149909 Ga0207668_101499092 214
531 3300025981 Ga0207640_10023587 Ga0207640_100235872 214
532 3300025981 Ga0207640_10213151 Ga0207640_102131512 214
533 3300025981 Ga0207640_10366858 Ga0207640_103668582 214
534 3300026023 Ga0207677_10326456 Ga0207677_103264562 214
535 3300026041 Ga0207639_10039065 Ga0207639_100390653 214
536 3300026041 Ga0207639_10630024 Ga0207639_106300242 214
537 3300026067 Ga0207678_10002002 Ga0207678_1000200210 214
538 3300026078 Ga0207702_10016299 Ga0207702_100162992 214
539 3300026078 Ga0207702_10054569 Ga0207702_100545692 214
540 3300026078 Ga0207702_10363759 Ga0207702_103637592 214
541 3300026078 Ga0207702_10381692 Ga0207702_103816922 214
542 3300026088 Ga0207641_10183018 Ga0207641_101830182 214
543 3300026088 Ga0207641_10226137 Ga0207641_102261372 214
544 3300026089 Ga0207648_10105730 Ga0207648_101057303 214
545 3300026095 Ga0207676_10030082 Ga0207676_100300822 214
546 3300026095 Ga0207676_10034484 Ga0207676_100344842 214
547 3300026095 Ga0207676_10135625 Ga0207676_101356253 214
548 3300026116 Ga0207674_10007917 Ga0207674_100079174 214
549 3300026116 Ga0207674_10195272 Ga0207674_101952722 214
550 3300026142 Ga0207698_10002093 Ga0207698_100020933 214
551 3300026142 Ga0207698_10004842 Ga0207698_100048427 214
552 3300027312 Ga0209371_1005256 Ga0209371_10052566 214
553 3300027666 Ga0209282_1001174 Ga0209282_100117414 214
554 3300027666 Ga0209282_1137457 Ga0209282_11374572 214
555 3300027907 Ga0207428_10303229 Ga0207428_103032292 214
556 3300028379 Ga0268266_10016386 Ga0268266_100163865 214
557 3300028794 Ga0307515_10000152 Ga0307515_1000015263 214
558 3300030731 Ga0316177_1192376 Ga0316177_11923765 214
559 3300030742 Ga0316183_1051137 Ga0316183_10511372 214
560 3300030745 Ga0316182_1122964 Ga0316182_11229642 214
561 3300031251 Ga0265327_10000777 Ga0265327_1000077726 214
562 3300031251 Ga0265327_10008172 Ga0265327_100081729 214
563 3300031456 Ga0307513_10065904 Ga0307513_100659042 214
564 3300031456 Ga0307513_10090119 Ga0307513_100901193 214
565 3300031548 Ga0307408_100111775 Ga0307408_1001117752 214
566 3300031548 Ga0307408_100355467 Ga0307408_1003554672 214
567 3300031548 Ga0307408_100444291 Ga0307408_1004442912 214
568 3300031649 Ga0307514_10124915 Ga0307514_101249152 214
569 3300031731 Ga0307405_10186499 Ga0307405_101864992 214
570 3300031901 Ga0307406_10006868 Ga0307406_100068682 214
571 3300031911 Ga0307412_10029890 Ga0307412_100298903 214
572 3300031911 Ga0307412_10052063 Ga0307412_100520632 214
573 3300031911 Ga0307412_10081391 Ga0307412_100813912 214
574 3300031911 Ga0307412_10090438 Ga0307412_100904383 214
575 3300031911 Ga0307412_11012476 Ga0307412_110124761 214
576 3300031995 Ga0307409_100494442 Ga0307409_1004944422 214
577 3300032002 Ga0307416_100248852 Ga0307416_1002488522 214
578 3300032002 Ga0307416_100273917 Ga0307416_1002739172 214
579 3300032004 Ga0307414_10272027 Ga0307414_102720272 214
580 3300032004 Ga0307414_10346528 Ga0307414_103465282 214
581 3300032004 Ga0307414_10353223 Ga0307414_103532232 214
582 3300032004 Ga0307414_10516729 Ga0307414_105167292 214
583 3300032005 Ga0307411_10126489 Ga0307411_101264892 214
584 3300032005 Ga0307411_10127142 Ga0307411_101271423 214
585 3300032005 Ga0307411_10154694 Ga0307411_101546942 214
586 3300032005 Ga0307411_10178818 Ga0307411_101788182 214
587 3300032005 Ga0307411_10331449 Ga0307411_103314491 214
588 3300033180 Ga0307510_10031385 Ga0307510_100313854 214
589 3300037312 Ga0395899_0001942 Ga0395899_0001942_12236_12889 214
590 3300037312 Ga0395899_0037564 Ga0395899_0037564_318_971 214
591 3300037418 Ga0395900_0007000 Ga0395900_0007000_4785_5438 214
592 3300037418 Ga0395900_0031551 Ga0395900_0031551_3289_3942 214
593 3300037418 Ga0395900_0328009 Ga0395900_0328009_753_1406 214
594 3300037466 Ga0395898_0005430 Ga0395898_0005430_8479_9132 214
595 3300037466 Ga0395898_0023388 Ga0395898_0023388_4698_5351 214
596 3300037466 Ga0395898_0284077 Ga0395898_0284077_349_1002 214
597 3300037471 Ga0395905_0007138 Ga0395905_0007138_1094_1747 214
598 3300037471 Ga0395905_0022261 Ga0395905_0022261_3797_4450 214
599 3300037471 Ga0395905_0034921 Ga0395905_0034921_2176_2829 214
600 3300037471 Ga0395905_0134156 Ga0395905_0134156_649_1302 214
601 3300037471 Ga0395905_0288704 Ga0395905_0288704_97_753 214
602 3300038443 Ga0395901_0053458 Ga0395901_0053458_3533_4186 214
603 3300038443 Ga0395901_0087292 Ga0395901_0087292_1095_1748 214
604 3300038443 Ga0395901_0098619 Ga0395901_0098619_1505_2158 214
605 3300038443 Ga0395901_0161306 Ga0395901_0161306_647_1300 214
606 3300038443 Ga0395901_0241940 Ga0395901_0241940_431_1084 214
607 3300038443 Ga0395901_0291445 Ga0395901_0291445_91_744 214
608 3300039447 Ga0436361_0042902 Ga0436361_0042902_4595_5245 214
609 3300041404 Ga0439436_0040093 Ga0439436_0040093_354_1007 214
610 3300041406 Ga0439439_0125455 Ga0439439_0125455_38_691 214
611 3300041411 Ga0439466_0047929 Ga0439466_0047929_472_1125 214
612 3300041413 Ga0439465_0011629 Ga0439465_0011629_547_1197 214
613 3300041413 Ga0439465_0050689 Ga0439465_0050689_74_724 214
614 3300041443 Ga0451789_1335968 Ga0451789_1335968_213_866 214
615 3300041486 Ga0451807_1518065 Ga0451807_1518065_144_797 214
616 3300041498 Ga0451841_0497166 Ga0451841_0497166_161_811 214
617 3300041505 Ga0451849_0678049 Ga0451849_0678049_219_872 214
618 3300041509 Ga0451843_0558905 Ga0451843_0558905_115_768 214
619 3300041511 Ga0451855_0724113 Ga0451855_0724113_177_827 214
620 3300041512 Ga0451853_1561911 Ga0451853_1561911_4670_5320 214
621 3300041999 Ga0439433_0045643 Ga0439433_0045643_137_790 214
622 3300042004 Ga0439445_0005785 Ga0439445_0005785_1406_2059 214
623 3300042004 Ga0439445_0064595 Ga0439445_0064595_68_718 214
624 3300042006 Ga0439432_018005 Ga0439432_018005_1399_2052 214
625 3300042006 Ga0439432_077720 Ga0439432_077720_256_906 214
626 3300042007 Ga0439449_0003797 Ga0439449_0003797_4942_5595 214
627 3300042007 Ga0439449_0027720 Ga0439449_0027720_1223_1873 214
628 3300042007 Ga0439449_0029793 Ga0439449_0029793_1058_1711 214
629 3300042007 Ga0439449_0055546 Ga0439449_0055546_177_830 214
630 3300042007 Ga0439449_0058086 Ga0439449_0058086_691_1341 214
631 3300042010 Ga0439452_007125 Ga0439452_007125_503_1156 214
632 3300042010 Ga0439452_053252 Ga0439452_053252_54_707 214
633 3300042014 Ga0439457_039037 Ga0439457_039037_220_873 214
634 3300042015 Ga0439462_0072097 Ga0439462_0072097_48_701 214
635 3300042115 Ga0450911_000935 Ga0450911_000935_6230_6883 214
636 3300042123 Ga0450921_007383 Ga0450921_007383_20_673 214
637 3300042125 Ga0450923_001056 Ga0450923_001056_159_812 214
638 3300042125 Ga0450923_025537 Ga0450923_025537_422_1075 214
639 3300042145 Ga0450906_001534 Ga0450906_001534_1357_2010 214
640 3300042146 Ga0450907_018413 Ga0450907_018413_321_974 214
641 3300042184 Ga0450908_007977 Ga0450908_007977_955_1608 214
642 3300042184 Ga0450908_030656 Ga0450908_030656_91_744 214
643 3300042531 Ga0450918_000934 Ga0450918_000934_5292_5945 214
644 3300042876 Ga0451577_0066420 Ga0451577_0066420_560_1213 214
645 3300044656 Ga0466969_0152924 Ga0466969_0152924_386_1039 214
646 3300044683 Ga0466965_0182478 Ga0466965_0182478_220_873 214
647 3300044712 Ga0453684_0516077 Ga0453684_0516077_80_733 214
648 3300044712 Ga0453684_0546791 Ga0453684_0546791_222_866 214
649 3300044842 Ga0466957_0189471 Ga0466957_0189471_100_753 214
650 3300045051 Ga0451576_0585814 Ga0451576_0585814_308_958 214
651 3300045976 Ga0466967_0443681 Ga0466967_0443681_345_998 214
652 3300046453 Ga0495627_003930 Ga0495627_003930_5674_6327 214
653 3300046455 Ga0495603_0165527 Ga0495603_0165527_34_687 214
654 3300046459 Ga0495629_0352332 Ga0495629_0352332_207_860 214
655 3300046473 Ga0495582_0153466 Ga0495582_0153466_320_973 214
656 3300046501 Ga0495607_0000252 Ga0495607_0000252_56563_57219 214
657 3300046512 Ga0495610_0080849 Ga0495610_0080849_409_1062 214
658 3300046513 Ga0495616_0023039 Ga0495616_0023039_2215_2868 214
659 3300046515 Ga0495620_0008895 Ga0495620_0008895_2878_3531 214
660 3300046516 Ga0495628_0380461 Ga0495628_0380461_247_900 214
661 3300046517 Ga0495630_0222885 Ga0495630_0222885_342_995 214
662 3300046518 Ga0495631_0095683 Ga0495631_0095683_310_963 214
663 3300046520 Ga0495637_0010611 Ga0495637_0010611_198_851 214
664 3300046528 Ga0495642_0100047 Ga0495642_0100047_447_1100 214
665 3300046530 Ga0495654_0090347 Ga0495654_0090347_327_980 214
666 3300046539 Ga0495621_0016352 Ga0495621_0016352_354_1007 214
667 3300046558 Ga0495633_0003443 Ga0495633_0003443_7815_8468 214
668 3300046558 Ga0495633_0060037 Ga0495633_0060037_65_715 214
669 3300046558 Ga0495633_0150745 Ga0495633_0150745_65_718 214
670 3300046559 Ga0495667_0235221 Ga0495667_0235221_429_1082 214
671 3300046615 Ga0495656_0000108 Ga0495656_0000108_20557_21210 214
672 3300046615 Ga0495656_0034326 Ga0495656_0034326_1111_1764 214
673 3300046660 Ga0495625_0000637 Ga0495625_0000637_29031_29684 214
674 3300046660 Ga0495625_0098883 Ga0495625_0098883_209_862 214
675 3300046665 Ga0495661_0360397 Ga0495661_0360397_25_678 214
676 3300046674 Ga0495588_0018926 Ga0495588_0018926_379_1029 214
677 3300046681 Ga0495647_0133047 Ga0495647_0133047_79_732 214
678 3300046691 Ga0495670_0155104 Ga0495670_0155104_302_955 214
679 3300046692 Ga0495671_0020509 Ga0495671_0020509_79_729 214
680 3300047318 Ga0495636_0116299 Ga0495636_0116299_273_926 214
681 3300047321 Ga0495676_0007868 Ga0495676_0007868_4403_5056 214
682 3300047445 Ga0495677_0028439 Ga0495677_0028439_1173_1826 214
683 3300047470 Ga0495681_0002764 Ga0495681_0002764_9371_10021 214
684 3300047472 Ga0495686_0001297 Ga0495686_0001297_4872_5525 214
685 3300047673 Ga0495593_0005660 Ga0495593_0005660_5257_5910 214
686 3300048089 Ga0495614_0003894 Ga0495614_0003894_4680_5333 214
687 3300048904 Ga0496101_0002803 Ga0496101_0002803_378_1031 214
688 3300048904 Ga0496101_0455762 Ga0496101_0455762_166_819 214
689 3300048905 Ga0496102_0003435 Ga0496102_0003435_12526_13179 214
690 3300048905 Ga0496102_0030993 Ga0496102_0030993_3830_4483 214
691 3300048906 Ga0496103_0236151 Ga0496103_0236151_388_1041 214
692 3300048907 Ga0496104_0006268 Ga0496104_0006268_1525_2178 214
693 3300048907 Ga0496104_0045610 Ga0496104_0045610_394_1044 214
694 3300048908 Ga0496105_0381014 Ga0496105_0381014_397_1050 214
695 3300048909 Ga0496106_0165973 Ga0496106_0165973_1020_1673 214
696 3300048909 Ga0496106_0340134 Ga0496106_0340134_15_668 214
697 3300048911 Ga0496108_0170429 Ga0496108_0170429_718_1371 214
698 3300048911 Ga0496108_0397048 Ga0496108_0397048_177_830 214
699 3300048913 Ga0496110_0231827 Ga0496110_0231827_637_1290 214
700 3300048914 Ga0496111_0236653 Ga0496111_0236653_508_1161 214
701 3300048915 Ga0496112_0712570 Ga0496112_0712570_202_855 214
702 3300048916 Ga0496113_0159675 Ga0496113_0159675_786_1439 214
703 3300048917 Ga0496114_0179880 Ga0496114_0179880_397_1050 214
704 3300048919 Ga0496116_0026734 Ga0496116_0026734_711_1364 214
705 3300048919 Ga0496116_0035145 Ga0496116_0035145_1876_2526 214
706 3300048919 Ga0496116_0192403 Ga0496116_0192403_158_808 214
707 3300048920 Ga0496117_0000030 Ga0496117_0000030_69090_69740 214
708 3300048920 Ga0496117_0002266 Ga0496117_0002266_22623_23273 214
709 3300048920 Ga0496117_0016902 Ga0496117_0016902_4730_5383 214
710 3300048920 Ga0496117_0173575 Ga0496117_0173575_147_797 214
711 3300048921 Ga0496118_0003433 Ga0496118_0003433_7455_8105 214
712 3300048921 Ga0496118_0003748 Ga0496118_0003748_18092_18742 214
713 3300048921 Ga0496118_0011117 Ga0496118_0011117_7611_8264 214
714 3300048921 Ga0496118_0079459 Ga0496118_0079459_1452_2105 214
715 3300048922 Ga0496119_0006742 Ga0496119_0006742_5364_6014 214
716 3300048922 Ga0496119_0024993 Ga0496119_0024993_956_1606 214
717 3300048923 Ga0496120_0000148 Ga0496120_0000148_27377_28027 214
718 3300048923 Ga0496120_0247637 Ga0496120_0247637_22_675 214
719 3300048924 Ga0496121_0008570 Ga0496121_0008570_5376_6029 214
720 3300048924 Ga0496121_0045401 Ga0496121_0045401_792_1445 214
721 3300048924 Ga0496121_0123171 Ga0496121_0123171_840_1493 214
722 3300048924 Ga0496121_0248526 Ga0496121_0248526_14_664 214
723 3300048924 Ga0496121_0305559 Ga0496121_0305559_258_911 214
724 3300048925 Ga0496122_0000050 Ga0496122_0000050_101109_101759 214
725 3300048925 Ga0496122_0000565 Ga0496122_0000565_8073_8723 214
726 3300048925 Ga0496122_0001461 Ga0496122_0001461_37066_37719 214
727 3300048925 Ga0496122_0055769 Ga0496122_0055769_1685_2338 214
728 3300048926 Ga0496123_0000023 Ga0496123_0000023_26573_27223 214
729 3300048926 Ga0496123_0000179 Ga0496123_0000179_87421_88074 214
730 3300048926 Ga0496123_0000247 Ga0496123_0000247_99489_100139 214
731 3300048926 Ga0496123_0029502 Ga0496123_0029502_1011_1661 214
732 3300048926 Ga0496123_0041436 Ga0496123_0041436_210_863 214
733 3300048926 Ga0496123_0152383 Ga0496123_0152383_92_745 214
734 3300048927 Ga0496124_0000004 Ga0496124_0000004_892920_893573 214
735 3300048927 Ga0496124_0001021 Ga0496124_0001021_24173_24823 214
736 3300048927 Ga0496124_0002705 Ga0496124_0002705_5358_6008 214
737 3300048927 Ga0496124_0016756 Ga0496124_0016756_2371_3021 214
738 3300048927 Ga0496124_0180198 Ga0496124_0180198_233_883 214
739 3300048927 Ga0496124_0230138 Ga0496124_0230138_497_1150 214
740 3300048928 Ga0496125_0000161 Ga0496125_0000161_127039_127689 214
741 3300048928 Ga0496125_0000171 Ga0496125_0000171_66188_66838 214
742 3300048928 Ga0496125_0027820 Ga0496125_0027820_1694_2347 214
743 3300048928 Ga0496125_0035255 Ga0496125_0035255_143_796 214
744 3300048928 Ga0496125_0094490 Ga0496125_0094490_1121_1774 214
745 3300048928 Ga0496125_0116994 Ga0496125_0116994_297_947 214
746 3300048928 Ga0496125_0205763 Ga0496125_0205763_231_884 214
747 3300048928 Ga0496125_0226980 Ga0496125_0226980_342_995 214
748 3300048928 Ga0496125_0292768 Ga0496125_0292768_292_942 214
749 3300049568 Ga0501031_0013513 Ga0501031_0013513_4362_5018 214
750 3300049569 Ga0501032_0003246 Ga0501032_0003246_2385_3041 214
751 3300049570 Ga0501033_0000059 Ga0501033_0000059_49133_49783 214
752 3300049570 Ga0501033_0001825 Ga0501033_0001825_4020_4676 214
753 3300049571 Ga0501034_0078279 Ga0501034_0078279_2097_2750 214
754 3300049571 Ga0501034_0345391 Ga0501034_0345391_256_909 214
755 3300049572 Ga0501036_0008122 Ga0501036_0008122_1389_2045 214
756 3300049573 Ga0501037_0002561 Ga0501037_0002561_3806_4462 214
757 3300049573 Ga0501037_0414562 Ga0501037_0414562_92_745 214
758 3300049573 Ga0501037_0456101 Ga0501037_0456101_37_690 214
759 3300049574 Ga0501038_0073454 Ga0501038_0073454_1050_1706 214
760 3300049574 Ga0501038_0605245 Ga0501038_0605245_142_795 214
761 3300049579 Ga0501043_0000090 Ga0501043_0000090_4655_5308 214
762 3300049579 Ga0501043_0000828 Ga0501043_0000828_17777_18433 214
763 3300049579 Ga0501043_0312175 Ga0501043_0312175_210_863 214
764 3300049580 Ga0501046_0000126 Ga0501046_0000126_4653_5306 214
765 3300049580 Ga0501046_0033515 Ga0501046_0033515_2288_2944 214
766 3300049581 Ga0501047_0000160 Ga0501047_0000160_76029_76682 214
767 3300049582 Ga0501048_0000040 Ga0501048_0000040_57663_58316 214
768 3300049759 Ga0501262_000393 Ga0501262_000393_861_1514 214
769 3300049822 Ga0501035_0000213 Ga0501035_0000213_30151_30801 214
770 3300049822 Ga0501035_0002403 Ga0501035_0002403_633_1289 214
771 3300049822 Ga0501035_0169553 Ga0501035_0169553_938_1591 214
772 3300049822 Ga0501035_0304843 Ga0501035_0304843_481_1134 214
773 3300049822 Ga0501035_0395444 Ga0501035_0395444_333_986 214
774 3300049823 Ga0501044_0000045 Ga0501044_0000045_51028_51681 214
775 3300049823 Ga0501044_0009438 Ga0501044_0009438_2503_3159 214
776 3300049823 Ga0501044_0198289 Ga0501044_0198289_927_1580 214
777 3300049824 Ga0501045_0035981 Ga0501045_0035981_1824_2477 214
778 3300050489 nmdc:mga03683_136111_c1 nmdc:mga03683_136111_c1_233_886 214
779 3300050489 nmdc:mga03683_205984_c1 nmdc:mga03683_205984_c1_176_829 214
780 3300050489 nmdc:mga03683_26366_c1 nmdc:mga03683_26366_c1_681_1334 214
781 3300050489 nmdc:mga03683_41053_c1 nmdc:mga03683_41053_c1_1189_1839 214
782 3300050490 nmdc:mga03n38_164100_c1 nmdc:mga03n38_164100_c1_291_944 214
783 3300050490 nmdc:mga03n38_21477_c1 nmdc:mga03n38_21477_c1_1147_1800 214
784 3300050491 nmdc:mga00v17_213293_c1 nmdc:mga00v17_213293_c1_159_809 214
785 3300050491 nmdc:mga00v17_55892_c1 nmdc:mga00v17_55892_c1_1378_2031 214
786 3300050491 nmdc:mga00v17_700_c1 nmdc:mga00v17_700_c1_9801_10451 214
787 3300050492 nmdc:mga0yw44_76476_c1 nmdc:mga0yw44_76476_c1_951_1601 214
788 3300050493 nmdc:mga0k408_264627_c1 nmdc:mga0k408_264627_c1_220_873 214
789 3300050493 nmdc:mga0k408_29093_c1 nmdc:mga0k408_29093_c1_244_897 214
790 3300050496 nmdc:mga07m45_1027_c1 nmdc:mga07m45_1027_c1_10495_11148 214
791 3300050496 nmdc:mga07m45_278739_c1 nmdc:mga07m45_278739_c1_262_912 214
792 3300050514 nmdc:mga08x19_447026_c1 nmdc:mga08x19_447026_c1_196_849 214
793 3300050516 nmdc:mga0sz30_13103_c1 nmdc:mga0sz30_13103_c1_2088_2738 214
794 3300050516 nmdc:mga0sz30_29872_c1 nmdc:mga0sz30_29872_c1_1049_1699 214
795 3300053087 Ga0500643_009198 Ga0500643_009198_443_1096 214
796 3300053093 Ga0500651_0000029 Ga0500651_0000029_54470_55123 214
797 3300053093 Ga0500651_0157988 Ga0500651_0157988_272_925 214
798 3300053107 Ga0500560_000085 Ga0500560_000085_423_1073 214
799 3300053110 Ga0500571_000896 Ga0500571_000896_11652_12305 214
800 3300053111 Ga0500572_094070 Ga0500572_094070_140_793 214
801 3300053116 Ga0500592_025006 Ga0500592_025006_88_741 214
802 3300053117 Ga0500593_109834 Ga0500593_109834_263_916 214
803 3300053118 Ga0500594_0003141 Ga0500594_0003141_2764_3417 214
804 3300053122 Ga0500608_002231 Ga0500608_002231_6145_6798 214
805 3300053133 Ga0500655_014612 Ga0500655_014612_501_1154 214
806 3300053134 Ga0500658_0000243 Ga0500658_0000243_4393_5046 214
807 3300053134 Ga0500658_0000358 Ga0500658_0000358_1102_1755 214
808 3300053136 Ga0500559_0000021 Ga0500559_0000021_1852_2505 214
809 3300053136 Ga0500559_0084981 Ga0500559_0084981_547_1200 214
810 3300053136 Ga0500559_0134986 Ga0500559_0134986_246_899 214
811 3300053137 Ga0500561_0000067 Ga0500561_0000067_18946_19596 214
812 3300053138 Ga0500564_037142 Ga0500564_037142_1451_2104 214
813 3300053140 Ga0500573_0216890 Ga0500573_0216890_152_805 214
814 3300053141 Ga0500574_000803 Ga0500574_000803_3341_3994 214
815 3300053141 Ga0500574_039051 Ga0500574_039051_496_1149 214
816 3300053157 Ga0500624_000351 Ga0500624_000351_10130_10780 214
817 3300053158 Ga0500627_0000393 Ga0500627_0000393_10926_11579 214
818 3300053161 Ga0500634_0054964 Ga0500634_0054964_319_972 214
819 3300053161 Ga0500634_0117040 Ga0500634_0117040_154_807 214
820 3300053161 Ga0500634_0167315 Ga0500634_0167315_207_860 214
821 3300053177 Ga0500636_0000012 Ga0500636_0000012_53350_54000 214
822 3300053730 Ga0500645_043394 Ga0500645_043394_103_756 214
823 3300059510 Ga0587090_000032 Ga0587090_000032_1965_2615 214
824 3300059511 Ga0587091_001375 Ga0587091_001375_803_1453 214
825 3300059640 Ga0587067_000808 Ga0587067_000808_1245_1895 214
826 3300059643 Ga0587072_000287 Ga0587072_000287_860_1510 214
827 3300003775 Ga0055524_1010583 Ga0055524_10105834 215
828 3300025294 Ga0209025_1062080 Ga0209025_10620801 215
829 3300025299 Ga0209256_1000470 Ga0209256_100047037 215
830 3300003187 JGI25151J46595_10076514 JGI25151J46595_100765142 216
831 3300003215 JGI25153J46596_10016995 JGI25153J46596_100169954 216
832 3300005328 Ga0070676_10197030 Ga0070676_101970302 216
833 3300005331 Ga0070670_100060064 Ga0070670_1000600642 216
834 3300005434 Ga0070709_10391818 Ga0070709_103918182 216
835 3300005459 Ga0068867_100302199 Ga0068867_1003021991 216
836 3300005617 Ga0068859_101566843 Ga0068859_1015668431 216
837 3300005718 Ga0068866_10428922 Ga0068866_104289222 216
838 3300005983 Ga0081540_1000001 Ga0081540_100000121 216
839 3300005985 Ga0081539_10011653 Ga0081539_100116537 216
840 3300006042 Ga0075368_10009279 Ga0075368_100092793 216
841 3300006051 Ga0075364_10043751 Ga0075364_100437513 216
842 3300006051 Ga0075364_10566178 Ga0075364_105661782 216
843 3300006177 Ga0075362_10068895 Ga0075362_100688953 216
844 3300006178 Ga0075367_10020216 Ga0075367_100202164 216
845 3300006353 Ga0075370_10031122 Ga0075370_100311222 216
846 3300009545 Ga0105237_10582625 Ga0105237_105826252 216
847 3300010375 Ga0105239_11158671 Ga0105239_111586711 216
848 3300025297 Ga0209758_1005551 Ga0209758_10055513 216
849 3300025914 Ga0207671_10112041 Ga0207671_101120412 216
850 3300025925 Ga0207650_10227158 Ga0207650_102271582 216
851 3300025936 Ga0207670_10115274 Ga0207670_101152743 216
852 3300028379 Ga0268266_10222780 Ga0268266_102227803 216
853 3300028381 Ga0268264_11404748 Ga0268264_114047481 216
854 3300028794 Ga0307515_10014281 Ga0307515_1001428113 216
855 3300031239 Ga0265328_10097000 Ga0265328_100970001 216
856 3300031241 Ga0265325_10004238 Ga0265325_100042384 216
857 3300031250 Ga0265331_10098030 Ga0265331_100980302 216
858 3300031251 Ga0265327_10000028 Ga0265327_10000028224 216
859 3300031548 Ga0307408_100332892 Ga0307408_1003328922 216
860 3300031595 Ga0265313_10030042 Ga0265313_100300422 216
861 3300031901 Ga0307406_10634622 Ga0307406_106346222 216
862 3300032126 Ga0307415_100426498 Ga0307415_1004264982 216
863 3300039062 Ga0400483_082990 Ga0400483_082990_3000_3650 216
864 3300046471 Ga0495650_0015654 Ga0495650_0015654_2472_3122 216
865 3300046507 Ga0495606_0173958 Ga0495606_0173958_452_1102 216
866 3300046557 Ga0495622_0014993 Ga0495622_0014993_65_715 216
867 3300046681 Ga0495647_0085866 Ga0495647_0085866_43_744 216
868 3300048924 Ga0496121_0024154 Ga0496121_0024154_685_1383 216
869 3300048928 Ga0496125_0095746 Ga0496125_0095746_743_1441 216
870 3300048929 Ga0496126_0027931 Ga0496126_0027931_459_1115 216
871 3300050489 nmdc:mga03683_128261_c1 nmdc:mga03683_128261_c1_337_987 216
872 3300050489 nmdc:mga03683_34001_c1 nmdc:mga03683_34001_c1_1016_1666 216
873 3300050491 nmdc:mga00v17_5989_c1 nmdc:mga00v17_5989_c1_2076_2726 216
874 3300050494 nmdc:mga06z11_1446_c1 nmdc:mga06z11_1446_c1_7467_8117 216
875 3300050496 nmdc:mga07m45_8066_c1 nmdc:mga07m45_8066_c1_582_1232 216
876 3300053153 Ga0500616_0039096 Ga0500616_0039096_1055_1705 216
877 3300001989 JGI24739J22299_10017252 JGI24739J22299_100172523 217
878 3300003187 JGI25151J46595_10001106 JGI25151J46595_1000110610 217
879 3300003187 JGI25151J46595_10056756 JGI25151J46595_100567562 217
880 3300003773 Ga0055537_1000544 Ga0055537_100054411 217
881 3300003781 Ga0055536_1002305 Ga0055536_10023054 217
882 3300003784 Ga0055534_1000470 Ga0055534_10004704 217
883 3300003784 Ga0055534_1000494 Ga0055534_100049411 217
884 3300003791 Ga0055530_10044594 Ga0055530_100445942 217
885 3300003792 Ga0055540_1002128 Ga0055540_100212812 217
886 3300003792 Ga0055540_1006032 Ga0055540_10060325 217
887 3300003794 Ga0055531_10001138 Ga0055531_100011382 217
888 3300003794 Ga0055531_10001242 Ga0055531_1000124214 217
889 3300005262 Ga0065165_1039354 Ga0065165_10393542 217
890 3300005327 Ga0070658_10816950 Ga0070658_108169501 217
891 3300005367 Ga0070667_100025826 Ga0070667_1000258263 217
892 3300005539 Ga0068853_100005290 Ga0068853_1000052904 217
893 3300005543 Ga0070672_100463449 Ga0070672_1004634492 217
894 3300005843 Ga0068860_100498273 Ga0068860_1004982732 217
895 3300006038 Ga0075365_10514958 Ga0075365_105149582 217
896 3300006051 Ga0075364_10132498 Ga0075364_101324983 217
897 3300006051 Ga0075364_10454599 Ga0075364_104545992 217
898 3300006177 Ga0075362_10131574 Ga0075362_101315742 217
899 3300006195 Ga0075366_10031124 Ga0075366_100311242 217
900 3300006237 Ga0097621_100697246 Ga0097621_1006972462 217
901 3300006353 Ga0075370_10001936 Ga0075370_1000193611 217
902 3300006353 Ga0075370_10014295 Ga0075370_100142955 217
903 3300006946 Ga0079104_1005275 Ga0079104_10052753 217
904 3300006948 Ga0099826_10000408 Ga0099826_1000040811 217
905 3300009093 Ga0105240_10027927 Ga0105240_100279277 217
906 3300009148 Ga0105243_10728975 Ga0105243_107289752 217
907 3300009545 Ga0105237_10214553 Ga0105237_102145533 217
908 3300010375 Ga0105239_11155729 Ga0105239_111557292 217
909 3300011119 Ga0105246_10437945 Ga0105246_104379452 217
910 3300013104 Ga0157370_10012371 Ga0157370_1001237110 217
911 3300013306 Ga0163162_10240918 Ga0163162_102409182 217
912 3300013308 Ga0157375_10441668 Ga0157375_104416682 217
913 3300014497 Ga0182008_10004309 Ga0182008_100043099 217
914 3300015261 Ga0182006_1098533 Ga0182006_10985332 217
915 3300015261 Ga0182006_1113178 Ga0182006_11131782 217
916 3300015262 Ga0182007_10006630 Ga0182007_100066307 217
917 3300015683 Ga0183362_10001 Ga0183362_10001509 217
918 3300017792 Ga0163161_10000598 Ga0163161_1000059822 217
919 3300017792 Ga0163161_10010182 Ga0163161_100101823 217
920 3300017792 Ga0163161_10131056 Ga0163161_101310562 217
921 3300017792 Ga0163161_10219816 Ga0163161_102198162 217
922 3300021361 Ga0213872_10000161 Ga0213872_1000016159 217
923 3300025228 Ga0209672_103043 Ga0209672_1030433 217
924 3300025229 Ga0209147_100510 Ga0209147_10051018 217
925 3300025242 Ga0209258_100009 Ga0209258_100009248 217
926 3300025245 Ga0207425_1054598 Ga0207425_10545981 217
927 3300025254 Ga0209148_1000007 Ga0209148_1000007248 217
928 3300025258 Ga0209129_1002464 Ga0209129_10024642 217
929 3300025258 Ga0209129_1003880 Ga0209129_10038801 217
930 3300025263 Ga0209565_1000138 Ga0209565_100013811 217
931 3300025263 Ga0209565_1020057 Ga0209565_10200572 217
932 3300025273 Ga0209673_1000064 Ga0209673_100006411 217
933 3300025273 Ga0209673_1000329 Ga0209673_100032922 217
934 3300025273 Ga0209673_1011314 Ga0209673_10113143 217
935 3300025284 Ga0209130_1000489 Ga0209130_100048924 217
936 3300025284 Ga0209130_1010307 Ga0209130_10103073 217
937 3300025291 Ga0209675_1000036 Ga0209675_100003611 217
938 3300025291 Ga0209675_1000573 Ga0209675_10005738 217
939 3300025291 Ga0209675_1001085 Ga0209675_100108512 217
940 3300025292 Ga0209676_1000004 Ga0209676_1000004253 217
941 3300025292 Ga0209676_1000162 Ga0209676_1000162129 217
942 3300025292 Ga0209676_1007094 Ga0209676_10070944 217
943 3300025292 Ga0209676_1028115 Ga0209676_10281152 217
944 3300025294 Ga0209025_1000168 Ga0209025_100016845 217
945 3300025294 Ga0209025_1000220 Ga0209025_100022015 217
946 3300025294 Ga0209025_1008041 Ga0209025_10080419 217
947 3300025294 Ga0209025_1022779 Ga0209025_10227795 217
948 3300025295 Ga0209564_1000287 Ga0209564_100028760 217
949 3300025295 Ga0209564_1020032 Ga0209564_10200322 217
950 3300025297 Ga0209758_1012867 Ga0209758_10128673 217
951 3300025298 Ga0209050_1000002 Ga0209050_1000002763 217
952 3300025298 Ga0209050_1011437 Ga0209050_10114375 217
953 3300025298 Ga0209050_1022072 Ga0209050_10220722 217
954 3300025298 Ga0209050_1027972 Ga0209050_10279723 217
955 3300025299 Ga0209256_1001206 Ga0209256_100120610 217
956 3300025299 Ga0209256_1023119 Ga0209256_10231192 217
957 3300025302 Ga0207426_1000095 Ga0207426_100009599 217
958 3300025303 Ga0209051_1000002 Ga0209051_1000002531 217
959 3300025303 Ga0209051_1000113 Ga0209051_100011319 217
960 3300025303 Ga0209051_1000274 Ga0209051_100027413 217
961 3300025303 Ga0209051_1000367 Ga0209051_100036731 217
962 3300025304 Ga0209257_1000002 Ga0209257_1000002672 217
963 3300025304 Ga0209257_1000012 Ga0209257_1000012553 217
964 3300025304 Ga0209257_1000286 Ga0209257_100028650 217
965 3300025304 Ga0209257_1006354 Ga0209257_10063549 217
966 3300025304 Ga0209257_1015259 Ga0209257_10152592 217
967 3300025913 Ga0207695_10454631 Ga0207695_104546312 217
968 3300025914 Ga0207671_10128694 Ga0207671_101286942 217
969 3300025926 Ga0207659_10173289 Ga0207659_101732893 217
970 3300025927 Ga0207687_10324063 Ga0207687_103240632 217
971 3300025935 Ga0207709_10000205 Ga0207709_1000020565 217
972 3300025937 Ga0207669_10373259 Ga0207669_103732592 217
973 3300025940 Ga0207691_10183259 Ga0207691_101832592 217
974 3300025960 Ga0207651_10472957 Ga0207651_104729572 217
975 3300025972 Ga0207668_10532612 Ga0207668_105326122 217
976 3300025986 Ga0207658_10029339 Ga0207658_100293392 217
977 3300026035 Ga0207703_10630473 Ga0207703_106304731 217
978 3300026142 Ga0207698_10992278 Ga0207698_109922781 217
979 3300027111 Ga0209281_1011677 Ga0209281_10116772 217
980 3300027666 Ga0209282_1000521 Ga0209282_100052110 217
981 3300028380 Ga0268265_10293161 Ga0268265_102931612 217
982 3300028381 Ga0268264_10222893 Ga0268264_102228932 217
983 3300030522 Ga0307512_10206815 Ga0307512_102068152 217
984 3300030733 Ga0314311_1055507 Ga0314311_10555073 217
985 3300030734 Ga0316179_1038668 Ga0316179_10386684 217
986 3300030735 Ga0316178_1036717 Ga0316178_10367174 217
987 3300030736 Ga0316180_1138007 Ga0316180_11380072 217
988 3300030744 Ga0316181_1003089 Ga0316181_10030892 217
989 3300030745 Ga0316182_1388324 Ga0316182_13883244 217
990 3300031251 Ga0265327_10036761 Ga0265327_100367613 217
991 3300031548 Ga0307408_100003858 Ga0307408_1000038587 217
992 3300031548 Ga0307408_100177221 Ga0307408_1001772212 217
993 3300031548 Ga0307408_100665219 Ga0307408_1006652191 217
994 3300031649 Ga0307514_10062787 Ga0307514_100627872 217
995 3300031731 Ga0307405_10007105 Ga0307405_100071053 217
996 3300031852 Ga0307410_11059536 Ga0307410_110595361 217
997 3300031901 Ga0307406_10002407 Ga0307406_100024074 217
998 3300031903 Ga0307407_10200361 Ga0307407_102003612 217
999 3300031911 Ga0307412_10011637 Ga0307412_100116374 217
1000 3300031911 Ga0307412_10544762 Ga0307412_105447622 217
1001 3300032002 Ga0307416_100002355 Ga0307416_1000023557 217
1002 3300032002 Ga0307416_100839362 Ga0307416_1008393622 217
1003 3300032004 Ga0307414_10053714 Ga0307414_100537142 217
1004 3300032005 Ga0307411_10407642 Ga0307411_104076422 217
1005 3300032005 Ga0307411_10477974 Ga0307411_104779742 217
1006 3300037466 Ga0395898_0160759 Ga0395898_0160759_1292_1945 217
1007 3300038443 Ga0395901_0126807 Ga0395901_0126807_239_892 217
1008 3300039447 Ga0436361_0481133 Ga0436361_0481133_4731_5384 217
1009 3300042002 Ga0439442_007281 Ga0439442_007281_335_988 217
1010 3300042123 Ga0450921_001087 Ga0450921_001087_860_1513 217
1011 3300042127 Ga0450890_003439 Ga0450890_003439_177_830 217
1012 3300042145 Ga0450906_011587 Ga0450906_011587_571_1224 217
1013 3300042184 Ga0450908_018068 Ga0450908_018068_289_942 217
1014 3300042531 Ga0450918_021669 Ga0450918_021669_135_788 217
1015 3300046453 Ga0495627_013261 Ga0495627_013261_1734_2387 217
1016 3300046460 Ga0495638_0007637 Ga0495638_0007637_344_997 217
1017 3300046475 Ga0495639_0003490 Ga0495639_0003490_1781_2434 217
1018 3300046507 Ga0495606_0196526 Ga0495606_0196526_236_889 217
1019 3300046512 Ga0495610_0080827 Ga0495610_0080827_200_853 217
1020 3300046513 Ga0495616_0000916 Ga0495616_0000916_2862_3515 217
1021 3300046514 Ga0495618_0286256 Ga0495618_0286256_206_859 217
1022 3300046518 Ga0495631_0000233 Ga0495631_0000233_20127_20780 217
1023 3300046520 Ga0495637_0008199 Ga0495637_0008199_473_1126 217
1024 3300046520 Ga0495637_0140069 Ga0495637_0140069_189_842 217
1025 3300046524 Ga0495648_0137089 Ga0495648_0137089_91_744 217
1026 3300046525 Ga0495663_0064363 Ga0495663_0064363_216_869 217
1027 3300046525 Ga0495663_0095518 Ga0495663_0095518_154_807 217
1028 3300046539 Ga0495621_0020533 Ga0495621_0020533_1159_1812 217
1029 3300046539 Ga0495621_0042258 Ga0495621_0042258_618_1271 217
1030 3300046539 Ga0495621_0114909 Ga0495621_0114909_244_897 217
1031 3300046615 Ga0495656_0003752 Ga0495656_0003752_2235_2888 217
1032 3300046660 Ga0495625_0000057 Ga0495625_0000057_9274_9927 217
1033 3300046660 Ga0495625_0108633 Ga0495625_0108633_1008_1661 217
1034 3300046664 Ga0495659_0084499 Ga0495659_0084499_223_876 217
1035 3300046674 Ga0495588_0039983 Ga0495588_0039983_1103_1756 217
1036 3300046692 Ga0495671_0001282 Ga0495671_0001282_8156_8809 217
1037 3300047471 Ga0495684_0583206 Ga0495684_0583206_30_683 217
1038 3300047673 Ga0495593_0078652 Ga0495593_0078652_56_709 217
1039 3300048090 Ga0495615_0062668 Ga0495615_0062668_183_836 217
1040 3300048904 Ga0496101_0009650 Ga0496101_0009650_4632_5285 217
1041 3300048905 Ga0496102_0004534 Ga0496102_0004534_7759_8412 217
1042 3300048906 Ga0496103_0013210 Ga0496103_0013210_594_1247 217
1043 3300048907 Ga0496104_0137938 Ga0496104_0137938_1180_1833 217
1044 3300048908 Ga0496105_0002236 Ga0496105_0002236_6188_6841 217
1045 3300048909 Ga0496106_0011540 Ga0496106_0011540_2595_3248 217
1046 3300048911 Ga0496108_0201964 Ga0496108_0201964_650_1303 217
1047 3300048913 Ga0496110_0038468 Ga0496110_0038468_3026_3679 217
1048 3300048917 Ga0496114_0102391 Ga0496114_0102391_461_1114 217
1049 3300048919 Ga0496116_0022162 Ga0496116_0022162_3605_4258 217
1050 3300048919 Ga0496116_0145520 Ga0496116_0145520_322_975 217
1051 3300048920 Ga0496117_0086801 Ga0496117_0086801_318_971 217
1052 3300048920 Ga0496117_0116370 Ga0496117_0116370_735_1388 217
1053 3300048921 Ga0496118_0101001 Ga0496118_0101001_345_998 217
1054 3300048924 Ga0496121_0066020 Ga0496121_0066020_201_854 217
1055 3300048924 Ga0496121_0180394 Ga0496121_0180394_689_1342 217
1056 3300048925 Ga0496122_0005040 Ga0496122_0005040_10955_11614 217
1057 3300048925 Ga0496122_0068837 Ga0496122_0068837_1649_2302 217
1058 3300048925 Ga0496122_0093644 Ga0496122_0093644_534_1187 217
1059 3300048925 Ga0496122_0113078 Ga0496122_0113078_94_747 217
1060 3300048925 Ga0496122_0172882 Ga0496122_0172882_551_1204 217
1061 3300048926 Ga0496123_0001600 Ga0496123_0001600_19809_20468 217
1062 3300048926 Ga0496123_0043777 Ga0496123_0043777_2025_2678 217
1063 3300048927 Ga0496124_0021012 Ga0496124_0021012_1624_2277 217
1064 3300048927 Ga0496124_0144906 Ga0496124_0144906_997_1650 217
1065 3300048928 Ga0496125_0042236 Ga0496125_0042236_3027_3680 217
1066 3300048928 Ga0496125_0254557 Ga0496125_0254557_217_870 217
1067 3300049679 Ga0501249_009632 Ga0501249_009632_464_1117 217
1068 3300049682 Ga0501252_019446 Ga0501252_019446_181_834 217
1069 3300049705 Ga0501225_0007904 Ga0501225_0007904_1823_2476 217
1070 3300049759 Ga0501262_000028 Ga0501262_000028_7156_7809 217
1071 3300049763 Ga0501266_030019 Ga0501266_030019_32_685 217
1072 3300050489 nmdc:mga03683_78960_c1 nmdc:mga03683_78960_c1_284_937 217
1073 3300050491 nmdc:mga00v17_171779_c1 nmdc:mga00v17_171779_c1_87_740 217
1074 3300050492 nmdc:mga0yw44_185856_c1 nmdc:mga0yw44_185856_c1_260_913 217
1075 3300050492 nmdc:mga0yw44_4974_c1 nmdc:mga0yw44_4974_c1_2396_3049 217
1076 3300050493 nmdc:mga0k408_140873_c1 nmdc:mga0k408_140873_c1_596_1249 217
1077 3300050493 nmdc:mga0k408_78681_c1 nmdc:mga0k408_78681_c1_915_1568 217
1078 3300050496 nmdc:mga07m45_3652_c1 nmdc:mga07m45_3652_c1_2001_2654 217
1079 3300050496 nmdc:mga07m45_59_c1 nmdc:mga07m45_59_c1_8628_9281 217
1080 3300050516 nmdc:mga0sz30_5751_c1 nmdc:mga0sz30_5751_c1_45_698 217
1081 3300053096 Ga0500641_0099616 Ga0500641_0099616_82_735 217
1082 3300053104 Ga0500556_0000102 Ga0500556_0000102_9974_10633 217
1083 3300053117 Ga0500593_000625 Ga0500593_000625_1550_2203 217
1084 3300053118 Ga0500594_0014303 Ga0500594_0014303_142_795 217
1085 3300053134 Ga0500658_0004281 Ga0500658_0004281_3543_4196 217
1086 3300053136 Ga0500559_0070922 Ga0500559_0070922_482_1135 217
1087 3300053139 Ga0500568_0004013 Ga0500568_0004013_4519_5172 217
1088 3300053158 Ga0500627_0008574 Ga0500627_0008574_2457_3110 217
1089 3300053160 Ga0500633_0078818 Ga0500633_0078818_246_899 217
1090 3300053730 Ga0500645_030395 Ga0500645_030395_121_780 217
1091 3300053735 Ga0500596_009403 Ga0500596_009403_28_681 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

30

214

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8451 1 210
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8268 1 210
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7514 10 153
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.7321 18 203
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7234 11 204
ID Description Score Start End Superfamily
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8663 17 210 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8656 8 216 1.10.3720.10
af_Q2FX86_270_484_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8509 11 213 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8478 1 210 1.10.3720.10
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.842 1 210 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A2R7R261-F1-model_v4 deleted 0.9311 13 138
AF-A0A2E0RD90-F1-model_v4 deleted 0.9227 13 158
AF-A0A0H3GTQ0-F1-model_v4 Amino acid ABC superfamily ATP binding cassette transporter 0.9213 1 214 GO:0006865
GO:0022857
GO:0043190
AF-A0A2V8FXA6-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9189 5 145 GO:0006865
GO:0022857
GO:0043190
AF-A0A6P1V534-F1-model_v4 Amino acid ABC transporter permease 0.9186 1 214 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
87.4 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map