F489799

General Info

Members Datasets Scaffolds Average Seq Length
1087 626 868 295

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100000411|Ga0068860_10000041148
Length 334
Sequence MTLETSLQRTRFTAPDGSGRIAPMIPVRGSGPSMEPSPSLQPSHDDVGPIRLAARDNLRTEPRAVRIAIIAAALSFLGVFVVLPLVLVFAEAFSKGIGAYLAALSDPEALSAIRLTLLVAAVSVSINLVFGLMAAWAIAKFEFSGKTFLTTLIDLPFSVSPVISGLVFVLLFGAQGYWGAWLRDHDIQVLFAVPGIALATTFVTFPFVARALIPLMQEQGTQEEEAAISLGASGLQTFFRVTLPNIKWGVLYGVLLCNARAMGEFGAVSVVSGHIRGETNTMPLLVEILYNEYQFVASFAIASLLAMXXXXTLVAKAFLERHLDEGQQEVSHDH

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
17 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
21 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
22 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
23 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
24 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
25 2643221651 Afipia sp. Root123D2 Isolate Unclassified
26 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
27 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
28 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
29 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
30 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
31 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
32 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
33 2791355199
34 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
35 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
36 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
37 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
38 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
39 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
40 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
41 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
42 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
43 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
44 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
45 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
46 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
47 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
48 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
49 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
50 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
51 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
52 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
53 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
54 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
55 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
56 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
57 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
58 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
59 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
60 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
61 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
62 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
63 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
64 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
65 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
66 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
67 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
68 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
69 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
70 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
71 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
72 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
73 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
74 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
75 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
76 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
77 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
78 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
79 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
80 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
83 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
84 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
85 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
86 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
87 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
88 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
89 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
90 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
91 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
92 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
93 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
94 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
95 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
96 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
97 2904699407
98 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
99 2906610324
100 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
101 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
102 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
103 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
104 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
105 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
106 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
107 2922368715
108 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
109 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
110 2922425934
111 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
112 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
113 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
114 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
115 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
116 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
117 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
118 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
119 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
120 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
121 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
122 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
123 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
124 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
125 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
126 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
127 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
128 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
129 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
130 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
131 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
132 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
133 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
134 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
135 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
136 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
137 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
138 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
139 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
140 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
141 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
142 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
143 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
144 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
145 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
146 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
147 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
148 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
149 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
150 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
151 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
152 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
153 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
154 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
155 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
156 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
157 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
158 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
159 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
160 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
161 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
162 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
163 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
164 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
165 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
166 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
167 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
168 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
169 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
170 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
171 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
172 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
173 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
174 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
175 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
176 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
177 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
178 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
179 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
180 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
181 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
182 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
183 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
184 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
185 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
186 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
187 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
188 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
189 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
190 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
191 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
192 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
193 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
194 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
195 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
196 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
197 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
198 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
199 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
200 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
201 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
202 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
203 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
204 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
205 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
206 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
207 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
208 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
209 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
210 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
211 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
212 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
213 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
214 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
215 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
216 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
217 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
218 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
219 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
220 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
221 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
222 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
223 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
224 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
225 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
226 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
227 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
228 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
229 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
230 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
231 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
232 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
233 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
234 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
235 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
236 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
237 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
238 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
239 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
240 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
241 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
242 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
243 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
244 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
245 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
246 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
247 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
248 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
249 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
250 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
251 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
252 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
253 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
254 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
255 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
256 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
257 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
258 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
259 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
260 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
261 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
262 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
263 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
264 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
265 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
266 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
267 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
268 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
269 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
270 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
271 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
272 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
273 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
274 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
275 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
276 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
277 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
278 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
279 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
280 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
281 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
282 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
283 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
284 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
285 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
286 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
287 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
288 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
289 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
290 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
291 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
292 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
293 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
294 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
295 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
296 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
297 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
298 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
299 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
300 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
303 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
305 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
307 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
308 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
310 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
311 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
360 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
363 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
368 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
369 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
370 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
371 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
372 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
376 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
377 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
378 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
379 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
380 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
381 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
382 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
383 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
384 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
385 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
386 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
387 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
388 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
389 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
390 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
391 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
392 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
393 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
394 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
395 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
396 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
397 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
398 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
399 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
400 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
401 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
402 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
403 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
404 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
405 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
406 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
407 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
408 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
409 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
410 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
411 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
412 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
413 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
414 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
415 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
416 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
417 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
418 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
419 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
420 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
421 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
422 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
423 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
424 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
425 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
426 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
427 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
428 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
429 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
430 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
431 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
432 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
433 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
434 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
435 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
436 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
437 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
438 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
439 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
440 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
441 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
442 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
443 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
444 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
445 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
446 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
447 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
448 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
449 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
450 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
451 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
452 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
453 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
454 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
455 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
456 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
457 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
458 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
459 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
460 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
461 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
462 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
463 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
464 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
465 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
466 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
467 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
468 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
469 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
470 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
471 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
472 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
473 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
474 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
475 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
476 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
477 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
478 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
479 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
480 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
481 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
482 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
483 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
484 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
485 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
486 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
487 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
488 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
489 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
490 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
491 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
492 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
493 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
494 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
495 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
496 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
497 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
498 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
499 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
500 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
501 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
502 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
503 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
504 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
505 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
506 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
507 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
508 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
509 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
510 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
511 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
512 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
513 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
514 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
515 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
518 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
522 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
531 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
532 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
533 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
534 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
535 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
536 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
537 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
538 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
539 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
540 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
541 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
542 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
543 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
545 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
546 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
547 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
548 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
549 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
550 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
551 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
552 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
553 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
554 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
555 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
556 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
557 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
558 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
559 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
560 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
561 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
562 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
563 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
564 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
565 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
566 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
567 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
568 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
569 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
570 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
571 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
572 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
573 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
574 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
575 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
576 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
577 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
578 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
579 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
580 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
581 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
582 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
583 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
584 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
585 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
586 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
587 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
588 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
589 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
590 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
591 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
592 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
593 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
594 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
595 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
596 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
597 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
598 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
599 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
600 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
601 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
602 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
603 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
604 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
605 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
606 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
607 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
608 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
609 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
610 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
611 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
612 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
613 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
614 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
615 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
616 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
617 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
618 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
619 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
620 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
621 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
622 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
623 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
624 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
625 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
626 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.31
Metatranscriptomes 0
Isolates 19.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.94
Nodule 15.46
Rhizoplane 3.68
Rhizosphere 61.27
Stem 0
Stem Tuber 0
Unclassified 9.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1003629 3300000549 Bacteria 2054
2 JGI24740J21852_10010589 3300001979 Bacteria 3543
3 JGI24735J21928_10038218 3300002067 Bacteria 1406
4 JGI24750J21931_1003497 3300002070 Bacteria 1880
5 JGI24744J21845_10006597 3300002077 Bacteria 2406
6 JGI25153J46596_10000600 3300003215 Bacteria 22036
7 JGI25153J46596_10001390 3300003215 Bacteria 14494
8 JGI25153J46596_10002696 3300003215 Bacteria 10122
9 JGI25160J50197_1001415 3300003354 Bacteria 12018
10 JGI25404J52841_10000278 3300003659 Bacteria 6581
11 JGI25404J52841_10009489 3300003659 Bacteria 2081
12 JGI25404J52841_10011990 3300003659 Bacteria 1874
13 Ga0055542_1006533 3300003762 Bacteria 2481
14 Ga0055536_1008613 3300003781 Bacteria 4352
15 Ga0055531_10031132 3300003794 Bacteria 1774
16 Ga0065165_1002667 3300005262 Bacteria 14412
17 Ga0065165_1013580 3300005262 Bacteria 3227
18 Ga0070676_10016539 3300005328 Bacteria 4080
19 Ga0070683_100025289 3300005329 Bacteria 5330
20 Ga0070683_100130359 3300005329 Bacteria 2379
21 Ga0070683_100215018 3300005329 Bacteria 1827
22 Ga0070666_10243708 3300005335 Bacteria 1271
23 Ga0070680_100010901 3300005336 Bacteria 7023
24 Ga0070680_100350873 3300005336 Bacteria 1255
25 Ga0070682_100174131 3300005337 Bacteria 1498
26 Ga0070682_100284830 3300005337 Bacteria 1206
27 Ga0070660_100004981 3300005339 Bacteria 9181
28 Ga0070660_100311084 3300005339 Bacteria 1293
29 Ga0070660_100323793 3300005339 Bacteria 1267
30 Ga0070689_100027366 3300005340 Bacteria 4298
31 Ga0070661_100135531 3300005344 Bacteria 1853
32 Ga0070661_100311839 3300005344 Bacteria 1227
33 Ga0070692_10032810 3300005345 Bacteria 2614
34 Ga0070668_100003914 3300005347 Bacteria 10999
35 Ga0070668_100076766 3300005347 Bacteria 2610
36 Ga0070668_100209627 3300005347 Bacteria 1602
37 Ga0070669_100000033 3300005353 Bacteria 144544
38 Ga0070669_100000387 3300005353 Bacteria 33852
39 Ga0070669_100037707 3300005353 Bacteria 3507
40 Ga0070675_100061546 3300005354 Bacteria 3099
41 Ga0070675_100589391 3300005354 Bacteria 1008
42 Ga0070671_100000012 3300005355 Bacteria 196420
43 Ga0070671_100017669 3300005355 Bacteria 5780
44 Ga0070671_100109525 3300005355 Bacteria 2320
45 Ga0070674_100020257 3300005356 Bacteria 4244
46 Ga0070673_100076660 3300005364 Bacteria 2700
47 Ga0070673_100233740 3300005364 Bacteria 1595
48 Ga0070688_100004706 3300005365 Bacteria 7127
49 Ga0070688_100017655 3300005365 Bacteria 4099
50 Ga0070659_100072567 3300005366 Bacteria 2739
51 Ga0070667_100000279 3300005367 Bacteria 58238
52 Ga0070667_100136017 3300005367 Bacteria 2149
53 Ga0070703_10067958 3300005406 Bacteria 1183
54 Ga0070709_10000375 3300005434 Bacteria 27523
55 Ga0070714_100212996 3300005435 Bacteria 1772
56 Ga0070713_100041867 3300005436 Bacteria 3735
57 Ga0070713_100089707 3300005436 Bacteria 2641
58 Ga0070710_10000275 3300005437 Bacteria 24270
59 Ga0070710_10017525 3300005437 Bacteria 3667
60 Ga0070710_10040067 3300005437 Bacteria 2581
61 Ga0070710_10228597 3300005437 Bacteria 1187
62 Ga0070711_100006414 3300005439 Bacteria 7094
63 Ga0070711_100020739 3300005439 Bacteria 4240
64 Ga0070711_100022239 3300005439 Bacteria 4107
65 Ga0070663_100018265 3300005455 Bacteria 4593
66 Ga0070663_100161988 3300005455 Bacteria 1722
67 Ga0070678_100106912 3300005456 Bacteria 2181
68 Ga0070662_100134192 3300005457 Bacteria 1912
69 Ga0070662_100140170 3300005457 Bacteria 1873
70 Ga0070662_100391421 3300005457 Bacteria 1145
71 Ga0070681_10061629 3300005458 Bacteria 3725
72 Ga0070681_10216576 3300005458 Bacteria 1831
73 Ga0070681_10308969 3300005458 Bacteria 1490
74 Ga0068867_100029064 3300005459 Bacteria 3982
75 Ga0070685_10000001 3300005466 Bacteria 349867
76 Ga0070685_10049514 3300005466 Bacteria 2424
77 Ga0070706_100219916 3300005467 Bacteria 1773
78 Ga0070707_100083474 3300005468 Bacteria 3087
79 Ga0070679_100034040 3300005530 Bacteria 5047
80 Ga0070679_100053135 3300005530 Bacteria 4033
81 Ga0070679_100075094 3300005530 Bacteria 3371
82 Ga0070679_100076591 3300005530 Bacteria 3334
83 Ga0070684_100001508 3300005535 Bacteria 16819
84 Ga0070684_100028072 3300005535 Bacteria 4757
85 Ga0070684_100053196 3300005535 Bacteria 3523
86 Ga0070684_100168155 3300005535 Bacteria 1991
87 Ga0070684_100398277 3300005535 Bacteria 1269
88 Ga0068853_100000629 3300005539 Bacteria 24248
89 Ga0068853_100086846 3300005539 Bacteria 2744
90 Ga0068853_100296802 3300005539 Bacteria 1493
91 Ga0070672_100005802 3300005543 Bacteria 8236
92 Ga0070672_100147354 3300005543 Bacteria 1945
93 Ga0070686_100014547 3300005544 Bacteria 4539
94 Ga0070696_100024651 3300005546 Bacteria 4089
95 Ga0070696_100313661 3300005546 Bacteria 1205
96 Ga0070665_100078792 3300005548 Bacteria 3301
97 Ga0070665_100102324 3300005548 Bacteria 2868
98 Ga0070665_100135855 3300005548 Bacteria 2462
99 Ga0070665_100313579 3300005548 Bacteria 1572
100 Ga0070665_100326537 3300005548 Bacteria 1538
101 Ga0070704_100044331 3300005549 Bacteria 3090
102 Ga0070704_100110635 3300005549 Bacteria 2089
103 Ga0068855_100029638 3300005563 Bacteria 6541
104 Ga0068855_100034408 3300005563 Bacteria 6043
105 Ga0068855_100058404 3300005563 Bacteria 4518
106 Ga0068855_100094463 3300005563 Bacteria 3448
107 Ga0068855_100098198 3300005563 Bacteria 3374
108 Ga0068855_100237342 3300005563 Bacteria 2038
109 Ga0068855_100250279 3300005563 Bacteria 1977
110 Ga0068855_100582204 3300005563 Bacteria 1209
111 Ga0070664_100096036 3300005564 Bacteria 2571
112 Ga0070664_100387472 3300005564 Bacteria 1277
113 Ga0068857_100036777 3300005577 Bacteria 4338
114 Ga0068857_100064583 3300005577 Bacteria 3255
115 Ga0068857_100066950 3300005577 Bacteria 3196
116 Ga0068857_100084387 3300005577 Bacteria 2838
117 Ga0068857_100274189 3300005577 Bacteria 1551
118 Ga0068854_100026612 3300005578 Bacteria 3977
119 Ga0068854_100043105 3300005578 Bacteria 3196
120 Ga0068854_100150904 3300005578 Bacteria 1792
121 Ga0068854_100354045 3300005578 Bacteria 1202
122 Ga0068856_100003776 3300005614 Bacteria 15173
123 Ga0068856_100062045 3300005614 Bacteria 3692
124 Ga0068856_100338831 3300005614 Bacteria 1522
125 Ga0070702_100215099 3300005615 Bacteria 1282
126 Ga0068852_100005759 3300005616 Bacteria 8896
127 Ga0068852_100064924 3300005616 Bacteria 3183
128 Ga0068852_100064930 3300005616 Bacteria 3183
129 Ga0068864_100000018 3300005618 Bacteria 277365
130 Ga0068864_100047366 3300005618 Bacteria 3692
131 Ga0068864_100055374 3300005618 Bacteria 3424
132 Ga0068864_100248805 3300005618 Bacteria 1649
133 Ga0068864_100261239 3300005618 Bacteria 1611
134 Ga0068864_100663065 3300005618 Bacteria 1017
135 Ga0068861_100010209 3300005719 Bacteria 6517
136 Ga0068861_100136558 3300005719 Bacteria 1996
137 Ga0068861_100176343 3300005719 Bacteria 1775
138 Ga0068851_10017462 3300005834 Bacteria 3446
139 Ga0068851_10054937 3300005834 Bacteria 2029
140 Ga0068863_100630285 3300005841 Bacteria 1062
141 Ga0068858_100004448 3300005842 Bacteria 13737
142 Ga0068858_100136821 3300005842 Bacteria 2299
143 Ga0068860_100000411 3300005843 Bacteria 55810
144 Ga0068860_100000456 3300005843 Bacteria 51397
145 Ga0068860_100012696 3300005843 Bacteria 8287
146 Ga0068860_100044144 3300005843 Bacteria 4249
147 Ga0068862_100002580 3300005844 Bacteria 15999
148 Ga0068862_100006134 3300005844 Bacteria 10004
149 Ga0068862_100270297 3300005844 Bacteria 1554
150 Ga0068862_100526453 3300005844 Bacteria 1126
151 Ga0081455_10002674 3300005937 Bacteria 21063
152 Ga0081455_10016366 3300005937 Bacteria 7162
153 Ga0081455_10052651 3300005937 Bacteria 3483
154 Ga0081455_10092032 3300005937 Bacteria 2455
155 Ga0081540_1000128 3300005983 Bacteria 80512
156 Ga0081540_1001275 3300005983 Bacteria 21968
157 Ga0081540_1001299 3300005983 Bacteria 21824
158 Ga0081540_1005588 3300005983 Bacteria 9363
159 Ga0081540_1006389 3300005983 Bacteria 8593
160 Ga0081540_1012898 3300005983 Bacteria 5466
161 Ga0081540_1016667 3300005983 Bacteria 4584
162 Ga0081540_1028615 3300005983 Bacteria 3125
163 Ga0081540_1028764 3300005983 Bacteria 3113
164 Ga0081540_1041487 3300005983 Bacteria 2385
165 Ga0081539_10074173 3300005985 Bacteria 1813
166 Ga0081539_10105926 3300005985 Bacteria 1424
167 Ga0081539_10120167 3300005985 Bacteria 1306
168 Ga0070717_10069615 3300006028 Bacteria 2931
169 Ga0070717_10073105 3300006028 Bacteria 2865
170 Ga0075365_10060955 3300006038 Bacteria 2518
171 Ga0075365_10082394 3300006038 Bacteria 2181
172 Ga0075365_10136170 3300006038 Bacteria 1702
173 Ga0075365_10179433 3300006038 Bacteria 1480
174 Ga0075365_10228216 3300006038 Bacteria 1307
175 Ga0075365_10269441 3300006038 Bacteria 1198
176 Ga0075368_10001639 3300006042 Bacteria 7182
177 Ga0075368_10048310 3300006042 Bacteria 1686
178 Ga0075363_100002809 3300006048 Bacteria 7231
179 Ga0075363_100017335 3300006048 Bacteria 3570
180 Ga0075364_10085142 3300006051 Bacteria 2093
181 Ga0075364_10221940 3300006051 Bacteria 1283
182 Ga0070715_10024687 3300006163 Bacteria 2372
183 Ga0070716_100013938 3300006173 Bacteria 4109
184 Ga0070712_100005151 3300006175 Bacteria 8089
185 Ga0070712_100005941 3300006175 Bacteria 7546
186 Ga0070712_100045559 3300006175 Bacteria 3029
187 Ga0070712_100070842 3300006175 Bacteria 2493
188 Ga0070712_100434960 3300006175 Bacteria 1090
189 Ga0075367_10042532 3300006178 Bacteria 2659
190 Ga0075369_10044924 3300006186 Bacteria 1898
191 Ga0075369_10089752 3300006186 Bacteria 1370
192 Ga0097621_100033964 3300006237 Bacteria 4066
193 Ga0097621_100122673 3300006237 Bacteria 2206
194 Ga0075370_10034039 3300006353 Bacteria 2855
195 Ga0075370_10194632 3300006353 Bacteria 1195
196 Ga0068871_100081737 3300006358 Bacteria 2677
197 Ga0068871_100195541 3300006358 Bacteria 1744
198 Ga0075428_100155620 3300006844 Bacteria 2483
199 Ga0075434_100359271 3300006871 Bacteria 1477
200 Ga0068865_100070580 3300006881 Bacteria 2475
201 Ga0075436_100009187 3300006914 Bacteria 6763
202 Ga0099825_1032482 3300006941 Bacteria 2112
203 Ga0099824_1014728 3300006942 Bacteria 7661
204 Ga0099822_1000031 3300006943 Bacteria 62575
205 Ga0099794_10102171 3300007265 Bacteria 1431
206 Ga0099795_10009109 3300007788 Bacteria 2865
207 Ga0099795_10042026 3300007788 Bacteria 1630
208 Ga0105250_10048076 3300009092 Bacteria 1711
209 Ga0105240_10005310 3300009093 Bacteria 19223
210 Ga0105240_10008157 3300009093 Bacteria 15019
211 Ga0105240_10020584 3300009093 Bacteria 8793
212 Ga0105240_10020686 3300009093 Bacteria 8768
213 Ga0105240_10194470 3300009093 Bacteria 2383
214 Ga0105245_10233172 3300009098 Bacteria 1781
215 Ga0105247_10037262 3300009101 Bacteria 2967
216 Ga0105247_10085391 3300009101 Bacteria 1996
217 Ga0105247_10101322 3300009101 Bacteria 1841
218 Ga0105247_10153131 3300009101 Bacteria 1521
219 Ga0105247_10178817 3300009101 Bacteria 1414
220 Ga0105247_10290054 3300009101 Bacteria 1131
221 Ga0114129_10085137 3300009147 Bacteria 4386
222 Ga0105243_10181929 3300009148 Bacteria 1829
223 Ga0105241_10001771 3300009174 Bacteria 16387
224 Ga0105241_10104105 3300009174 Bacteria 2261
225 Ga0105242_10086402 3300009176 Bacteria 2632
226 Ga0105248_10042837 3300009177 Bacteria 5076
227 Ga0105248_10082009 3300009177 Bacteria 3626
228 Ga0105248_10095178 3300009177 Bacteria 3353
229 Ga0105248_10400059 3300009177 Bacteria 1546
230 Ga0105248_10512173 3300009177 Bacteria 1353
231 Ga0105237_10008184 3300009545 Bacteria 11357
232 Ga0105237_10045694 3300009545 Bacteria 4406
233 Ga0105237_10046343 3300009545 Bacteria 4373
234 Ga0105237_10113822 3300009545 Bacteria 2697
235 Ga0105237_10146340 3300009545 Bacteria 2357
236 Ga0105237_10361717 3300009545 Bacteria 1455
237 Ga0105237_10385688 3300009545 Bacteria 1406
238 Ga0105238_10000517 3300009551 Bacteria 40562
239 Ga0105238_10022670 3300009551 Bacteria 6399
240 Ga0105238_10026980 3300009551 Bacteria 5854
241 Ga0105249_10471740 3300009553 Bacteria 1296
242 Ga0099796_10009283 3300010159 Bacteria 2656
243 Ga0099796_10021895 3300010159 Bacteria 1976
244 Ga0099796_10023122 3300010159 Bacteria 1937
245 Ga0099796_10033766 3300010159 Bacteria 1686
246 Ga0105239_10002648 3300010375 Bacteria 22602
247 Ga0105239_10017924 3300010375 Bacteria 7829
248 Ga0105239_10021488 3300010375 Bacteria 7115
249 Ga0105239_10031806 3300010375 Bacteria 5798
250 Ga0105239_10065141 3300010375 Bacteria 4002
251 Ga0105239_10072205 3300010375 Bacteria 3794
252 Ga0105239_10134890 3300010375 Bacteria 2748
253 Ga0105239_10234595 3300010375 Bacteria 2059
254 Ga0105239_10391969 3300010375 Bacteria 1571
255 Ga0105246_10116136 3300011119 Bacteria 1975
256 Ga0105246_10191791 3300011119 Bacteria 1582
257 Ga0105246_10220229 3300011119 Bacteria 1487
258 Ga0157371_10021936 3300013102 Bacteria 4687
259 Ga0157370_10014532 3300013104 Bacteria 8047
260 Ga0157370_10124641 3300013104 Bacteria 2405
261 Ga0157369_10003506 3300013105 Bacteria 18636
262 Ga0157369_10006970 3300013105 Bacteria 13030
263 Ga0157369_10014315 3300013105 Bacteria 8959
264 Ga0157369_10052523 3300013105 Bacteria 4409
265 Ga0157369_10496025 3300013105 Bacteria 1263
266 Ga0157374_10061178 3300013296 Bacteria 3526
267 Ga0157374_10077659 3300013296 Bacteria 3143
268 Ga0157378_10063588 3300013297 Bacteria 3297
269 Ga0157378_10293822 3300013297 Bacteria 1570
270 Ga0157378_10454106 3300013297 Bacteria 1272
271 Ga0163162_10382877 3300013306 Bacteria 1540
272 Ga0157372_10023555 3300013307 Bacteria 6676
273 Ga0157375_10055632 3300013308 Bacteria 3902
274 Ga0157375_10073375 3300013308 Bacteria 3441
275 Ga0163163_10000069 3300014325 Bacteria 114043
276 Ga0157380_10210285 3300014326 Bacteria 1733
277 Ga0157380_10338602 3300014326 Bacteria 1402
278 Ga0157380_10448403 3300014326 Bacteria 1238
279 Ga0157377_10060818 3300014745 Bacteria 2157
280 Ga0157377_10090470 3300014745 Bacteria 1806
281 Ga0157379_10051655 3300014968 Bacteria 3671
282 Ga0157379_10355752 3300014968 Bacteria 1341
283 Ga0157376_10325225 3300014969 Bacteria 1463
284 Ga0157376_10419511 3300014969 Bacteria 1298
285 Ga0213872_10022702 3300021361 Bacteria 2888
286 Ga0213876_10000477 3300021384 Bacteria 31939
287 Ga0209677_102608 3300025253 Bacteria 6582
288 Ga0209148_1001000 3300025254 Bacteria 18034
289 Ga0209233_1002990 3300025261 Bacteria 6023
290 Ga0209233_1009100 3300025261 Bacteria 3038
291 Ga0209455_1001389 3300025272 Bacteria 11022
292 Ga0209455_1010687 3300025272 Bacteria 2315
293 Ga0209455_1015147 3300025272 Bacteria 1709
294 Ga0209675_1006021 3300025291 Bacteria 4960
295 Ga0209676_1000284 3300025292 Bacteria 104999
296 Ga0209564_1002110 3300025295 Bacteria 16929
297 Ga0209564_1013028 3300025295 Bacteria 3566
298 Ga0209758_1000206 3300025297 Bacteria 130177
299 Ga0209758_1001267 3300025297 Bacteria 31294
300 Ga0209758_1001347 3300025297 Bacteria 29637
301 Ga0209758_1011263 3300025297 Bacteria 5206
302 Ga0209758_1037256 3300025297 Bacteria 1882
303 Ga0209050_1016402 3300025298 Bacteria 3033
304 Ga0207426_1000799 3300025302 Bacteria 34123
305 Ga0207426_1003234 3300025302 Bacteria 9138
306 Ga0207426_1008081 3300025302 Bacteria 4310
307 Ga0207426_1030869 3300025302 Bacteria 1753
308 Ga0209257_1000394 3300025304 Bacteria 86654
309 Ga0209257_1008387 3300025304 Bacteria 5892
310 Ga0209257_1013507 3300025304 Bacteria 3621
311 Ga0207697_10064088 3300025315 Bacteria 1532
312 Ga0207656_10003517 3300025321 Bacteria 5390
313 Ga0207692_10000229 3300025898 Bacteria 19004
314 Ga0207692_10023181 3300025898 Bacteria 2868
315 Ga0207710_10014586 3300025900 Bacteria 3317
316 Ga0207710_10038836 3300025900 Bacteria 2105
317 Ga0207710_10084508 3300025900 Bacteria 1477
318 Ga0207688_10001503 3300025901 Bacteria 12239
319 Ga0207688_10067444 3300025901 Bacteria 2025
320 Ga0207688_10072127 3300025901 Bacteria 1961
321 Ga0207680_10100912 3300025903 Bacteria 1854
322 Ga0207685_10041278 3300025905 Bacteria 1725
323 Ga0207699_10000242 3300025906 Bacteria 30591
324 Ga0207645_10012744 3300025907 Bacteria 5699
325 Ga0207645_10083437 3300025907 Bacteria 2050
326 Ga0207645_10139770 3300025907 Bacteria 1578
327 Ga0207654_10000248 3300025911 Bacteria 32761
328 Ga0207654_10009059 3300025911 Bacteria 5050
329 Ga0207654_10041873 3300025911 Bacteria 2589
330 Ga0207654_10062044 3300025911 Bacteria 2189
331 Ga0207707_10002685 3300025912 Bacteria 15895
332 Ga0207707_10045342 3300025912 Bacteria 3831
333 Ga0207695_10000006 3300025913 Bacteria 1135309
334 Ga0207695_10000343 3300025913 Bacteria 107739
335 Ga0207695_10050510 3300025913 Bacteria 4374
336 Ga0207695_10050929 3300025913 Bacteria 4352
337 Ga0207695_10063575 3300025913 Bacteria 3804
338 Ga0207695_10075958 3300025913 Bacteria 3417
339 Ga0207671_10029138 3300025914 Bacteria 4124
340 Ga0207671_10061668 3300025914 Bacteria 2783
341 Ga0207693_10007398 3300025915 Bacteria 9032
342 Ga0207693_10033852 3300025915 Bacteria 4031
343 Ga0207693_10073908 3300025915 Bacteria 2669
344 Ga0207693_10096274 3300025915 Bacteria 2320
345 Ga0207663_10009571 3300025916 Bacteria 5126
346 Ga0207663_10025694 3300025916 Bacteria 3408
347 Ga0207663_10186331 3300025916 Bacteria 1486
348 Ga0207660_10008346 3300025917 Bacteria 6698
349 Ga0207660_10029917 3300025917 Bacteria 3741
350 Ga0207660_10205430 3300025917 Bacteria 1540
351 Ga0207660_10207998 3300025917 Bacteria 1531
352 Ga0207660_10286956 3300025917 Bacteria 1308
353 Ga0207657_10004349 3300025919 Bacteria 15004
354 Ga0207657_10012048 3300025919 Bacteria 8553
355 Ga0207657_10127903 3300025919 Bacteria 2085
356 Ga0207657_10280914 3300025919 Bacteria 1322
357 Ga0207649_10064731 3300025920 Bacteria 2312
358 Ga0207652_10166910 3300025921 Bacteria 1974
359 Ga0207652_10201178 3300025921 Bacteria 1792
360 Ga0207646_10028422 3300025922 Bacteria 5091
361 Ga0207681_10000011 3300025923 Bacteria 366878
362 Ga0207681_10001220 3300025923 Bacteria 16562
363 Ga0207681_10136657 3300025923 Bacteria 1820
364 Ga0207694_10000136 3300025924 Bacteria 74908
365 Ga0207694_10029183 3300025924 Bacteria 4207
366 Ga0207694_10360648 3300025924 Bacteria 1204
367 Ga0207650_10000003 3300025925 Bacteria 1123235
368 Ga0207659_10046382 3300025926 Bacteria 3068
369 Ga0207687_10065440 3300025927 Bacteria 2581
370 Ga0207700_10168867 3300025928 Bacteria 1823
371 Ga0207700_10301374 3300025928 Bacteria 1384
372 Ga0207664_10124695 3300025929 Bacteria 2161
373 Ga0207644_10000036 3300025931 Bacteria 128383
374 Ga0207644_10114097 3300025931 Bacteria 2047
375 Ga0207690_10118641 3300025932 Bacteria 1918
376 Ga0207690_10345481 3300025932 Bacteria 1175
377 Ga0207706_10002700 3300025933 Bacteria 17297
378 Ga0207706_10247650 3300025933 Bacteria 1557
379 Ga0207709_10174233 3300025935 Bacteria 1513
380 Ga0207669_10057536 3300025937 Bacteria 2367
381 Ga0207665_10004541 3300025939 Bacteria 9211
382 Ga0207665_10081743 3300025939 Bacteria 2225
383 Ga0207691_10002238 3300025940 Bacteria 18948
384 Ga0207691_10097989 3300025940 Bacteria 2620
385 Ga0207691_10192500 3300025940 Bacteria 1778
386 Ga0207691_10329244 3300025940 Bacteria 1309
387 Ga0207711_10000469 3300025941 Bacteria 41584
388 Ga0207689_10012288 3300025942 Bacteria 7326
389 Ga0207661_10000613 3300025944 Bacteria 22875
390 Ga0207661_10053399 3300025944 Bacteria 3233
391 Ga0207661_10173608 3300025944 Bacteria 1878
392 Ga0207679_10133539 3300025945 Bacteria 1995
393 Ga0207667_10018828 3300025949 Bacteria 7731
394 Ga0207667_10084423 3300025949 Bacteria 3287
395 Ga0207667_10174101 3300025949 Bacteria 2211
396 Ga0207667_10377599 3300025949 Bacteria 1444
397 Ga0207712_10062581 3300025961 Bacteria 2646
398 Ga0207668_10021332 3300025972 Bacteria 4130
399 Ga0207668_10111939 3300025972 Bacteria 2050
400 Ga0207668_10117302 3300025972 Bacteria 2009
401 Ga0207668_10292653 3300025972 Bacteria 1340
402 Ga0207668_10421735 3300025972 Bacteria 1133
403 Ga0207640_10080475 3300025981 Bacteria 2224
404 Ga0207640_10138490 3300025981 Bacteria 1770
405 Ga0207658_10000007 3300025986 Bacteria 329651
406 Ga0207658_10101121 3300025986 Bacteria 2258
407 Ga0207677_10130335 3300026023 Bacteria 1908
408 Ga0207703_10036999 3300026035 Bacteria 3887
409 Ga0207639_10056591 3300026041 Bacteria 3006
410 Ga0207639_10277079 3300026041 Bacteria 1474
411 Ga0207678_10045082 3300026067 Bacteria 3813
412 Ga0207678_10079165 3300026067 Bacteria 2814
413 Ga0207678_10162783 3300026067 Bacteria 1905
414 Ga0207678_10198830 3300026067 Bacteria 1713
415 Ga0207678_10237184 3300026067 Bacteria 1562
416 Ga0207708_10088913 3300026075 Bacteria 2380
417 Ga0207702_10000006 3300026078 Bacteria 346370
418 Ga0207702_10128736 3300026078 Bacteria 2276
419 Ga0207641_10099781 3300026088 Bacteria 2555
420 Ga0207648_10008717 3300026089 Bacteria 9778
421 Ga0207648_10201861 3300026089 Bacteria 1763
422 Ga0207648_10265156 3300026089 Bacteria 1533
423 Ga0207676_10000003 3300026095 Bacteria 1123235
424 Ga0207676_10005493 3300026095 Bacteria 8974
425 Ga0207676_10019688 3300026095 Bacteria 4928
426 Ga0207676_10023076 3300026095 Bacteria 4584
427 Ga0207674_10003449 3300026116 Bacteria 19336
428 Ga0207674_10108458 3300026116 Bacteria 2753
429 Ga0207674_10217126 3300026116 Bacteria 1861
430 Ga0207674_10287903 3300026116 Bacteria 1591
431 Ga0207675_100001986 3300026118 Bacteria 20396
432 Ga0207683_10021982 3300026121 Bacteria 5472
433 Ga0207683_10041690 3300026121 Bacteria 4009
434 Ga0207683_10089991 3300026121 Bacteria 2732
435 Ga0207683_10127715 3300026121 Bacteria 2286
436 Ga0207698_10175307 3300026142 Bacteria 1893
437 Ga0209389_1000039 3300027296 Bacteria 124545
438 Ga0209589_1000025 3300027357 Bacteria 165546
439 Ga0209489_100039 3300027361 Bacteria 165546
440 Ga0209489_100087 3300027361 Bacteria 124545
441 Ga0209700_100043 3300027363 Bacteria 167890
442 Ga0209700_100090 3300027363 Bacteria 124545
443 Ga0207428_10091011 3300027907 Bacteria 2368
444 Ga0268266_10002576 3300028379 Bacteria 19238
445 Ga0268266_10010607 3300028379 Bacteria 8030
446 Ga0268266_10023222 3300028379 Bacteria 5281
447 Ga0268266_10049211 3300028379 Bacteria 3614
448 Ga0268266_10117706 3300028379 Bacteria 2361
449 Ga0268266_10161996 3300028379 Bacteria 2024
450 Ga0268266_10190963 3300028379 Bacteria 1870
451 Ga0268266_10252527 3300028379 Bacteria 1631
452 Ga0268266_10576138 3300028379 Bacteria 1080
453 Ga0268265_10000404 3300028380 Bacteria 46221
454 Ga0268265_10518300 3300028380 Bacteria 1126
455 Ga0268264_10000009 3300028381 Bacteria 724972
456 Ga0268264_10000194 3300028381 Bacteria 125395
457 Ga0268264_10267649 3300028381 Bacteria 1595
458 Ga0265337_1007418 3300028556 Bacteria 4104
459 Ga0265326_10003492 3300028558 Bacteria 5140
460 Ga0265334_10052977 3300028573 Bacteria 1551
461 Ga0265318_10013434 3300028577 Bacteria 3461
462 Ga0265323_10001501 3300028653 Bacteria 11409
463 Ga0265336_10000238 3300028666 Bacteria 39366
464 Ga0307517_10000460 3300028786 Bacteria 70026
465 Ga0307515_10022467 3300028794 Bacteria 11113
466 Ga0265338_10000278 3300028800 Bacteria 93010
467 Ga0265338_10015741 3300028800 Bacteria 8284
468 Ga0265324_10001755 3300029957 Bacteria 11922
469 Ga0307511_10087368 3300030521 Bacteria 2140
470 Ga0265328_10062648 3300031239 Bacteria 1366
471 Ga0265325_10035604 3300031241 Bacteria 2642
472 Ga0265339_10000080 3300031249 Bacteria 83570
473 Ga0265331_10062111 3300031250 Bacteria 1763
474 Ga0265327_10133407 3300031251 Bacteria 1166
475 Ga0307513_10108928 3300031456 Bacteria 2769
476 Ga0307509_10046806 3300031507 Bacteria 4654
477 Ga0265313_10000948 3300031595 Bacteria 28784
478 Ga0307508_10009068 3300031616 Bacteria 9164
479 Ga0307508_10072172 3300031616 Bacteria 3026
480 Ga0307508_10117091 3300031616 Bacteria 2266
481 Ga0307508_10138745 3300031616 Bacteria 2035
482 Ga0316576_10039580 3300031727 Bacteria 3385
483 Ga0307516_10020275 3300031730 Bacteria 6870
484 Ga0307516_10024100 3300031730 Bacteria 6220
485 Ga0307516_10097455 3300031730 Bacteria 2760
486 Ga0307413_10260066 3300031824 Bacteria 1293
487 Ga0307507_10094534 3300033179 Bacteria 2540
488 Ga0307510_10003787 3300033180 Bacteria 17693
489 Ga0307510_10015985 3300033180 Bacteria 8867
490 Ga0307510_10034065 3300033180 Bacteria 5709
491 Ga0307510_10034602 3300033180 Bacteria 5655
492 Ga0373934_0040432 3300035086 Bacteria 1839
493 Ga0373934_0084520 3300035086 Bacteria 1277
494 Ga0373923_0003366 3300035111 Bacteria 5114
495 Ga0373936_0032224 3300035113 Bacteria 2072
496 Ga0373954_0003572 3300035118 Bacteria 6607
497 Ga0373943_0110063 3300035170 Bacteria 1452
498 Ga0373946_0027530 3300035171 Bacteria 2249
499 Ga0373924_0007531 3300035410 Bacteria 3934
500 Ga0373931_0019668 3300035691 Bacteria 3372
501 Ga0373935_0000718 3300035692 Bacteria 17605
502 Ga0373927_0000666 3300035695 Bacteria 26107
503 Ga0373927_0028210 3300035695 Bacteria 3662
504 Ga0373927_0055244 3300035695 Bacteria 2568
505 Ga0373927_0083230 3300035695 Bacteria 2074
506 Ga0373927_0116554 3300035695 Bacteria 1742
507 Ga0373933_0016974 3300035724 Bacteria 4080
508 Ga0373947_0004761 3300035725 Bacteria 7952
509 Ga0373947_0007585 3300035725 Bacteria 6278
510 Ga0373937_0351720 3300036401 Bacteria 1396
511 Ga0373925_0005280 3300037068 Bacteria 9642
512 Ga0373925_0017463 3300037068 Bacteria 5201
513 Ga0373925_0108934 3300037068 Bacteria 2138
514 Ga0373925_0116855 3300037068 Bacteria 2067
515 Ga0395899_0139018 3300037312 Bacteria 1729
516 Ga0395900_0001340 3300037418 Bacteria 29756
517 Ga0395900_0040887 3300037418 Bacteria 4779
518 Ga0395900_0062560 3300037418 Bacteria 3826
519 Ga0395900_0215928 3300037418 Bacteria 1935
520 Ga0395898_0005324 3300037466 Bacteria 13909
521 Ga0395898_0018293 3300037466 Bacteria 7145
522 Ga0395905_0006516 3300037471 Bacteria 11740
523 Ga0395905_0393524 3300037471 Bacteria 1280
524 Ga0395901_0007542 3300038443 Bacteria 10989
525 Ga0395901_0043404 3300038443 Bacteria 4664
526 Ga0395901_0070968 3300038443 Bacteria 3629
527 Ga0395901_0106088 3300038443 Bacteria 2949
528 Ga0395901_0278347 3300038443 Bacteria 1739
529 Ga0436365_0009505 3300039437 Bacteria 114283
530 Ga0436365_0646338 3300039437 Bacteria 1288
531 Ga0436365_1302408 3300039437 Bacteria 3201
532 Ga0436362_0825075 3300039453 Bacteria 1455
533 Ga0451837_0551018 3300041494 Bacteria 914
534 Ga0439458_0010422 3300042157 Bacteria 2072
535 Ga0451577_0002389 3300042876 Bacteria 22482
536 Ga0453683_0008359 3300044673 Bacteria 6949
537 Ga0453684_0002985 3300044712 Bacteria 39370
538 Ga0453684_0004556 3300044712 Bacteria 29006
539 Ga0453684_0029755 3300044712 Bacteria 7740
540 Ga0453684_0434711 3300044712 Bacteria 1463
541 Ga0466957_0024632 3300044842 Bacteria 3563
542 Ga0466959_0065671 3300045049 Bacteria 2633
543 Ga0451576_0181107 3300045051 Bacteria 2200
544 Ga0451576_0551541 3300045051 Bacteria 1211
545 Ga0466967_0113558 3300045976 Bacteria 2492
546 Ga0466967_0127095 3300045976 Bacteria 2362
547 Ga0495592_0034591 3300046454 Bacteria 3809
548 Ga0495592_0142153 3300046454 Bacteria 1668
549 Ga0495603_0000206 3300046455 Bacteria 30433
550 Ga0495603_0069469 3300046455 Bacteria 2072
551 Ga0495603_0146188 3300046455 Bacteria 1374
552 Ga0495629_0000338 3300046459 Bacteria 40007
553 Ga0495638_0003637 3300046460 Bacteria 12027
554 Ga0495641_0005602 3300046461 Bacteria 8407
555 Ga0495653_0183846 3300046463 Bacteria 1432
556 Ga0495650_0048142 3300046471 Bacteria 1779
557 Ga0495580_0003372 3300046472 Bacteria 13653
558 Ga0495582_0000423 3300046473 Bacteria 23085
559 Ga0495582_0034111 3300046473 Bacteria 2798
560 Ga0495605_0034758 3300046474 Bacteria 2551
561 Ga0495639_0000039 3300046475 Bacteria 57380
562 Ga0495639_0026043 3300046475 Bacteria 2583
563 Ga0495664_0000847 3300046477 Bacteria 15732
564 Ga0495664_0009313 3300046477 Bacteria 5491
565 Ga0495664_0082926 3300046477 Bacteria 1923
566 Ga0495584_0054927 3300046491 Bacteria 2004
567 Ga0495585_0058241 3300046492 Bacteria 2131
568 Ga0495594_0006677 3300046499 Bacteria 5937
569 Ga0495594_0122324 3300046499 Bacteria 1471
570 Ga0495606_0001194 3300046507 Bacteria 36568
571 Ga0495606_0036283 3300046507 Bacteria 3359
572 Ga0495606_0073803 3300046507 Bacteria 2139
573 Ga0495610_0109050 3300046512 Bacteria 1229
574 Ga0495618_0003604 3300046514 Bacteria 9601
575 Ga0495628_0048999 3300046516 Bacteria 3346
576 Ga0495630_0024274 3300046517 Bacteria 4484
577 Ga0495630_0132772 3300046517 Bacteria 1891
578 Ga0495643_0008839 3300046522 Bacteria 6342
579 Ga0495644_0043687 3300046523 Bacteria 1686
580 Ga0495644_0044816 3300046523 Bacteria 1664
581 Ga0495648_0000536 3300046524 Bacteria 40969
582 Ga0495648_0012759 3300046524 Bacteria 6242
583 Ga0495663_0052662 3300046525 Bacteria 1264
584 Ga0495666_0007417 3300046526 Bacteria 5498
585 Ga0495652_0085687 3300046529 Bacteria 2588
586 Ga0495652_0113761 3300046529 Bacteria 2172
587 Ga0495665_0000082 3300046531 Bacteria 41861
588 Ga0495665_0084964 3300046531 Bacteria 1663
589 Ga0495640_0177856 3300046533 Bacteria 1357
590 Ga0495609_0077069 3300046538 Bacteria 1460
591 Ga0495645_0017895 3300046543 Bacteria 5085
592 Ga0495622_0011857 3300046557 Bacteria 4030
593 Ga0495622_0024190 3300046557 Bacteria 2836
594 Ga0495633_0015568 3300046558 Bacteria 3943
595 Ga0495667_0043015 3300046559 Bacteria 2994
596 Ga0495656_0007521 3300046615 Bacteria 3852
597 Ga0495656_0074139 3300046615 Bacteria 1519
598 Ga0495668_0116184 3300046616 Bacteria 1463
599 Ga0495634_0000776 3300046642 Bacteria 30917
600 Ga0495635_0009338 3300046663 Bacteria 6855
601 Ga0495659_0002499 3300046664 Bacteria 5935
602 Ga0495588_0033674 3300046674 Bacteria 2588
603 Ga0495657_0025940 3300046675 Bacteria 4157
604 Ga0495599_0012128 3300046678 Bacteria 5306
605 Ga0495623_0149613 3300046679 Bacteria 1381
606 Ga0495646_0137791 3300046680 Bacteria 1367
607 Ga0495658_0003324 3300046683 Bacteria 7978
608 Ga0495658_0004531 3300046683 Bacteria 6830
609 Ga0495669_0031299 3300046684 Bacteria 2336
610 Ga0495613_0016376 3300046689 Bacteria 5524
611 Ga0495624_0159753 3300046690 Bacteria 1377
612 Ga0495624_0165888 3300046690 Bacteria 1348
613 Ga0495624_0209447 3300046690 Bacteria 1183
614 Ga0495670_0068221 3300046691 Bacteria 1796
615 Ga0495649_0111470 3300046694 Bacteria 1451
616 Ga0495589_0202372 3300046794 Bacteria 937
617 Ga0495600_0100275 3300046809 Bacteria 1887
618 Ga0495581_0000006 3300047315 Bacteria 77433
619 Ga0495581_0010765 3300047315 Bacteria 5290
620 Ga0495604_0005606 3300047317 Bacteria 9957
621 Ga0495604_0102161 3300047317 Bacteria 2105
622 Ga0495636_0014126 3300047318 Bacteria 3175
623 Ga0495674_0012193 3300047319 Bacteria 8099
624 Ga0495672_0008439 3300047320 Bacteria 7604
625 Ga0495672_0037381 3300047320 Bacteria 2971
626 Ga0495680_0005494 3300047322 Bacteria 11908
627 Ga0495683_0132631 3300047323 Bacteria 1173
628 Ga0495675_0002994 3300047444 Bacteria 10142
629 Ga0495684_0001984 3300047471 Bacteria 16445
630 Ga0495684_0050956 3300047471 Bacteria 3160
631 Ga0495684_0109343 3300047471 Bacteria 2088
632 Ga0495593_0000032 3300047673 Bacteria 58862
633 Ga0495602_0039658 3300048088 Bacteria 4333
634 Ga0495614_0014894 3300048089 Bacteria 3397
635 Ga0496100_0018954 3300048903 Bacteria 4096
636 Ga0496101_0015301 3300048904 Bacteria 5167
637 Ga0496101_0151395 3300048904 Bacteria 1775
638 Ga0496101_0155163 3300048904 Bacteria 1753
639 Ga0496101_0174929 3300048904 Bacteria 1651
640 Ga0496102_0019308 3300048905 Bacteria 6005
641 Ga0496102_0334042 3300048905 Bacteria 1427
642 Ga0496103_0039846 3300048906 Bacteria 2887
643 Ga0496104_0031856 3300048907 Bacteria 4905
644 Ga0496104_0032721 3300048907 Bacteria 4840
645 Ga0496104_0173868 3300048907 Bacteria 2064
646 Ga0496104_0178162 3300048907 Bacteria 2036
647 Ga0496105_0059106 3300048908 Bacteria 3163
648 Ga0496106_0002364 3300048909 Bacteria 14037
649 Ga0496106_0020140 3300048909 Bacteria 4948
650 Ga0496106_0039179 3300048909 Bacteria 3549
651 Ga0496106_0158596 3300048909 Bacteria 1788
652 Ga0496106_0194625 3300048909 Bacteria 1612
653 Ga0496108_0020520 3300048911 Bacteria 5432
654 Ga0496108_0261238 3300048911 Bacteria 1507
655 Ga0496109_0088902 3300048912 Bacteria 2855
656 Ga0496109_0412342 3300048912 Bacteria 1276
657 Ga0496110_0554298 3300048913 Bacteria 1044
658 Ga0496111_0016061 3300048914 Bacteria 5153
659 Ga0496111_0021658 3300048914 Bacteria 4492
660 Ga0496111_0139669 3300048914 Bacteria 1795
661 Ga0496111_0452783 3300048914 Bacteria 947
662 Ga0496112_0000029 3300048915 Bacteria 122291
663 Ga0496112_0108628 3300048915 Bacteria 2744
664 Ga0496112_0440467 3300048915 Bacteria 1241
665 Ga0496113_0060918 3300048916 Bacteria 2846
666 Ga0496113_0068963 3300048916 Bacteria 2684
667 Ga0496113_0116139 3300048916 Bacteria 2088
668 Ga0496114_0042973 3300048917 Bacteria 3747
669 Ga0496114_0056894 3300048917 Bacteria 3265
670 Ga0496114_0269007 3300048917 Bacteria 1501
671 Ga0496114_0527816 3300048917 Bacteria 1044
672 Ga0496115_0006927 3300048918 Bacteria 8327
673 Ga0496115_0052564 3300048918 Bacteria 3269
674 Ga0496117_0016836 3300048920 Bacteria 6142
675 Ga0496118_0002319 3300048921 Bacteria 25849
676 Ga0496118_0032776 3300048921 Bacteria 4272
677 Ga0496120_0022972 3300048923 Bacteria 3911
678 Ga0496121_0000352 3300048924 Bacteria 95800
679 Ga0496121_0003091 3300048924 Bacteria 24094
680 Ga0496121_0018747 3300048924 Bacteria 6957
681 Ga0496121_0019666 3300048924 Bacteria 6739
682 Ga0496121_0085513 3300048924 Bacteria 2482
683 Ga0496121_0091056 3300048924 Bacteria 2382
684 Ga0496121_0120703 3300048924 Bacteria 1980
685 Ga0496121_0158117 3300048924 Bacteria 1660
686 Ga0496124_0001443 3300048927 Bacteria 35124
687 Ga0496124_0054966 3300048927 Bacteria 3367
688 Ga0496124_0107167 3300048927 Bacteria 2255
689 Ga0496125_0008186 3300048928 Bacteria 11004
690 Ga0496125_0026403 3300048928 Bacteria 5293
691 Ga0496125_0029894 3300048928 Bacteria 4885
692 Ga0496126_0003276 3300048929 Bacteria 20656
693 Ga0496126_0005702 3300048929 Bacteria 14109
694 Ga0496126_0013048 3300048929 Bacteria 8479
695 Ga0496126_0014279 3300048929 Bacteria 8036
696 Ga0496126_0016514 3300048929 Bacteria 7378
697 Ga0496126_0042845 3300048929 Bacteria 4178
698 Ga0496126_0051752 3300048929 Bacteria 3737
699 Ga0496126_0065029 3300048929 Bacteria 3265
700 Ga0496126_0206382 3300048929 Bacteria 1656
701 Ga0501031_0002569 3300049568 Bacteria 11569
702 Ga0501031_0008055 3300049568 Bacteria 6862
703 Ga0501032_0000301 3300049569 Bacteria 41571
704 Ga0501032_0005845 3300049569 Bacteria 9101
705 Ga0501032_0017725 3300049569 Bacteria 4999
706 Ga0501032_0030565 3300049569 Bacteria 3696
707 Ga0501032_0097679 3300049569 Bacteria 1946
708 Ga0501032_0282915 3300049569 Bacteria 1074
709 Ga0501033_0000270 3300049570 Bacteria 50079
710 Ga0501033_0001377 3300049570 Bacteria 21662
711 Ga0501033_0010053 3300049570 Bacteria 7264
712 Ga0501033_0080248 3300049570 Bacteria 2394
713 Ga0501034_0000715 3300049571 Bacteria 50444
714 Ga0501034_0030327 3300049571 Bacteria 5497
715 Ga0501036_0000043 3300049572 Bacteria 79310
716 Ga0501036_0000128 3300049572 Bacteria 48330
717 Ga0501036_0006458 3300049572 Bacteria 9524
718 Ga0501036_0007332 3300049572 Bacteria 8983
719 Ga0501036_0063189 3300049572 Bacteria 3135
720 Ga0501037_0000040 3300049573 Bacteria 119364
721 Ga0501037_0006378 3300049573 Bacteria 8627
722 Ga0501037_0006531 3300049573 Bacteria 8534
723 Ga0501037_0009276 3300049573 Bacteria 7215
724 Ga0501037_0051620 3300049573 Bacteria 3007
725 Ga0501037_0097398 3300049573 Bacteria 2125
726 Ga0501037_0247706 3300049573 Bacteria 1247
727 Ga0501038_0000131 3300049574 Bacteria 63880
728 Ga0501038_0000630 3300049574 Bacteria 31329
729 Ga0501038_0038383 3300049574 Bacteria 4194
730 Ga0501038_0198446 3300049574 Bacteria 1611
731 Ga0501039_0000106 3300049575 Bacteria 56453
732 Ga0501039_0006604 3300049575 Bacteria 8807
733 Ga0501039_0096394 3300049575 Bacteria 2306
734 Ga0501040_0068247 3300049576 Bacteria 2452
735 Ga0501041_0018507 3300049577 Bacteria 4150
736 Ga0501042_0159404 3300049578 Bacteria 1628
737 Ga0501042_0170445 3300049578 Bacteria 1570
738 Ga0501043_0000074 3300049579 Bacteria 87396
739 Ga0501043_0005735 3300049579 Bacteria 10004
740 Ga0501043_0036399 3300049579 Bacteria 3871
741 Ga0501046_0000074 3300049580 Bacteria 104319
742 Ga0501046_0005024 3300049580 Bacteria 11874
743 Ga0501046_0013483 3300049580 Bacteria 6919
744 Ga0501046_0014460 3300049580 Bacteria 6658
745 Ga0501047_0000346 3300049581 Bacteria 52545
746 Ga0501047_0020019 3300049581 Bacteria 6425
747 Ga0501047_0057626 3300049581 Bacteria 3756
748 Ga0501047_0078407 3300049581 Bacteria 3176
749 Ga0501048_0000349 3300049582 Bacteria 31934
750 Ga0501048_0000550 3300049582 Bacteria 26481
751 Ga0501048_0009855 3300049582 Bacteria 7163
752 Ga0501067_0007707 3300049583 Bacteria 5988
753 Ga0501067_0037192 3300049583 Bacteria 2704
754 Ga0501067_0118106 3300049583 Bacteria 1475
755 Ga0501068_0006614 3300049584 Bacteria 6397
756 Ga0501068_0021802 3300049584 Bacteria 3743
757 Ga0501068_0071766 3300049584 Bacteria 2114
758 Ga0501069_0003736 3300049585 Bacteria 7821
759 Ga0501069_0003813 3300049585 Bacteria 7756
760 Ga0501070_0005383 3300049586 Bacteria 10920
761 Ga0501070_0022234 3300049586 Bacteria 5312
762 Ga0501070_0046564 3300049586 Bacteria 3606
763 Ga0501070_0068726 3300049586 Bacteria 2933
764 Ga0501071_0220347 3300049587 Bacteria 1428
765 Ga0501072_0001372 3300049588 Bacteria 18281
766 Ga0501072_0002038 3300049588 Bacteria 15051
767 Ga0501073_0000085 3300049589 Bacteria 59315
768 Ga0501073_0004871 3300049589 Bacteria 10076
769 Ga0501073_0026762 3300049589 Bacteria 4130
770 Ga0501074_0000145 3300049590 Bacteria 36757
771 Ga0501074_0159786 3300049590 Bacteria 1609
772 Ga0501079_0001762 3300049741 Bacteria 15438
773 Ga0501079_0012601 3300049741 Bacteria 6457
774 Ga0501080_0005166 3300049742 Bacteria 11628
775 Ga0501080_0005596 3300049742 Bacteria 11228
776 Ga0501080_0093793 3300049742 Bacteria 2787
777 Ga0501080_0195710 3300049742 Bacteria 1857
778 Ga0501081_0228803 3300049743 Bacteria 1354
779 Ga0501083_0015067 3300049744 Bacteria 5411
780 Ga0501083_0015766 3300049744 Bacteria 5289
781 Ga0501083_0099940 3300049744 Bacteria 1913
782 Ga0501083_0117923 3300049744 Bacteria 1741
783 Ga0501035_0001345 3300049822 Bacteria 25323
784 Ga0501035_0002989 3300049822 Bacteria 16240
785 Ga0501035_0008293 3300049822 Bacteria 9678
786 Ga0501035_0013984 3300049822 Bacteria 7403
787 Ga0501035_0054696 3300049822 Bacteria 3565
788 Ga0501035_0301024 3300049822 Bacteria 1351
789 Ga0501035_0418591 3300049822 Bacteria 1112
790 Ga0501044_0000667 3300049823 Bacteria 41447
791 Ga0501044_0027021 3300049823 Bacteria 6072
792 Ga0501044_0032753 3300049823 Bacteria 5462
793 Ga0501044_0081071 3300049823 Bacteria 3285
794 Ga0501044_0083394 3300049823 Bacteria 3232
795 Ga0501044_0109258 3300049823 Bacteria 2775
796 Ga0501044_0165131 3300049823 Bacteria 2188
797 Ga0501044_0209343 3300049823 Bacteria 1905
798 Ga0501045_0003017 3300049824 Bacteria 11527
799 Ga0501045_0012743 3300049824 Bacteria 5923
800 Ga0501045_0137643 3300049824 Bacteria 1816
801 nmdc:mga03n38_1891_c1 3300050490 Bacteria 6265
802 nmdc:mga03n38_91863_c1 3300050490 Bacteria 1447
803 nmdc:mga00v17_135430_c1 3300050491 Bacteria 1577
804 nmdc:mga0yw44_134578_c1 3300050492 Bacteria 1603
805 nmdc:mga0yw44_222728_c1 3300050492 Bacteria 1251
806 nmdc:mga0yw44_63789_c1 3300050492 Bacteria 2266
807 nmdc:mga0k408_157748_c1 3300050493 Bacteria 1351
808 nmdc:mga0k408_35179_c1 3300050493 Bacteria 2872
809 nmdc:mga0k408_60795_c1 3300050493 Bacteria 2196
810 nmdc:mga0k408_65696_c1 3300050493 Bacteria 2112
811 nmdc:mga06z11_27139_c1 3300050494 Bacteria 2735
812 nmdc:mga06z11_54543_c1 3300050494 Bacteria 2061
813 nmdc:mga04h51_3952_c1 3300050495 Bacteria 3649
814 nmdc:mga08y16_382969_c1 3300050511 Bacteria 1441
815 nmdc:mga0n895_227122_c1 3300050512 Bacteria 1895
816 nmdc:mga0n895_357578_c1 3300050512 Bacteria 1479
817 nmdc:mga0n895_4726_c1 3300050512 Bacteria 11245
818 nmdc:mga08x19_67652_c1 3300050514 Bacteria 2324
819 nmdc:mga0sz30_12669_c1 3300050516 Bacteria 3284
820 nmdc:mga0sz30_18835_c1 3300050516 Bacteria 2767
821 nmdc:mga0sz30_28201_c1 3300050516 Bacteria 2054
822 Ga0495601_0085301 3300053077 Bacteria 2029
823 Ga0500635_0012868 3300053080 Bacteria 2415
824 Ga0500643_000443 3300053087 Bacteria 30999
825 Ga0500647_0023852 3300053091 Bacteria 2874
826 Ga0500566_0000270 3300053094 Bacteria 27957
827 Ga0500566_0000780 3300053094 Bacteria 18033
828 Ga0500566_0014575 3300053094 Bacteria 4619
829 Ga0500641_0008048 3300053096 Bacteria 3758
830 Ga0500641_0008602 3300053096 Bacteria 3648
831 Ga0500641_0109731 3300053096 Bacteria 1187
832 Ga0500555_023586 3300053103 Bacteria 1764
833 Ga0500556_0004536 3300053104 Bacteria 3952
834 Ga0500556_0099071 3300053104 Bacteria 1121
835 Ga0500572_001115 3300053111 Bacteria 7839
836 Ga0500594_0043603 3300053118 Bacteria 1238
837 Ga0500595_000328 3300053119 Bacteria 31283
838 Ga0500595_001866 3300053119 Bacteria 10887
839 Ga0500595_012540 3300053119 Bacteria 3275
840 Ga0500614_001182 3300053123 Bacteria 6395
841 Ga0500617_115703 3300053124 Bacteria 1114
842 Ga0500559_0001813 3300053136 Bacteria 11672
843 Ga0500564_146053 3300053138 Bacteria 1011
844 Ga0500568_0084481 3300053139 Bacteria 1202
845 Ga0500573_0017246 3300053140 Bacteria 4109
846 Ga0500577_0030140 3300053142 Bacteria 1885
847 Ga0500588_0009801 3300053146 Bacteria 2291
848 Ga0500603_000151 3300053150 Bacteria 17010
849 Ga0500603_008750 3300053150 Bacteria 2255
850 Ga0500616_0053704 3300053153 Bacteria 2113
851 Ga0500622_0092915 3300053156 Bacteria 1494
852 Ga0500638_057307 3300053162 Bacteria 1876
853 Ga0500639_000065 3300053163 Bacteria 48250
854 Ga0500636_0000584 3300053177 Bacteria 19957
855 Ga0500636_0023297 3300053177 Bacteria 3661
856 Ga0500637_0000413 3300053178 Bacteria 16315
857 Ga0500637_0090652 3300053178 Bacteria 1770
858 Ga0500637_0157770 3300053178 Bacteria 1308
859 Ga0500645_025589 3300053730 Bacteria 1800
860 Ga0500645_054165 3300053730 Bacteria 1167
861 Ga0500596_000494 3300053735 Bacteria 7393
862 Ga0500599_000161 3300053736 Bacteria 6110
863 Ga0500601_000483 3300053737 Bacteria 6200
864 Ga0501084_0002085 3300054114 Bacteria 15967
865 Ga0501084_0003469 3300054114 Bacteria 12809
866 Ga0501082_0018999 3300060353 Bacteria 5921
867 Ga0501082_0033487 3300060353 Bacteria 4433
868 Ga0501082_0087916 3300060353 Bacteria 2681

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047471 Ga0495684_0050956 Ga0495684_0050956_308_1216 226
2 3300005456 Ga0070678_100106912 Ga0070678_1001069122 231
3 3300005578 Ga0068854_100150904 Ga0068854_1001509042 231
4 3300005616 Ga0068852_100005759 Ga0068852_1000057593 231
5 3300025911 Ga0207654_10041873 Ga0207654_100418733 231
6 3300005355 Ga0070671_100017669 Ga0070671_1000176696 232
7 3300005548 Ga0070665_100102324 Ga0070665_1001023243 232
8 3300006048 Ga0075363_100017335 Ga0075363_1000173353 232
9 3300006353 Ga0075370_10034039 Ga0075370_100340393 232
10 3300009545 Ga0105237_10045694 Ga0105237_100456945 232
11 3300010375 Ga0105239_10065141 Ga0105239_100651413 232
12 3300013297 Ga0157378_10454106 Ga0157378_104541061 232
13 3300025304 Ga0209257_1008387 Ga0209257_10083873 232
14 3300025901 Ga0207688_10072127 Ga0207688_100721272 232
15 3300025914 Ga0207671_10061668 Ga0207671_100616682 232
16 3300025972 Ga0207668_10117302 Ga0207668_101173022 232
17 3300026067 Ga0207678_10162783 Ga0207678_101627832 232
18 3300026067 Ga0207678_10198830 Ga0207678_101988301 232
19 3300028379 Ga0268266_10190963 Ga0268266_101909632 232
20 3300046522 Ga0495643_0008839 Ga0495643_0008839_4350_5261 232
21 3300046616 Ga0495668_0116184 Ga0495668_0116184_27_938 232
22 3300048916 Ga0496113_0068963 Ga0496113_0068963_858_1769 232
23 3300048928 Ga0496125_0029894 Ga0496125_0029894_1355_2266 232
24 3300050490 nmdc:mga03n38_91863_c1 nmdc:mga03n38_91863_c1_521_1426 232
25 3300050492 nmdc:mga0yw44_222728_c1 nmdc:mga0yw44_222728_c1_11_922 232
26 3300050493 nmdc:mga0k408_35179_c1 nmdc:mga0k408_35179_c1_673_1584 232
27 3300046690 Ga0495624_0209447 Ga0495624_0209447_100_1005 234
28 3300046454 Ga0495592_0142153 Ga0495592_0142153_457_1365 235
29 3300046463 Ga0495653_0183846 Ga0495653_0183846_390_1298 235
30 3300046529 Ga0495652_0085687 Ga0495652_0085687_1470_2378 235
31 3300046559 Ga0495667_0043015 Ga0495667_0043015_1503_2411 235
32 3300046675 Ga0495657_0025940 Ga0495657_0025940_486_1394 235
33 3300046679 Ga0495623_0149613 Ga0495623_0149613_270_1178 235
34 3300046809 Ga0495600_0100275 Ga0495600_0100275_219_1127 235
35 3300047317 Ga0495604_0005606 Ga0495604_0005606_7614_8522 235
36 3300047322 Ga0495680_0005494 Ga0495680_0005494_5068_5976 235
37 3300047444 Ga0495675_0002994 Ga0495675_0002994_309_1217 235
38 3300048088 Ga0495602_0039658 Ga0495602_0039658_3012_3920 235
39 3300053730 Ga0500645_025589 Ga0500645_025589_389_1300 238
40 3300021361 Ga0213872_10022702 Ga0213872_100227022 240
41 3300033180 Ga0307510_10015985 Ga0307510_100159853 240
42 3300046664 Ga0495659_0002499 Ga0495659_0002499_4686_5615 240
43 3300009177 Ga0105248_10512173 Ga0105248_105121732 241
44 3300053103 Ga0500555_023586 Ga0500555_023586_348_1259 241
45 3300053118 Ga0500594_0043603 Ga0500594_0043603_213_1124 241
46 iso_pu_bacteria 8019586578 8019594086 241
47 3300028379 Ga0268266_10252527 Ga0268266_102525272 242
48 3300047471 Ga0495684_0109343 Ga0495684_0109343_623_1471 243
49 3300049742 Ga0501080_0093793 Ga0501080_0093793_318_1235 243
50 iso_pu_bacteria 2842775625 2842778407 243
51 3300009174 Ga0105241_10104105 Ga0105241_101041052 244
52 3300025911 Ga0207654_10009059 Ga0207654_100090592 244
53 3300025940 Ga0207691_10192500 Ga0207691_101925002 244
54 3300053087 Ga0500643_000443 Ga0500643_000443_20437_21348 244
55 3300053104 Ga0500556_0004536 Ga0500556_0004536_1618_2529 244
56 3300037418 Ga0395900_0001340 Ga0395900_0001340_3969_4874 245
57 3300037466 Ga0395898_0005324 Ga0395898_0005324_9078_9983 245
58 3300038443 Ga0395901_0007542 Ga0395901_0007542_3998_4903 245
59 3300042876 Ga0451577_0002389 Ga0451577_0002389_2903_3775 245
60 3300044712 Ga0453684_0004556 Ga0453684_0004556_12155_13027 245
61 3300045051 Ga0451576_0181107 Ga0451576_0181107_401_1273 245
62 3300049572 Ga0501036_0000128 Ga0501036_0000128_8997_9887 245
63 3300049822 Ga0501035_0002989 Ga0501035_0002989_7714_8604 245
64 3300006028 Ga0070717_10073105 Ga0070717_100731052 246
65 3300010159 Ga0099796_10023122 Ga0099796_100231222 246
66 3300025302 Ga0207426_1008081 Ga0207426_10080812 246
67 3300031727 Ga0316576_10039580 Ga0316576_100395803 246
68 3300048907 Ga0496104_0173868 Ga0496104_0173868_482_1393 246
69 3300049568 Ga0501031_0002569 Ga0501031_0002569_6863_7780 246
70 3300049569 Ga0501032_0000301 Ga0501032_0000301_35717_36634 246
71 3300049570 Ga0501033_0000270 Ga0501033_0000270_29016_29933 246
72 3300049571 Ga0501034_0000715 Ga0501034_0000715_13301_14218 246
73 3300049572 Ga0501036_0000043 Ga0501036_0000043_6718_7635 246
74 3300049573 Ga0501037_0000040 Ga0501037_0000040_87249_88166 246
75 3300049574 Ga0501038_0000131 Ga0501038_0000131_35746_36663 246
76 3300049575 Ga0501039_0000106 Ga0501039_0000106_38925_39842 246
77 3300049579 Ga0501043_0000074 Ga0501043_0000074_11627_12544 246
78 3300049580 Ga0501046_0000074 Ga0501046_0000074_76549_77466 246
79 3300049581 Ga0501047_0000346 Ga0501047_0000346_31806_32723 246
80 3300049582 Ga0501048_0000349 Ga0501048_0000349_11880_12797 246
81 3300049584 Ga0501068_0021802 Ga0501068_0021802_1924_2841 246
82 3300049585 Ga0501069_0003736 Ga0501069_0003736_3270_4187 246
83 3300049586 Ga0501070_0005383 Ga0501070_0005383_4165_5082 246
84 3300049588 Ga0501072_0001372 Ga0501072_0001372_824_1741 246
85 3300049589 Ga0501073_0000085 Ga0501073_0000085_35939_36856 246
86 3300049590 Ga0501074_0000145 Ga0501074_0000145_29368_30285 246
87 3300049742 Ga0501080_0005596 Ga0501080_0005596_6971_7888 246
88 3300049744 Ga0501083_0015067 Ga0501083_0015067_3618_4535 246
89 3300049822 Ga0501035_0001345 Ga0501035_0001345_11414_12331 246
90 3300049823 Ga0501044_0000667 Ga0501044_0000667_4810_5727 246
91 3300049824 Ga0501045_0012743 Ga0501045_0012743_4453_5370 246
92 3300053096 Ga0500641_0008602 Ga0500641_0008602_447_1433 246
93 3300053162 Ga0500638_057307 Ga0500638_057307_602_1513 246
94 3300053177 Ga0500636_0000584 Ga0500636_0000584_1517_2428 246
95 3300053737 Ga0500601_000483 Ga0500601_000483_3722_4633 246
96 3300054114 Ga0501084_0002085 Ga0501084_0002085_3585_4502 246
97 3300060353 Ga0501082_0018999 Ga0501082_0018999_1340_2257 246
98 3300002070 JGI24750J21931_1003497 JGI24750J21931_10034972 247
99 3300002077 JGI24744J21845_10006597 JGI24744J21845_100065972 247
100 3300003659 JGI25404J52841_10000278 JGI25404J52841_100002782 247
101 3300003659 JGI25404J52841_10011990 JGI25404J52841_100119901 247
102 3300005328 Ga0070676_10016539 Ga0070676_100165394 247
103 3300005340 Ga0070689_100027366 Ga0070689_1000273663 247
104 3300005345 Ga0070692_10032810 Ga0070692_100328103 247
105 3300005347 Ga0070668_100003914 Ga0070668_1000039142 247
106 3300005365 Ga0070688_100017655 Ga0070688_1000176555 247
107 3300005366 Ga0070659_100072567 Ga0070659_1000725673 247
108 3300005406 Ga0070703_10067958 Ga0070703_100679582 247
109 3300005457 Ga0070662_100134192 Ga0070662_1001341922 247
110 3300005459 Ga0068867_100029064 Ga0068867_1000290642 247
111 3300005543 Ga0070672_100005802 Ga0070672_1000058022 247
112 3300005544 Ga0070686_100014547 Ga0070686_1000145474 247
113 3300005549 Ga0070704_100044331 Ga0070704_1000443314 247
114 3300005564 Ga0070664_100096036 Ga0070664_1000960362 247
115 3300005577 Ga0068857_100064583 Ga0068857_1000645833 247
116 3300005578 Ga0068854_100026612 Ga0068854_1000266122 247
117 3300005618 Ga0068864_100047366 Ga0068864_1000473662 247
118 3300005719 Ga0068861_100136558 Ga0068861_1001365582 247
119 3300005834 Ga0068851_10054937 Ga0068851_100549372 247
120 3300005842 Ga0068858_100004448 Ga0068858_1000044487 247
121 3300005843 Ga0068860_100012696 Ga0068860_1000126964 247
122 3300005844 Ga0068862_100006134 Ga0068862_1000061345 247
123 3300005983 Ga0081540_1000128 Ga0081540_100012864 247
124 3300005983 Ga0081540_1016667 Ga0081540_10166672 247
125 3300006175 Ga0070712_100005941 Ga0070712_1000059412 247
126 3300006358 Ga0068871_100081737 Ga0068871_1000817372 247
127 3300006881 Ga0068865_100070580 Ga0068865_1000705802 247
128 3300006914 Ga0075436_100009187 Ga0075436_1000091873 247
129 3300025901 Ga0207688_10001503 Ga0207688_100015035 247
130 3300025907 Ga0207645_10012744 Ga0207645_100127445 247
131 3300025919 Ga0207657_10012048 Ga0207657_100120485 247
132 3300025926 Ga0207659_10046382 Ga0207659_100463824 247
133 3300025933 Ga0207706_10002700 Ga0207706_100027005 247
134 3300025940 Ga0207691_10002238 Ga0207691_100022389 247
135 3300025942 Ga0207689_10012288 Ga0207689_100122884 247
136 3300025981 Ga0207640_10138490 Ga0207640_101384902 247
137 3300026089 Ga0207648_10008717 Ga0207648_100087177 247
138 3300026095 Ga0207676_10005493 Ga0207676_100054932 247
139 3300026118 Ga0207675_100001986 Ga0207675_10000198619 247
140 3300046690 Ga0495624_0165888 Ga0495624_0165888_122_997 247
141 3300050512 nmdc:mga0n895_4726_c1 nmdc:mga0n895_4726_c1_4242_5102 247
142 3300050514 nmdc:mga08x19_67652_c1 nmdc:mga08x19_67652_c1_325_1185 247
143 3300053138 Ga0500564_146053 Ga0500564_146053_32_943 247
144 3300005546 Ga0070696_100024651 Ga0070696_1000246513 248
145 3300009101 Ga0105247_10178817 Ga0105247_101788172 248
146 3300025297 Ga0209758_1001347 Ga0209758_100134710 248
147 3300028379 Ga0268266_10117706 Ga0268266_101177062 248
148 3300049569 Ga0501032_0017725 Ga0501032_0017725_2480_3382 248
149 3300049572 Ga0501036_0006458 Ga0501036_0006458_3396_4298 248
150 3300049573 Ga0501037_0051620 Ga0501037_0051620_1038_1940 248
151 3300049576 Ga0501040_0068247 Ga0501040_0068247_924_1826 248
152 3300049579 Ga0501043_0005735 Ga0501043_0005735_1889_2791 248
153 3300049580 Ga0501046_0014460 Ga0501046_0014460_5002_5904 248
154 3300049581 Ga0501047_0078407 Ga0501047_0078407_755_1657 248
155 3300049582 Ga0501048_0009855 Ga0501048_0009855_1553_2455 248
156 3300049585 Ga0501069_0003813 Ga0501069_0003813_6065_6967 248
157 3300049741 Ga0501079_0001762 Ga0501079_0001762_6526_7428 248
158 3300049822 Ga0501035_0054696 Ga0501035_0054696_1095_1997 248
159 3300049823 Ga0501044_0081071 Ga0501044_0081071_1807_2709 248
160 3300053730 Ga0500645_054165 Ga0500645_054165_52_927 248
161 3300054114 Ga0501084_0003469 Ga0501084_0003469_11151_12053 248
162 3300060353 Ga0501082_0033487 Ga0501082_0033487_2520_3422 248
163 3300005337 Ga0070682_100174131 Ga0070682_1001741312 249
164 3300005353 Ga0070669_100000033 Ga0070669_10000003324 249
165 3300005937 Ga0081455_10092032 Ga0081455_100920323 249
166 3300025923 Ga0207681_10000011 Ga0207681_10000011203 249
167 3300046517 Ga0495630_0024274 Ga0495630_0024274_1327_2175 249
168 3300046524 Ga0495648_0000536 Ga0495648_0000536_21408_22283 249
169 3300049568 Ga0501031_0008055 Ga0501031_0008055_1380_2282 249
170 3300049569 Ga0501032_0005845 Ga0501032_0005845_6539_7441 249
171 3300049570 Ga0501033_0001377 Ga0501033_0001377_9822_10724 249
172 3300049572 Ga0501036_0007332 Ga0501036_0007332_311_1213 249
173 3300049573 Ga0501037_0006531 Ga0501037_0006531_4504_5406 249
174 3300049574 Ga0501038_0198446 Ga0501038_0198446_630_1532 249
175 3300049575 Ga0501039_0096394 Ga0501039_0096394_598_1500 249
176 3300049580 Ga0501046_0005024 Ga0501046_0005024_3129_4031 249
177 3300049581 Ga0501047_0020019 Ga0501047_0020019_192_1094 249
178 3300049582 Ga0501048_0000550 Ga0501048_0000550_3549_4451 249
179 3300049583 Ga0501067_0007707 Ga0501067_0007707_393_1295 249
180 3300049584 Ga0501068_0006614 Ga0501068_0006614_3419_4321 249
181 3300049586 Ga0501070_0022234 Ga0501070_0022234_2942_3844 249
182 3300049589 Ga0501073_0004871 Ga0501073_0004871_8943_9845 249
183 3300049590 Ga0501074_0159786 Ga0501074_0159786_231_1133 249
184 3300049741 Ga0501079_0012601 Ga0501079_0012601_3357_4259 249
185 3300049742 Ga0501080_0005166 Ga0501080_0005166_3129_4031 249
186 3300049744 Ga0501083_0015766 Ga0501083_0015766_457_1359 249
187 3300049822 Ga0501035_0008293 Ga0501035_0008293_2953_3855 249
188 3300049824 Ga0501045_0003017 Ga0501045_0003017_9775_10677 249
189 3300060353 Ga0501082_0087916 Ga0501082_0087916_614_1516 249
190 3300003781 Ga0055536_1008613 Ga0055536_10086132 250
191 3300005466 Ga0070685_10049514 Ga0070685_100495142 250
192 3300005548 Ga0070665_100078792 Ga0070665_1000787924 250
193 3300005844 Ga0068862_100002580 Ga0068862_1000025809 250
194 3300005983 Ga0081540_1001299 Ga0081540_100129917 250
195 3300009177 Ga0105248_10082009 Ga0105248_100820092 250
196 3300014968 Ga0157379_10355752 Ga0157379_103557521 250
197 3300025292 Ga0209676_1000284 Ga0209676_1000284100 250
198 3300025298 Ga0209050_1016402 Ga0209050_10164023 250
199 3300025941 Ga0207711_10000469 Ga0207711_1000046939 250
200 3300028379 Ga0268266_10023222 Ga0268266_100232222 250
201 3300028380 Ga0268265_10000404 Ga0268265_1000040422 250
202 3300028786 Ga0307517_10000460 Ga0307517_1000046028 250
203 3300028794 Ga0307515_10022467 Ga0307515_100224676 250
204 3300037312 Ga0395899_0139018 Ga0395899_0139018_273_1142 250
205 3300037418 Ga0395900_0215928 Ga0395900_0215928_750_1619 250
206 3300044712 Ga0453684_0029755 Ga0453684_0029755_4391_5248 250
207 3300046475 Ga0495639_0026043 Ga0495639_0026043_380_1255 250
208 3300048915 Ga0496112_0000029 Ga0496112_0000029_78735_79604 250
209 3300049581 Ga0501047_0057626 Ga0501047_0057626_1890_2759 250
210 3300005335 Ga0070666_10243708 Ga0070666_102437081 251
211 3300005353 Ga0070669_100000387 Ga0070669_10000038729 251
212 3300005355 Ga0070671_100000012 Ga0070671_10000001255 251
213 3300005365 Ga0070688_100004706 Ga0070688_1000047065 251
214 3300005367 Ga0070667_100000279 Ga0070667_10000027955 251
215 3300005458 Ga0070681_10061629 Ga0070681_100616292 251
216 3300005458 Ga0070681_10308969 Ga0070681_103089692 251
217 3300005466 Ga0070685_10000001 Ga0070685_1000000150 251
218 3300005530 Ga0070679_100076591 Ga0070679_1000765912 251
219 3300005563 Ga0068855_100034408 Ga0068855_1000344083 251
220 3300005618 Ga0068864_100000018 Ga0068864_100000018175 251
221 3300005618 Ga0068864_100663065 Ga0068864_1006630651 251
222 3300005841 Ga0068863_100630285 Ga0068863_1006302851 251
223 3300005843 Ga0068860_100000456 Ga0068860_10000045637 251
224 3300005983 Ga0081540_1012898 Ga0081540_10128985 251
225 3300009093 Ga0105240_10008157 Ga0105240_100081577 251
226 3300009101 Ga0105247_10101322 Ga0105247_101013221 251
227 3300013105 Ga0157369_10496025 Ga0157369_104960252 251
228 3300014325 Ga0163163_10000069 Ga0163163_1000006954 251
229 3300025900 Ga0207710_10014586 Ga0207710_100145863 251
230 3300025903 Ga0207680_10100912 Ga0207680_101009122 251
231 3300025912 Ga0207707_10045342 Ga0207707_100453422 251
232 3300025913 Ga0207695_10075958 Ga0207695_100759583 251
233 3300025917 Ga0207660_10207998 Ga0207660_102079982 251
234 3300025921 Ga0207652_10201178 Ga0207652_102011782 251
235 3300025923 Ga0207681_10001220 Ga0207681_1000122010 251
236 3300025925 Ga0207650_10000003 Ga0207650_10000003382 251
237 3300025931 Ga0207644_10000036 Ga0207644_10000036121 251
238 3300025986 Ga0207658_10000007 Ga0207658_10000007171 251
239 3300026088 Ga0207641_10099781 Ga0207641_100997812 251
240 3300026095 Ga0207676_10000003 Ga0207676_10000003713 251
241 3300026095 Ga0207676_10023076 Ga0207676_100230761 251
242 3300026116 Ga0207674_10217126 Ga0207674_102171262 251
243 3300028379 Ga0268266_10576138 Ga0268266_105761381 251
244 3300028381 Ga0268264_10000009 Ga0268264_10000009279 251
245 3300028800 Ga0265338_10015741 Ga0265338_100157414 251
246 3300031241 Ga0265325_10035604 Ga0265325_100356042 251
247 3300031249 Ga0265339_10000080 Ga0265339_1000008056 251
248 3300031595 Ga0265313_10000948 Ga0265313_1000094821 251
249 3300044712 Ga0453684_0002985 Ga0453684_0002985_29613_30485 251
250 3300044712 Ga0453684_0434711 Ga0453684_0434711_475_1362 251
251 3300046512 Ga0495610_0109050 Ga0495610_0109050_31_900 251
252 3300047320 Ga0495672_0037381 Ga0495672_0037381_402_1364 251
253 3300049583 Ga0501067_0118106 Ga0501067_0118106_70_942 251
254 3300049588 Ga0501072_0002038 Ga0501072_0002038_2306_3202 251
255 3300049744 Ga0501083_0099940 Ga0501083_0099940_564_1460 251
256 3300049744 Ga0501083_0117923 Ga0501083_0117923_130_1026 251
257 3300050493 nmdc:mga0k408_157748_c1 nmdc:mga0k408_157748_c1_71_1030 251
258 3300050512 nmdc:mga0n895_357578_c1 nmdc:mga0n895_357578_c1_342_1217 251
259 iso_pu_bacteria 2513237087 2513592443 251
260 3300005354 Ga0070675_100061546 Ga0070675_1000615462 252
261 3300005364 Ga0070673_100076660 Ga0070673_1000766602 252
262 3300005435 Ga0070714_100212996 Ga0070714_1002129962 252
263 3300005436 Ga0070713_100041867 Ga0070713_1000418672 252
264 3300005437 Ga0070710_10017525 Ga0070710_100175254 252
265 3300005539 Ga0068853_100086846 Ga0068853_1000868462 252
266 3300005563 Ga0068855_100098198 Ga0068855_1000981983 252
267 3300006163 Ga0070715_10024687 Ga0070715_100246872 252
268 3300006175 Ga0070712_100005151 Ga0070712_1000051515 252
269 3300009545 Ga0105237_10046343 Ga0105237_100463433 252
270 3300010375 Ga0105239_10031806 Ga0105239_100318062 252
271 3300013296 Ga0157374_10077659 Ga0157374_100776593 252
272 3300021384 Ga0213876_10000477 Ga0213876_1000047721 252
273 3300025898 Ga0207692_10023181 Ga0207692_100231812 252
274 3300025915 Ga0207693_10007398 Ga0207693_100073988 252
275 3300025916 Ga0207663_10009571 Ga0207663_100095715 252
276 3300025919 Ga0207657_10280914 Ga0207657_102809142 252
277 3300025924 Ga0207694_10029183 Ga0207694_100291834 252
278 3300025928 Ga0207700_10301374 Ga0207700_103013742 252
279 3300025940 Ga0207691_10329244 Ga0207691_103292442 252
280 3300025949 Ga0207667_10084423 Ga0207667_100844232 252
281 3300026089 Ga0207648_10201861 Ga0207648_102018612 252
282 3300031456 Ga0307513_10108928 Ga0307513_101089282 252
283 3300035113 Ga0373936_0032224 Ga0373936_0032224_510_1478 252
284 3300037471 Ga0395905_0006516 Ga0395905_0006516_2957_3865 252
285 3300038443 Ga0395901_0070968 Ga0395901_0070968_1040_1948 252
286 3300039437 Ga0436365_0009505 Ga0436365_0009505_28418_29293 252
287 3300041494 Ga0451837_0551018 Ga0451837_0551018_33_884 252
288 3300044673 Ga0453683_0008359 Ga0453683_0008359_3807_4649 252
289 3300046523 Ga0495644_0044816 Ga0495644_0044816_275_1219 252
290 3300048911 Ga0496108_0261238 Ga0496108_0261238_355_1224 252
291 3300048918 Ga0496115_0052564 Ga0496115_0052564_723_1628 252
292 3300048929 Ga0496126_0014279 Ga0496126_0014279_2973_3869 252
293 3300049569 Ga0501032_0097679 Ga0501032_0097679_301_1170 252
294 3300049569 Ga0501032_0282915 Ga0501032_0282915_119_988 252
295 3300049570 Ga0501033_0010053 Ga0501033_0010053_2729_3598 252
296 3300049570 Ga0501033_0080248 Ga0501033_0080248_764_1633 252
297 3300049571 Ga0501034_0030327 Ga0501034_0030327_3447_4316 252
298 3300049572 Ga0501036_0063189 Ga0501036_0063189_1093_1962 252
299 3300049573 Ga0501037_0006378 Ga0501037_0006378_5387_6256 252
300 3300049573 Ga0501037_0247706 Ga0501037_0247706_19_888 252
301 3300049574 Ga0501038_0000630 Ga0501038_0000630_24985_25854 252
302 3300049574 Ga0501038_0038383 Ga0501038_0038383_302_1171 252
303 3300049575 Ga0501039_0006604 Ga0501039_0006604_2322_3191 252
304 3300049577 Ga0501041_0018507 Ga0501041_0018507_2342_3211 252
305 3300049578 Ga0501042_0170445 Ga0501042_0170445_94_963 252
306 3300049579 Ga0501043_0036399 Ga0501043_0036399_886_1755 252
307 3300049580 Ga0501046_0013483 Ga0501046_0013483_2365_3234 252
308 3300049584 Ga0501068_0071766 Ga0501068_0071766_143_1012 252
309 3300049589 Ga0501073_0026762 Ga0501073_0026762_1508_2377 252
310 3300049742 Ga0501080_0195710 Ga0501080_0195710_250_1119 252
311 3300049743 Ga0501081_0228803 Ga0501081_0228803_409_1326 252
312 3300049822 Ga0501035_0013984 Ga0501035_0013984_6172_7041 252
313 3300049822 Ga0501035_0301024 Ga0501035_0301024_31_885 252
314 3300049823 Ga0501044_0027021 Ga0501044_0027021_751_1620 252
315 3300049823 Ga0501044_0032753 Ga0501044_0032753_36_905 252
316 3300049824 Ga0501045_0137643 Ga0501045_0137643_388_1257 252
317 3300050492 nmdc:mga0yw44_63789_c1 nmdc:mga0yw44_63789_c1_450_1355 252
318 3300053094 Ga0500566_0000780 Ga0500566_0000780_12797_13708 252
319 iso_pu_bacteria 8016603502 8016605596 252
320 3300002067 JGI24735J21928_10038218 JGI24735J21928_100382182 253
321 3300003215 JGI25153J46596_10002696 JGI25153J46596_1000269610 253
322 3300003762 Ga0055542_1006533 Ga0055542_10065332 253
323 3300003794 Ga0055531_10031132 Ga0055531_100311322 253
324 3300005262 Ga0065165_1002667 Ga0065165_10026679 253
325 3300005262 Ga0065165_1013580 Ga0065165_10135803 253
326 3300005347 Ga0070668_100076766 Ga0070668_1000767663 253
327 3300005354 Ga0070675_100589391 Ga0070675_1005893911 253
328 3300005455 Ga0070663_100018265 Ga0070663_1000182654 253
329 3300005457 Ga0070662_100140170 Ga0070662_1001401702 253
330 3300005467 Ga0070706_100219916 Ga0070706_1002199162 253
331 3300005578 Ga0068854_100354045 Ga0068854_1003540452 253
332 3300005614 Ga0068856_100062045 Ga0068856_1000620452 253
333 3300005616 Ga0068852_100064924 Ga0068852_1000649243 253
334 3300005618 Ga0068864_100261239 Ga0068864_1002612392 253
335 3300006042 Ga0075368_10001639 Ga0075368_100016392 253
336 3300006358 Ga0068871_100195541 Ga0068871_1001955412 253
337 3300009093 Ga0105240_10005310 Ga0105240_100053109 253
338 3300009177 Ga0105248_10042837 Ga0105248_100428374 253
339 3300009553 Ga0105249_10471740 Ga0105249_104717402 253
340 3300010375 Ga0105239_10234595 Ga0105239_102345952 253
341 3300013297 Ga0157378_10063588 Ga0157378_100635882 253
342 3300025253 Ga0209677_102608 Ga0209677_1026083 253
343 3300025254 Ga0209148_1001000 Ga0209148_100100010 253
344 3300025261 Ga0209233_1002990 Ga0209233_10029903 253
345 3300025261 Ga0209233_1009100 Ga0209233_10091003 253
346 3300025272 Ga0209455_1001389 Ga0209455_10013896 253
347 3300025272 Ga0209455_1010687 Ga0209455_10106872 253
348 3300025272 Ga0209455_1015147 Ga0209455_10151472 253
349 3300025295 Ga0209564_1013028 Ga0209564_10130282 253
350 3300025297 Ga0209758_1000206 Ga0209758_100020673 253
351 3300025302 Ga0207426_1003234 Ga0207426_10032343 253
352 3300025302 Ga0207426_1030869 Ga0207426_10308692 253
353 3300025304 Ga0209257_1000394 Ga0209257_100039473 253
354 3300025900 Ga0207710_10084508 Ga0207710_100845082 253
355 3300025905 Ga0207685_10041278 Ga0207685_100412782 253
356 3300025913 Ga0207695_10000006 Ga0207695_10000006653 253
357 3300025924 Ga0207694_10360648 Ga0207694_103606482 253
358 3300025949 Ga0207667_10174101 Ga0207667_101741011 253
359 3300025972 Ga0207668_10111939 Ga0207668_101119392 253
360 3300026067 Ga0207678_10079165 Ga0207678_100791653 253
361 3300027296 Ga0209389_1000039 Ga0209389_100003949 253
362 3300027361 Ga0209489_100087 Ga0209489_10008749 253
363 3300027363 Ga0209700_100090 Ga0209700_10009068 253
364 3300031824 Ga0307413_10260066 Ga0307413_102600661 253
365 3300035170 Ga0373943_0110063 Ga0373943_0110063_272_1129 253
366 3300037471 Ga0395905_0393524 Ga0395905_0393524_215_1126 253
367 3300039437 Ga0436365_1302408 Ga0436365_1302408_1343_2239 253
368 3300046460 Ga0495638_0003637 Ga0495638_0003637_8806_9714 253
369 3300046507 Ga0495606_0036283 Ga0495606_0036283_1633_2544 253
370 3300046507 Ga0495606_0073803 Ga0495606_0073803_985_1890 253
371 3300046694 Ga0495649_0111470 Ga0495649_0111470_384_1295 253
372 3300048907 Ga0496104_0032721 Ga0496104_0032721_3438_4349 253
373 3300048909 Ga0496106_0039179 Ga0496106_0039179_2554_3465 253
374 3300048914 Ga0496111_0452783 Ga0496111_0452783_14_901 253
375 3300048917 Ga0496114_0042973 Ga0496114_0042973_156_1061 253
376 3300048921 Ga0496118_0032776 Ga0496118_0032776_2507_3403 253
377 3300048924 Ga0496121_0019666 Ga0496121_0019666_4821_5717 253
378 3300048924 Ga0496121_0091056 Ga0496121_0091056_336_1310 253
379 3300048924 Ga0496121_0120703 Ga0496121_0120703_797_1681 253
380 3300048924 Ga0496121_0158117 Ga0496121_0158117_126_1037 253
381 3300048929 Ga0496126_0206382 Ga0496126_0206382_695_1606 253
382 3300049569 Ga0501032_0030565 Ga0501032_0030565_1846_2721 253
383 3300049573 Ga0501037_0097398 Ga0501037_0097398_85_960 253
384 3300049587 Ga0501071_0220347 Ga0501071_0220347_314_1189 253
385 3300049822 Ga0501035_0418591 Ga0501035_0418591_51_926 253
386 3300049823 Ga0501044_0165131 Ga0501044_0165131_722_1597 253
387 3300050495 nmdc:mga04h51_3952_c1 nmdc:mga04h51_3952_c1_635_1546 253
388 3300053096 Ga0500641_0109731 Ga0500641_0109731_60_1034 253
389 3300053142 Ga0500577_0030140 Ga0500577_0030140_277_1251 253
390 3300053146 Ga0500588_0009801 Ga0500588_0009801_293_1267 253
391 3300053153 Ga0500616_0053704 Ga0500616_0053704_941_1849 253
392 3300053156 Ga0500622_0092915 Ga0500622_0092915_269_1177 253
393 3300053177 Ga0500636_0023297 Ga0500636_0023297_132_1028 253
394 3300053736 Ga0500599_000161 Ga0500599_000161_3827_4735 253
395 iso_pu_bacteria 2874620515 2874622554 253
396 iso_pu_bacteria 2904666416 2904671439 253
397 3300003215 JGI25153J46596_10000600 JGI25153J46596_1000060021 254
398 3300003354 JGI25160J50197_1001415 JGI25160J50197_10014157 254
399 3300005434 Ga0070709_10000375 Ga0070709_1000037511 254
400 3300005437 Ga0070710_10000275 Ga0070710_1000027518 254
401 3300005439 Ga0070711_100006414 Ga0070711_1000064148 254
402 3300006038 Ga0075365_10082394 Ga0075365_100823943 254
403 3300006051 Ga0075364_10221940 Ga0075364_102219402 254
404 3300006175 Ga0070712_100045559 Ga0070712_1000455593 254
405 3300009545 Ga0105237_10361717 Ga0105237_103617172 254
406 3300009545 Ga0105237_10385688 Ga0105237_103856881 254
407 3300009551 Ga0105238_10022670 Ga0105238_100226707 254
408 3300010375 Ga0105239_10072205 Ga0105239_100722052 254
409 3300014326 Ga0157380_10210285 Ga0157380_102102852 254
410 3300025295 Ga0209564_1002110 Ga0209564_10021107 254
411 3300025297 Ga0209758_1001267 Ga0209758_10012678 254
412 3300025302 Ga0207426_1000799 Ga0207426_100079925 254
413 3300025304 Ga0209257_1013507 Ga0209257_10135072 254
414 3300025898 Ga0207692_10000229 Ga0207692_100002292 254
415 3300025906 Ga0207699_10000242 Ga0207699_1000024212 254
416 3300025915 Ga0207693_10033852 Ga0207693_100338522 254
417 3300025939 Ga0207665_10004541 Ga0207665_100045415 254
418 3300028556 Ga0265337_1007418 Ga0265337_10074182 254
419 3300028558 Ga0265326_10003492 Ga0265326_100034926 254
420 3300028577 Ga0265318_10013434 Ga0265318_100134344 254
421 3300028653 Ga0265323_10001501 Ga0265323_1000150110 254
422 3300028666 Ga0265336_10000238 Ga0265336_1000023818 254
423 3300028800 Ga0265338_10000278 Ga0265338_1000027821 254
424 3300029957 Ga0265324_10001755 Ga0265324_100017553 254
425 3300035692 Ga0373935_0000718 Ga0373935_0000718_15272_16147 254
426 3300035695 Ga0373927_0000666 Ga0373927_0000666_11445_12320 254
427 3300035725 Ga0373947_0004761 Ga0373947_0004761_5279_6154 254
428 3300037068 Ga0373925_0005280 Ga0373925_0005280_7680_8555 254
429 3300044842 Ga0466957_0024632 Ga0466957_0024632_425_1324 254
430 3300045051 Ga0451576_0551541 Ga0451576_0551541_96_1001 254
431 3300046454 Ga0495592_0034591 Ga0495592_0034591_2621_3496 254
432 3300046455 Ga0495603_0000206 Ga0495603_0000206_6989_7864 254
433 3300046459 Ga0495629_0000338 Ga0495629_0000338_8283_9158 254
434 3300046461 Ga0495641_0005602 Ga0495641_0005602_6370_7245 254
435 3300046472 Ga0495580_0003372 Ga0495580_0003372_12503_13378 254
436 3300046473 Ga0495582_0000423 Ga0495582_0000423_2791_3666 254
437 3300046475 Ga0495639_0000039 Ga0495639_0000039_23242_24117 254
438 3300046477 Ga0495664_0000847 Ga0495664_0000847_6750_7625 254
439 3300046499 Ga0495594_0006677 Ga0495594_0006677_4891_5766 254
440 3300046526 Ga0495666_0007417 Ga0495666_0007417_3226_4101 254
441 3300046529 Ga0495652_0113761 Ga0495652_0113761_1250_2125 254
442 3300046531 Ga0495665_0000082 Ga0495665_0000082_5228_6103 254
443 3300046557 Ga0495622_0011857 Ga0495622_0011857_1841_2716 254
444 3300046642 Ga0495634_0000776 Ga0495634_0000776_10869_11744 254
445 3300046663 Ga0495635_0009338 Ga0495635_0009338_5131_6006 254
446 3300046680 Ga0495646_0137791 Ga0495646_0137791_108_983 254
447 3300046683 Ga0495658_0004531 Ga0495658_0004531_4913_5788 254
448 3300047315 Ga0495581_0000006 Ga0495581_0000006_57326_58201 254
449 3300047319 Ga0495674_0012193 Ga0495674_0012193_5848_6723 254
450 3300047673 Ga0495593_0000032 Ga0495593_0000032_38760_39635 254
451 3300048909 Ga0496106_0002364 Ga0496106_0002364_11054_11914 254
452 3300048920 Ga0496117_0016836 Ga0496117_0016836_1017_1877 254
453 3300048921 Ga0496118_0002319 Ga0496118_0002319_15692_16552 254
454 3300048924 Ga0496121_0000352 Ga0496121_0000352_42627_43487 254
455 3300048927 Ga0496124_0001443 Ga0496124_0001443_30781_31641 254
456 3300048927 Ga0496124_0054966 Ga0496124_0054966_1483_2388 254
457 3300048928 Ga0496125_0008186 Ga0496125_0008186_5254_6114 254
458 3300048928 Ga0496125_0026403 Ga0496125_0026403_426_1331 254
459 3300048929 Ga0496126_0003276 Ga0496126_0003276_10502_11362 254
460 3300048929 Ga0496126_0065029 Ga0496126_0065029_1543_2460 254
461 3300049823 Ga0501044_0209343 Ga0501044_0209343_472_1449 254
462 3300050516 nmdc:mga0sz30_18835_c1 nmdc:mga0sz30_18835_c1_258_1175 254
463 3300053140 Ga0500573_0017246 Ga0500573_0017246_984_1883 254
464 iso_pu_bacteria 2885409591 2885412984 254
465 iso_pu_bacteria 3005506211 3005510989 254
466 3300001979 JGI24740J21852_10010589 JGI24740J21852_100105893 255
467 3300005548 Ga0070665_100313579 Ga0070665_1003135792 255
468 3300005563 Ga0068855_100094463 Ga0068855_1000944632 255
469 3300005563 Ga0068855_100582204 Ga0068855_1005822042 255
470 3300005577 Ga0068857_100066950 Ga0068857_1000669503 255
471 3300005578 Ga0068854_100043105 Ga0068854_1000431053 255
472 3300005614 Ga0068856_100003776 Ga0068856_1000037766 255
473 3300005616 Ga0068852_100064930 Ga0068852_1000649302 255
474 3300005834 Ga0068851_10017462 Ga0068851_100174623 255
475 3300005983 Ga0081540_1028615 Ga0081540_10286153 255
476 3300006038 Ga0075365_10228216 Ga0075365_102282161 255
477 3300009093 Ga0105240_10020686 Ga0105240_100206866 255
478 3300009093 Ga0105240_10194470 Ga0105240_101944703 255
479 3300009147 Ga0114129_10085137 Ga0114129_100851373 255
480 3300009174 Ga0105241_10001771 Ga0105241_100017715 255
481 3300009551 Ga0105238_10000517 Ga0105238_1000051735 255
482 3300010375 Ga0105239_10002648 Ga0105239_1000264819 255
483 3300013102 Ga0157371_10021936 Ga0157371_100219362 255
484 3300013105 Ga0157369_10014315 Ga0157369_100143152 255
485 3300025321 Ga0207656_10003517 Ga0207656_100035175 255
486 3300025911 Ga0207654_10000248 Ga0207654_1000024814 255
487 3300025913 Ga0207695_10000343 Ga0207695_1000034359 255
488 3300025913 Ga0207695_10050929 Ga0207695_100509293 255
489 3300025917 Ga0207660_10205430 Ga0207660_102054302 255
490 3300025919 Ga0207657_10004349 Ga0207657_100043498 255
491 3300025924 Ga0207694_10000136 Ga0207694_100001366 255
492 3300025929 Ga0207664_10124695 Ga0207664_101246952 255
493 3300025949 Ga0207667_10018828 Ga0207667_100188288 255
494 3300026023 Ga0207677_10130335 Ga0207677_101303352 255
495 3300026041 Ga0207639_10056591 Ga0207639_100565913 255
496 3300026067 Ga0207678_10045082 Ga0207678_100450824 255
497 3300026075 Ga0207708_10088913 Ga0207708_100889132 255
498 3300026078 Ga0207702_10000006 Ga0207702_10000006226 255
499 3300026116 Ga0207674_10003449 Ga0207674_1000344916 255
500 3300026142 Ga0207698_10175307 Ga0207698_101753072 255
501 3300038443 Ga0395901_0278347 Ga0395901_0278347_229_1134 255
502 3300045976 Ga0466967_0127095 Ga0466967_0127095_1009_1908 255
503 3300046477 Ga0495664_0082926 Ga0495664_0082926_778_1692 255
504 3300046491 Ga0495584_0054927 Ga0495584_0054927_870_1856 255
505 3300046492 Ga0495585_0058241 Ga0495585_0058241_483_1457 255
506 3300046499 Ga0495594_0122324 Ga0495594_0122324_401_1387 255
507 3300046523 Ga0495644_0043687 Ga0495644_0043687_431_1417 255
508 3300046543 Ga0495645_0017895 Ga0495645_0017895_2855_3769 255
509 3300046558 Ga0495633_0015568 Ga0495633_0015568_2291_3277 255
510 3300046615 Ga0495656_0007521 Ga0495656_0007521_71_1057 255
511 3300046674 Ga0495588_0033674 Ga0495588_0033674_1084_2070 255
512 3300046678 Ga0495599_0012128 Ga0495599_0012128_2080_2994 255
513 3300046691 Ga0495670_0068221 Ga0495670_0068221_161_1147 255
514 3300047318 Ga0495636_0014126 Ga0495636_0014126_753_1739 255
515 3300048923 Ga0496120_0022972 Ga0496120_0022972_2251_3126 255
516 3300048924 Ga0496121_0085513 Ga0496121_0085513_1101_2087 255
517 3300048927 Ga0496124_0107167 Ga0496124_0107167_23_1009 255
518 3300048929 Ga0496126_0051752 Ga0496126_0051752_1399_2304 255
519 3300049586 Ga0501070_0046564 Ga0501070_0046564_298_1215 255
520 3300049823 Ga0501044_0083394 Ga0501044_0083394_1943_2788 255
521 3300005339 Ga0070660_100323793 Ga0070660_1003237931 256
522 3300005353 Ga0070669_100037707 Ga0070669_1000377072 256
523 3300005436 Ga0070713_100089707 Ga0070713_1000897073 256
524 3300005437 Ga0070710_10228597 Ga0070710_102285972 256
525 3300005439 Ga0070711_100020739 Ga0070711_1000207392 256
526 3300005842 Ga0068858_100136821 Ga0068858_1001368212 256
527 3300006173 Ga0070716_100013938 Ga0070716_1000139381 256
528 3300006175 Ga0070712_100434960 Ga0070712_1004349602 256
529 3300009101 Ga0105247_10085391 Ga0105247_100853912 256
530 3300010375 Ga0105239_10134890 Ga0105239_101348902 256
531 3300025900 Ga0207710_10038836 Ga0207710_100388363 256
532 3300025916 Ga0207663_10186331 Ga0207663_101863312 256
533 3300025923 Ga0207681_10136657 Ga0207681_101366571 256
534 3300025928 Ga0207700_10168867 Ga0207700_101688672 256
535 3300025931 Ga0207644_10114097 Ga0207644_101140973 256
536 3300025940 Ga0207691_10097989 Ga0207691_100979892 256
537 3300031507 Ga0307509_10046806 Ga0307509_100468066 256
538 3300031616 Ga0307508_10117091 Ga0307508_101170912 256
539 3300031730 Ga0307516_10024100 Ga0307516_100241004 256
540 3300035691 Ga0373931_0019668 Ga0373931_0019668_1861_2823 256
541 3300035695 Ga0373927_0055244 Ga0373927_0055244_902_1864 256
542 3300037068 Ga0373925_0116855 Ga0373925_0116855_332_1294 256
543 3300037418 Ga0395900_0062560 Ga0395900_0062560_2179_3048 256
544 3300038443 Ga0395901_0043404 Ga0395901_0043404_3270_4139 256
545 3300039453 Ga0436362_0825075 Ga0436362_0825075_135_1037 256
546 3300046794 Ga0495589_0202372 Ga0495589_0202372_50_889 256
547 3300048903 Ga0496100_0018954 Ga0496100_0018954_2653_3615 256
548 3300048904 Ga0496101_0155163 Ga0496101_0155163_593_1555 256
549 3300048905 Ga0496102_0019308 Ga0496102_0019308_3873_4835 256
550 3300048906 Ga0496103_0039846 Ga0496103_0039846_1117_2079 256
551 3300048909 Ga0496106_0158596 Ga0496106_0158596_270_1232 256
552 3300048913 Ga0496110_0554298 Ga0496110_0554298_47_1009 256
553 3300048914 Ga0496111_0021658 Ga0496111_0021658_401_1363 256
554 3300048916 Ga0496113_0060918 Ga0496113_0060918_1097_2059 256
555 3300048917 Ga0496114_0269007 Ga0496114_0269007_493_1455 256
556 3300048924 Ga0496121_0018747 Ga0496121_0018747_2631_3506 256
557 3300048929 Ga0496126_0005702 Ga0496126_0005702_4326_5288 256
558 3300049573 Ga0501037_0009276 Ga0501037_0009276_882_1751 256
559 3300049578 Ga0501042_0159404 Ga0501042_0159404_569_1543 256
560 3300049823 Ga0501044_0109258 Ga0501044_0109258_1436_2353 256
561 3300053080 Ga0500635_0012868 Ga0500635_0012868_1295_2212 256
562 3300053091 Ga0500647_0023852 Ga0500647_0023852_1130_2047 256
563 3300053094 Ga0500566_0000270 Ga0500566_0000270_10771_11688 256
564 3300053111 Ga0500572_001115 Ga0500572_001115_199_1116 256
565 3300053123 Ga0500614_001182 Ga0500614_001182_2817_3734 256
566 3300053136 Ga0500559_0001813 Ga0500559_0001813_7895_8812 256
567 3300053150 Ga0500603_000151 Ga0500603_000151_596_1513 256
568 3300053163 Ga0500639_000065 Ga0500639_000065_9783_10700 256
569 3300053178 Ga0500637_0090652 Ga0500637_0090652_302_1219 256
570 3300053735 Ga0500596_000494 Ga0500596_000494_5934_6851 256
571 iso_pu_bacteria 2507262055 2507505999 256
572 iso_pu_bacteria 2508501009 2508540187 256
573 iso_pu_bacteria 2508501042 2508696261 256
574 iso_pu_bacteria 2511231028 2511397326 256
575 iso_pu_bacteria 2513237094 2513638257 256
576 iso_pu_bacteria 2513237095 2513649095 256
577 iso_pu_bacteria 2513237102 2513701556 256
578 iso_pu_bacteria 2513237104 2513716261 256
579 iso_pu_bacteria 2513237139 2513877170 256
580 iso_pu_bacteria 2513237161 2514014539 256
581 iso_pu_bacteria 2524023205 2524440757 256
582 iso_pu_bacteria 2528768022 2528850764 256
583 iso_pu_bacteria 2617270735 2617347882 256
584 iso_pu_bacteria 2617270741 2617374804 256
585 iso_pu_bacteria 2744054633 2745075998 256
586 iso_pu_bacteria 2758568016 2758640684 256
587 iso_pu_bacteria 2791355196 2793061467 256
588 iso_pu_bacteria 2802429603 2805916231 256
589 iso_pu_bacteria 2816332527 2818240486 256
590 iso_pu_bacteria 2824600985 2824603706 256
591 iso_pu_bacteria 2824609381 2824610708 256
592 iso_pu_bacteria 2824617872 2824624968 256
593 iso_pu_bacteria 2824626560 2824630995 256
594 iso_pu_bacteria 2824635225 2824641243 256
595 iso_pu_bacteria 2824644064 2824649673 256
596 iso_pu_bacteria 2824653114 2824657910 256
597 iso_pu_bacteria 2824661429 2824666907 256
598 iso_pu_bacteria 2824671348 2824674085 256
599 iso_pu_bacteria 2824687955 2824690751 256
600 iso_pu_bacteria 2824696289 2824703321 256
601 iso_pu_bacteria 2824704595 2824710962 256
602 iso_pu_bacteria 2824714736 2824719598 256
603 iso_pu_bacteria 2824723954 2824728573 256
604 iso_pu_bacteria 2824732956 2824737933 256
605 iso_pu_bacteria 2824746037 2824752186 256
606 iso_pu_bacteria 2824753945 2824760348 256
607 iso_pu_bacteria 2824763712 2824772484 256
608 iso_pu_bacteria 2824773399 2824776341 256
609 iso_pu_bacteria 2838122688 2838125008 256
610 iso_pu_bacteria 2841941048 2841945747 256
611 iso_pu_bacteria 2841949485 2841956846 256
612 iso_pu_bacteria 2841966195 2841973594 256
613 iso_pu_bacteria 2841974524 2841981928 256
614 iso_pu_bacteria 2841983080 2841989482 256
615 iso_pu_bacteria 2842038055 2842044467 256
616 iso_pu_bacteria 2842045827 2842051544 256
617 iso_pu_bacteria 2847930680 2847939359 256
618 iso_pu_bacteria 2847939898 2847941115 256
619 iso_pu_bacteria 2849076700 2849082101 256
620 iso_pu_bacteria 2857509624 2857513418 256
621 iso_pu_bacteria 2874123672 2874130557 256
622 iso_pu_bacteria 2874590934 2874596264 256
623 iso_pu_bacteria 2874628541 2874633467 256
624 iso_pu_bacteria 2874645413 2874650251 256
625 iso_pu_bacteria 2876761206 2876763652 256
626 iso_pu_bacteria 2876771140 2876776729 256
627 iso_pu_bacteria 2876818435 2876824519 256
628 iso_pu_bacteria 2879074833 2879080866 256
629 iso_pu_bacteria 2879083081 2879087032 256
630 iso_pu_bacteria 2879099564 2879104363 256
631 iso_pu_bacteria 2879127579 2879133711 256
632 iso_pu_bacteria 2879142872 2879148213 256
633 iso_pu_bacteria 2881364244 2881369522 256
634 iso_pu_bacteria 2885366525 2885367832 256
635 iso_pu_bacteria 2888378607 2888387161 256
636 iso_pu_bacteria 2888419890 2888421257 256
637 iso_pu_bacteria 2904711408 2904719731 256
638 iso_pu_bacteria 2906626472 2906631358 256
639 iso_pu_bacteria 2906643746 2906646702 256
640 iso_pu_bacteria 2908775508 2908777286 256
641 iso_pu_bacteria 2922368715 2922377328 256
642 iso_pu_bacteria 2922393267 2922398430 256
643 iso_pu_bacteria 2929615660 2929622130 256
644 iso_pu_bacteria 2929624759 2929630225 256
645 iso_pu_bacteria 2932784394 2932787853 256
646 iso_pu_bacteria 2932794094 2932795971 256
647 iso_pu_bacteria 2932801729 2932807548 256
648 iso_pu_bacteria 2932809354 2932817577 256
649 iso_pu_bacteria 2932818245 2932826263 256
650 iso_pu_bacteria 2932828146 2932835119 256
651 iso_pu_bacteria 2933577622 2933584254 256
652 iso_pu_bacteria 2935608549 2935614424 256
653 iso_pu_bacteria 2935616580 2935620497 256
654 iso_pu_bacteria 2935638405 2935640819 256
655 iso_pu_bacteria 2935648319 2935649453 256
656 iso_pu_bacteria 2935656913 2935657775 256
657 iso_pu_bacteria 2935665750 2935670322 256
658 iso_pu_bacteria 2935675223 2935679752 256
659 iso_pu_bacteria 2935684952 2935687321 256
660 iso_pu_bacteria 2935694250 2935696708 256
661 iso_pu_bacteria 2935703347 2935709200 256
662 iso_pu_bacteria 2935713505 2935718780 256
663 iso_pu_bacteria 2935722832 2935728432 256
664 iso_pu_bacteria 2935732158 2935736971 256
665 iso_pu_bacteria 2935741537 2935746026 256
666 iso_pu_bacteria 2935750917 2935753287 256
667 iso_pu_bacteria 2935760218 2935766320 256
668 iso_pu_bacteria 2935769743 2935770291 256
669 iso_pu_bacteria 2935777560 2935777682 256
670 iso_pu_bacteria 2935785616 2935786656 256
671 iso_pu_bacteria 2935793552 2935794710 256
672 iso_pu_bacteria 2935801545 2935809002 256
673 iso_pu_bacteria 2935810662 2935813819 256
674 iso_pu_bacteria 2935819856 2935826642 256
675 iso_pu_bacteria 2935827899 2935832326 256
676 iso_pu_bacteria 2935837841 2935844031 256
677 iso_pu_bacteria 2935847175 2935851064 256
678 iso_pu_bacteria 2935855204 2935862823 256
679 iso_pu_bacteria 2935864058 2935864566 256
680 iso_pu_bacteria 2935873716 2935875082 256
681 iso_pu_bacteria 2935883170 2935890238 256
682 iso_pu_bacteria 2935908558 2935913114 256
683 iso_pu_bacteria 2935916978 2935922536 256
684 iso_pu_bacteria 2935926038 2935930961 256
685 iso_pu_bacteria 2935934488 2935939705 256
686 iso_pu_bacteria 2935942939 2935946654 256
687 iso_pu_bacteria 2935951376 2935956145 256
688 iso_pu_bacteria 2935959822 2935965051 256
689 iso_pu_bacteria 2935967501 2935972938 256
690 iso_pu_bacteria 2935975950 2935978146 256
691 iso_pu_bacteria 2935984226 2935985730 256
692 iso_pu_bacteria 2935992306 2935999299 256
693 iso_pu_bacteria 2936002035 2936005854 256
694 iso_pu_bacteria 2936011229 2936011994 256
695 iso_pu_bacteria 2936019824 2936020925 256
696 iso_pu_bacteria 2936028420 2936029287 256
697 iso_pu_bacteria 2936037263 2936039375 256
698 iso_pu_bacteria 2936046547 2936048389 256
699 iso_pu_bacteria 2936055302 2936056500 256
700 iso_pu_bacteria 2940556831 2940559200 256
701 iso_pu_bacteria 2941538514 2941541894 256
702 iso_pu_bacteria 3005483717 3005491148 256
703 iso_pu_bacteria 3005587118 3005591834 256
704 iso_pu_bacteria 3005710791 3005711890 256
705 iso_pu_bacteria 8006926726 8006931481 256
706 iso_pu_bacteria 8016511872 8016517182 256
707 iso_pu_bacteria 8016522445 8016527062 256
708 iso_pu_bacteria 8016530956 8016532144 256
709 iso_pu_bacteria 8016539877 8016545354 256
710 iso_pu_bacteria 8016548790 8016556734 256
711 iso_pu_bacteria 8016557553 8016565091 256
712 iso_pu_bacteria 8016566248 8016570441 256
713 iso_pu_bacteria 8016575299 8016582973 256
714 iso_pu_bacteria 8016583857 8016585326 256
715 iso_pu_bacteria 8016595262 8016602739 256
716 iso_pu_bacteria 8016613128 8016617514 256
717 iso_pu_bacteria 8016622563 8016624059 256
718 iso_pu_bacteria 8016630954 8016634809 256
719 iso_pu_bacteria 8017057580 8017059406 256
720 iso_pu_bacteria 8019530166 8019531962 256
721 iso_pu_bacteria 8019538911 8019539574 256
722 iso_pu_bacteria 8019547302 8019551081 256
723 iso_pu_bacteria 8019576017 8019576212 256
724 iso_pu_bacteria 8019597564 8019607476 256
725 iso_pu_bacteria 8019619141 8019621884 256
726 iso_pu_bacteria 8019638758 8019639171 256
727 iso_pu_bacteria 8019648815 8019651322 256
728 iso_pu_bacteria 8019659431 8019668254 256
729 iso_pu_bacteria 8019668869 8019677705 256
730 iso_pu_bacteria 8019678201 8019687237 256
731 iso_pu_bacteria 8019687851 8019693219 256
732 iso_pu_bacteria 8055742211 8055743619 256
733 iso_pu_bacteria 8056967851 8056974074 256
734 3300005329 Ga0070683_100025289 Ga0070683_1000252893 257
735 3300005344 Ga0070661_100311839 Ga0070661_1003118392 257
736 3300005530 Ga0070679_100034040 Ga0070679_1000340402 257
737 3300005535 Ga0070684_100001508 Ga0070684_1000015089 257
738 3300005535 Ga0070684_100028072 Ga0070684_1000280723 257
739 3300005535 Ga0070684_100398277 Ga0070684_1003982772 257
740 3300005563 Ga0068855_100250279 Ga0068855_1002502792 257
741 3300005577 Ga0068857_100274189 Ga0068857_1002741892 257
742 3300005983 Ga0081540_1041487 Ga0081540_10414872 257
743 3300006028 Ga0070717_10069615 Ga0070717_100696152 257
744 3300006178 Ga0075367_10042532 Ga0075367_100425322 257
745 3300009093 Ga0105240_10020584 Ga0105240_100205845 257
746 3300009101 Ga0105247_10290054 Ga0105247_102900542 257
747 3300009545 Ga0105237_10146340 Ga0105237_101463401 257
748 3300010159 Ga0099796_10033766 Ga0099796_100337662 257
749 3300013104 Ga0157370_10014532 Ga0157370_100145326 257
750 3300013105 Ga0157369_10006970 Ga0157369_100069708 257
751 3300013105 Ga0157369_10052523 Ga0157369_100525232 257
752 3300013307 Ga0157372_10023555 Ga0157372_100235554 257
753 3300025912 Ga0207707_10002685 Ga0207707_100026859 257
754 3300025913 Ga0207695_10050510 Ga0207695_100505102 257
755 3300025913 Ga0207695_10063575 Ga0207695_100635754 257
756 3300025917 Ga0207660_10029917 Ga0207660_100299173 257
757 3300025917 Ga0207660_10286956 Ga0207660_102869561 257
758 3300025944 Ga0207661_10000613 Ga0207661_1000061312 257
759 3300025944 Ga0207661_10053399 Ga0207661_100533992 257
760 3300026078 Ga0207702_10128736 Ga0207702_101287362 257
761 3300026116 Ga0207674_10287903 Ga0207674_102879032 257
762 3300031251 Ga0265327_10133407 Ga0265327_101334072 257
763 3300035086 Ga0373934_0040432 Ga0373934_0040432_271_1170 257
764 3300035111 Ga0373923_0003366 Ga0373923_0003366_804_1703 257
765 3300035118 Ga0373954_0003572 Ga0373954_0003572_726_1625 257
766 3300035171 Ga0373946_0027530 Ga0373946_0027530_153_1052 257
767 3300035410 Ga0373924_0007531 Ga0373924_0007531_1363_2262 257
768 3300035695 Ga0373927_0083230 Ga0373927_0083230_1033_1932 257
769 3300035724 Ga0373933_0016974 Ga0373933_0016974_1456_2355 257
770 3300035725 Ga0373947_0007585 Ga0373947_0007585_3388_4287 257
771 3300037068 Ga0373925_0017463 Ga0373925_0017463_1400_2299 257
772 3300037418 Ga0395900_0040887 Ga0395900_0040887_1362_2267 257
773 3300037466 Ga0395898_0018293 Ga0395898_0018293_5441_6346 257
774 3300038443 Ga0395901_0106088 Ga0395901_0106088_690_1589 257
775 3300045049 Ga0466959_0065671 Ga0466959_0065671_1707_2621 257
776 3300045976 Ga0466967_0113558 Ga0466967_0113558_520_1389 257
777 3300046455 Ga0495603_0069469 Ga0495603_0069469_503_1402 257
778 3300046473 Ga0495582_0034111 Ga0495582_0034111_1286_2185 257
779 3300046477 Ga0495664_0009313 Ga0495664_0009313_1802_2701 257
780 3300046514 Ga0495618_0003604 Ga0495618_0003604_5323_6222 257
781 3300046516 Ga0495628_0048999 Ga0495628_0048999_2269_3168 257
782 3300046517 Ga0495630_0132772 Ga0495630_0132772_722_1621 257
783 3300046524 Ga0495648_0012759 Ga0495648_0012759_1172_2047 257
784 3300046531 Ga0495665_0084964 Ga0495665_0084964_130_1029 257
785 3300046533 Ga0495640_0177856 Ga0495640_0177856_271_1170 257
786 3300046683 Ga0495658_0003324 Ga0495658_0003324_6538_7437 257
787 3300046689 Ga0495613_0016376 Ga0495613_0016376_3586_4485 257
788 3300046690 Ga0495624_0159753 Ga0495624_0159753_297_1196 257
789 3300047315 Ga0495581_0010765 Ga0495581_0010765_81_980 257
790 3300047317 Ga0495604_0102161 Ga0495604_0102161_49_948 257
791 3300047471 Ga0495684_0001984 Ga0495684_0001984_14855_15754 257
792 3300048089 Ga0495614_0014894 Ga0495614_0014894_2172_3071 257
793 3300049586 Ga0501070_0068726 Ga0501070_0068726_152_1081 257
794 3300050493 nmdc:mga0k408_65696_c1 nmdc:mga0k408_65696_c1_948_1922 257
795 3300053077 Ga0495601_0085301 Ga0495601_0085301_1009_1908 257
796 iso_pu_bacteria 2513237092 2513624910 257
797 iso_pu_bacteria 2517093001 2517103189 257
798 iso_pu_bacteria 2841957949 2841964029 257
799 iso_pu_bacteria 2874612657 2874616536 257
800 iso_pu_bacteria 2881665667 2881669762 257
801 3300003659 JGI25404J52841_10009489 JGI25404J52841_100094892 258
802 3300005983 Ga0081540_1001275 Ga0081540_100127520 258
803 3300014326 Ga0157380_10338602 Ga0157380_103386022 258
804 3300025939 Ga0207665_10081743 Ga0207665_100817432 258
805 3300039437 Ga0436365_0646338 Ga0436365_0646338_372_1244 258
806 3300046455 Ga0495603_0146188 Ga0495603_0146188_28_873 258
807 3300047320 Ga0495672_0008439 Ga0495672_0008439_1710_2576 258
808 3300048929 Ga0496126_0042845 Ga0496126_0042845_2222_3208 258
809 3300050511 nmdc:mga08y16_382969_c1 nmdc:mga08y16_382969_c1_320_1291 258
810 iso_pu_bacteria 2643221651 2644290425 258
811 3300005336 Ga0070680_100350873 Ga0070680_1003508731 259
812 3300005844 Ga0068862_100270297 Ga0068862_1002702972 259
813 3300005937 Ga0081455_10002674 Ga0081455_1000267421 259
814 3300006038 Ga0075365_10179433 Ga0075365_101794332 259
815 3300006051 Ga0075364_10085142 Ga0075364_100851422 259
816 3300006186 Ga0075369_10044924 Ga0075369_100449242 259
817 3300006844 Ga0075428_100155620 Ga0075428_1001556202 259
818 3300010159 Ga0099796_10009283 Ga0099796_100092832 259
819 3300025291 Ga0209675_1006021 Ga0209675_10060212 259
820 3300025932 Ga0207690_10345481 Ga0207690_103454812 259
821 3300026089 Ga0207648_10265156 Ga0207648_102651561 259
822 3300028379 Ga0268266_10002576 Ga0268266_1000257615 259
823 3300031250 Ga0265331_10062111 Ga0265331_100621112 259
824 3300048915 Ga0496112_0440467 Ga0496112_0440467_253_1224 259
825 3300050492 nmdc:mga0yw44_134578_c1 nmdc:mga0yw44_134578_c1_512_1498 259
826 3300050516 nmdc:mga0sz30_28201_c1 nmdc:mga0sz30_28201_c1_966_1952 259
827 iso_pu_bacteria 2508501128 2509148190 259
828 3300005437 Ga0070710_10040067 Ga0070710_100400672 260
829 3300005439 Ga0070711_100022239 Ga0070711_1000222393 260
830 3300007788 Ga0099795_10042026 Ga0099795_100420262 260
831 3300013306 Ga0163162_10382877 Ga0163162_103828772 260
832 3300025915 Ga0207693_10096274 Ga0207693_100962743 260
833 3300025916 Ga0207663_10025694 Ga0207663_100256942 260
834 3300048904 Ga0496101_0174929 Ga0496101_0174929_481_1443 260
835 3300005457 Ga0070662_100391421 Ga0070662_1003914211 261
836 3300005844 Ga0068862_100526453 Ga0068862_1005264531 261
837 3300005983 Ga0081540_1028764 Ga0081540_10287643 261
838 3300006353 Ga0075370_10194632 Ga0075370_101946322 261
839 3300009092 Ga0105250_10048076 Ga0105250_100480762 261
840 3300025972 Ga0207668_10292653 Ga0207668_102926532 261
841 3300025972 Ga0207668_10421735 Ga0207668_104217351 261
842 3300031616 Ga0307508_10072172 Ga0307508_100721724 261
843 3300031616 Ga0307508_10138745 Ga0307508_101387452 261
844 3300033179 Ga0307507_10094534 Ga0307507_100945341 261
845 3300033180 Ga0307510_10034065 Ga0307510_100340654 261
846 3300035695 Ga0373927_0028210 Ga0373927_0028210_85_1044 261
847 3300037068 Ga0373925_0108934 Ga0373925_0108934_454_1413 261
848 3300048929 Ga0496126_0016514 Ga0496126_0016514_4979_5941 261
849 3300053119 Ga0500595_012540 Ga0500595_012540_1193_2191 261
850 3300053178 Ga0500637_0157770 Ga0500637_0157770_300_1298 261
851 3300006038 Ga0075365_10269441 Ga0075365_102694412 262
852 3300009148 Ga0105243_10181929 Ga0105243_101819292 262
853 3300013308 Ga0157375_10073375 Ga0157375_100733753 262
854 3300026121 Ga0207683_10127715 Ga0207683_101277152 262
855 3300035695 Ga0373927_0116554 Ga0373927_0116554_164_1117 262
856 3300046507 Ga0495606_0001194 Ga0495606_0001194_31939_32811 262
857 3300048904 Ga0496101_0151395 Ga0496101_0151395_472_1431 262
858 3300053124 Ga0500617_115703 Ga0500617_115703_62_1036 262
859 3300005356 Ga0070674_100020257 Ga0070674_1000202572 263
860 3300005367 Ga0070667_100136017 Ga0070667_1001360172 263
861 3300005548 Ga0070665_100326537 Ga0070665_1003265372 263
862 3300005719 Ga0068861_100010209 Ga0068861_1000102098 263
863 3300005937 Ga0081455_10016366 Ga0081455_100163663 263
864 3300005983 Ga0081540_1005588 Ga0081540_10055882 263
865 3300005983 Ga0081540_1006389 Ga0081540_100638910 263
866 3300006042 Ga0075368_10048310 Ga0075368_100483102 263
867 3300006943 Ga0099822_1000031 Ga0099822_100003156 263
868 3300009176 Ga0105242_10086402 Ga0105242_100864022 263
869 3300009177 Ga0105248_10400059 Ga0105248_104000592 263
870 3300013297 Ga0157378_10293822 Ga0157378_102938221 263
871 3300014326 Ga0157380_10448403 Ga0157380_104484031 263
872 3300014969 Ga0157376_10419511 Ga0157376_104195112 263
873 3300025297 Ga0209758_1011263 Ga0209758_10112633 263
874 3300025907 Ga0207645_10083437 Ga0207645_100834372 263
875 3300025932 Ga0207690_10118641 Ga0207690_101186412 263
876 3300025935 Ga0207709_10174233 Ga0207709_101742332 263
877 3300025937 Ga0207669_10057536 Ga0207669_100575362 263
878 3300025961 Ga0207712_10062581 Ga0207712_100625813 263
879 3300025986 Ga0207658_10101121 Ga0207658_101011212 263
880 3300027907 Ga0207428_10091011 Ga0207428_100910112 263
881 3300031616 Ga0307508_10009068 Ga0307508_100090686 263
882 3300031730 Ga0307516_10097455 Ga0307516_100974552 263
883 3300046474 Ga0495605_0034758 Ga0495605_0034758_859_1830 263
884 3300046525 Ga0495663_0052662 Ga0495663_0052662_193_1164 263
885 3300046615 Ga0495656_0074139 Ga0495656_0074139_70_1041 263
886 3300046684 Ga0495669_0031299 Ga0495669_0031299_862_1833 263
887 3300047323 Ga0495683_0132631 Ga0495683_0132631_110_1096 263
888 3300048909 Ga0496106_0194625 Ga0496106_0194625_451_1422 263
889 3300048917 Ga0496114_0056894 Ga0496114_0056894_1678_2640 263
890 3300048929 Ga0496126_0013048 Ga0496126_0013048_669_1640 263
891 3300003215 JGI25153J46596_10001390 JGI25153J46596_100013909 264
892 3300005329 Ga0070683_100130359 Ga0070683_1001303592 264
893 3300005336 Ga0070680_100010901 Ga0070680_1000109013 264
894 3300005337 Ga0070682_100284830 Ga0070682_1002848302 264
895 3300005339 Ga0070660_100311084 Ga0070660_1003110842 264
896 3300005347 Ga0070668_100209627 Ga0070668_1002096272 264
897 3300005355 Ga0070671_100109525 Ga0070671_1001095252 264
898 3300005364 Ga0070673_100233740 Ga0070673_1002337402 264
899 3300005455 Ga0070663_100161988 Ga0070663_1001619882 264
900 3300005458 Ga0070681_10216576 Ga0070681_102165762 264
901 3300005530 Ga0070679_100075094 Ga0070679_1000750942 264
902 3300005535 Ga0070684_100168155 Ga0070684_1001681552 264
903 3300005539 Ga0068853_100296802 Ga0068853_1002968022 264
904 3300005543 Ga0070672_100147354 Ga0070672_1001473542 264
905 3300005548 Ga0070665_100135855 Ga0070665_1001358551 264
906 3300005549 Ga0070704_100110635 Ga0070704_1001106352 264
907 3300005563 Ga0068855_100029638 Ga0068855_1000296386 264
908 3300005563 Ga0068855_100237342 Ga0068855_1002373422 264
909 3300005577 Ga0068857_100084387 Ga0068857_1000843873 264
910 3300005614 Ga0068856_100338831 Ga0068856_1003388312 264
911 3300005615 Ga0070702_100215099 Ga0070702_1002150991 264
912 3300005618 Ga0068864_100055374 Ga0068864_1000553742 264
913 3300005618 Ga0068864_100248805 Ga0068864_1002488052 264
914 3300005719 Ga0068861_100176343 Ga0068861_1001763432 264
915 3300005843 Ga0068860_100044144 Ga0068860_1000441442 264
916 3300005937 Ga0081455_10052651 Ga0081455_100526513 264
917 3300005985 Ga0081539_10074173 Ga0081539_100741732 264
918 3300006038 Ga0075365_10136170 Ga0075365_101361702 264
919 3300006048 Ga0075363_100002809 Ga0075363_1000028092 264
920 3300006186 Ga0075369_10089752 Ga0075369_100897522 264
921 3300006237 Ga0097621_100033964 Ga0097621_1000339644 264
922 3300006237 Ga0097621_100122673 Ga0097621_1001226732 264
923 3300006871 Ga0075434_100359271 Ga0075434_1003592712 264
924 3300009098 Ga0105245_10233172 Ga0105245_102331722 264
925 3300009101 Ga0105247_10037262 Ga0105247_100372622 264
926 3300009101 Ga0105247_10153131 Ga0105247_101531312 264
927 3300009177 Ga0105248_10095178 Ga0105248_100951781 264
928 3300009545 Ga0105237_10113822 Ga0105237_101138222 264
929 3300010159 Ga0099796_10021895 Ga0099796_100218952 264
930 3300010375 Ga0105239_10021488 Ga0105239_100214886 264
931 3300010375 Ga0105239_10391969 Ga0105239_103919692 264
932 3300011119 Ga0105246_10116136 Ga0105246_101161362 264
933 3300011119 Ga0105246_10191791 Ga0105246_101917912 264
934 3300013104 Ga0157370_10124641 Ga0157370_101246412 264
935 3300013296 Ga0157374_10061178 Ga0157374_100611783 264
936 3300013308 Ga0157375_10055632 Ga0157375_100556323 264
937 3300014745 Ga0157377_10060818 Ga0157377_100608182 264
938 3300014745 Ga0157377_10090470 Ga0157377_100904702 264
939 3300014968 Ga0157379_10051655 Ga0157379_100516552 264
940 3300014969 Ga0157376_10325225 Ga0157376_103252252 264
941 3300025297 Ga0209758_1037256 Ga0209758_10372562 264
942 3300025315 Ga0207697_10064088 Ga0207697_100640882 264
943 3300025901 Ga0207688_10067444 Ga0207688_100674442 264
944 3300025907 Ga0207645_10139770 Ga0207645_101397701 264
945 3300025911 Ga0207654_10062044 Ga0207654_100620443 264
946 3300025914 Ga0207671_10029138 Ga0207671_100291383 264
947 3300025917 Ga0207660_10008346 Ga0207660_100083463 264
948 3300025919 Ga0207657_10127903 Ga0207657_101279032 264
949 3300025920 Ga0207649_10064731 Ga0207649_100647312 264
950 3300025921 Ga0207652_10166910 Ga0207652_101669102 264
951 3300025927 Ga0207687_10065440 Ga0207687_100654402 264
952 3300025933 Ga0207706_10247650 Ga0207706_102476502 264
953 3300025944 Ga0207661_10173608 Ga0207661_101736082 264
954 3300025945 Ga0207679_10133539 Ga0207679_101335392 264
955 3300025949 Ga0207667_10377599 Ga0207667_103775991 264
956 3300025972 Ga0207668_10021332 Ga0207668_100213325 264
957 3300025981 Ga0207640_10080475 Ga0207640_100804752 264
958 3300026035 Ga0207703_10036999 Ga0207703_100369992 264
959 3300026041 Ga0207639_10277079 Ga0207639_102770792 264
960 3300026067 Ga0207678_10237184 Ga0207678_102371842 264
961 3300026095 Ga0207676_10019688 Ga0207676_100196885 264
962 3300026116 Ga0207674_10108458 Ga0207674_101084582 264
963 3300026121 Ga0207683_10021982 Ga0207683_100219826 264
964 3300026121 Ga0207683_10041690 Ga0207683_100416902 264
965 3300028379 Ga0268266_10010607 Ga0268266_100106079 264
966 3300028379 Ga0268266_10049211 Ga0268266_100492113 264
967 3300028379 Ga0268266_10161996 Ga0268266_101619962 264
968 3300028380 Ga0268265_10518300 Ga0268265_105183001 264
969 3300028381 Ga0268264_10267649 Ga0268264_102676491 264
970 3300030521 Ga0307511_10087368 Ga0307511_100873682 264
971 3300033180 Ga0307510_10003787 Ga0307510_100037875 264
972 3300042157 Ga0439458_0010422 Ga0439458_0010422_113_1087 264
973 3300046538 Ga0495609_0077069 Ga0495609_0077069_102_1088 264
974 3300046557 Ga0495622_0024190 Ga0495622_0024190_402_1388 264
975 3300048904 Ga0496101_0015301 Ga0496101_0015301_3073_4029 264
976 3300048907 Ga0496104_0031856 Ga0496104_0031856_2515_3471 264
977 3300048907 Ga0496104_0178162 Ga0496104_0178162_38_970 264
978 3300048908 Ga0496105_0059106 Ga0496105_0059106_1357_2313 264
979 3300048909 Ga0496106_0020140 Ga0496106_0020140_706_1662 264
980 3300048911 Ga0496108_0020520 Ga0496108_0020520_1831_2787 264
981 3300048912 Ga0496109_0088902 Ga0496109_0088902_1195_2151 264
982 3300048912 Ga0496109_0412342 Ga0496109_0412342_314_1246 264
983 3300048914 Ga0496111_0016061 Ga0496111_0016061_2941_3897 264
984 3300048914 Ga0496111_0139669 Ga0496111_0139669_325_1296 264
985 3300048915 Ga0496112_0108628 Ga0496112_0108628_431_1387 264
986 3300048918 Ga0496115_0006927 Ga0496115_0006927_4779_5735 264
987 3300050490 nmdc:mga03n38_1891_c1 nmdc:mga03n38_1891_c1_648_1634 264
988 3300050491 nmdc:mga00v17_135430_c1 nmdc:mga00v17_135430_c1_503_1474 264
989 3300050493 nmdc:mga0k408_60795_c1 nmdc:mga0k408_60795_c1_1013_1984 264
990 3300050494 nmdc:mga06z11_27139_c1 nmdc:mga06z11_27139_c1_810_1796 264
991 3300050494 nmdc:mga06z11_54543_c1 nmdc:mga06z11_54543_c1_681_1652 264
992 3300050512 nmdc:mga0n895_227122_c1 nmdc:mga0n895_227122_c1_295_1266 264
993 3300050516 nmdc:mga0sz30_12669_c1 nmdc:mga0sz30_12669_c1_1745_2716 264
994 3300050516 nmdc:mga0sz30_12669_c1 nmdc:mga0sz30_12669_c1_569_1540 264
995 3300053094 Ga0500566_0014575 Ga0500566_0014575_3419_4387 264
996 3300053096 Ga0500641_0008048 Ga0500641_0008048_1938_2909 264
997 3300053119 Ga0500595_000328 Ga0500595_000328_28557_29525 264
998 3300053150 Ga0500603_008750 Ga0500603_008750_455_1423 264
999 3300053178 Ga0500637_0000413 Ga0500637_0000413_10197_11165 264
1000 3300005329 Ga0070683_100215018 Ga0070683_1002150182 265
1001 3300005339 Ga0070660_100004981 Ga0070660_1000049814 265
1002 3300005344 Ga0070661_100135531 Ga0070661_1001355312 265
1003 3300005530 Ga0070679_100053135 Ga0070679_1000531351 265
1004 3300005535 Ga0070684_100053196 Ga0070684_1000531964 265
1005 3300005539 Ga0068853_100000629 Ga0068853_1000006293 265
1006 3300005546 Ga0070696_100313661 Ga0070696_1003136612 265
1007 3300005563 Ga0068855_100058404 Ga0068855_1000584044 265
1008 3300005564 Ga0070664_100387472 Ga0070664_1003874722 265
1009 3300005577 Ga0068857_100036777 Ga0068857_1000367773 265
1010 3300005985 Ga0081539_10105926 Ga0081539_101059262 265
1011 3300006175 Ga0070712_100070842 Ga0070712_1000708422 265
1012 3300006941 Ga0099825_1032482 Ga0099825_10324822 265
1013 3300006942 Ga0099824_1014728 Ga0099824_10147282 265
1014 3300009545 Ga0105237_10008184 Ga0105237_100081844 265
1015 3300009551 Ga0105238_10026980 Ga0105238_100269806 265
1016 3300010375 Ga0105239_10017924 Ga0105239_100179248 265
1017 3300013105 Ga0157369_10003506 Ga0157369_100035068 265
1018 3300025915 Ga0207693_10073908 Ga0207693_100739082 265
1019 3300027357 Ga0209589_1000025 Ga0209589_1000025122 265
1020 3300027361 Ga0209489_100039 Ga0209489_100039122 265
1021 3300027363 Ga0209700_100043 Ga0209700_100043125 265
1022 3300046471 Ga0495650_0048142 Ga0495650_0048142_158_1144 265
1023 3300048905 Ga0496102_0334042 Ga0496102_0334042_28_1002 265
1024 3300048916 Ga0496113_0116139 Ga0496113_0116139_863_1837 265
1025 3300048917 Ga0496114_0527816 Ga0496114_0527816_13_981 265
1026 3300049583 Ga0501067_0037192 Ga0501067_0037192_938_1906 265
1027 3300005843 Ga0068860_100000411 Ga0068860_10000041148 266
1028 3300005985 Ga0081539_10120167 Ga0081539_101201672 266
1029 3300011119 Ga0105246_10220229 Ga0105246_102202292 266
1030 3300028381 Ga0268264_10000194 Ga0268264_1000019458 266
1031 3300031730 Ga0307516_10020275 Ga0307516_100202753 266
1032 3300053119 Ga0500595_001866 Ga0500595_001866_469_1338 266
1033 3300006038 Ga0075365_10060955 Ga0075365_100609551 267
1034 3300007265 Ga0099794_10102171 Ga0099794_101021712 267
1035 3300026121 Ga0207683_10089991 Ga0207683_100899912 267
1036 iso_pu_bacteria 2513237098 2513674944 267
1037 iso_pu_bacteria 2885383462 2885386468 267
1038 iso_pu_bacteria 2903768456 2903775238 267
1039 iso_pu_bacteria 8056681323 8056681593 267
1040 3300000549 LJQas_1003629 LJQas_10036292 268
1041 3300005468 Ga0070707_100083474 Ga0070707_1000834744 268
1042 3300007788 Ga0099795_10009109 Ga0099795_100091092 268
1043 3300025922 Ga0207646_10028422 Ga0207646_100284226 268
1044 3300028573 Ga0265334_10052977 Ga0265334_100529772 268
1045 3300031239 Ga0265328_10062648 Ga0265328_100626482 268
1046 3300033180 Ga0307510_10034602 Ga0307510_100346025 268
1047 3300035086 Ga0373934_0084520 Ga0373934_0084520_25_894 268
1048 3300036401 Ga0373937_0351720 Ga0373937_0351720_117_986 268
1049 3300048924 Ga0496121_0003091 Ga0496121_0003091_18694_19572 268
1050 3300053104 Ga0500556_0099071 Ga0500556_0099071_196_1074 268
1051 3300053139 Ga0500568_0084481 Ga0500568_0084481_65_976 268
1052 iso_pu_bacteria 2513237096 2513657558 268
1053 iso_pu_bacteria 2513237137 2513861114 268
1054 iso_pu_bacteria 2513237145 2513916811 268
1055 iso_pu_bacteria 2517572143 2517889721 268
1056 iso_pu_bacteria 2524023228 2524533113 268
1057 iso_pu_bacteria 2667528175 2671119571 268
1058 iso_pu_bacteria 2721755755 2723848926 268
1059 iso_pu_bacteria 2728368998 2728748933 268
1060 iso_pu_bacteria 2791355197 2793070299 268
1061 iso_pu_bacteria 2791355199 2793078930 268
1062 iso_pu_bacteria 2874604998 2874610051 268
1063 iso_pu_bacteria 2879110137 2879116915 268
1064 iso_pu_bacteria 2885374607 2885378461 268
1065 iso_pu_bacteria 2903748898 2903750330 268
1066 iso_pu_bacteria 2904690495 2904691971 268
1067 iso_pu_bacteria 2904699407 2904707522 268
1068 iso_pu_bacteria 2906610324 2906614697 268
1069 iso_pu_bacteria 2906635258 2906636216 268
1070 iso_pu_bacteria 2906660503 2906661026 268
1071 iso_pu_bacteria 2908739725 2908746475 268
1072 iso_pu_bacteria 2908756301 2908757431 268
1073 iso_pu_bacteria 2922386360 2922389453 268
1074 iso_pu_bacteria 2922425934 2922426559 268
1075 iso_pu_bacteria 2935630451 2935632899 268
1076 iso_pu_bacteria 2941507105 2941508436 268
1077 iso_pu_bacteria 2941515067 2941516267 268
1078 iso_pu_bacteria 2941523033 2941524717 268
1079 iso_pu_bacteria 3005474847 3005475905 268
1080 iso_pu_bacteria 8006933436 8006937217 268
1081 iso_pu_bacteria 8006964411 8006966234 268
1082 iso_pu_bacteria 8006973647 8006977228 268
1083 iso_pu_bacteria 8006984368 8006993039 268
1084 iso_pu_bacteria 8006994254 8006996899 268
1085 iso_pu_bacteria 8019565922 8019571513 268
1086 iso_pu_bacteria 8056673599 8056675289 268
1087 iso_pu_bacteria 8056689827 8056692930 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

127

324

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.6681 39 251
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6558 44 255
4jbw-assembly1.cif.gz_F crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.6437 44 255
3fh6-assembly2.cif.gz_H crystal structure of the resting state maltose transporter from e. coli 0.6286 58 255
2r6g-assembly1.cif.gz_F the crystal structure of the e. coli maltose transporter 0.6268 39 254
ID Description Score Start End Superfamily
3puzF04 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.7632 53 208 1.10.3720.10
af_P0AEB0_20_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6882 24 260 1.10.3720.10
af_P71745_27_277_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.669 22 259 1.10.3720.10
af_P71746_10_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6665 22 265 1.10.3720.10
af_Q2G2A9_6_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6649 21 263 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A6N8KAJ4-F1-model_v4 deleted 0.8747 24 157
AF-A0A351BIM1-F1-model_v4 Sulfate/thiosulfate ABC transporter permease CysW 0.8568 49 210 GO:0005886
GO:0015419
AF-A0A351BIM1-F1-model_v4 Sulfate/thiosulfate ABC transporter permease CysW 0.8474 49 210 GO:0005886
GO:0015419
AF-A0A1F7MUY6-F1-model_v4 Molybdenum ABC transporter permease subunit 0.844 53 203 GO:0005886
GO:0055085
AF-A0A328V5M5-F1-model_v4 deleted 0.84 22 195

Feature Viewer

pLDDT pTM Quality
68.26 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map