F489774

General Info

Members Datasets Scaffolds Average Seq Length
1085 625 2160 375

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016522445|8016526939
Length 430
Sequence YLTAAVTAAALALPALPALAQTTEITIGITTTTTGPGAALGIPERNALEFVPKEIGGVPLKVIVLDDGGDPTTATTNARRFVTESKADIIMGSALTPPTIAVSNVANEAGIPHFGLAPFPITPERMKWSVAMPQPIPIMGKVLYQHMKSKGVKTVGYIGYSDSYGDLWFNDFKAQGVPMGMTLADEERFARPDTSVTGQVLKLVAANPDAILVGASGTAAALPQTELRERGYQGLIYQTHGAASMDFIRIAGKAAEGVLMASGPVMDPEDQPDEAATKKPGLALNSAYEGKYGPNSRSQFAGHSYDAFEILKRVIPTALKTAKPRHAGIPRSNPPGTAVGEGNCCKPGRLQFHRKGPLRPRRPLAHPADGEERQVHAGEVDAAIVSRRREPAQWAGSFHLRSLSGLRPPDAAGSRRIPDSNCPSSGRHRR

Samples

Sample ID Description Type Environment
1 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
74 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
100 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
101 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
102 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
155 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
156 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
157 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
178 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
179 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
204 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
208 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
224 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
225 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
226 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
235 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
238 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
239 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
240 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
250 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
251 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
252 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
271 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
287 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
306 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
316 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
333 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
334 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
335 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
340 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
341 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
342 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
343 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
344 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
345 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
346 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
347 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
348 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
349 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
353 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
356 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
359 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
362 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
363 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
364 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
365 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
366 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
367 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
368 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
369 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
370 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
371 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
372 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
373 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
374 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
375 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
376 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
377 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
378 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
379 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
380 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
381 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
382 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
383 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
384 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
385 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
386 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
387 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
388 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
389 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
390 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
391 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
392 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
393 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
394 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
395 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
396 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
397 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
398 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
399 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
400 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
401 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
402 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
403 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
404 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
405 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
406 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
407 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
408 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
409 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
410 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
411 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
412 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
413 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
414 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
415 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
416 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
417 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
418 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
419 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
420 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
421 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
422 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
423 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
424 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
425 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
426 2643221651 Afipia sp. Root123D2 Isolate Unclassified
427 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
428 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
429 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
430 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
431 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
432 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
433 2791355199
434 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
435 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
436 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
437 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
438 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
439 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
440 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
441 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
442 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
443 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
444 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
445 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
446 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
447 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
448 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
449 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
450 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
451 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
452 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
453 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
454 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
455 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
456 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
457 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
458 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
459 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
460 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
461 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
462 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
463 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
464 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
465 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
466 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
467 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
468 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
469 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
470 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
471 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
472 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
473 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
474 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
475 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
476 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
477 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
478 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
479 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
480 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
481 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
482 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
483 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
484 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
485 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
486 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
487 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
488 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
489 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
490 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
491 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
492 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
493 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
494 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
495 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
496 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
497 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
498 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
499 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
500 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
501 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
502 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
503 2904699407
504 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
505 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
506 2906610324
507 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
508 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
509 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
510 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
511 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
512 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
513 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
514 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
515 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
516 2922368715
517 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
518 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
519 2922425934
520 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
521 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
522 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
523 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
524 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
525 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
526 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
527 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
528 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
529 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
530 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
531 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
532 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
533 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
534 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
535 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
536 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
537 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
538 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
539 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
540 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
541 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
542 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
543 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
544 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
545 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
546 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
547 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
548 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
549 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
550 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
551 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
552 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
553 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
554 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
555 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
556 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
557 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
558 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
559 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
560 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
561 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
562 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
563 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
564 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
565 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
566 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
567 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
568 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
569 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
570 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
571 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
572 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
573 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
574 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
575 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
576 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
577 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
578 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
579 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
580 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
581 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
582 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
583 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
584 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
585 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
586 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
587 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
588 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
589 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
590 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
591 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
592 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
593 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
594 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
595 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
596 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
597 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
598 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
599 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
600 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
601 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
602 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
603 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
604 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
605 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
606 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
607 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
608 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
609 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
610 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
611 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
612 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
613 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
614 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
615 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
616 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
617 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
618 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
619 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
620 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
621 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
622 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
623 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
624 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
625 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 79.26
Metatranscriptomes 0.09
Isolates 20.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.55
Nodule 16.22
Rhizoplane 5.25
Rhizosphere 51.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1005265 3300002070 Bacteria 1589
2 JGI25406J46586_10000233 3300003203 Bacteria 24719
3 JGI25406J46586_10031025 3300003203 Bacteria 2005
4 JGI25153J46596_10013655 3300003215 Bacteria 3420
5 JGI25153J46596_10014278 3300003215 Bacteria 3310
6 JGI25160J50197_1000761 3300003354 Bacteria 17408
7 JGI25160J50197_1002871 3300003354 Bacteria 7885
8 JGI25404J52841_10007829 3300003659 Bacteria 2267
9 Ga0055524_1033351 3300003775 Bacteria 1442
10 Ga0055531_10011226 3300003794 Bacteria 4350
11 Ga0055543_1008603 3300004625 Bacteria 2250
12 Ga0065165_1000917 3300005262 Bacteria 37935
13 Ga0065165_1001167 3300005262 Bacteria 30545
14 Ga0070658_10049328 3300005327 Bacteria 3410
15 Ga0070683_100060073 3300005329 Bacteria 3532
16 Ga0070683_100062216 3300005329 Bacteria 3471
17 Ga0070690_100225216 3300005330 Bacteria 1316
18 Ga0070670_100057855 3300005331 Bacteria 3327
19 Ga0068869_100013881 3300005334 Bacteria 5371
20 Ga0068869_100044308 3300005334 Bacteria 3199
21 Ga0070666_10118987 3300005335 Bacteria 1831
22 Ga0070680_100021196 3300005336 Bacteria 5164
23 Ga0070680_100172603 3300005336 Bacteria 1820
24 Ga0068868_100005952 3300005338 Bacteria 8601
25 Ga0068868_100009208 3300005338 Bacteria 7095
26 Ga0068868_100215362 3300005338 Bacteria 1607
27 Ga0070660_100098187 3300005339 Bacteria 2318
28 Ga0070660_100101082 3300005339 Bacteria 2285
29 Ga0070691_10070551 3300005341 Bacteria 1695
30 Ga0070668_100041755 3300005347 Bacteria 3514
31 Ga0070668_100062584 3300005347 Bacteria 2883
32 Ga0070671_100017933 3300005355 Bacteria 5742
33 Ga0070674_100076988 3300005356 Bacteria 2373
34 Ga0070674_100296474 3300005356 Bacteria 1287
35 Ga0070673_100183631 3300005364 Bacteria 1792
36 Ga0070709_10001520 3300005434 Bacteria 12532
37 Ga0070709_10011423 3300005434 Bacteria 4949
38 Ga0070709_10025696 3300005434 Bacteria 3482
39 Ga0070714_100081216 3300005435 Bacteria 2822
40 Ga0070714_100086974 3300005435 Bacteria 2732
41 Ga0070714_100109302 3300005435 Bacteria 2446
42 Ga0070713_100003802 3300005436 Bacteria 9991
43 Ga0070713_100032524 3300005436 Bacteria 4167
44 Ga0070713_100080905 3300005436 Bacteria 2771
45 Ga0070713_100081587 3300005436 Bacteria 2760
46 Ga0070713_100253337 3300005436 Bacteria 1606
47 Ga0070710_10000656 3300005437 Bacteria 16428
48 Ga0070710_10002985 3300005437 Bacteria 8039
49 Ga0070710_10020236 3300005437 Bacteria 3449
50 Ga0070711_100004436 3300005439 Bacteria 8279
51 Ga0070711_100005326 3300005439 Bacteria 7689
52 Ga0070711_100047709 3300005439 Bacteria 2925
53 Ga0070711_100052438 3300005439 Bacteria 2807
54 Ga0070694_100042928 3300005444 Bacteria 3021
55 Ga0070708_100112222 3300005445 Bacteria 2507
56 Ga0070663_100049161 3300005455 Bacteria 2993
57 Ga0070663_100051373 3300005455 Bacteria 2936
58 Ga0070663_100190735 3300005455 Bacteria 1595
59 Ga0070678_100030437 3300005456 Bacteria 3710
60 Ga0070678_100031850 3300005456 Bacteria 3642
61 Ga0070681_10034725 3300005458 Bacteria 5064
62 Ga0070698_100087771 3300005471 Bacteria 3096
63 Ga0070698_100151618 3300005471 Bacteria 2265
64 Ga0070679_100017100 3300005530 Bacteria 7011
65 Ga0070679_100031850 3300005530 Bacteria 5213
66 Ga0070679_100110000 3300005530 Bacteria 2742
67 Ga0070684_100027140 3300005535 Bacteria 4831
68 Ga0068853_100090980 3300005539 Bacteria 2682
69 Ga0068853_100385225 3300005539 Bacteria 1310
70 Ga0070686_100101383 3300005544 Bacteria 1946
71 Ga0070665_100004629 3300005548 Bacteria 14379
72 Ga0070665_100015575 3300005548 Bacteria 7638
73 Ga0068855_100181157 3300005563 Bacteria 2382
74 Ga0068857_100019162 3300005577 Bacteria 6006
75 Ga0068854_100144716 3300005578 Bacteria 1827
76 Ga0068856_100000137 3300005614 Bacteria 73762
77 Ga0068856_100089592 3300005614 Bacteria 3059
78 Ga0068856_100151171 3300005614 Bacteria 2331
79 Ga0070702_100037542 3300005615 Bacteria 2691
80 Ga0068852_100045438 3300005616 Bacteria 3735
81 Ga0068859_100119183 3300005617 Bacteria 2705
82 Ga0068864_100127071 3300005618 Bacteria 2285
83 Ga0068864_100206508 3300005618 Bacteria 1807
84 Ga0068866_10120683 3300005718 Bacteria 1477
85 Ga0068861_100034317 3300005719 Bacteria 3751
86 Ga0068870_10064809 3300005840 Bacteria 1974
87 Ga0068858_100045860 3300005842 Bacteria 4052
88 Ga0068858_100127363 3300005842 Bacteria 2385
89 Ga0068860_100000313 3300005843 Bacteria 66545
90 Ga0068860_100285936 3300005843 Bacteria 1612
91 Ga0068862_100075315 3300005844 Bacteria 2919
92 Ga0081455_10003860 3300005937 Bacteria 17086
93 Ga0081455_10007493 3300005937 Bacteria 11483
94 Ga0081455_10023465 3300005937 Bacteria 5739
95 Ga0081455_10054097 3300005937 Bacteria 3424
96 Ga0081538_10047308 3300005981 Bacteria 2640
97 Ga0081540_1003389 3300005983 Bacteria 12636
98 Ga0081540_1005657 3300005983 Bacteria 9294
99 Ga0081540_1012479 3300005983 Bacteria 5588
100 Ga0081540_1013267 3300005983 Bacteria 5368
101 Ga0081540_1019710 3300005983 Bacteria 4086
102 Ga0081540_1030350 3300005983 Bacteria 2995
103 Ga0081540_1032245 3300005983 Bacteria 2865
104 Ga0081540_1060906 3300005983 Bacteria 1802
105 Ga0081539_10000157 3300005985 Bacteria 158278
106 Ga0081539_10002599 3300005985 Bacteria 24763
107 Ga0081539_10017515 3300005985 Bacteria 5025
108 Ga0081539_10022796 3300005985 Bacteria 4126
109 Ga0081539_10057358 3300005985 Bacteria 2155
110 Ga0070717_10001671 3300006028 Bacteria 15424
111 Ga0070717_10017257 3300006028 Bacteria 5613
112 Ga0070717_10204002 3300006028 Bacteria 1733
113 Ga0075365_10012998 3300006038 Bacteria 4966
114 Ga0075365_10042277 3300006038 Bacteria 2979
115 Ga0075365_10065794 3300006038 Bacteria 2430
116 Ga0075365_10158192 3300006038 Bacteria 1578
117 Ga0075365_10211792 3300006038 Bacteria 1358
118 Ga0075368_10041613 3300006042 Bacteria 1805
119 Ga0075368_10056347 3300006042 Bacteria 1568
120 Ga0075363_100013603 3300006048 Bacteria 3951
121 Ga0075363_100021149 3300006048 Bacteria 3273
122 Ga0075363_100031275 3300006048 Bacteria 2759
123 Ga0075363_100041425 3300006048 Bacteria 2429
124 Ga0075363_100059526 3300006048 Bacteria 2054
125 Ga0075364_10047292 3300006051 Bacteria 2802
126 Ga0075364_10137182 3300006051 Bacteria 1644
127 Ga0070715_10000590 3300006163 Bacteria 9547
128 Ga0070715_10071086 3300006163 Bacteria 1555
129 Ga0070716_100017234 3300006173 Bacteria 3741
130 Ga0070712_100021384 3300006175 Bacteria 4250
131 Ga0075362_10051603 3300006177 Bacteria 1841
132 Ga0075367_10000722 3300006178 Bacteria 12799
133 Ga0075367_10001394 3300006178 Bacteria 10346
134 Ga0075367_10012975 3300006178 Bacteria 4464
135 Ga0075367_10102176 3300006178 Bacteria 1753
136 Ga0075366_10032723 3300006195 Bacteria 3061
137 Ga0097621_100014735 3300006237 Bacteria 5860
138 Ga0075370_10001262 3300006353 Bacteria 10776
139 Ga0075370_10008731 3300006353 Bacteria 5228
140 Ga0075370_10019237 3300006353 Bacteria 3717
141 Ga0075370_10083319 3300006353 Bacteria 1840
142 Ga0075434_100104354 3300006871 Bacteria 2844
143 Ga0075434_100271941 3300006871 Bacteria 1713
144 Ga0097620_100119191 3300006931 Bacteria 2705
145 Ga0099824_1008303 3300006942 Bacteria 13338
146 Ga0099822_1000541 3300006943 Bacteria 35996
147 Ga0105250_10049362 3300009092 Bacteria 1688
148 Ga0105240_10002492 3300009093 Bacteria 29572
149 Ga0105240_10031167 3300009093 Bacteria 6919
150 Ga0105240_10033967 3300009093 Bacteria 6585
151 Ga0105240_10094752 3300009093 Bacteria 3641
152 Ga0105240_10174427 3300009093 Bacteria 2543
153 Ga0105245_10117978 3300009098 Bacteria 2476
154 Ga0105247_10073098 3300009101 Bacteria 2148
155 Ga0114129_10285040 3300009147 Bacteria 2206
156 Ga0105241_10004267 3300009174 Bacteria 10572
157 Ga0105241_10026939 3300009174 Bacteria 4278
158 Ga0105248_10251915 3300009177 Bacteria 1987
159 Ga0105237_10017841 3300009545 Bacteria 7357
160 Ga0105237_10020566 3300009545 Bacteria 6801
161 Ga0105237_10082692 3300009545 Bacteria 3201
162 Ga0105237_10111420 3300009545 Bacteria 2729
163 Ga0105237_10148154 3300009545 Bacteria 2342
164 Ga0105237_10339257 3300009545 Bacteria 1507
165 Ga0105238_10191493 3300009551 Bacteria 2021
166 Ga0105238_10192363 3300009551 Bacteria 2016
167 Ga0105249_10097572 3300009553 Bacteria 2759
168 Ga0105239_10023011 3300010375 Bacteria 6870
169 Ga0105239_10031553 3300010375 Bacteria 5826
170 Ga0105239_10066232 3300010375 Bacteria 3968
171 Ga0105239_10091046 3300010375 Bacteria 3366
172 Ga0105239_10099249 3300010375 Bacteria 3219
173 Ga0105239_10354237 3300010375 Bacteria 1657
174 Ga0105246_10031978 3300011119 Bacteria 3486
175 Ga0157371_10082442 3300013102 Bacteria 2277
176 Ga0157369_10006548 3300013105 Bacteria 13480
177 Ga0157374_10057255 3300013296 Bacteria 3641
178 Ga0157374_10129159 3300013296 Bacteria 2444
179 Ga0157378_10001192 3300013297 Bacteria 23599
180 Ga0157378_10031729 3300013297 Bacteria 4666
181 Ga0157378_10206002 3300013297 Bacteria 1863
182 Ga0157378_10264155 3300013297 Bacteria 1653
183 Ga0163162_10081273 3300013306 Bacteria 3311
184 Ga0163162_10141798 3300013306 Bacteria 2517
185 Ga0157372_10139256 3300013307 Bacteria 2795
186 Ga0157372_10172733 3300013307 Bacteria 2501
187 Ga0157375_10006444 3300013308 Bacteria 10223
188 Ga0157375_10195176 3300013308 Bacteria 2179
189 Ga0157375_10480788 3300013308 Bacteria 1407
190 Ga0163163_10010769 3300014325 Bacteria 8250
191 Ga0163163_10031158 3300014325 Bacteria 5146
192 Ga0157380_10136861 3300014326 Bacteria 2098
193 Ga0157377_10060704 3300014745 Bacteria 2159
194 Ga0157376_10106890 3300014969 Bacteria 2456
195 Ga0206353_11382579 3300020082 Bacteria 1348
196 Ga0214544_1000003 3300021320 Bacteria 643752
197 Ga0214542_1000022 3300021321 Bacteria 193578
198 Ga0214545_1000010 3300021324 Bacteria 193578
199 Ga0214543_1000035 3300021327 Bacteria 183100
200 Ga0213876_10017171 3300021384 Bacteria 3821
201 Ga0213876_10044681 3300021384 Bacteria 2342
202 Ga0213876_10046958 3300021384 Bacteria 2283
203 Ga0213876_10108812 3300021384 Bacteria 1471
204 Ga0209677_100492 3300025253 Bacteria 22270
205 Ga0209148_1000267 3300025254 Bacteria 81839
206 Ga0209233_1001870 3300025261 Bacteria 8086
207 Ga0209233_1013744 3300025261 Bacteria 2304
208 Ga0209455_1004219 3300025272 Bacteria 4792
209 Ga0209455_1004254 3300025272 Bacteria 4760
210 Ga0209455_1008390 3300025272 Bacteria 2811
211 Ga0209564_1000718 3300025295 Bacteria 47576
212 Ga0209564_1002404 3300025295 Bacteria 14939
213 Ga0209564_1011905 3300025295 Bacteria 3847
214 Ga0209564_1028080 3300025295 Bacteria 1809
215 Ga0209758_1000015 3300025297 Bacteria 851943
216 Ga0209758_1000711 3300025297 Bacteria 49164
217 Ga0209758_1000764 3300025297 Bacteria 46385
218 Ga0209758_1001094 3300025297 Bacteria 35071
219 Ga0209758_1004096 3300025297 Bacteria 12498
220 Ga0209758_1011473 3300025297 Bacteria 5124
221 Ga0209256_1002592 3300025299 Bacteria 14393
222 Ga0209256_1019435 3300025299 Bacteria 2161
223 Ga0207426_1000368 3300025302 Bacteria 79715
224 Ga0207426_1013131 3300025302 Bacteria 3083
225 Ga0209257_1002989 3300025304 Bacteria 15349
226 Ga0207692_10004867 3300025898 Bacteria 5346
227 Ga0207692_10054264 3300025898 Bacteria 2046
228 Ga0207710_10096088 3300025900 Bacteria 1393
229 Ga0207688_10016777 3300025901 Bacteria 3976
230 Ga0207688_10063558 3300025901 Bacteria 2082
231 Ga0207699_10001435 3300025906 Bacteria 11313
232 Ga0207699_10003885 3300025906 Bacteria 7136
233 Ga0207699_10006921 3300025906 Bacteria 5519
234 Ga0207645_10149547 3300025907 Bacteria 1524
235 Ga0207643_10076315 3300025908 Bacteria 1936
236 Ga0207705_10029183 3300025909 Bacteria 3932
237 Ga0207684_10142304 3300025910 Bacteria 2062
238 Ga0207707_10000143 3300025912 Bacteria 74226
239 Ga0207707_10000613 3300025912 Bacteria 35676
240 Ga0207707_10030362 3300025912 Bacteria 4728
241 Ga0207707_10090452 3300025912 Bacteria 2675
242 Ga0207695_10000059 3300025913 Bacteria 363920
243 Ga0207695_10020632 3300025913 Bacteria 7543
244 Ga0207695_10177667 3300025913 Bacteria 2051
245 Ga0207671_10013578 3300025914 Bacteria 6481
246 Ga0207671_10088574 3300025914 Bacteria 2329
247 Ga0207671_10106177 3300025914 Bacteria 2132
248 Ga0207671_10145151 3300025914 Bacteria 1830
249 Ga0207671_10242235 3300025914 Bacteria 1417
250 Ga0207693_10005195 3300025915 Bacteria 10899
251 Ga0207693_10056281 3300025915 Bacteria 3083
252 Ga0207693_10159692 3300025915 Bacteria 1773
253 Ga0207663_10001411 3300025916 Bacteria 11145
254 Ga0207663_10099070 3300025916 Bacteria 1953
255 Ga0207663_10170928 3300025916 Bacteria 1544
256 Ga0207660_10026752 3300025917 Bacteria 3931
257 Ga0207660_10038751 3300025917 Bacteria 3328
258 Ga0207660_10173529 3300025917 Bacteria 1670
259 Ga0207657_10096510 3300025919 Bacteria 2459
260 Ga0207652_10023738 3300025921 Bacteria 5083
261 Ga0207694_10133399 3300025924 Bacteria 1992
262 Ga0207694_10152670 3300025924 Bacteria 1861
263 Ga0207687_10112719 3300025927 Bacteria 2022
264 Ga0207700_10007542 3300025928 Bacteria 6659
265 Ga0207700_10045941 3300025928 Bacteria 3226
266 Ga0207700_10064374 3300025928 Bacteria 2793
267 Ga0207700_10072426 3300025928 Bacteria 2657
268 Ga0207664_10064293 3300025929 Bacteria 2934
269 Ga0207664_10094469 3300025929 Bacteria 2458
270 Ga0207664_10176777 3300025929 Bacteria 1831
271 Ga0207664_10283691 3300025929 Bacteria 1454
272 Ga0207644_10025584 3300025931 Bacteria 4059
273 Ga0207690_10240562 3300025932 Bacteria 1394
274 Ga0207686_10030104 3300025934 Bacteria 3210
275 Ga0207686_10146933 3300025934 Bacteria 1636
276 Ga0207670_10263755 3300025936 Bacteria 1336
277 Ga0207665_10006088 3300025939 Bacteria 8010
278 Ga0207665_10031878 3300025939 Bacteria 3489
279 Ga0207711_10052528 3300025941 Bacteria 3493
280 Ga0207711_10055306 3300025941 Bacteria 3407
281 Ga0207661_10065867 3300025944 Bacteria 2941
282 Ga0207651_10171886 3300025960 Bacteria 1710
283 Ga0207651_10176730 3300025960 Bacteria 1689
284 Ga0207640_10008004 3300025981 Bacteria 5840
285 Ga0207677_10060703 3300026023 Bacteria 2615
286 Ga0207703_10128866 3300026035 Bacteria 2182
287 Ga0207639_10214675 3300026041 Bacteria 1658
288 Ga0207678_10016337 3300026067 Bacteria 6516
289 Ga0207678_10017766 3300026067 Bacteria 6245
290 Ga0207678_10019513 3300026067 Bacteria 5956
291 Ga0207678_10033040 3300026067 Bacteria 4508
292 Ga0207678_10059483 3300026067 Bacteria 3287
293 Ga0207678_10060315 3300026067 Bacteria 3263
294 Ga0207678_10090054 3300026067 Bacteria 2622
295 Ga0207702_10000063 3300026078 Bacteria 123034
296 Ga0207702_10042949 3300026078 Bacteria 3793
297 Ga0207702_10091162 3300026078 Bacteria 2668
298 Ga0207641_10037994 3300026088 Bacteria 4024
299 Ga0207641_10079791 3300026088 Bacteria 2838
300 Ga0207648_10023956 3300026089 Bacteria 5457
301 Ga0207674_10027211 3300026116 Bacteria 6054
302 Ga0207674_10061985 3300026116 Bacteria 3777
303 Ga0207675_100037599 3300026118 Bacteria 4514
304 Ga0207683_10038422 3300026121 Bacteria 4172
305 Ga0207683_10040055 3300026121 Bacteria 4087
306 Ga0207698_10314242 3300026142 Bacteria 1464
307 Ga0209389_1000012 3300027296 Bacteria 213243
308 Ga0209389_1000069 3300027296 Bacteria 98063
309 Ga0209589_1000015 3300027357 Bacteria 225913
310 Ga0209589_1000077 3300027357 Bacteria 98063
311 Ga0209489_100015 3300027361 Bacteria 225913
312 Ga0209489_100019 3300027361 Bacteria 213243
313 Ga0209489_100020 3300027361 Bacteria 207541
314 Ga0209700_100018 3300027363 Bacteria 238200
315 Ga0209700_100025 3300027363 Bacteria 225913
316 Ga0209179_1004877 3300027512 Bacteria 2059
317 Ga0207428_10148947 3300027907 Bacteria 1782
318 Ga0268266_10003840 3300028379 Bacteria 14672
319 Ga0268266_10008431 3300028379 Bacteria 9163
320 Ga0268266_10034518 3300028379 Bacteria 4302
321 Ga0268264_10000356 3300028381 Bacteria 68810
322 Ga0265323_10007414 3300028653 Bacteria 4559
323 Ga0265336_10000346 3300028666 Bacteria 30553
324 Ga0307517_10001423 3300028786 Bacteria 40213
325 Ga0307515_10032146 3300028794 Bacteria 8708
326 Ga0307515_10090460 3300028794 Bacteria 3838
327 Ga0307515_10252869 3300028794 Bacteria 1511
328 Ga0265338_10000417 3300028800 Bacteria 76249
329 Ga0307511_10087863 3300030521 Bacteria 2130
330 Ga0265325_10109984 3300031241 Bacteria 1340
331 Ga0265340_10002373 3300031247 Bacteria 10714
332 Ga0265339_10003359 3300031249 Bacteria 11199
333 Ga0265339_10008317 3300031249 Bacteria 6608
334 Ga0307509_10119372 3300031507 Bacteria 2618
335 Ga0307508_10000012 3300031616 Bacteria 243167
336 Ga0307508_10013966 3300031616 Bacteria 7327
337 Ga0307508_10095708 3300031616 Bacteria 2560
338 Ga0307508_10148584 3300031616 Bacteria 1948
339 Ga0265314_10032879 3300031711 Bacteria 3810
340 Ga0265314_10043122 3300031711 Bacteria 3210
341 Ga0307516_10010102 3300031730 Bacteria 10436
342 Ga0307516_10074049 3300031730 Bacteria 3262
343 Ga0307516_10118097 3300031730 Bacteria 2446
344 Ga0307516_10167679 3300031730 Bacteria 1939
345 Ga0307409_100106920 3300031995 Bacteria 2336
346 Ga0307416_100170057 3300032002 Bacteria 2027
347 Ga0307415_100136139 3300032126 Bacteria 1868
348 Ga0307507_10092970 3300033179 Bacteria 2571
349 Ga0307510_10015377 3300033180 Bacteria 9047
350 Ga0307510_10023362 3300033180 Bacteria 7168
351 Ga0307510_10068023 3300033180 Bacteria 3579
352 Ga0307510_10100483 3300033180 Bacteria 2686
353 Ga0315911_1000037 3300033442 Bacteria 62198
354 Ga0373930_0020548 3300034816 Bacteria 1288
355 Ga0373934_0002532 3300035086 Bacteria 6723
356 Ga0373923_0003267 3300035111 Bacteria 5166
357 Ga0373923_0059362 3300035111 Bacteria 1621
358 Ga0373936_0001098 3300035113 Bacteria 9698
359 Ga0373936_0042302 3300035113 Bacteria 1829
360 Ga0373936_0043904 3300035113 Bacteria 1797
361 Ga0373945_0001922 3300035116 Bacteria 6445
362 Ga0373953_0001769 3300035117 Bacteria 6378
363 Ga0373953_0009391 3300035117 Bacteria 3364
364 Ga0373954_0002946 3300035118 Bacteria 7181
365 Ga0373954_0006705 3300035118 Bacteria 5021
366 Ga0373956_0000376 3300035119 Bacteria 18268
367 Ga0373957_0005684 3300035120 Bacteria 3881
368 Ga0373957_0046825 3300035120 Bacteria 1642
369 Ga0373943_0071667 3300035170 Bacteria 1756
370 Ga0373955_0000325 3300035172 Bacteria 19823
371 Ga0373955_0067917 3300035172 Bacteria 1985
372 Ga0373955_0086410 3300035172 Bacteria 1781
373 Ga0373942_0033799 3300035207 Bacteria 1365
374 Ga0373924_0007619 3300035410 Bacteria 3912
375 Ga0373924_0007815 3300035410 Bacteria 3866
376 Ga0373924_0065537 3300035410 Bacteria 1525
377 Ga0373931_0009747 3300035691 Bacteria 4598
378 Ga0373935_0007815 3300035692 Bacteria 6411
379 Ga0373935_0050257 3300035692 Bacteria 2646
380 Ga0373935_0127495 3300035692 Bacteria 1706
381 Ga0373927_0000137 3300035695 Bacteria 56546
382 Ga0373927_0017402 3300035695 Bacteria 4730
383 Ga0373927_0036587 3300035695 Bacteria 3192
384 Ga0373927_0068754 3300035695 Bacteria 2292
385 Ga0373927_0082856 3300035695 Bacteria 2080
386 Ga0373927_0121167 3300035695 Bacteria 1707
387 Ga0373933_0000108 3300035724 Bacteria 53024
388 Ga0373933_0099071 3300035724 Bacteria 1806
389 Ga0373947_0000902 3300035725 Bacteria 17985
390 Ga0373947_0012959 3300035725 Bacteria 4780
391 Ga0373947_0141466 3300035725 Bacteria 1543
392 Ga0373937_0007855 3300036401 Bacteria 9247
393 Ga0373937_0024716 3300036401 Bacteria 5421
394 Ga0373925_0002159 3300037068 Bacteria 16068
395 Ga0373925_0010829 3300037068 Bacteria 6612
396 Ga0373925_0027502 3300037068 Bacteria 4162
397 Ga0373925_0036147 3300037068 Bacteria 3646
398 Ga0373925_0062118 3300037068 Bacteria 2808
399 Ga0373925_0173665 3300037068 Bacteria 1702
400 Ga0373925_0203260 3300037068 Bacteria 1576
401 Ga0373925_0219803 3300037068 Bacteria 1516
402 Ga0395900_0001756 3300037418 Bacteria 24872
403 Ga0395900_0010446 3300037418 Bacteria 9497
404 Ga0395900_0351119 3300037418 Bacteria 1448
405 Ga0395898_0035306 3300037466 Bacteria 4974
406 Ga0395898_0058280 3300037466 Bacteria 3760
407 Ga0395905_0098242 3300037471 Bacteria 2749
408 Ga0395905_0161755 3300037471 Bacteria 2104
409 Ga0395905_0196810 3300037471 Bacteria 1890
410 Ga0395905_0221082 3300037471 Bacteria 1772
411 Ga0436364_0461113 3300037853 Bacteria 2216
412 Ga0436364_0735016 3300037853 Bacteria 1210
413 Ga0436364_0948768 3300037853 Bacteria 1461
414 Ga0395901_0028786 3300038443 Bacteria 5715
415 Ga0395901_0109804 3300038443 Bacteria 2896
416 Ga0436365_0457714 3300039437 Bacteria 7003
417 Ga0436365_0592130 3300039437 Bacteria 8188
418 Ga0436365_1312844 3300039437 Bacteria 2246
419 Ga0436361_0474776 3300039447 Bacteria 6557
420 Ga0439465_0024103 3300041413 Bacteria 1917
421 Ga0439465_0029460 3300041413 Bacteria 1744
422 Ga0451795_0601895 3300041456 Bacteria 1789
423 Ga0466969_0050676 3300044656 Bacteria 2046
424 Ga0466972_0000100 3300044658 Bacteria 76018
425 Ga0466972_0014629 3300044658 Bacteria 3927
426 Ga0466965_0011221 3300044683 Bacteria 4195
427 Ga0466966_0001463 3300044684 Bacteria 15199
428 Ga0466961_0000601 3300044693 Bacteria 22652
429 Ga0466963_0058249 3300044694 Bacteria 2575
430 Ga0466963_0121410 3300044694 Bacteria 1799
431 Ga0466968_0008001 3300044735 Bacteria 4039
432 Ga0466957_0117662 3300044842 Bacteria 1692
433 Ga0466959_0000634 3300045049 Bacteria 20407
434 Ga0466958_0012458 3300045836 Bacteria 4821
435 Ga0466967_0161245 3300045976 Bacteria 2105
436 Ga0466967_0227567 3300045976 Bacteria 1774
437 Ga0466967_0302164 3300045976 Bacteria 1540
438 Ga0495592_0000339 3300046454 Bacteria 38389
439 Ga0495592_0008958 3300046454 Bacteria 7516
440 Ga0495592_0033013 3300046454 Bacteria 3905
441 Ga0495592_0034020 3300046454 Bacteria 3843
442 Ga0495592_0058113 3300046454 Bacteria 2853
443 Ga0495603_0000277 3300046455 Bacteria 27280
444 Ga0495603_0011788 3300046455 Bacteria 5292
445 Ga0495603_0030573 3300046455 Bacteria 3243
446 Ga0495603_0058565 3300046455 Bacteria 2277
447 Ga0495603_0063865 3300046455 Bacteria 2171
448 Ga0495603_0064886 3300046455 Bacteria 2152
449 Ga0495629_0000029 3300046459 Bacteria 127000
450 Ga0495629_0001483 3300046459 Bacteria 18494
451 Ga0495629_0043490 3300046459 Bacteria 3153
452 Ga0495629_0056255 3300046459 Bacteria 2751
453 Ga0495629_0057452 3300046459 Bacteria 2721
454 Ga0495629_0081882 3300046459 Bacteria 2253
455 Ga0495641_0003605 3300046461 Bacteria 11465
456 Ga0495651_0031486 3300046462 Bacteria 4136
457 Ga0495651_0034091 3300046462 Bacteria 3969
458 Ga0495651_0042153 3300046462 Bacteria 3545
459 Ga0495651_0053385 3300046462 Bacteria 3111
460 Ga0495651_0105986 3300046462 Bacteria 2084
461 Ga0495653_0001063 3300046463 Bacteria 21155
462 Ga0495580_0002567 3300046472 Bacteria 15791
463 Ga0495582_0000024 3300046473 Bacteria 82444
464 Ga0495582_0008119 3300046473 Bacteria 5796
465 Ga0495605_0056580 3300046474 Bacteria 1891
466 Ga0495639_0000006 3300046475 Bacteria 100361
467 Ga0495639_0127276 3300046475 Bacteria 1218
468 Ga0495662_0000348 3300046476 Bacteria 20253
469 Ga0495662_0062304 3300046476 Bacteria 1802
470 Ga0495664_0007034 3300046477 Bacteria 6232
471 Ga0495664_0013716 3300046477 Bacteria 4596
472 Ga0495664_0163539 3300046477 Bacteria 1350
473 Ga0495584_0035543 3300046491 Bacteria 2518
474 Ga0495585_0105255 3300046492 Bacteria 1505
475 Ga0495594_0000170 3300046499 Bacteria 31295
476 Ga0495606_0013516 3300046507 Bacteria 6440
477 Ga0495606_0083744 3300046507 Bacteria 1977
478 Ga0495608_0075302 3300046511 Bacteria 2199
479 Ga0495608_0190980 3300046511 Bacteria 1293
480 Ga0495610_0044538 3300046512 Bacteria 2202
481 Ga0495610_0058795 3300046512 Bacteria 1838
482 Ga0495610_0112766 3300046512 Bacteria 1202
483 Ga0495616_0038012 3300046513 Bacteria 2473
484 Ga0495618_0018824 3300046514 Bacteria 4242
485 Ga0495628_0010789 3300046516 Bacteria 7737
486 Ga0495628_0014226 3300046516 Bacteria 6678
487 Ga0495628_0074634 3300046516 Bacteria 2641
488 Ga0495628_0079529 3300046516 Bacteria 2549
489 Ga0495630_0003257 3300046517 Bacteria 11317
490 Ga0495630_0058889 3300046517 Bacteria 2880
491 Ga0495648_0016531 3300046524 Bacteria 5317
492 Ga0495648_0019778 3300046524 Bacteria 4718
493 Ga0495648_0027989 3300046524 Bacteria 3763
494 Ga0495666_0011725 3300046526 Bacteria 4370
495 Ga0495666_0031438 3300046526 Bacteria 2601
496 Ga0495652_0040442 3300046529 Bacteria 4030
497 Ga0495652_0047155 3300046529 Bacteria 3696
498 Ga0495652_0061633 3300046529 Bacteria 3165
499 Ga0495652_0101400 3300046529 Bacteria 2333
500 Ga0495665_0000178 3300046531 Bacteria 32333
501 Ga0495665_0044353 3300046531 Bacteria 2363
502 Ga0495640_0003797 3300046533 Bacteria 12127
503 Ga0495640_0004410 3300046533 Bacteria 11233
504 Ga0495640_0022850 3300046533 Bacteria 4566
505 Ga0495587_0087441 3300046536 Bacteria 1803
506 Ga0495587_0127658 3300046536 Bacteria 1454
507 Ga0495597_0014928 3300046542 Bacteria 3689
508 Ga0495645_0033925 3300046543 Bacteria 3723
509 Ga0495645_0052192 3300046543 Bacteria 2976
510 Ga0495645_0100650 3300046543 Bacteria 2055
511 Ga0495622_0002996 3300046557 Bacteria 8018
512 Ga0495622_0015955 3300046557 Bacteria 3493
513 Ga0495622_0031914 3300046557 Bacteria 2460
514 Ga0495622_0044412 3300046557 Bacteria 2065
515 Ga0495622_0046682 3300046557 Bacteria 2012
516 Ga0495667_0003075 3300046559 Bacteria 11195
517 Ga0495667_0074387 3300046559 Bacteria 2212
518 Ga0495667_0088315 3300046559 Bacteria 2009
519 Ga0495656_0007598 3300046615 Bacteria 3838
520 Ga0495656_0008501 3300046615 Bacteria 3666
521 Ga0495656_0023243 3300046615 Bacteria 2438
522 Ga0495668_0148417 3300046616 Bacteria 1284
523 Ga0495634_0000354 3300046642 Bacteria 44714
524 Ga0495634_0002330 3300046642 Bacteria 15886
525 Ga0495634_0023750 3300046642 Bacteria 4308
526 Ga0495634_0033779 3300046642 Bacteria 3513
527 Ga0495634_0037146 3300046642 Bacteria 3329
528 Ga0495634_0162458 3300046642 Bacteria 1407
529 Ga0495611_0053797 3300046648 Bacteria 1818
530 Ga0495625_0014247 3300046660 Bacteria 6356
531 Ga0495625_0030852 3300046660 Bacteria 3994
532 Ga0495635_0000917 3300046663 Bacteria 19365
533 Ga0495635_0002291 3300046663 Bacteria 13017
534 Ga0495635_0006214 3300046663 Bacteria 8323
535 Ga0495635_0018638 3300046663 Bacteria 4842
536 Ga0495659_0049165 3300046664 Bacteria 1530
537 Ga0495588_0020824 3300046674 Bacteria 3227
538 Ga0495657_0003543 3300046675 Bacteria 12725
539 Ga0495657_0005133 3300046675 Bacteria 10381
540 Ga0495657_0009727 3300046675 Bacteria 7262
541 Ga0495657_0066994 3300046675 Bacteria 2358
542 Ga0495599_0005791 3300046678 Bacteria 7417
543 Ga0495599_0036803 3300046678 Bacteria 3075
544 Ga0495599_0038886 3300046678 Bacteria 2990
545 Ga0495599_0051217 3300046678 Bacteria 2587
546 Ga0495623_0010483 3300046679 Bacteria 5998
547 Ga0495623_0013015 3300046679 Bacteria 5388
548 Ga0495646_0000902 3300046680 Bacteria 16844
549 Ga0495646_0003762 3300046680 Bacteria 9487
550 Ga0495646_0037428 3300046680 Bacteria 3001
551 Ga0495646_0056213 3300046680 Bacteria 2360
552 Ga0495647_0002169 3300046681 Bacteria 6134
553 Ga0495647_0025404 3300046681 Bacteria 2164
554 Ga0495658_0000428 3300046683 Bacteria 23516
555 Ga0495658_0013755 3300046683 Bacteria 4124
556 Ga0495669_0057920 3300046684 Bacteria 1748
557 Ga0495613_0001078 3300046689 Bacteria 20808
558 Ga0495613_0012318 3300046689 Bacteria 6353
559 Ga0495613_0067784 3300046689 Bacteria 2604
560 Ga0495613_0067799 3300046689 Bacteria 2604
561 Ga0495624_0000788 3300046690 Bacteria 24985
562 Ga0495624_0039622 3300046690 Bacteria 3020
563 Ga0495624_0065431 3300046690 Bacteria 2271
564 Ga0495670_0006876 3300046691 Bacteria 5596
565 Ga0495671_0049797 3300046692 Bacteria 2087
566 Ga0495649_0067447 3300046694 Bacteria 1919
567 Ga0495600_0002741 3300046809 Bacteria 10203
568 Ga0495600_0006367 3300046809 Bacteria 7183
569 Ga0495600_0091394 3300046809 Bacteria 1985
570 Ga0495660_0030369 3300046810 Bacteria 3044
571 Ga0495581_0000004 3300047315 Bacteria 84424
572 Ga0495581_0029027 3300047315 Bacteria 3207
573 Ga0495581_0064398 3300047315 Bacteria 2118
574 Ga0495581_0096450 3300047315 Bacteria 1717
575 Ga0495604_0000678 3300047317 Bacteria 28877
576 Ga0495604_0007941 3300047317 Bacteria 8404
577 Ga0495604_0024945 3300047317 Bacteria 4768
578 Ga0495674_0000415 3300047319 Bacteria 38235
579 Ga0495674_0007236 3300047319 Bacteria 10620
580 Ga0495674_0026281 3300047319 Bacteria 5328
581 Ga0495672_0018820 3300047320 Bacteria 4574
582 Ga0495672_0041687 3300047320 Bacteria 2774
583 Ga0495672_0084711 3300047320 Bacteria 1758
584 Ga0495676_0019876 3300047321 Bacteria 5903
585 Ga0495676_0032444 3300047321 Bacteria 4408
586 Ga0495676_0037764 3300047321 Bacteria 4016
587 Ga0495676_0109575 3300047321 Bacteria 2029
588 Ga0495676_0110006 3300047321 Bacteria 2023
589 Ga0495680_0001164 3300047322 Bacteria 28965
590 Ga0495680_0239647 3300047322 Bacteria 1289
591 Ga0495687_010280 3300047443 Bacteria 5141
592 Ga0495675_0000901 3300047444 Bacteria 18140
593 Ga0495675_0012017 3300047444 Bacteria 5442
594 Ga0495675_0068840 3300047444 Bacteria 2235
595 Ga0495677_0027542 3300047445 Bacteria 2062
596 Ga0495685_052355 3300047447 Bacteria 1383
597 Ga0495673_0028163 3300047469 Bacteria 2664
598 Ga0495684_0000721 3300047471 Bacteria 26637
599 Ga0495684_0009275 3300047471 Bacteria 7597
600 Ga0495684_0064676 3300047471 Bacteria 2780
601 Ga0495684_0132607 3300047471 Bacteria 1870
602 Ga0495593_0000198 3300047673 Bacteria 31587
603 Ga0495593_0003019 3300047673 Bacteria 10137
604 Ga0495593_0004072 3300047673 Bacteria 8702
605 Ga0495593_0012359 3300047673 Bacteria 4879
606 Ga0495602_0007817 3300048088 Bacteria 11179
607 Ga0495602_0060850 3300048088 Bacteria 3287
608 Ga0495602_0068869 3300048088 Bacteria 3037
609 Ga0495614_0010431 3300048089 Bacteria 4097
610 Ga0495626_0021097 3300048091 Bacteria 3238
611 Ga0495626_0033878 3300048091 Bacteria 2446
612 Ga0496100_0059742 3300048903 Bacteria 2506
613 Ga0496100_0076187 3300048903 Bacteria 2252
614 Ga0496101_0051291 3300048904 Bacteria 2972
615 Ga0496101_0075732 3300048904 Bacteria 2477
616 Ga0496102_0010100 3300048905 Bacteria 8120
617 Ga0496102_0039067 3300048905 Bacteria 4286
618 Ga0496102_0094833 3300048905 Bacteria 2765
619 Ga0496102_0143511 3300048905 Bacteria 2240
620 Ga0496102_0253222 3300048905 Bacteria 1660
621 Ga0496103_0028235 3300048906 Bacteria 3403
622 Ga0496103_0088357 3300048906 Bacteria 1954
623 Ga0496104_0014507 3300048907 Bacteria 7117
624 Ga0496104_0069211 3300048907 Bacteria 3354
625 Ga0496104_0127620 3300048907 Bacteria 2442
626 Ga0496104_0152912 3300048907 Bacteria 2214
627 Ga0496105_0007733 3300048908 Bacteria 8340
628 Ga0496105_0023125 3300048908 Bacteria 5040
629 Ga0496105_0104649 3300048908 Bacteria 2337
630 Ga0496105_0158139 3300048908 Bacteria 1860
631 Ga0496106_0001953 3300048909 Bacteria 15491
632 Ga0496106_0008314 3300048909 Bacteria 7679
633 Ga0496106_0068753 3300048909 Bacteria 2702
634 Ga0496106_0111956 3300048909 Bacteria 2126
635 Ga0496106_0136444 3300048909 Bacteria 1927
636 Ga0496107_0026534 3300048910 Bacteria 4108
637 Ga0496108_0024837 3300048911 Bacteria 4934
638 Ga0496108_0084715 3300048911 Bacteria 2690
639 Ga0496108_0137501 3300048911 Bacteria 2103
640 Ga0496108_0164457 3300048911 Bacteria 1918
641 Ga0496109_0086237 3300048912 Bacteria 2899
642 Ga0496109_0117930 3300048912 Bacteria 2471
643 Ga0496109_0119096 3300048912 Bacteria 2458
644 Ga0496110_0067758 3300048913 Bacteria 3158
645 Ga0496110_0097259 3300048913 Bacteria 2638
646 Ga0496110_0148774 3300048913 Bacteria 2119
647 Ga0496110_0184677 3300048913 Bacteria 1893
648 Ga0496110_0209272 3300048913 Bacteria 1773
649 Ga0496111_0039021 3300048914 Bacteria 3403
650 Ga0496111_0132668 3300048914 Bacteria 1844
651 Ga0496111_0176718 3300048914 Bacteria 1587
652 Ga0496112_0000035 3300048915 Bacteria 106983
653 Ga0496112_0005407 3300048915 Bacteria 11041
654 Ga0496112_0012245 3300048915 Bacteria 7876
655 Ga0496112_0012881 3300048915 Bacteria 7699
656 Ga0496112_0097098 3300048915 Bacteria 2917
657 Ga0496113_0012388 3300048916 Bacteria 5730
658 Ga0496113_0078640 3300048916 Bacteria 2523
659 Ga0496113_0100776 3300048916 Bacteria 2238
660 Ga0496114_0089409 3300048917 Bacteria 2613
661 Ga0496115_0009406 3300048918 Bacteria 7262
662 Ga0496115_0027885 3300048918 Bacteria 4421
663 Ga0496115_0064612 3300048918 Bacteria 2954
664 Ga0496115_0104129 3300048918 Bacteria 2329
665 Ga0496115_0106861 3300048918 Bacteria 2298
666 Ga0496116_0000965 3300048919 Bacteria 35491
667 Ga0496116_0027251 3300048919 Bacteria 4163
668 Ga0496117_0040145 3300048920 Bacteria 3447
669 Ga0496117_0090678 3300048920 Bacteria 1968
670 Ga0496117_0123782 3300048920 Bacteria 1583
671 Ga0496118_0006555 3300048921 Bacteria 12729
672 Ga0496118_0011084 3300048921 Bacteria 8847
673 Ga0496118_0028559 3300048921 Bacteria 4695
674 Ga0496118_0069557 3300048921 Bacteria 2548
675 Ga0496118_0083383 3300048921 Bacteria 2235
676 Ga0496118_0147501 3300048921 Bacteria 1478
677 Ga0496118_0162829 3300048921 Bacteria 1376
678 Ga0496119_0050692 3300048922 Bacteria 2556
679 Ga0496119_0090924 3300048922 Bacteria 1734
680 Ga0496119_0104129 3300048922 Bacteria 1588
681 Ga0496120_0003365 3300048923 Bacteria 14668
682 Ga0496120_0026986 3300048923 Bacteria 3539
683 Ga0496121_0001622 3300048924 Bacteria 37285
684 Ga0496121_0002148 3300048924 Bacteria 30905
685 Ga0496121_0003594 3300048924 Bacteria 21886
686 Ga0496121_0020688 3300048924 Bacteria 6493
687 Ga0496121_0029073 3300048924 Bacteria 5124
688 Ga0496121_0033947 3300048924 Bacteria 4603
689 Ga0496121_0046952 3300048924 Bacteria 3689
690 Ga0496121_0054013 3300048924 Bacteria 3361
691 Ga0496121_0060870 3300048924 Bacteria 3102
692 Ga0496121_0063382 3300048924 Bacteria 3021
693 Ga0496121_0095914 3300048924 Bacteria 2303
694 Ga0496122_0049255 3300048925 Bacteria 3229
695 Ga0496123_0006724 3300048926 Bacteria 11061
696 Ga0496123_0073867 3300048926 Bacteria 2113
697 Ga0496124_0009366 3300048927 Bacteria 10092
698 Ga0496124_0098855 3300048927 Bacteria 2367
699 Ga0496125_0001356 3300048928 Bacteria 36075
700 Ga0496125_0001441 3300048928 Bacteria 34581
701 Ga0496125_0001630 3300048928 Bacteria 31638
702 Ga0496125_0042831 3300048928 Bacteria 3850
703 Ga0496125_0057923 3300048928 Bacteria 3133
704 Ga0496125_0060229 3300048928 Bacteria 3053
705 Ga0496125_0094540 3300048928 Bacteria 2226
706 Ga0496125_0195548 3300048928 Bacteria 1330
707 Ga0496126_0003472 3300048929 Bacteria 19892
708 Ga0496126_0005839 3300048929 Bacteria 13910
709 Ga0496126_0010376 3300048929 Bacteria 9777
710 Ga0496126_0014638 3300048929 Bacteria 7918
711 Ga0496126_0017647 3300048929 Bacteria 7109
712 Ga0496126_0021771 3300048929 Bacteria 6253
713 Ga0496126_0041017 3300048929 Bacteria 4288
714 Ga0496126_0043071 3300048929 Bacteria 4167
715 Ga0496126_0047705 3300048929 Bacteria 3920
716 Ga0496126_0110276 3300048929 Bacteria 2397
717 Ga0501031_0001791 3300049568 Bacteria 13478
718 Ga0501032_0000073 3300049569 Bacteria 85584
719 Ga0501033_0000136 3300049570 Bacteria 70952
720 Ga0501033_0044103 3300049570 Bacteria 3320
721 Ga0501034_0000251 3300049571 Bacteria 99406
722 Ga0501036_0000036 3300049572 Bacteria 87244
723 Ga0501036_0199252 3300049572 Bacteria 1684
724 Ga0501037_0001715 3300049573 Bacteria 15897
725 Ga0501038_0000428 3300049574 Bacteria 36623
726 Ga0501038_0191908 3300049574 Bacteria 1643
727 Ga0501039_0000273 3300049575 Bacteria 37431
728 Ga0501042_0019699 3300049578 Bacteria 4690
729 Ga0501042_0099665 3300049578 Bacteria 2089
730 Ga0501043_0000165 3300049579 Bacteria 59980
731 Ga0501043_0010054 3300049579 Bacteria 7420
732 Ga0501043_0222635 3300049579 Bacteria 1459
733 Ga0501046_0001143 3300049580 Bacteria 25820
734 Ga0501047_0000340 3300049581 Bacteria 53278
735 Ga0501047_0147575 3300049581 Bacteria 2228
736 Ga0501067_0014425 3300049583 Bacteria 4375
737 Ga0501067_0039960 3300049583 Bacteria 2605
738 Ga0501068_0003807 3300049584 Bacteria 8179
739 Ga0501069_0005466 3300049585 Bacteria 6608
740 Ga0501070_0006502 3300049586 Bacteria 9938
741 Ga0501070_0193980 3300049586 Bacteria 1669
742 Ga0501072_0001213 3300049588 Bacteria 19257
743 Ga0501073_0000037 3300049589 Bacteria 87345
744 Ga0501076_0299103 3300049592 Bacteria 1319
745 Ga0501079_0001057 3300049741 Bacteria 19118
746 Ga0501080_0003259 3300049742 Bacteria 14325
747 Ga0501035_0000142 3300049822 Bacteria 87561
748 Ga0501044_0000414 3300049823 Bacteria 52784
749 Ga0501044_0047997 3300049823 Bacteria 4414
750 Ga0501044_0107750 3300049823 Bacteria 2797
751 Ga0501044_0109662 3300049823 Bacteria 2769
752 Ga0501044_0110374 3300049823 Bacteria 2759
753 nmdc:mga03683_46130_c1 3300050489 Bacteria 1806
754 nmdc:mga03n38_17691_c1 3300050490 Bacteria 2797
755 nmdc:mga03n38_18684_c1 3300050490 Bacteria 2740
756 nmdc:mga03n38_70566_c1 3300050490 Bacteria 1616
757 nmdc:mga03n38_957_c1 3300050490 Bacteria 7831
758 nmdc:mga00v17_49103_c1 3300050491 Bacteria 2559
759 nmdc:mga00v17_61593_c1 3300050491 Bacteria 2307
760 nmdc:mga0yw44_16568_c1 3300050492 Bacteria 3985
761 nmdc:mga0yw44_21933_c1 3300050492 Bacteria 3571
762 nmdc:mga0yw44_4551_c1 3300050492 Bacteria 6383
763 nmdc:mga0yw44_50490_c1 3300050492 Bacteria 2515
764 nmdc:mga0yw44_62231_c1 3300050492 Bacteria 2292
765 nmdc:mga0yw44_85060_c1 3300050492 Bacteria 1990
766 nmdc:mga0k408_68589_c1 3300050493 Bacteria 2069
767 nmdc:mga0k408_88982_c1 3300050493 Bacteria 1813
768 nmdc:mga06z11_1871_c1 3300050494 Bacteria 7925
769 nmdc:mga06z11_2498_c1 3300050494 Bacteria 7030
770 nmdc:mga06z11_36176_c1 3300050494 Bacteria 2436
771 nmdc:mga04h51_24891_c1 3300050495 Bacteria 1838
772 nmdc:mga04h51_25760_c1 3300050495 Bacteria 1813
773 nmdc:mga07m45_2419_c1 3300050496 Bacteria 8757
774 nmdc:mga07m45_2500_c2 3300050496 Bacteria 7815
775 nmdc:mga07m45_44349_c1 3300050496 Bacteria 2496
776 nmdc:mga08y16_127311_c1 3300050511 Bacteria 2649
777 nmdc:mga0n895_45691_c1 3300050512 Bacteria 4274
778 nmdc:mga0sz30_72698_c1 3300050516 Bacteria 1482
779 Ga0495601_0041651 3300053077 Bacteria 2880
780 Ga0500635_0009854 3300053080 Bacteria 2664
781 Ga0495595_0000828 3300053084 Bacteria 11843
782 Ga0495595_0073753 3300053084 Bacteria 1616
783 Ga0495619_0000912 3300053085 Bacteria 19381
784 Ga0495619_0198200 3300053085 Bacteria 1390
785 Ga0500578_0126224 3300053086 Bacteria 1606
786 Ga0500643_000048 3300053087 Bacteria 147879
787 Ga0500644_0023241 3300053088 Bacteria 1880
788 Ga0500647_0045982 3300053091 Bacteria 2097
789 Ga0500583_0019068 3300053092 Bacteria 2804
790 Ga0500651_0046117 3300053093 Bacteria 2741
791 Ga0500651_0141612 3300053093 Bacteria 1449
792 Ga0500566_0000223 3300053094 Bacteria 30380
793 Ga0500566_0004965 3300053094 Bacteria 7920
794 Ga0500566_0006352 3300053094 Bacteria 7020
795 Ga0500566_0007034 3300053094 Bacteria 6659
796 Ga0500640_022290 3300053095 Bacteria 2736
797 Ga0500641_0013850 3300053096 Bacteria 2967
798 Ga0500554_038657 3300053102 Bacteria 1453
799 Ga0500555_005336 3300053103 Bacteria 3646
800 Ga0500556_0000003 3300053104 Bacteria 679379
801 Ga0500556_0002950 3300053104 Bacteria 5142
802 Ga0500557_000083 3300053105 Bacteria 32931
803 Ga0500562_026505 3300053108 Bacteria 1519
804 Ga0500572_000389 3300053111 Bacteria 15536
805 Ga0500572_003205 3300053111 Bacteria 3773
806 Ga0500592_005061 3300053116 Bacteria 2094
807 Ga0500594_0018254 3300053118 Bacteria 1725
808 Ga0500594_0041141 3300053118 Bacteria 1265
809 Ga0500595_000333 3300053119 Bacteria 30925
810 Ga0500595_002703 3300053119 Bacteria 8594
811 Ga0500595_017370 3300053119 Bacteria 2657
812 Ga0500595_025546 3300053119 Bacteria 2045
813 Ga0500608_007296 3300053122 Bacteria 4564
814 Ga0500642_0000015 3300053130 Bacteria 181424
815 Ga0500642_0000642 3300053130 Bacteria 10422
816 Ga0500652_000665 3300053131 Bacteria 11648
817 Ga0500559_0000230 3300053136 Bacteria 44504
818 Ga0500559_0000461 3300053136 Bacteria 28939
819 Ga0500559_0009186 3300053136 Bacteria 4292
820 Ga0500568_0000536 3300053139 Bacteria 27978
821 Ga0500568_0022304 3300053139 Bacteria 2711
822 Ga0500577_0003157 3300053142 Bacteria 4266
823 Ga0500577_0056783 3300053142 Bacteria 1491
824 Ga0500577_0061364 3300053142 Bacteria 1446
825 Ga0500586_000256 3300053145 Bacteria 10561
826 Ga0500589_085151 3300053147 Bacteria 1404
827 Ga0500603_000178 3300053150 Bacteria 16265
828 Ga0500603_000237 3300053150 Bacteria 14490
829 Ga0500603_005395 3300053150 Bacteria 2748
830 Ga0500616_0000033 3300053153 Bacteria 398830
831 Ga0500619_014041 3300053154 Bacteria 2141
832 Ga0500622_0020500 3300053156 Bacteria 3509
833 Ga0500630_000468 3300053159 Bacteria 17761
834 Ga0500633_0035066 3300053160 Bacteria 1650
835 Ga0500634_0106454 3300053161 Bacteria 1393
836 Ga0500639_004846 3300053163 Bacteria 6855
837 Ga0500639_067495 3300053163 Bacteria 1830
838 Ga0500636_0000148 3300053177 Bacteria 36338
839 Ga0500636_0000686 3300053177 Bacteria 18167
840 Ga0500636_0029898 3300053177 Bacteria 3220
841 Ga0500637_0000060 3300053178 Bacteria 38881
842 Ga0500637_0030606 3300053178 Bacteria 2996
843 Ga0500637_0038025 3300053178 Bacteria 2709
844 Ga0500637_0133157 3300053178 Bacteria 1440
845 Ga0500645_011592 3300053730 Bacteria 2873
846 Ga0500645_043216 3300053730 Bacteria 1327
847 Ga0500596_000423 3300053735 Bacteria 7778
848 Ga0500599_002459 3300053736 Bacteria 2220
849 Ga0500601_000452 3300053737 Bacteria 6662
850 Ga0501084_0025829 3300054114 Bacteria 4898
851 Ga0500661_000303 3300055283 Bacteria 8936
852 Ga0501082_0002719 3300060353 Bacteria 15447
853 8016526939 8016522445 Bacteria 8156687
854 2507505890 2507262055 Bacteria 8048963
855 2508540081 2508501009 Bacteria 7784016
856 2508696151 2508501042 Bacteria 8719808
857 2511396625 2511231028 Bacteria 8046582
858 2513627472 2513237092 Bacteria 8341956
859 2513638786 2513237094 Bacteria 8789602
860 2513649864 2513237095 Bacteria 8976980
861 2513659778 2513237096 Bacteria 8722461
862 2513676897 2513237098 Bacteria 9902361
863 2513696306 2513237101 Bacteria 7952346
864 2513704349 2513237102 Bacteria 7703324
865 2513715420 2513237104 Bacteria 10034502
866 2513857239 2513237137 Bacteria 9558895
867 2513877274 2513237139 Bacteria 8737671
868 2513891631 2513237141 Bacteria 8496279
869 2513918854 2513237145 Bacteria 8979722
870 2514011239 2513237161 Bacteria 8871253
871 2515631365 2515154112 Bacteria 8294334
872 2517105697 2517093001 Bacteria 9002274
873 2517888180 2517572143 Bacteria 9484767
874 2524435441 2524023205 Bacteria 8918781
875 2524468616 2524023210 Bacteria 9029266
876 2524533355 2524023228 Bacteria 10118060
877 2528855128 2528768022 Bacteria 10457665
878 2603860081 2602042107 Bacteria 6226103
879 2617347774 2617270735 Bacteria 9163226
880 2617374502 2617270741 Bacteria 8201522
881 2644290509 2643221651 Bacteria 4798932
882 2671119361 2667528175 Bacteria 7532676
883 2723842261 2721755755 Bacteria 8322773
884 2728753837 2728368998 Bacteria 8720350
885 2745081395 2744054633 Bacteria 8678936
886 2793061570 2791355196 Bacteria 7323613
887 2793073858 2791355197 Bacteria 8420563
888 2793077969
889 2805916126 2802429603 Bacteria 8777136
890 2818240864 2816332527 Bacteria 8933356
891 2824605531 2824600985 Bacteria 8488197
892 2824610829 2824609381 Bacteria 8672835
893 2824619364 2824617872 Bacteria 8814715
894 2824627819 2824626560 Bacteria 8813858
895 2824641889 2824635225 Bacteria 8785348
896 2824651287 2824644064 Bacteria 8743947
897 2824653881 2824653114 Bacteria 8493680
898 2824663766 2824661429 Bacteria 9877870
899 2824676114 2824671348 Bacteria 8369588
900 2824680229 2824679649 Bacteria 8248951
901 2824692467 2824687955 Bacteria 8360029
902 2824699890 2824696289 Bacteria 8335049
903 2824706072 2824704595 Bacteria 9667483
904 2824720081 2824714736 Bacteria 8717648
905 2824729443 2824723954 Bacteria 8758240
906 2824737481 2824732956 Bacteria 7810675
907 2824748036 2824746037 Bacteria 7911610
908 2824760295 2824753945 Bacteria 9787441
909 2824771534 2824763712 Bacteria 9792355
910 2824775746 2824773399 Bacteria 8360218
911 2838125119 2838122688 Bacteria 8803140
912 2841945857 2841941048 Bacteria 8688029
913 2841956816 2841949485 Bacteria 8680857
914 2841965300 2841957949 Bacteria 8652217
915 2841973332 2841966195 Bacteria 8673214
916 2841979504 2841974524 Bacteria 8931498
917 2841989371 2841983080 Bacteria 8395090
918 2842044362 2842038055 Bacteria 8002051
919 2842051649 2842045827 Bacteria 8006841
920 2844321490 2844315083 Bacteria 8138177
921 2847939475 2847930680 Bacteria 9342022
922 2847941223 2847939898 Bacteria 8606328
923 2849082215 2849076700 Bacteria 7039503
924 2857513310 2857509624 Bacteria 7472071
925 2857525064 2857524615 Bacteria 6615449
926 2874596372 2874590934 Bacteria 8299676
927 2874610150 2874604998 Bacteria 7834745
928 2874620215 2874612657 Bacteria 8252029
929 2874622438 2874620515 Bacteria 8290088
930 2874633344 2874628541 Bacteria 8630250
931 2874650360 2874645413 Bacteria 8214782
932 2876761697 2876761206 Bacteria 10111113
933 2876776837 2876771140 Bacteria 8287509
934 2876815702 2876808645 Bacteria 8824342
935 2876824627 2876818435 Bacteria 8274608
936 2879080974 2879074833 Bacteria 8279565
937 2879091083 2879083081 Bacteria 8587928
938 2879106648 2879099564 Bacteria 10442239
939 2879117026 2879110137 Bacteria 8907982
940 2879128205 2879127579 Bacteria 8294491
941 2879143552 2879142872 Bacteria 8267021
942 2881369634 2881364244 Bacteria 7710352
943 2881670157 2881665667 Bacteria 8175609
944 2885367716 2885366525 Bacteria 8326213
945 2885380640 2885374607 Bacteria 8927485
946 2885390784 2885383462 Bacteria 9473874
947 2885418257 2885409591 Bacteria 9235467
948 2888387745 2888378607 Bacteria 9652610
949 2888389964 2888388044 Bacteria 7304136
950 2888421136 2888419890 Bacteria 7857137
951 2889036377 2889033259 Bacteria 9099371
952 2893069651 2893066018 Bacteria 6158120
953 2903727931 2903727486 Bacteria 8281579
954 2903754031 2903748898 Bacteria 9972761
955 2903776661 2903768456 Bacteria 9749579
956 2904671555 2904666416 Bacteria 8226587
957 2904695753 2904690495 Bacteria 9412302
958 2904710022
959 2904718099 2904711408 Bacteria 9771557
960 2906602585 2906602504 Bacteria 8295279
961 2906614463
962 2906629717 2906626472 Bacteria 8826946
963 2906643414 2906635258 Bacteria 8601019
964 2906651659 2906643746 Bacteria 8722424
965 2906666606 2906660503 Bacteria 8595048
966 2908746707 2908739725 Bacteria 8628932
967 2908764269 2908756301 Bacteria 8864324
968 2908776981 2908775508 Bacteria 8092255
969 2919078952 2919073203 Bacteria 6531949
970 2922366740 2922361189 Bacteria 7436256
971 2922377450
972 2922389357 2922386360 Bacteria 7017218
973 2922393375 2922393267 Bacteria 8285685
974 2922426298
975 2929622242 2929615660 Bacteria 9193770
976 2929630111 2929624759 Bacteria 9339455
977 2932787956 2932784394 Bacteria 9704911
978 2932799510 2932794094 Bacteria 7915132
979 2932805184 2932801729 Bacteria 7987968
980 2932813331 2932809354 Bacteria 9135765
981 2932820028 2932818245 Bacteria 9955613
982 2932832908 2932828146 Bacteria 9745859
983 2933584144 2933577622 Bacteria 9116884
984 2935614314 2935608549 Bacteria 8203142
985 2935620393 2935616580 Bacteria 9032984
986 2935632682 2935630451 Bacteria 8169952
987 2935640717 2935638405 Bacteria 10015038
988 2935649342 2935648319 Bacteria 8801166
989 2935657886 2935656913 Bacteria 8965014
990 2935668909 2935665750 Bacteria 9571747
991 2935681365 2935675223 Bacteria 9928132
992 2935687218 2935684952 Bacteria 9590419
993 2935696811 2935694250 Bacteria 9291695
994 2935709097 2935703347 Bacteria 10242284
995 2935716906 2935713505 Bacteria 9608509
996 2935722969 2935722832 Bacteria 9608746
997 2935734526 2935732158 Bacteria 9706831
998 2935744683 2935741537 Bacteria 9707219
999 2935753184 2935750917 Bacteria 9590372
1000 2935767588 2935760218 Bacteria 9817913
1001 2935770182 2935769743 Bacteria 7878163
1002 2935777788 2935777560 Bacteria 8077691
1003 2935786764 2935785616 Bacteria 7962367
1004 2935794818 2935793552 Bacteria 8012592
1005 2935804827 2935801545 Bacteria 9301974
1006 2935815976 2935810662 Bacteria 9401221
1007 2935826532 2935819856 Bacteria 8261050
1008 2935832224 2935827899 Bacteria 10038562
1009 2935840946 2935837841 Bacteria 9454360
1010 2935851174 2935847175 Bacteria 8228321
1011 2935859279 2935855204 Bacteria 9035059
1012 2935864463 2935864058 Bacteria 9784707
1013 2935875185 2935873716 Bacteria 9632195
1014 2935887726 2935883170 Bacteria 7964738
1015 2935913223 2935908558 Bacteria 8568796
1016 2935922645 2935916978 Bacteria 9113783
1017 2935930852 2935926038 Bacteria 8601059
1018 2935939814 2935934488 Bacteria 8602579
1019 2935946763 2935942939 Bacteria 8599779
1020 2935956036 2935951376 Bacteria 8602333
1021 2935963884 2935959822 Bacteria 7869783
1022 2935972829 2935967501 Bacteria 8603075
1023 2935978254 2935975950 Bacteria 8347125
1024 2935985618 2935984226 Bacteria 8302647
1025 2935995840 2935992306 Bacteria 9802711
1026 2936005751 2936002035 Bacteria 9362176
1027 2936012105 2936011229 Bacteria 8801034
1028 2936020814 2936019824 Bacteria 8804134
1029 2936029398 2936028420 Bacteria 8965941
1030 2936041879 2936037263 Bacteria 9446081
1031 2936048278 2936046547 Bacteria 8903709
1032 2936056611 2936055302 Bacteria 8785755
1033 2940559097 2940556831 Bacteria 9590747
1034 2941508654 2941507105 Bacteria 8166816
1035 2941516484 2941515067 Bacteria 8166720
1036 2941524500 2941523033 Bacteria 8169134
1037 2941532070 2941531003 Bacteria 7653939
1038 2941541792 2941538514 Bacteria 9402094
1039 3005475661 3005474847 Bacteria 9259049
1040 3005485838 3005483717 Bacteria 7877331
1041 3005510879 3005506211 Bacteria 6943378
1042 3005588828 3005587118 Bacteria 7794411
1043 3005601856 3005594810 Bacteria 8716512
1044 3005717595 3005710791 Bacteria 7622528
1045 3005724643 3005718088 Bacteria 8283608
1046 8006932298 8006926726 Bacteria 6749210
1047 8006937001 8006933436 Bacteria 10410654
1048 8006966338 8006964411 Bacteria 8966052
1049 8006976966 8006973647 Bacteria 10679141
1050 8006993164 8006984368 Bacteria 9651211
1051 8006997003 8006994254 Bacteria 8309700
1052 8016517295 8016511872 Bacteria 9921665
1053 8016545233 8016539877 Bacteria 8155419
1054 8016556855 8016548790 Bacteria 8155074
1055 8016565208 8016557553 Bacteria 8154380
1056 8016570311 8016566248 Bacteria 8158151
1057 8016582859 8016575299 Bacteria 8154085
1058 8016585435 8016583857 Bacteria 10421953
1059 8016602851 8016595262 Bacteria 8149947
1060 8016617628 8016613128 Bacteria 8794220
1061 8016623941 8016622563 Bacteria 7999408
1062 8017059302 8017057580 Bacteria 10023680
1063 8019539688 8019538911 Bacteria 7872763
1064 8019550959 8019547302 Bacteria 7996444
1065 8019561676 8019555841 Bacteria 9642137
1066 8019571750 8019565922 Bacteria 9639779
1067 8019576327 8019576017 Bacteria 10049540
1068 8019607363 8019597564 Bacteria 10041141
1069 8019621999 8019619141 Bacteria 9218857
1070 8019631322 8019629233 Bacteria 8687553
1071 8019651718 8019648815 Bacteria 10014479
1072 8019668127 8019659431 Bacteria 8577854
1073 8019677593 8019668869 Bacteria 8791617
1074 8019687356 8019678201 Bacteria 8863603
1075 8019693332 8019687851 Bacteria 8712826
1076 8055743509 8055742211 Bacteria 9226248
1077 8056678189 8056673599 Bacteria 7871253
1078 8056683419 8056681323 Bacteria 8472857
1079 8056692716 8056689827 Bacteria 6712655
1080 8056975366 8056967851 Bacteria 9038162
1081 JGI24750J21931_1005265
1082 JGI25406J46586_10000233
1083 JGI25406J46586_10031025
1084 JGI25153J46596_10013655
1085 JGI25153J46596_10014278
1086 JGI25160J50197_1000761
1087 JGI25160J50197_1002871
1088 JGI25404J52841_10007829
1089 Ga0055524_1033351
1090 Ga0055531_10011226
1091 Ga0055543_1008603
1092 Ga0065165_1000917
1093 Ga0065165_1001167
1094 Ga0070658_10049328
1095 Ga0070683_100060073
1096 Ga0070683_100062216
1097 Ga0070690_100225216
1098 Ga0070670_100057855
1099 Ga0068869_100013881
1100 Ga0068869_100044308
1101 Ga0070666_10118987
1102 Ga0070680_100021196
1103 Ga0070680_100172603
1104 Ga0068868_100005952
1105 Ga0068868_100009208
1106 Ga0068868_100215362
1107 Ga0070660_100098187
1108 Ga0070660_100101082
1109 Ga0070691_10070551
1110 Ga0070668_100041755
1111 Ga0070668_100062584
1112 Ga0070671_100017933
1113 Ga0070674_100076988
1114 Ga0070674_100296474
1115 Ga0070673_100183631
1116 Ga0070709_10001520
1117 Ga0070709_10011423
1118 Ga0070709_10025696
1119 Ga0070714_100081216
1120 Ga0070714_100086974
1121 Ga0070714_100109302
1122 Ga0070713_100003802
1123 Ga0070713_100032524
1124 Ga0070713_100080905
1125 Ga0070713_100081587
1126 Ga0070713_100253337
1127 Ga0070710_10000656
1128 Ga0070710_10002985
1129 Ga0070710_10020236
1130 Ga0070711_100004436
1131 Ga0070711_100005326
1132 Ga0070711_100047709
1133 Ga0070711_100052438
1134 Ga0070694_100042928
1135 Ga0070708_100112222
1136 Ga0070663_100049161
1137 Ga0070663_100051373
1138 Ga0070663_100190735
1139 Ga0070678_100030437
1140 Ga0070678_100031850
1141 Ga0070681_10034725
1142 Ga0070698_100087771
1143 Ga0070698_100151618
1144 Ga0070679_100017100
1145 Ga0070679_100031850
1146 Ga0070679_100110000
1147 Ga0070684_100027140
1148 Ga0068853_100090980
1149 Ga0068853_100385225
1150 Ga0070686_100101383
1151 Ga0070665_100004629
1152 Ga0070665_100015575
1153 Ga0068855_100181157
1154 Ga0068857_100019162
1155 Ga0068854_100144716
1156 Ga0068856_100000137
1157 Ga0068856_100089592
1158 Ga0068856_100151171
1159 Ga0070702_100037542
1160 Ga0068852_100045438
1161 Ga0068859_100119183
1162 Ga0068864_100127071
1163 Ga0068864_100206508
1164 Ga0068866_10120683
1165 Ga0068861_100034317
1166 Ga0068870_10064809
1167 Ga0068858_100045860
1168 Ga0068858_100127363
1169 Ga0068860_100000313
1170 Ga0068860_100285936
1171 Ga0068862_100075315
1172 Ga0081455_10003860
1173 Ga0081455_10007493
1174 Ga0081455_10023465
1175 Ga0081455_10054097
1176 Ga0081538_10047308
1177 Ga0081540_1003389
1178 Ga0081540_1005657
1179 Ga0081540_1012479
1180 Ga0081540_1013267
1181 Ga0081540_1019710
1182 Ga0081540_1030350
1183 Ga0081540_1032245
1184 Ga0081540_1060906
1185 Ga0081539_10000157
1186 Ga0081539_10002599
1187 Ga0081539_10017515
1188 Ga0081539_10022796
1189 Ga0081539_10057358
1190 Ga0070717_10001671
1191 Ga0070717_10017257
1192 Ga0070717_10204002
1193 Ga0075365_10012998
1194 Ga0075365_10042277
1195 Ga0075365_10065794
1196 Ga0075365_10158192
1197 Ga0075365_10211792
1198 Ga0075368_10041613
1199 Ga0075368_10056347
1200 Ga0075363_100013603
1201 Ga0075363_100021149
1202 Ga0075363_100031275
1203 Ga0075363_100041425
1204 Ga0075363_100059526
1205 Ga0075364_10047292
1206 Ga0075364_10137182
1207 Ga0070715_10000590
1208 Ga0070715_10071086
1209 Ga0070716_100017234
1210 Ga0070712_100021384
1211 Ga0075362_10051603
1212 Ga0075367_10000722
1213 Ga0075367_10001394
1214 Ga0075367_10012975
1215 Ga0075367_10102176
1216 Ga0075366_10032723
1217 Ga0097621_100014735
1218 Ga0075370_10001262
1219 Ga0075370_10008731
1220 Ga0075370_10019237
1221 Ga0075370_10083319
1222 Ga0075434_100104354
1223 Ga0075434_100271941
1224 Ga0097620_100119191
1225 Ga0099824_1008303
1226 Ga0099822_1000541
1227 Ga0105250_10049362
1228 Ga0105240_10002492
1229 Ga0105240_10031167
1230 Ga0105240_10033967
1231 Ga0105240_10094752
1232 Ga0105240_10174427
1233 Ga0105245_10117978
1234 Ga0105247_10073098
1235 Ga0114129_10285040
1236 Ga0105241_10004267
1237 Ga0105241_10026939
1238 Ga0105248_10251915
1239 Ga0105237_10017841
1240 Ga0105237_10020566
1241 Ga0105237_10082692
1242 Ga0105237_10111420
1243 Ga0105237_10148154
1244 Ga0105237_10339257
1245 Ga0105238_10191493
1246 Ga0105238_10192363
1247 Ga0105249_10097572
1248 Ga0105239_10023011
1249 Ga0105239_10031553
1250 Ga0105239_10066232
1251 Ga0105239_10091046
1252 Ga0105239_10099249
1253 Ga0105239_10354237
1254 Ga0105246_10031978
1255 Ga0157371_10082442
1256 Ga0157369_10006548
1257 Ga0157374_10057255
1258 Ga0157374_10129159
1259 Ga0157378_10001192
1260 Ga0157378_10031729
1261 Ga0157378_10206002
1262 Ga0157378_10264155
1263 Ga0163162_10081273
1264 Ga0163162_10141798
1265 Ga0157372_10139256
1266 Ga0157372_10172733
1267 Ga0157375_10006444
1268 Ga0157375_10195176
1269 Ga0157375_10480788
1270 Ga0163163_10010769
1271 Ga0163163_10031158
1272 Ga0157380_10136861
1273 Ga0157377_10060704
1274 Ga0157376_10106890
1275 Ga0206353_11382579
1276 Ga0214544_1000003
1277 Ga0214542_1000022
1278 Ga0214545_1000010
1279 Ga0214543_1000035
1280 Ga0213876_10017171
1281 Ga0213876_10044681
1282 Ga0213876_10046958
1283 Ga0213876_10108812
1284 Ga0209677_100492
1285 Ga0209148_1000267
1286 Ga0209233_1001870
1287 Ga0209233_1013744
1288 Ga0209455_1004219
1289 Ga0209455_1004254
1290 Ga0209455_1008390
1291 Ga0209564_1000718
1292 Ga0209564_1002404
1293 Ga0209564_1011905
1294 Ga0209564_1028080
1295 Ga0209758_1000015
1296 Ga0209758_1000711
1297 Ga0209758_1000764
1298 Ga0209758_1001094
1299 Ga0209758_1004096
1300 Ga0209758_1011473
1301 Ga0209256_1002592
1302 Ga0209256_1019435
1303 Ga0207426_1000368
1304 Ga0207426_1013131
1305 Ga0209257_1002989
1306 Ga0207692_10004867
1307 Ga0207692_10054264
1308 Ga0207710_10096088
1309 Ga0207688_10016777
1310 Ga0207688_10063558
1311 Ga0207699_10001435
1312 Ga0207699_10003885
1313 Ga0207699_10006921
1314 Ga0207645_10149547
1315 Ga0207643_10076315
1316 Ga0207705_10029183
1317 Ga0207684_10142304
1318 Ga0207707_10000143
1319 Ga0207707_10000613
1320 Ga0207707_10030362
1321 Ga0207707_10090452
1322 Ga0207695_10000059
1323 Ga0207695_10020632
1324 Ga0207695_10177667
1325 Ga0207671_10013578
1326 Ga0207671_10088574
1327 Ga0207671_10106177
1328 Ga0207671_10145151
1329 Ga0207671_10242235
1330 Ga0207693_10005195
1331 Ga0207693_10056281
1332 Ga0207693_10159692
1333 Ga0207663_10001411
1334 Ga0207663_10099070
1335 Ga0207663_10170928
1336 Ga0207660_10026752
1337 Ga0207660_10038751
1338 Ga0207660_10173529
1339 Ga0207657_10096510
1340 Ga0207652_10023738
1341 Ga0207694_10133399
1342 Ga0207694_10152670
1343 Ga0207687_10112719
1344 Ga0207700_10007542
1345 Ga0207700_10045941
1346 Ga0207700_10064374
1347 Ga0207700_10072426
1348 Ga0207664_10064293
1349 Ga0207664_10094469
1350 Ga0207664_10176777
1351 Ga0207664_10283691
1352 Ga0207644_10025584
1353 Ga0207690_10240562
1354 Ga0207686_10030104
1355 Ga0207686_10146933
1356 Ga0207670_10263755
1357 Ga0207665_10006088
1358 Ga0207665_10031878
1359 Ga0207711_10052528
1360 Ga0207711_10055306
1361 Ga0207661_10065867
1362 Ga0207651_10171886
1363 Ga0207651_10176730
1364 Ga0207640_10008004
1365 Ga0207677_10060703
1366 Ga0207703_10128866
1367 Ga0207639_10214675
1368 Ga0207678_10016337
1369 Ga0207678_10017766
1370 Ga0207678_10019513
1371 Ga0207678_10033040
1372 Ga0207678_10059483
1373 Ga0207678_10060315
1374 Ga0207678_10090054
1375 Ga0207702_10000063
1376 Ga0207702_10042949
1377 Ga0207702_10091162
1378 Ga0207641_10037994
1379 Ga0207641_10079791
1380 Ga0207648_10023956
1381 Ga0207674_10027211
1382 Ga0207674_10061985
1383 Ga0207675_100037599
1384 Ga0207683_10038422
1385 Ga0207683_10040055
1386 Ga0207698_10314242
1387 Ga0209389_1000012
1388 Ga0209389_1000069
1389 Ga0209589_1000015
1390 Ga0209589_1000077
1391 Ga0209489_100015
1392 Ga0209489_100019
1393 Ga0209489_100020
1394 Ga0209700_100018
1395 Ga0209700_100025
1396 Ga0209179_1004877
1397 Ga0207428_10148947
1398 Ga0268266_10003840
1399 Ga0268266_10008431
1400 Ga0268266_10034518
1401 Ga0268264_10000356
1402 Ga0265323_10007414
1403 Ga0265336_10000346
1404 Ga0307517_10001423
1405 Ga0307515_10032146
1406 Ga0307515_10090460
1407 Ga0307515_10252869
1408 Ga0265338_10000417
1409 Ga0307511_10087863
1410 Ga0265325_10109984
1411 Ga0265340_10002373
1412 Ga0265339_10003359
1413 Ga0265339_10008317
1414 Ga0307509_10119372
1415 Ga0307508_10000012
1416 Ga0307508_10013966
1417 Ga0307508_10095708
1418 Ga0307508_10148584
1419 Ga0265314_10032879
1420 Ga0265314_10043122
1421 Ga0307516_10010102
1422 Ga0307516_10074049
1423 Ga0307516_10118097
1424 Ga0307516_10167679
1425 Ga0307409_100106920
1426 Ga0307416_100170057
1427 Ga0307415_100136139
1428 Ga0307507_10092970
1429 Ga0307510_10015377
1430 Ga0307510_10023362
1431 Ga0307510_10068023
1432 Ga0307510_10100483
1433 Ga0315911_1000037
1434 Ga0373930_0020548
1435 Ga0373934_0002532
1436 Ga0373923_0003267
1437 Ga0373923_0059362
1438 Ga0373936_0001098
1439 Ga0373936_0042302
1440 Ga0373936_0043904
1441 Ga0373945_0001922
1442 Ga0373953_0001769
1443 Ga0373953_0009391
1444 Ga0373954_0002946
1445 Ga0373954_0006705
1446 Ga0373956_0000376
1447 Ga0373957_0005684
1448 Ga0373957_0046825
1449 Ga0373943_0071667
1450 Ga0373955_0000325
1451 Ga0373955_0067917
1452 Ga0373955_0086410
1453 Ga0373942_0033799
1454 Ga0373924_0007619
1455 Ga0373924_0007815
1456 Ga0373924_0065537
1457 Ga0373931_0009747
1458 Ga0373935_0007815
1459 Ga0373935_0050257
1460 Ga0373935_0127495
1461 Ga0373927_0000137
1462 Ga0373927_0017402
1463 Ga0373927_0036587
1464 Ga0373927_0068754
1465 Ga0373927_0082856
1466 Ga0373927_0121167
1467 Ga0373933_0000108
1468 Ga0373933_0099071
1469 Ga0373947_0000902
1470 Ga0373947_0012959
1471 Ga0373947_0141466
1472 Ga0373937_0007855
1473 Ga0373937_0024716
1474 Ga0373925_0002159
1475 Ga0373925_0010829
1476 Ga0373925_0027502
1477 Ga0373925_0036147
1478 Ga0373925_0062118
1479 Ga0373925_0173665
1480 Ga0373925_0203260
1481 Ga0373925_0219803
1482 Ga0395900_0001756
1483 Ga0395900_0010446
1484 Ga0395900_0351119
1485 Ga0395898_0035306
1486 Ga0395898_0058280
1487 Ga0395905_0098242
1488 Ga0395905_0161755
1489 Ga0395905_0196810
1490 Ga0395905_0221082
1491 Ga0436364_0461113
1492 Ga0436364_0735016
1493 Ga0436364_0948768
1494 Ga0395901_0028786
1495 Ga0395901_0109804
1496 Ga0436365_0457714
1497 Ga0436365_0592130
1498 Ga0436365_1312844
1499 Ga0436361_0474776
1500 Ga0439465_0024103
1501 Ga0439465_0029460
1502 Ga0451795_0601895
1503 Ga0466969_0050676
1504 Ga0466972_0000100
1505 Ga0466972_0014629
1506 Ga0466965_0011221
1507 Ga0466966_0001463
1508 Ga0466961_0000601
1509 Ga0466963_0058249
1510 Ga0466963_0121410
1511 Ga0466968_0008001
1512 Ga0466957_0117662
1513 Ga0466959_0000634
1514 Ga0466958_0012458
1515 Ga0466967_0161245
1516 Ga0466967_0227567
1517 Ga0466967_0302164
1518 Ga0495592_0000339
1519 Ga0495592_0008958
1520 Ga0495592_0033013
1521 Ga0495592_0034020
1522 Ga0495592_0058113
1523 Ga0495603_0000277
1524 Ga0495603_0011788
1525 Ga0495603_0030573
1526 Ga0495603_0058565
1527 Ga0495603_0063865
1528 Ga0495603_0064886
1529 Ga0495629_0000029
1530 Ga0495629_0001483
1531 Ga0495629_0043490
1532 Ga0495629_0056255
1533 Ga0495629_0057452
1534 Ga0495629_0081882
1535 Ga0495641_0003605
1536 Ga0495651_0031486
1537 Ga0495651_0034091
1538 Ga0495651_0042153
1539 Ga0495651_0053385
1540 Ga0495651_0105986
1541 Ga0495653_0001063
1542 Ga0495580_0002567
1543 Ga0495582_0000024
1544 Ga0495582_0008119
1545 Ga0495605_0056580
1546 Ga0495639_0000006
1547 Ga0495639_0127276
1548 Ga0495662_0000348
1549 Ga0495662_0062304
1550 Ga0495664_0007034
1551 Ga0495664_0013716
1552 Ga0495664_0163539
1553 Ga0495584_0035543
1554 Ga0495585_0105255
1555 Ga0495594_0000170
1556 Ga0495606_0013516
1557 Ga0495606_0083744
1558 Ga0495608_0075302
1559 Ga0495608_0190980
1560 Ga0495610_0044538
1561 Ga0495610_0058795
1562 Ga0495610_0112766
1563 Ga0495616_0038012
1564 Ga0495618_0018824
1565 Ga0495628_0010789
1566 Ga0495628_0014226
1567 Ga0495628_0074634
1568 Ga0495628_0079529
1569 Ga0495630_0003257
1570 Ga0495630_0058889
1571 Ga0495648_0016531
1572 Ga0495648_0019778
1573 Ga0495648_0027989
1574 Ga0495666_0011725
1575 Ga0495666_0031438
1576 Ga0495652_0040442
1577 Ga0495652_0047155
1578 Ga0495652_0061633
1579 Ga0495652_0101400
1580 Ga0495665_0000178
1581 Ga0495665_0044353
1582 Ga0495640_0003797
1583 Ga0495640_0004410
1584 Ga0495640_0022850
1585 Ga0495587_0087441
1586 Ga0495587_0127658
1587 Ga0495597_0014928
1588 Ga0495645_0033925
1589 Ga0495645_0052192
1590 Ga0495645_0100650
1591 Ga0495622_0002996
1592 Ga0495622_0015955
1593 Ga0495622_0031914
1594 Ga0495622_0044412
1595 Ga0495622_0046682
1596 Ga0495667_0003075
1597 Ga0495667_0074387
1598 Ga0495667_0088315
1599 Ga0495656_0007598
1600 Ga0495656_0008501
1601 Ga0495656_0023243
1602 Ga0495668_0148417
1603 Ga0495634_0000354
1604 Ga0495634_0002330
1605 Ga0495634_0023750
1606 Ga0495634_0033779
1607 Ga0495634_0037146
1608 Ga0495634_0162458
1609 Ga0495611_0053797
1610 Ga0495625_0014247
1611 Ga0495625_0030852
1612 Ga0495635_0000917
1613 Ga0495635_0002291
1614 Ga0495635_0006214
1615 Ga0495635_0018638
1616 Ga0495659_0049165
1617 Ga0495588_0020824
1618 Ga0495657_0003543
1619 Ga0495657_0005133
1620 Ga0495657_0009727
1621 Ga0495657_0066994
1622 Ga0495599_0005791
1623 Ga0495599_0036803
1624 Ga0495599_0038886
1625 Ga0495599_0051217
1626 Ga0495623_0010483
1627 Ga0495623_0013015
1628 Ga0495646_0000902
1629 Ga0495646_0003762
1630 Ga0495646_0037428
1631 Ga0495646_0056213
1632 Ga0495647_0002169
1633 Ga0495647_0025404
1634 Ga0495658_0000428
1635 Ga0495658_0013755
1636 Ga0495669_0057920
1637 Ga0495613_0001078
1638 Ga0495613_0012318
1639 Ga0495613_0067784
1640 Ga0495613_0067799
1641 Ga0495624_0000788
1642 Ga0495624_0039622
1643 Ga0495624_0065431
1644 Ga0495670_0006876
1645 Ga0495671_0049797
1646 Ga0495649_0067447
1647 Ga0495600_0002741
1648 Ga0495600_0006367
1649 Ga0495600_0091394
1650 Ga0495660_0030369
1651 Ga0495581_0000004
1652 Ga0495581_0029027
1653 Ga0495581_0064398
1654 Ga0495581_0096450
1655 Ga0495604_0000678
1656 Ga0495604_0007941
1657 Ga0495604_0024945
1658 Ga0495674_0000415
1659 Ga0495674_0007236
1660 Ga0495674_0026281
1661 Ga0495672_0018820
1662 Ga0495672_0041687
1663 Ga0495672_0084711
1664 Ga0495676_0019876
1665 Ga0495676_0032444
1666 Ga0495676_0037764
1667 Ga0495676_0109575
1668 Ga0495676_0110006
1669 Ga0495680_0001164
1670 Ga0495680_0239647
1671 Ga0495687_010280
1672 Ga0495675_0000901
1673 Ga0495675_0012017
1674 Ga0495675_0068840
1675 Ga0495677_0027542
1676 Ga0495685_052355
1677 Ga0495673_0028163
1678 Ga0495684_0000721
1679 Ga0495684_0009275
1680 Ga0495684_0064676
1681 Ga0495684_0132607
1682 Ga0495593_0000198
1683 Ga0495593_0003019
1684 Ga0495593_0004072
1685 Ga0495593_0012359
1686 Ga0495602_0007817
1687 Ga0495602_0060850
1688 Ga0495602_0068869
1689 Ga0495614_0010431
1690 Ga0495626_0021097
1691 Ga0495626_0033878
1692 Ga0496100_0059742
1693 Ga0496100_0076187
1694 Ga0496101_0051291
1695 Ga0496101_0075732
1696 Ga0496102_0010100
1697 Ga0496102_0039067
1698 Ga0496102_0094833
1699 Ga0496102_0143511
1700 Ga0496102_0253222
1701 Ga0496103_0028235
1702 Ga0496103_0088357
1703 Ga0496104_0014507
1704 Ga0496104_0069211
1705 Ga0496104_0127620
1706 Ga0496104_0152912
1707 Ga0496105_0007733
1708 Ga0496105_0023125
1709 Ga0496105_0104649
1710 Ga0496105_0158139
1711 Ga0496106_0001953
1712 Ga0496106_0008314
1713 Ga0496106_0068753
1714 Ga0496106_0111956
1715 Ga0496106_0136444
1716 Ga0496107_0026534
1717 Ga0496108_0024837
1718 Ga0496108_0084715
1719 Ga0496108_0137501
1720 Ga0496108_0164457
1721 Ga0496109_0086237
1722 Ga0496109_0117930
1723 Ga0496109_0119096
1724 Ga0496110_0067758
1725 Ga0496110_0097259
1726 Ga0496110_0148774
1727 Ga0496110_0184677
1728 Ga0496110_0209272
1729 Ga0496111_0039021
1730 Ga0496111_0132668
1731 Ga0496111_0176718
1732 Ga0496112_0000035
1733 Ga0496112_0005407
1734 Ga0496112_0012245
1735 Ga0496112_0012881
1736 Ga0496112_0097098
1737 Ga0496113_0012388
1738 Ga0496113_0078640
1739 Ga0496113_0100776
1740 Ga0496114_0089409
1741 Ga0496115_0009406
1742 Ga0496115_0027885
1743 Ga0496115_0064612
1744 Ga0496115_0104129
1745 Ga0496115_0106861
1746 Ga0496116_0000965
1747 Ga0496116_0027251
1748 Ga0496117_0040145
1749 Ga0496117_0090678
1750 Ga0496117_0123782
1751 Ga0496118_0006555
1752 Ga0496118_0011084
1753 Ga0496118_0028559
1754 Ga0496118_0069557
1755 Ga0496118_0083383
1756 Ga0496118_0147501
1757 Ga0496118_0162829
1758 Ga0496119_0050692
1759 Ga0496119_0090924
1760 Ga0496119_0104129
1761 Ga0496120_0003365
1762 Ga0496120_0026986
1763 Ga0496121_0001622
1764 Ga0496121_0002148
1765 Ga0496121_0003594
1766 Ga0496121_0020688
1767 Ga0496121_0029073
1768 Ga0496121_0033947
1769 Ga0496121_0046952
1770 Ga0496121_0054013
1771 Ga0496121_0060870
1772 Ga0496121_0063382
1773 Ga0496121_0095914
1774 Ga0496122_0049255
1775 Ga0496123_0006724
1776 Ga0496123_0073867
1777 Ga0496124_0009366
1778 Ga0496124_0098855
1779 Ga0496125_0001356
1780 Ga0496125_0001441
1781 Ga0496125_0001630
1782 Ga0496125_0042831
1783 Ga0496125_0057923
1784 Ga0496125_0060229
1785 Ga0496125_0094540
1786 Ga0496125_0195548
1787 Ga0496126_0003472
1788 Ga0496126_0005839
1789 Ga0496126_0010376
1790 Ga0496126_0014638
1791 Ga0496126_0017647
1792 Ga0496126_0021771
1793 Ga0496126_0041017
1794 Ga0496126_0043071
1795 Ga0496126_0047705
1796 Ga0496126_0110276
1797 Ga0501031_0001791
1798 Ga0501032_0000073
1799 Ga0501033_0000136
1800 Ga0501033_0044103
1801 Ga0501034_0000251
1802 Ga0501036_0000036
1803 Ga0501036_0199252
1804 Ga0501037_0001715
1805 Ga0501038_0000428
1806 Ga0501038_0191908
1807 Ga0501039_0000273
1808 Ga0501042_0019699
1809 Ga0501042_0099665
1810 Ga0501043_0000165
1811 Ga0501043_0010054
1812 Ga0501043_0222635
1813 Ga0501046_0001143
1814 Ga0501047_0000340
1815 Ga0501047_0147575
1816 Ga0501067_0014425
1817 Ga0501067_0039960
1818 Ga0501068_0003807
1819 Ga0501069_0005466
1820 Ga0501070_0006502
1821 Ga0501070_0193980
1822 Ga0501072_0001213
1823 Ga0501073_0000037
1824 Ga0501076_0299103
1825 Ga0501079_0001057
1826 Ga0501080_0003259
1827 Ga0501035_0000142
1828 Ga0501044_0000414
1829 Ga0501044_0047997
1830 Ga0501044_0107750
1831 Ga0501044_0109662
1832 Ga0501044_0110374
1833 nmdc:mga03683_46130_c1
1834 nmdc:mga03n38_17691_c1
1835 nmdc:mga03n38_18684_c1
1836 nmdc:mga03n38_70566_c1
1837 nmdc:mga03n38_957_c1
1838 nmdc:mga00v17_49103_c1
1839 nmdc:mga00v17_61593_c1
1840 nmdc:mga0yw44_16568_c1
1841 nmdc:mga0yw44_21933_c1
1842 nmdc:mga0yw44_4551_c1
1843 nmdc:mga0yw44_50490_c1
1844 nmdc:mga0yw44_62231_c1
1845 nmdc:mga0yw44_85060_c1
1846 nmdc:mga0k408_68589_c1
1847 nmdc:mga0k408_88982_c1
1848 nmdc:mga06z11_1871_c1
1849 nmdc:mga06z11_2498_c1
1850 nmdc:mga06z11_36176_c1
1851 nmdc:mga04h51_24891_c1
1852 nmdc:mga04h51_25760_c1
1853 nmdc:mga07m45_2419_c1
1854 nmdc:mga07m45_2500_c2
1855 nmdc:mga07m45_44349_c1
1856 nmdc:mga08y16_127311_c1
1857 nmdc:mga0n895_45691_c1
1858 nmdc:mga0sz30_72698_c1
1859 Ga0495601_0041651
1860 Ga0500635_0009854
1861 Ga0495595_0000828
1862 Ga0495595_0073753
1863 Ga0495619_0000912
1864 Ga0495619_0198200
1865 Ga0500578_0126224
1866 Ga0500643_000048
1867 Ga0500644_0023241
1868 Ga0500647_0045982
1869 Ga0500583_0019068
1870 Ga0500651_0046117
1871 Ga0500651_0141612
1872 Ga0500566_0000223
1873 Ga0500566_0004965
1874 Ga0500566_0006352
1875 Ga0500566_0007034
1876 Ga0500640_022290
1877 Ga0500641_0013850
1878 Ga0500554_038657
1879 Ga0500555_005336
1880 Ga0500556_0000003
1881 Ga0500556_0002950
1882 Ga0500557_000083
1883 Ga0500562_026505
1884 Ga0500572_000389
1885 Ga0500572_003205
1886 Ga0500592_005061
1887 Ga0500594_0018254
1888 Ga0500594_0041141
1889 Ga0500595_000333
1890 Ga0500595_002703
1891 Ga0500595_017370
1892 Ga0500595_025546
1893 Ga0500608_007296
1894 Ga0500642_0000015
1895 Ga0500642_0000642
1896 Ga0500652_000665
1897 Ga0500559_0000230
1898 Ga0500559_0000461
1899 Ga0500559_0009186
1900 Ga0500568_0000536
1901 Ga0500568_0022304
1902 Ga0500577_0003157
1903 Ga0500577_0056783
1904 Ga0500577_0061364
1905 Ga0500586_000256
1906 Ga0500589_085151
1907 Ga0500603_000178
1908 Ga0500603_000237
1909 Ga0500603_005395
1910 Ga0500616_0000033
1911 Ga0500619_014041
1912 Ga0500622_0020500
1913 Ga0500630_000468
1914 Ga0500633_0035066
1915 Ga0500634_0106454
1916 Ga0500639_004846
1917 Ga0500639_067495
1918 Ga0500636_0000148
1919 Ga0500636_0000686
1920 Ga0500636_0029898
1921 Ga0500637_0000060
1922 Ga0500637_0030606
1923 Ga0500637_0038025
1924 Ga0500637_0133157
1925 Ga0500645_011592
1926 Ga0500645_043216
1927 Ga0500596_000423
1928 Ga0500599_002459
1929 Ga0500601_000452
1930 Ga0501084_0025829
1931 Ga0500661_000303
1932 Ga0501082_0002719
1933 8016526939
1934 2507505890
1935 2508540081
1936 2508696151
1937 2511396625
1938 2513627472
1939 2513638786
1940 2513649864
1941 2513659778
1942 2513676897
1943 2513696306
1944 2513704349
1945 2513715420
1946 2513857239
1947 2513877274
1948 2513891631
1949 2513918854
1950 2514011239
1951 2515631365
1952 2517105697
1953 2517888180
1954 2524435441
1955 2524468616
1956 2524533355
1957 2528855128
1958 2603860081
1959 2617347774
1960 2617374502
1961 2644290509
1962 2671119361
1963 2723842261
1964 2728753837
1965 2745081395
1966 2793061570
1967 2793073858
1968 2793077969
1969 2805916126
1970 2818240864
1971 2824605531
1972 2824610829
1973 2824619364
1974 2824627819
1975 2824641889
1976 2824651287
1977 2824653881
1978 2824663766
1979 2824676114
1980 2824680229
1981 2824692467
1982 2824699890
1983 2824706072
1984 2824720081
1985 2824729443
1986 2824737481
1987 2824748036
1988 2824760295
1989 2824771534
1990 2824775746
1991 2838125119
1992 2841945857
1993 2841956816
1994 2841965300
1995 2841973332
1996 2841979504
1997 2841989371
1998 2842044362
1999 2842051649
2000 2844321490
2001 2847939475
2002 2847941223
2003 2849082215
2004 2857513310
2005 2857525064
2006 2874596372
2007 2874610150
2008 2874620215
2009 2874622438
2010 2874633344
2011 2874650360
2012 2876761697
2013 2876776837
2014 2876815702
2015 2876824627
2016 2879080974
2017 2879091083
2018 2879106648
2019 2879117026
2020 2879128205
2021 2879143552
2022 2881369634
2023 2881670157
2024 2885367716
2025 2885380640
2026 2885390784
2027 2885418257
2028 2888387745
2029 2888389964
2030 2888421136
2031 2889036377
2032 2893069651
2033 2903727931
2034 2903754031
2035 2903776661
2036 2904671555
2037 2904695753
2038 2904710022
2039 2904718099
2040 2906602585
2041 2906614463
2042 2906629717
2043 2906643414
2044 2906651659
2045 2906666606
2046 2908746707
2047 2908764269
2048 2908776981
2049 2919078952
2050 2922366740
2051 2922377450
2052 2922389357
2053 2922393375
2054 2922426298
2055 2929622242
2056 2929630111
2057 2932787956
2058 2932799510
2059 2932805184
2060 2932813331
2061 2932820028
2062 2932832908
2063 2933584144
2064 2935614314
2065 2935620393
2066 2935632682
2067 2935640717
2068 2935649342
2069 2935657886
2070 2935668909
2071 2935681365
2072 2935687218
2073 2935696811
2074 2935709097
2075 2935716906
2076 2935722969
2077 2935734526
2078 2935744683
2079 2935753184
2080 2935767588
2081 2935770182
2082 2935777788
2083 2935786764
2084 2935794818
2085 2935804827
2086 2935815976
2087 2935826532
2088 2935832224
2089 2935840946
2090 2935851174
2091 2935859279
2092 2935864463
2093 2935875185
2094 2935887726
2095 2935913223
2096 2935922645
2097 2935930852
2098 2935939814
2099 2935946763
2100 2935956036
2101 2935963884
2102 2935972829
2103 2935978254
2104 2935985618
2105 2935995840
2106 2936005751
2107 2936012105
2108 2936020814
2109 2936029398
2110 2936041879
2111 2936048278
2112 2936056611
2113 2940559097
2114 2941508654
2115 2941516484
2116 2941524500
2117 2941532070
2118 2941541792
2119 3005475661
2120 3005485838
2121 3005510879
2122 3005588828
2123 3005601856
2124 3005717595
2125 3005724643
2126 8006932298
2127 8006937001
2128 8006966338
2129 8006976966
2130 8006993164
2131 8006997003
2132 8016517295
2133 8016545233
2134 8016556855
2135 8016565208
2136 8016570311
2137 8016582859
2138 8016585435
2139 8016602851
2140 8016617628
2141 8016623941
2142 8017059302
2143 8019539688
2144 8019550959
2145 8019561676
2146 8019571750
2147 8019576327
2148 8019607363
2149 8019621999
2150 8019631322
2151 8019651718
2152 8019668127
2153 8019677593
2154 8019687356
2155 8019693332
2156 8055743509
2157 8056678189
2158 8056683419
2159 8056692716
2160 8056975366

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

24

328

0.89

PF01094

ANF_receptor

Receptor family ligand binding region

50

310

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f8j-assembly1.cif.gz_A the structure of an aromatic compound transport protein from rhodopseudomonas palustris in complex with p-coumarate 0.9439 26 351
3uk0-assembly1.cif.gz_A rpd_1889 protein, an extracellular ligand-binding receptor from rhodopseudomonas palustris. 0.9366 26 351
3ukj-assembly1.cif.gz_A crystal structure of extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 0.9355 27 351
7ylt-assembly2.cif.gz_D structure of a bacteria protein 0.9102 28 351
7ylt-assembly3.cif.gz_C structure of a bacteria protein 0.8999 28 351
ID Description Score Start End Superfamily
4jb2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.928 109 351 3.40.50.2300
4jb2A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9156 109 351 3.40.50.2300
3sg0A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9061 114 236 3.40.50.2300
3i45A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8437 107 233 3.40.50.2300
3lkbB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8402 110 235 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A401U0T1-F1-model_v4 Receptor ligand binding region domain-containing protein 0.9664 242 351
AF-A0A401U0T1-F1-model_v4 Receptor ligand binding region domain-containing protein 0.9578 242 351
AF-A0A3M1SD04-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9195 166 351
AF-A0A7C1G6Q7-F1-model_v4 Branched-chain amino acid ABC transporter substrate-binding protein 0.9101 123 351
AF-A0A0H4WIU1-F1-model_v4 deleted 0.9057 21 350

Map