F489774
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1085 | 625 | 2160 | 375 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|8016522445|8016526939 |
| Length | 430 |
| Sequence | YLTAAVTAAALALPALPALAQTTEITIGITTTTTGPGAALGIPERNALEFVPKEIGGVPLKVIVLDDGGDPTTATTNARRFVTESKADIIMGSALTPPTIAVSNVANEAGIPHFGLAPFPITPERMKWSVAMPQPIPIMGKVLYQHMKSKGVKTVGYIGYSDSYGDLWFNDFKAQGVPMGMTLADEERFARPDTSVTGQVLKLVAANPDAILVGASGTAAALPQTELRERGYQGLIYQTHGAASMDFIRIAGKAAEGVLMASGPVMDPEDQPDEAATKKPGLALNSAYEGKYGPNSRSQFAGHSYDAFEILKRVIPTALKTAKPRHAGIPRSNPPGTAVGEGNCCKPGRLQFHRKGPLRPRRPLAHPADGEERQVHAGEVDAAIVSRRREPAQWAGSFHLRSLSGLRPPDAAGSRRIPDSNCPSSGRHRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 60 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 61 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 62 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 67 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 74 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 75 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 100 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 101 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 102 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 155 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 156 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 157 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 159 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 162 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 164 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 167 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 168 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 178 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 179 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 180 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 186 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 187 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 204 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 205 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 208 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 219 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 220 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 293 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 297 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 298 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 306 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 307 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 308 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 309 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 310 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 313 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 314 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 315 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 316 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 341 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 342 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 343 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 345 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 346 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 347 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 348 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 353 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 356 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 357 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 359 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 365 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 367 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 368 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 369 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 370 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 371 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 372 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 373 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 374 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 375 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 376 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 377 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 378 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 379 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 380 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 381 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 383 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 384 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 385 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 386 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 387 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 388 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 389 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 390 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 391 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 392 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 393 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 394 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 395 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 397 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 399 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 400 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 401 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 402 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 403 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 404 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 405 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 406 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 407 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 408 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 409 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 410 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 411 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 412 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 413 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 414 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 415 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 416 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 417 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 418 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 419 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 420 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 421 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 422 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 423 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 424 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 425 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 426 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 427 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 428 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 429 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 430 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 431 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 432 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 433 | 2791355199 | |||
| 434 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 435 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 436 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 437 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 438 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 439 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 440 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 441 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 442 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 443 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 444 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 445 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 446 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 447 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 448 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 449 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 450 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 451 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 452 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 453 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 454 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 455 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 456 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 457 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 458 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 459 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 460 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 461 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 462 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 463 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 464 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 465 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 466 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 467 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 468 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 469 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 470 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 471 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 472 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 473 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 474 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 475 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 476 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 477 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 478 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 479 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 480 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 481 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 482 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 483 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 484 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 485 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 486 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 487 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 488 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 489 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 490 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 491 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 492 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 493 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 494 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 495 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 496 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 497 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 498 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 499 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 500 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 501 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 502 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 503 | 2904699407 | |||
| 504 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 505 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 506 | 2906610324 | |||
| 507 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 508 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 509 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 510 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 511 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 512 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 513 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 514 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 515 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 516 | 2922368715 | |||
| 517 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 518 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 519 | 2922425934 | |||
| 520 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 521 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 522 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 523 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 524 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 525 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 526 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 527 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 528 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 529 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 530 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 531 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 532 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 533 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 534 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 535 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 536 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 537 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 538 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 539 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 540 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 541 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 542 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 543 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 544 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 545 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 546 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 547 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 548 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 549 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 550 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 551 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 552 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 553 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 554 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 555 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 556 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 557 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 558 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 559 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 560 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 561 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 562 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 563 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 564 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 565 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 566 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 567 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 568 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 569 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 570 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 571 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 572 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 573 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 574 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 575 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 576 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 577 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 578 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 579 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 580 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 581 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 582 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 583 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 584 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 585 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 586 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 587 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 588 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 589 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 590 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 591 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 592 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 593 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 594 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 595 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 596 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 597 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 598 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 599 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 600 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 601 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 602 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 603 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 604 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 605 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 606 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 607 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 608 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 609 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 610 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 611 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 612 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 613 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 614 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 615 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 616 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 617 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 618 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 619 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 620 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 621 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 622 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 623 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 624 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 625 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.26 |
| Metatranscriptomes | 0.09 |
| Isolates | 20.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.55 |
| Nodule | 16.22 |
| Rhizoplane | 5.25 |
| Rhizosphere | 51.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24750J21931_1005265 | 3300002070 | Bacteria | 1589 |
| 2 | JGI25406J46586_10000233 | 3300003203 | Bacteria | 24719 |
| 3 | JGI25406J46586_10031025 | 3300003203 | Bacteria | 2005 |
| 4 | JGI25153J46596_10013655 | 3300003215 | Bacteria | 3420 |
| 5 | JGI25153J46596_10014278 | 3300003215 | Bacteria | 3310 |
| 6 | JGI25160J50197_1000761 | 3300003354 | Bacteria | 17408 |
| 7 | JGI25160J50197_1002871 | 3300003354 | Bacteria | 7885 |
| 8 | JGI25404J52841_10007829 | 3300003659 | Bacteria | 2267 |
| 9 | Ga0055524_1033351 | 3300003775 | Bacteria | 1442 |
| 10 | Ga0055531_10011226 | 3300003794 | Bacteria | 4350 |
| 11 | Ga0055543_1008603 | 3300004625 | Bacteria | 2250 |
| 12 | Ga0065165_1000917 | 3300005262 | Bacteria | 37935 |
| 13 | Ga0065165_1001167 | 3300005262 | Bacteria | 30545 |
| 14 | Ga0070658_10049328 | 3300005327 | Bacteria | 3410 |
| 15 | Ga0070683_100060073 | 3300005329 | Bacteria | 3532 |
| 16 | Ga0070683_100062216 | 3300005329 | Bacteria | 3471 |
| 17 | Ga0070690_100225216 | 3300005330 | Bacteria | 1316 |
| 18 | Ga0070670_100057855 | 3300005331 | Bacteria | 3327 |
| 19 | Ga0068869_100013881 | 3300005334 | Bacteria | 5371 |
| 20 | Ga0068869_100044308 | 3300005334 | Bacteria | 3199 |
| 21 | Ga0070666_10118987 | 3300005335 | Bacteria | 1831 |
| 22 | Ga0070680_100021196 | 3300005336 | Bacteria | 5164 |
| 23 | Ga0070680_100172603 | 3300005336 | Bacteria | 1820 |
| 24 | Ga0068868_100005952 | 3300005338 | Bacteria | 8601 |
| 25 | Ga0068868_100009208 | 3300005338 | Bacteria | 7095 |
| 26 | Ga0068868_100215362 | 3300005338 | Bacteria | 1607 |
| 27 | Ga0070660_100098187 | 3300005339 | Bacteria | 2318 |
| 28 | Ga0070660_100101082 | 3300005339 | Bacteria | 2285 |
| 29 | Ga0070691_10070551 | 3300005341 | Bacteria | 1695 |
| 30 | Ga0070668_100041755 | 3300005347 | Bacteria | 3514 |
| 31 | Ga0070668_100062584 | 3300005347 | Bacteria | 2883 |
| 32 | Ga0070671_100017933 | 3300005355 | Bacteria | 5742 |
| 33 | Ga0070674_100076988 | 3300005356 | Bacteria | 2373 |
| 34 | Ga0070674_100296474 | 3300005356 | Bacteria | 1287 |
| 35 | Ga0070673_100183631 | 3300005364 | Bacteria | 1792 |
| 36 | Ga0070709_10001520 | 3300005434 | Bacteria | 12532 |
| 37 | Ga0070709_10011423 | 3300005434 | Bacteria | 4949 |
| 38 | Ga0070709_10025696 | 3300005434 | Bacteria | 3482 |
| 39 | Ga0070714_100081216 | 3300005435 | Bacteria | 2822 |
| 40 | Ga0070714_100086974 | 3300005435 | Bacteria | 2732 |
| 41 | Ga0070714_100109302 | 3300005435 | Bacteria | 2446 |
| 42 | Ga0070713_100003802 | 3300005436 | Bacteria | 9991 |
| 43 | Ga0070713_100032524 | 3300005436 | Bacteria | 4167 |
| 44 | Ga0070713_100080905 | 3300005436 | Bacteria | 2771 |
| 45 | Ga0070713_100081587 | 3300005436 | Bacteria | 2760 |
| 46 | Ga0070713_100253337 | 3300005436 | Bacteria | 1606 |
| 47 | Ga0070710_10000656 | 3300005437 | Bacteria | 16428 |
| 48 | Ga0070710_10002985 | 3300005437 | Bacteria | 8039 |
| 49 | Ga0070710_10020236 | 3300005437 | Bacteria | 3449 |
| 50 | Ga0070711_100004436 | 3300005439 | Bacteria | 8279 |
| 51 | Ga0070711_100005326 | 3300005439 | Bacteria | 7689 |
| 52 | Ga0070711_100047709 | 3300005439 | Bacteria | 2925 |
| 53 | Ga0070711_100052438 | 3300005439 | Bacteria | 2807 |
| 54 | Ga0070694_100042928 | 3300005444 | Bacteria | 3021 |
| 55 | Ga0070708_100112222 | 3300005445 | Bacteria | 2507 |
| 56 | Ga0070663_100049161 | 3300005455 | Bacteria | 2993 |
| 57 | Ga0070663_100051373 | 3300005455 | Bacteria | 2936 |
| 58 | Ga0070663_100190735 | 3300005455 | Bacteria | 1595 |
| 59 | Ga0070678_100030437 | 3300005456 | Bacteria | 3710 |
| 60 | Ga0070678_100031850 | 3300005456 | Bacteria | 3642 |
| 61 | Ga0070681_10034725 | 3300005458 | Bacteria | 5064 |
| 62 | Ga0070698_100087771 | 3300005471 | Bacteria | 3096 |
| 63 | Ga0070698_100151618 | 3300005471 | Bacteria | 2265 |
| 64 | Ga0070679_100017100 | 3300005530 | Bacteria | 7011 |
| 65 | Ga0070679_100031850 | 3300005530 | Bacteria | 5213 |
| 66 | Ga0070679_100110000 | 3300005530 | Bacteria | 2742 |
| 67 | Ga0070684_100027140 | 3300005535 | Bacteria | 4831 |
| 68 | Ga0068853_100090980 | 3300005539 | Bacteria | 2682 |
| 69 | Ga0068853_100385225 | 3300005539 | Bacteria | 1310 |
| 70 | Ga0070686_100101383 | 3300005544 | Bacteria | 1946 |
| 71 | Ga0070665_100004629 | 3300005548 | Bacteria | 14379 |
| 72 | Ga0070665_100015575 | 3300005548 | Bacteria | 7638 |
| 73 | Ga0068855_100181157 | 3300005563 | Bacteria | 2382 |
| 74 | Ga0068857_100019162 | 3300005577 | Bacteria | 6006 |
| 75 | Ga0068854_100144716 | 3300005578 | Bacteria | 1827 |
| 76 | Ga0068856_100000137 | 3300005614 | Bacteria | 73762 |
| 77 | Ga0068856_100089592 | 3300005614 | Bacteria | 3059 |
| 78 | Ga0068856_100151171 | 3300005614 | Bacteria | 2331 |
| 79 | Ga0070702_100037542 | 3300005615 | Bacteria | 2691 |
| 80 | Ga0068852_100045438 | 3300005616 | Bacteria | 3735 |
| 81 | Ga0068859_100119183 | 3300005617 | Bacteria | 2705 |
| 82 | Ga0068864_100127071 | 3300005618 | Bacteria | 2285 |
| 83 | Ga0068864_100206508 | 3300005618 | Bacteria | 1807 |
| 84 | Ga0068866_10120683 | 3300005718 | Bacteria | 1477 |
| 85 | Ga0068861_100034317 | 3300005719 | Bacteria | 3751 |
| 86 | Ga0068870_10064809 | 3300005840 | Bacteria | 1974 |
| 87 | Ga0068858_100045860 | 3300005842 | Bacteria | 4052 |
| 88 | Ga0068858_100127363 | 3300005842 | Bacteria | 2385 |
| 89 | Ga0068860_100000313 | 3300005843 | Bacteria | 66545 |
| 90 | Ga0068860_100285936 | 3300005843 | Bacteria | 1612 |
| 91 | Ga0068862_100075315 | 3300005844 | Bacteria | 2919 |
| 92 | Ga0081455_10003860 | 3300005937 | Bacteria | 17086 |
| 93 | Ga0081455_10007493 | 3300005937 | Bacteria | 11483 |
| 94 | Ga0081455_10023465 | 3300005937 | Bacteria | 5739 |
| 95 | Ga0081455_10054097 | 3300005937 | Bacteria | 3424 |
| 96 | Ga0081538_10047308 | 3300005981 | Bacteria | 2640 |
| 97 | Ga0081540_1003389 | 3300005983 | Bacteria | 12636 |
| 98 | Ga0081540_1005657 | 3300005983 | Bacteria | 9294 |
| 99 | Ga0081540_1012479 | 3300005983 | Bacteria | 5588 |
| 100 | Ga0081540_1013267 | 3300005983 | Bacteria | 5368 |
| 101 | Ga0081540_1019710 | 3300005983 | Bacteria | 4086 |
| 102 | Ga0081540_1030350 | 3300005983 | Bacteria | 2995 |
| 103 | Ga0081540_1032245 | 3300005983 | Bacteria | 2865 |
| 104 | Ga0081540_1060906 | 3300005983 | Bacteria | 1802 |
| 105 | Ga0081539_10000157 | 3300005985 | Bacteria | 158278 |
| 106 | Ga0081539_10002599 | 3300005985 | Bacteria | 24763 |
| 107 | Ga0081539_10017515 | 3300005985 | Bacteria | 5025 |
| 108 | Ga0081539_10022796 | 3300005985 | Bacteria | 4126 |
| 109 | Ga0081539_10057358 | 3300005985 | Bacteria | 2155 |
| 110 | Ga0070717_10001671 | 3300006028 | Bacteria | 15424 |
| 111 | Ga0070717_10017257 | 3300006028 | Bacteria | 5613 |
| 112 | Ga0070717_10204002 | 3300006028 | Bacteria | 1733 |
| 113 | Ga0075365_10012998 | 3300006038 | Bacteria | 4966 |
| 114 | Ga0075365_10042277 | 3300006038 | Bacteria | 2979 |
| 115 | Ga0075365_10065794 | 3300006038 | Bacteria | 2430 |
| 116 | Ga0075365_10158192 | 3300006038 | Bacteria | 1578 |
| 117 | Ga0075365_10211792 | 3300006038 | Bacteria | 1358 |
| 118 | Ga0075368_10041613 | 3300006042 | Bacteria | 1805 |
| 119 | Ga0075368_10056347 | 3300006042 | Bacteria | 1568 |
| 120 | Ga0075363_100013603 | 3300006048 | Bacteria | 3951 |
| 121 | Ga0075363_100021149 | 3300006048 | Bacteria | 3273 |
| 122 | Ga0075363_100031275 | 3300006048 | Bacteria | 2759 |
| 123 | Ga0075363_100041425 | 3300006048 | Bacteria | 2429 |
| 124 | Ga0075363_100059526 | 3300006048 | Bacteria | 2054 |
| 125 | Ga0075364_10047292 | 3300006051 | Bacteria | 2802 |
| 126 | Ga0075364_10137182 | 3300006051 | Bacteria | 1644 |
| 127 | Ga0070715_10000590 | 3300006163 | Bacteria | 9547 |
| 128 | Ga0070715_10071086 | 3300006163 | Bacteria | 1555 |
| 129 | Ga0070716_100017234 | 3300006173 | Bacteria | 3741 |
| 130 | Ga0070712_100021384 | 3300006175 | Bacteria | 4250 |
| 131 | Ga0075362_10051603 | 3300006177 | Bacteria | 1841 |
| 132 | Ga0075367_10000722 | 3300006178 | Bacteria | 12799 |
| 133 | Ga0075367_10001394 | 3300006178 | Bacteria | 10346 |
| 134 | Ga0075367_10012975 | 3300006178 | Bacteria | 4464 |
| 135 | Ga0075367_10102176 | 3300006178 | Bacteria | 1753 |
| 136 | Ga0075366_10032723 | 3300006195 | Bacteria | 3061 |
| 137 | Ga0097621_100014735 | 3300006237 | Bacteria | 5860 |
| 138 | Ga0075370_10001262 | 3300006353 | Bacteria | 10776 |
| 139 | Ga0075370_10008731 | 3300006353 | Bacteria | 5228 |
| 140 | Ga0075370_10019237 | 3300006353 | Bacteria | 3717 |
| 141 | Ga0075370_10083319 | 3300006353 | Bacteria | 1840 |
| 142 | Ga0075434_100104354 | 3300006871 | Bacteria | 2844 |
| 143 | Ga0075434_100271941 | 3300006871 | Bacteria | 1713 |
| 144 | Ga0097620_100119191 | 3300006931 | Bacteria | 2705 |
| 145 | Ga0099824_1008303 | 3300006942 | Bacteria | 13338 |
| 146 | Ga0099822_1000541 | 3300006943 | Bacteria | 35996 |
| 147 | Ga0105250_10049362 | 3300009092 | Bacteria | 1688 |
| 148 | Ga0105240_10002492 | 3300009093 | Bacteria | 29572 |
| 149 | Ga0105240_10031167 | 3300009093 | Bacteria | 6919 |
| 150 | Ga0105240_10033967 | 3300009093 | Bacteria | 6585 |
| 151 | Ga0105240_10094752 | 3300009093 | Bacteria | 3641 |
| 152 | Ga0105240_10174427 | 3300009093 | Bacteria | 2543 |
| 153 | Ga0105245_10117978 | 3300009098 | Bacteria | 2476 |
| 154 | Ga0105247_10073098 | 3300009101 | Bacteria | 2148 |
| 155 | Ga0114129_10285040 | 3300009147 | Bacteria | 2206 |
| 156 | Ga0105241_10004267 | 3300009174 | Bacteria | 10572 |
| 157 | Ga0105241_10026939 | 3300009174 | Bacteria | 4278 |
| 158 | Ga0105248_10251915 | 3300009177 | Bacteria | 1987 |
| 159 | Ga0105237_10017841 | 3300009545 | Bacteria | 7357 |
| 160 | Ga0105237_10020566 | 3300009545 | Bacteria | 6801 |
| 161 | Ga0105237_10082692 | 3300009545 | Bacteria | 3201 |
| 162 | Ga0105237_10111420 | 3300009545 | Bacteria | 2729 |
| 163 | Ga0105237_10148154 | 3300009545 | Bacteria | 2342 |
| 164 | Ga0105237_10339257 | 3300009545 | Bacteria | 1507 |
| 165 | Ga0105238_10191493 | 3300009551 | Bacteria | 2021 |
| 166 | Ga0105238_10192363 | 3300009551 | Bacteria | 2016 |
| 167 | Ga0105249_10097572 | 3300009553 | Bacteria | 2759 |
| 168 | Ga0105239_10023011 | 3300010375 | Bacteria | 6870 |
| 169 | Ga0105239_10031553 | 3300010375 | Bacteria | 5826 |
| 170 | Ga0105239_10066232 | 3300010375 | Bacteria | 3968 |
| 171 | Ga0105239_10091046 | 3300010375 | Bacteria | 3366 |
| 172 | Ga0105239_10099249 | 3300010375 | Bacteria | 3219 |
| 173 | Ga0105239_10354237 | 3300010375 | Bacteria | 1657 |
| 174 | Ga0105246_10031978 | 3300011119 | Bacteria | 3486 |
| 175 | Ga0157371_10082442 | 3300013102 | Bacteria | 2277 |
| 176 | Ga0157369_10006548 | 3300013105 | Bacteria | 13480 |
| 177 | Ga0157374_10057255 | 3300013296 | Bacteria | 3641 |
| 178 | Ga0157374_10129159 | 3300013296 | Bacteria | 2444 |
| 179 | Ga0157378_10001192 | 3300013297 | Bacteria | 23599 |
| 180 | Ga0157378_10031729 | 3300013297 | Bacteria | 4666 |
| 181 | Ga0157378_10206002 | 3300013297 | Bacteria | 1863 |
| 182 | Ga0157378_10264155 | 3300013297 | Bacteria | 1653 |
| 183 | Ga0163162_10081273 | 3300013306 | Bacteria | 3311 |
| 184 | Ga0163162_10141798 | 3300013306 | Bacteria | 2517 |
| 185 | Ga0157372_10139256 | 3300013307 | Bacteria | 2795 |
| 186 | Ga0157372_10172733 | 3300013307 | Bacteria | 2501 |
| 187 | Ga0157375_10006444 | 3300013308 | Bacteria | 10223 |
| 188 | Ga0157375_10195176 | 3300013308 | Bacteria | 2179 |
| 189 | Ga0157375_10480788 | 3300013308 | Bacteria | 1407 |
| 190 | Ga0163163_10010769 | 3300014325 | Bacteria | 8250 |
| 191 | Ga0163163_10031158 | 3300014325 | Bacteria | 5146 |
| 192 | Ga0157380_10136861 | 3300014326 | Bacteria | 2098 |
| 193 | Ga0157377_10060704 | 3300014745 | Bacteria | 2159 |
| 194 | Ga0157376_10106890 | 3300014969 | Bacteria | 2456 |
| 195 | Ga0206353_11382579 | 3300020082 | Bacteria | 1348 |
| 196 | Ga0214544_1000003 | 3300021320 | Bacteria | 643752 |
| 197 | Ga0214542_1000022 | 3300021321 | Bacteria | 193578 |
| 198 | Ga0214545_1000010 | 3300021324 | Bacteria | 193578 |
| 199 | Ga0214543_1000035 | 3300021327 | Bacteria | 183100 |
| 200 | Ga0213876_10017171 | 3300021384 | Bacteria | 3821 |
| 201 | Ga0213876_10044681 | 3300021384 | Bacteria | 2342 |
| 202 | Ga0213876_10046958 | 3300021384 | Bacteria | 2283 |
| 203 | Ga0213876_10108812 | 3300021384 | Bacteria | 1471 |
| 204 | Ga0209677_100492 | 3300025253 | Bacteria | 22270 |
| 205 | Ga0209148_1000267 | 3300025254 | Bacteria | 81839 |
| 206 | Ga0209233_1001870 | 3300025261 | Bacteria | 8086 |
| 207 | Ga0209233_1013744 | 3300025261 | Bacteria | 2304 |
| 208 | Ga0209455_1004219 | 3300025272 | Bacteria | 4792 |
| 209 | Ga0209455_1004254 | 3300025272 | Bacteria | 4760 |
| 210 | Ga0209455_1008390 | 3300025272 | Bacteria | 2811 |
| 211 | Ga0209564_1000718 | 3300025295 | Bacteria | 47576 |
| 212 | Ga0209564_1002404 | 3300025295 | Bacteria | 14939 |
| 213 | Ga0209564_1011905 | 3300025295 | Bacteria | 3847 |
| 214 | Ga0209564_1028080 | 3300025295 | Bacteria | 1809 |
| 215 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 216 | Ga0209758_1000711 | 3300025297 | Bacteria | 49164 |
| 217 | Ga0209758_1000764 | 3300025297 | Bacteria | 46385 |
| 218 | Ga0209758_1001094 | 3300025297 | Bacteria | 35071 |
| 219 | Ga0209758_1004096 | 3300025297 | Bacteria | 12498 |
| 220 | Ga0209758_1011473 | 3300025297 | Bacteria | 5124 |
| 221 | Ga0209256_1002592 | 3300025299 | Bacteria | 14393 |
| 222 | Ga0209256_1019435 | 3300025299 | Bacteria | 2161 |
| 223 | Ga0207426_1000368 | 3300025302 | Bacteria | 79715 |
| 224 | Ga0207426_1013131 | 3300025302 | Bacteria | 3083 |
| 225 | Ga0209257_1002989 | 3300025304 | Bacteria | 15349 |
| 226 | Ga0207692_10004867 | 3300025898 | Bacteria | 5346 |
| 227 | Ga0207692_10054264 | 3300025898 | Bacteria | 2046 |
| 228 | Ga0207710_10096088 | 3300025900 | Bacteria | 1393 |
| 229 | Ga0207688_10016777 | 3300025901 | Bacteria | 3976 |
| 230 | Ga0207688_10063558 | 3300025901 | Bacteria | 2082 |
| 231 | Ga0207699_10001435 | 3300025906 | Bacteria | 11313 |
| 232 | Ga0207699_10003885 | 3300025906 | Bacteria | 7136 |
| 233 | Ga0207699_10006921 | 3300025906 | Bacteria | 5519 |
| 234 | Ga0207645_10149547 | 3300025907 | Bacteria | 1524 |
| 235 | Ga0207643_10076315 | 3300025908 | Bacteria | 1936 |
| 236 | Ga0207705_10029183 | 3300025909 | Bacteria | 3932 |
| 237 | Ga0207684_10142304 | 3300025910 | Bacteria | 2062 |
| 238 | Ga0207707_10000143 | 3300025912 | Bacteria | 74226 |
| 239 | Ga0207707_10000613 | 3300025912 | Bacteria | 35676 |
| 240 | Ga0207707_10030362 | 3300025912 | Bacteria | 4728 |
| 241 | Ga0207707_10090452 | 3300025912 | Bacteria | 2675 |
| 242 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 243 | Ga0207695_10020632 | 3300025913 | Bacteria | 7543 |
| 244 | Ga0207695_10177667 | 3300025913 | Bacteria | 2051 |
| 245 | Ga0207671_10013578 | 3300025914 | Bacteria | 6481 |
| 246 | Ga0207671_10088574 | 3300025914 | Bacteria | 2329 |
| 247 | Ga0207671_10106177 | 3300025914 | Bacteria | 2132 |
| 248 | Ga0207671_10145151 | 3300025914 | Bacteria | 1830 |
| 249 | Ga0207671_10242235 | 3300025914 | Bacteria | 1417 |
| 250 | Ga0207693_10005195 | 3300025915 | Bacteria | 10899 |
| 251 | Ga0207693_10056281 | 3300025915 | Bacteria | 3083 |
| 252 | Ga0207693_10159692 | 3300025915 | Bacteria | 1773 |
| 253 | Ga0207663_10001411 | 3300025916 | Bacteria | 11145 |
| 254 | Ga0207663_10099070 | 3300025916 | Bacteria | 1953 |
| 255 | Ga0207663_10170928 | 3300025916 | Bacteria | 1544 |
| 256 | Ga0207660_10026752 | 3300025917 | Bacteria | 3931 |
| 257 | Ga0207660_10038751 | 3300025917 | Bacteria | 3328 |
| 258 | Ga0207660_10173529 | 3300025917 | Bacteria | 1670 |
| 259 | Ga0207657_10096510 | 3300025919 | Bacteria | 2459 |
| 260 | Ga0207652_10023738 | 3300025921 | Bacteria | 5083 |
| 261 | Ga0207694_10133399 | 3300025924 | Bacteria | 1992 |
| 262 | Ga0207694_10152670 | 3300025924 | Bacteria | 1861 |
| 263 | Ga0207687_10112719 | 3300025927 | Bacteria | 2022 |
| 264 | Ga0207700_10007542 | 3300025928 | Bacteria | 6659 |
| 265 | Ga0207700_10045941 | 3300025928 | Bacteria | 3226 |
| 266 | Ga0207700_10064374 | 3300025928 | Bacteria | 2793 |
| 267 | Ga0207700_10072426 | 3300025928 | Bacteria | 2657 |
| 268 | Ga0207664_10064293 | 3300025929 | Bacteria | 2934 |
| 269 | Ga0207664_10094469 | 3300025929 | Bacteria | 2458 |
| 270 | Ga0207664_10176777 | 3300025929 | Bacteria | 1831 |
| 271 | Ga0207664_10283691 | 3300025929 | Bacteria | 1454 |
| 272 | Ga0207644_10025584 | 3300025931 | Bacteria | 4059 |
| 273 | Ga0207690_10240562 | 3300025932 | Bacteria | 1394 |
| 274 | Ga0207686_10030104 | 3300025934 | Bacteria | 3210 |
| 275 | Ga0207686_10146933 | 3300025934 | Bacteria | 1636 |
| 276 | Ga0207670_10263755 | 3300025936 | Bacteria | 1336 |
| 277 | Ga0207665_10006088 | 3300025939 | Bacteria | 8010 |
| 278 | Ga0207665_10031878 | 3300025939 | Bacteria | 3489 |
| 279 | Ga0207711_10052528 | 3300025941 | Bacteria | 3493 |
| 280 | Ga0207711_10055306 | 3300025941 | Bacteria | 3407 |
| 281 | Ga0207661_10065867 | 3300025944 | Bacteria | 2941 |
| 282 | Ga0207651_10171886 | 3300025960 | Bacteria | 1710 |
| 283 | Ga0207651_10176730 | 3300025960 | Bacteria | 1689 |
| 284 | Ga0207640_10008004 | 3300025981 | Bacteria | 5840 |
| 285 | Ga0207677_10060703 | 3300026023 | Bacteria | 2615 |
| 286 | Ga0207703_10128866 | 3300026035 | Bacteria | 2182 |
| 287 | Ga0207639_10214675 | 3300026041 | Bacteria | 1658 |
| 288 | Ga0207678_10016337 | 3300026067 | Bacteria | 6516 |
| 289 | Ga0207678_10017766 | 3300026067 | Bacteria | 6245 |
| 290 | Ga0207678_10019513 | 3300026067 | Bacteria | 5956 |
| 291 | Ga0207678_10033040 | 3300026067 | Bacteria | 4508 |
| 292 | Ga0207678_10059483 | 3300026067 | Bacteria | 3287 |
| 293 | Ga0207678_10060315 | 3300026067 | Bacteria | 3263 |
| 294 | Ga0207678_10090054 | 3300026067 | Bacteria | 2622 |
| 295 | Ga0207702_10000063 | 3300026078 | Bacteria | 123034 |
| 296 | Ga0207702_10042949 | 3300026078 | Bacteria | 3793 |
| 297 | Ga0207702_10091162 | 3300026078 | Bacteria | 2668 |
| 298 | Ga0207641_10037994 | 3300026088 | Bacteria | 4024 |
| 299 | Ga0207641_10079791 | 3300026088 | Bacteria | 2838 |
| 300 | Ga0207648_10023956 | 3300026089 | Bacteria | 5457 |
| 301 | Ga0207674_10027211 | 3300026116 | Bacteria | 6054 |
| 302 | Ga0207674_10061985 | 3300026116 | Bacteria | 3777 |
| 303 | Ga0207675_100037599 | 3300026118 | Bacteria | 4514 |
| 304 | Ga0207683_10038422 | 3300026121 | Bacteria | 4172 |
| 305 | Ga0207683_10040055 | 3300026121 | Bacteria | 4087 |
| 306 | Ga0207698_10314242 | 3300026142 | Bacteria | 1464 |
| 307 | Ga0209389_1000012 | 3300027296 | Bacteria | 213243 |
| 308 | Ga0209389_1000069 | 3300027296 | Bacteria | 98063 |
| 309 | Ga0209589_1000015 | 3300027357 | Bacteria | 225913 |
| 310 | Ga0209589_1000077 | 3300027357 | Bacteria | 98063 |
| 311 | Ga0209489_100015 | 3300027361 | Bacteria | 225913 |
| 312 | Ga0209489_100019 | 3300027361 | Bacteria | 213243 |
| 313 | Ga0209489_100020 | 3300027361 | Bacteria | 207541 |
| 314 | Ga0209700_100018 | 3300027363 | Bacteria | 238200 |
| 315 | Ga0209700_100025 | 3300027363 | Bacteria | 225913 |
| 316 | Ga0209179_1004877 | 3300027512 | Bacteria | 2059 |
| 317 | Ga0207428_10148947 | 3300027907 | Bacteria | 1782 |
| 318 | Ga0268266_10003840 | 3300028379 | Bacteria | 14672 |
| 319 | Ga0268266_10008431 | 3300028379 | Bacteria | 9163 |
| 320 | Ga0268266_10034518 | 3300028379 | Bacteria | 4302 |
| 321 | Ga0268264_10000356 | 3300028381 | Bacteria | 68810 |
| 322 | Ga0265323_10007414 | 3300028653 | Bacteria | 4559 |
| 323 | Ga0265336_10000346 | 3300028666 | Bacteria | 30553 |
| 324 | Ga0307517_10001423 | 3300028786 | Bacteria | 40213 |
| 325 | Ga0307515_10032146 | 3300028794 | Bacteria | 8708 |
| 326 | Ga0307515_10090460 | 3300028794 | Bacteria | 3838 |
| 327 | Ga0307515_10252869 | 3300028794 | Bacteria | 1511 |
| 328 | Ga0265338_10000417 | 3300028800 | Bacteria | 76249 |
| 329 | Ga0307511_10087863 | 3300030521 | Bacteria | 2130 |
| 330 | Ga0265325_10109984 | 3300031241 | Bacteria | 1340 |
| 331 | Ga0265340_10002373 | 3300031247 | Bacteria | 10714 |
| 332 | Ga0265339_10003359 | 3300031249 | Bacteria | 11199 |
| 333 | Ga0265339_10008317 | 3300031249 | Bacteria | 6608 |
| 334 | Ga0307509_10119372 | 3300031507 | Bacteria | 2618 |
| 335 | Ga0307508_10000012 | 3300031616 | Bacteria | 243167 |
| 336 | Ga0307508_10013966 | 3300031616 | Bacteria | 7327 |
| 337 | Ga0307508_10095708 | 3300031616 | Bacteria | 2560 |
| 338 | Ga0307508_10148584 | 3300031616 | Bacteria | 1948 |
| 339 | Ga0265314_10032879 | 3300031711 | Bacteria | 3810 |
| 340 | Ga0265314_10043122 | 3300031711 | Bacteria | 3210 |
| 341 | Ga0307516_10010102 | 3300031730 | Bacteria | 10436 |
| 342 | Ga0307516_10074049 | 3300031730 | Bacteria | 3262 |
| 343 | Ga0307516_10118097 | 3300031730 | Bacteria | 2446 |
| 344 | Ga0307516_10167679 | 3300031730 | Bacteria | 1939 |
| 345 | Ga0307409_100106920 | 3300031995 | Bacteria | 2336 |
| 346 | Ga0307416_100170057 | 3300032002 | Bacteria | 2027 |
| 347 | Ga0307415_100136139 | 3300032126 | Bacteria | 1868 |
| 348 | Ga0307507_10092970 | 3300033179 | Bacteria | 2571 |
| 349 | Ga0307510_10015377 | 3300033180 | Bacteria | 9047 |
| 350 | Ga0307510_10023362 | 3300033180 | Bacteria | 7168 |
| 351 | Ga0307510_10068023 | 3300033180 | Bacteria | 3579 |
| 352 | Ga0307510_10100483 | 3300033180 | Bacteria | 2686 |
| 353 | Ga0315911_1000037 | 3300033442 | Bacteria | 62198 |
| 354 | Ga0373930_0020548 | 3300034816 | Bacteria | 1288 |
| 355 | Ga0373934_0002532 | 3300035086 | Bacteria | 6723 |
| 356 | Ga0373923_0003267 | 3300035111 | Bacteria | 5166 |
| 357 | Ga0373923_0059362 | 3300035111 | Bacteria | 1621 |
| 358 | Ga0373936_0001098 | 3300035113 | Bacteria | 9698 |
| 359 | Ga0373936_0042302 | 3300035113 | Bacteria | 1829 |
| 360 | Ga0373936_0043904 | 3300035113 | Bacteria | 1797 |
| 361 | Ga0373945_0001922 | 3300035116 | Bacteria | 6445 |
| 362 | Ga0373953_0001769 | 3300035117 | Bacteria | 6378 |
| 363 | Ga0373953_0009391 | 3300035117 | Bacteria | 3364 |
| 364 | Ga0373954_0002946 | 3300035118 | Bacteria | 7181 |
| 365 | Ga0373954_0006705 | 3300035118 | Bacteria | 5021 |
| 366 | Ga0373956_0000376 | 3300035119 | Bacteria | 18268 |
| 367 | Ga0373957_0005684 | 3300035120 | Bacteria | 3881 |
| 368 | Ga0373957_0046825 | 3300035120 | Bacteria | 1642 |
| 369 | Ga0373943_0071667 | 3300035170 | Bacteria | 1756 |
| 370 | Ga0373955_0000325 | 3300035172 | Bacteria | 19823 |
| 371 | Ga0373955_0067917 | 3300035172 | Bacteria | 1985 |
| 372 | Ga0373955_0086410 | 3300035172 | Bacteria | 1781 |
| 373 | Ga0373942_0033799 | 3300035207 | Bacteria | 1365 |
| 374 | Ga0373924_0007619 | 3300035410 | Bacteria | 3912 |
| 375 | Ga0373924_0007815 | 3300035410 | Bacteria | 3866 |
| 376 | Ga0373924_0065537 | 3300035410 | Bacteria | 1525 |
| 377 | Ga0373931_0009747 | 3300035691 | Bacteria | 4598 |
| 378 | Ga0373935_0007815 | 3300035692 | Bacteria | 6411 |
| 379 | Ga0373935_0050257 | 3300035692 | Bacteria | 2646 |
| 380 | Ga0373935_0127495 | 3300035692 | Bacteria | 1706 |
| 381 | Ga0373927_0000137 | 3300035695 | Bacteria | 56546 |
| 382 | Ga0373927_0017402 | 3300035695 | Bacteria | 4730 |
| 383 | Ga0373927_0036587 | 3300035695 | Bacteria | 3192 |
| 384 | Ga0373927_0068754 | 3300035695 | Bacteria | 2292 |
| 385 | Ga0373927_0082856 | 3300035695 | Bacteria | 2080 |
| 386 | Ga0373927_0121167 | 3300035695 | Bacteria | 1707 |
| 387 | Ga0373933_0000108 | 3300035724 | Bacteria | 53024 |
| 388 | Ga0373933_0099071 | 3300035724 | Bacteria | 1806 |
| 389 | Ga0373947_0000902 | 3300035725 | Bacteria | 17985 |
| 390 | Ga0373947_0012959 | 3300035725 | Bacteria | 4780 |
| 391 | Ga0373947_0141466 | 3300035725 | Bacteria | 1543 |
| 392 | Ga0373937_0007855 | 3300036401 | Bacteria | 9247 |
| 393 | Ga0373937_0024716 | 3300036401 | Bacteria | 5421 |
| 394 | Ga0373925_0002159 | 3300037068 | Bacteria | 16068 |
| 395 | Ga0373925_0010829 | 3300037068 | Bacteria | 6612 |
| 396 | Ga0373925_0027502 | 3300037068 | Bacteria | 4162 |
| 397 | Ga0373925_0036147 | 3300037068 | Bacteria | 3646 |
| 398 | Ga0373925_0062118 | 3300037068 | Bacteria | 2808 |
| 399 | Ga0373925_0173665 | 3300037068 | Bacteria | 1702 |
| 400 | Ga0373925_0203260 | 3300037068 | Bacteria | 1576 |
| 401 | Ga0373925_0219803 | 3300037068 | Bacteria | 1516 |
| 402 | Ga0395900_0001756 | 3300037418 | Bacteria | 24872 |
| 403 | Ga0395900_0010446 | 3300037418 | Bacteria | 9497 |
| 404 | Ga0395900_0351119 | 3300037418 | Bacteria | 1448 |
| 405 | Ga0395898_0035306 | 3300037466 | Bacteria | 4974 |
| 406 | Ga0395898_0058280 | 3300037466 | Bacteria | 3760 |
| 407 | Ga0395905_0098242 | 3300037471 | Bacteria | 2749 |
| 408 | Ga0395905_0161755 | 3300037471 | Bacteria | 2104 |
| 409 | Ga0395905_0196810 | 3300037471 | Bacteria | 1890 |
| 410 | Ga0395905_0221082 | 3300037471 | Bacteria | 1772 |
| 411 | Ga0436364_0461113 | 3300037853 | Bacteria | 2216 |
| 412 | Ga0436364_0735016 | 3300037853 | Bacteria | 1210 |
| 413 | Ga0436364_0948768 | 3300037853 | Bacteria | 1461 |
| 414 | Ga0395901_0028786 | 3300038443 | Bacteria | 5715 |
| 415 | Ga0395901_0109804 | 3300038443 | Bacteria | 2896 |
| 416 | Ga0436365_0457714 | 3300039437 | Bacteria | 7003 |
| 417 | Ga0436365_0592130 | 3300039437 | Bacteria | 8188 |
| 418 | Ga0436365_1312844 | 3300039437 | Bacteria | 2246 |
| 419 | Ga0436361_0474776 | 3300039447 | Bacteria | 6557 |
| 420 | Ga0439465_0024103 | 3300041413 | Bacteria | 1917 |
| 421 | Ga0439465_0029460 | 3300041413 | Bacteria | 1744 |
| 422 | Ga0451795_0601895 | 3300041456 | Bacteria | 1789 |
| 423 | Ga0466969_0050676 | 3300044656 | Bacteria | 2046 |
| 424 | Ga0466972_0000100 | 3300044658 | Bacteria | 76018 |
| 425 | Ga0466972_0014629 | 3300044658 | Bacteria | 3927 |
| 426 | Ga0466965_0011221 | 3300044683 | Bacteria | 4195 |
| 427 | Ga0466966_0001463 | 3300044684 | Bacteria | 15199 |
| 428 | Ga0466961_0000601 | 3300044693 | Bacteria | 22652 |
| 429 | Ga0466963_0058249 | 3300044694 | Bacteria | 2575 |
| 430 | Ga0466963_0121410 | 3300044694 | Bacteria | 1799 |
| 431 | Ga0466968_0008001 | 3300044735 | Bacteria | 4039 |
| 432 | Ga0466957_0117662 | 3300044842 | Bacteria | 1692 |
| 433 | Ga0466959_0000634 | 3300045049 | Bacteria | 20407 |
| 434 | Ga0466958_0012458 | 3300045836 | Bacteria | 4821 |
| 435 | Ga0466967_0161245 | 3300045976 | Bacteria | 2105 |
| 436 | Ga0466967_0227567 | 3300045976 | Bacteria | 1774 |
| 437 | Ga0466967_0302164 | 3300045976 | Bacteria | 1540 |
| 438 | Ga0495592_0000339 | 3300046454 | Bacteria | 38389 |
| 439 | Ga0495592_0008958 | 3300046454 | Bacteria | 7516 |
| 440 | Ga0495592_0033013 | 3300046454 | Bacteria | 3905 |
| 441 | Ga0495592_0034020 | 3300046454 | Bacteria | 3843 |
| 442 | Ga0495592_0058113 | 3300046454 | Bacteria | 2853 |
| 443 | Ga0495603_0000277 | 3300046455 | Bacteria | 27280 |
| 444 | Ga0495603_0011788 | 3300046455 | Bacteria | 5292 |
| 445 | Ga0495603_0030573 | 3300046455 | Bacteria | 3243 |
| 446 | Ga0495603_0058565 | 3300046455 | Bacteria | 2277 |
| 447 | Ga0495603_0063865 | 3300046455 | Bacteria | 2171 |
| 448 | Ga0495603_0064886 | 3300046455 | Bacteria | 2152 |
| 449 | Ga0495629_0000029 | 3300046459 | Bacteria | 127000 |
| 450 | Ga0495629_0001483 | 3300046459 | Bacteria | 18494 |
| 451 | Ga0495629_0043490 | 3300046459 | Bacteria | 3153 |
| 452 | Ga0495629_0056255 | 3300046459 | Bacteria | 2751 |
| 453 | Ga0495629_0057452 | 3300046459 | Bacteria | 2721 |
| 454 | Ga0495629_0081882 | 3300046459 | Bacteria | 2253 |
| 455 | Ga0495641_0003605 | 3300046461 | Bacteria | 11465 |
| 456 | Ga0495651_0031486 | 3300046462 | Bacteria | 4136 |
| 457 | Ga0495651_0034091 | 3300046462 | Bacteria | 3969 |
| 458 | Ga0495651_0042153 | 3300046462 | Bacteria | 3545 |
| 459 | Ga0495651_0053385 | 3300046462 | Bacteria | 3111 |
| 460 | Ga0495651_0105986 | 3300046462 | Bacteria | 2084 |
| 461 | Ga0495653_0001063 | 3300046463 | Bacteria | 21155 |
| 462 | Ga0495580_0002567 | 3300046472 | Bacteria | 15791 |
| 463 | Ga0495582_0000024 | 3300046473 | Bacteria | 82444 |
| 464 | Ga0495582_0008119 | 3300046473 | Bacteria | 5796 |
| 465 | Ga0495605_0056580 | 3300046474 | Bacteria | 1891 |
| 466 | Ga0495639_0000006 | 3300046475 | Bacteria | 100361 |
| 467 | Ga0495639_0127276 | 3300046475 | Bacteria | 1218 |
| 468 | Ga0495662_0000348 | 3300046476 | Bacteria | 20253 |
| 469 | Ga0495662_0062304 | 3300046476 | Bacteria | 1802 |
| 470 | Ga0495664_0007034 | 3300046477 | Bacteria | 6232 |
| 471 | Ga0495664_0013716 | 3300046477 | Bacteria | 4596 |
| 472 | Ga0495664_0163539 | 3300046477 | Bacteria | 1350 |
| 473 | Ga0495584_0035543 | 3300046491 | Bacteria | 2518 |
| 474 | Ga0495585_0105255 | 3300046492 | Bacteria | 1505 |
| 475 | Ga0495594_0000170 | 3300046499 | Bacteria | 31295 |
| 476 | Ga0495606_0013516 | 3300046507 | Bacteria | 6440 |
| 477 | Ga0495606_0083744 | 3300046507 | Bacteria | 1977 |
| 478 | Ga0495608_0075302 | 3300046511 | Bacteria | 2199 |
| 479 | Ga0495608_0190980 | 3300046511 | Bacteria | 1293 |
| 480 | Ga0495610_0044538 | 3300046512 | Bacteria | 2202 |
| 481 | Ga0495610_0058795 | 3300046512 | Bacteria | 1838 |
| 482 | Ga0495610_0112766 | 3300046512 | Bacteria | 1202 |
| 483 | Ga0495616_0038012 | 3300046513 | Bacteria | 2473 |
| 484 | Ga0495618_0018824 | 3300046514 | Bacteria | 4242 |
| 485 | Ga0495628_0010789 | 3300046516 | Bacteria | 7737 |
| 486 | Ga0495628_0014226 | 3300046516 | Bacteria | 6678 |
| 487 | Ga0495628_0074634 | 3300046516 | Bacteria | 2641 |
| 488 | Ga0495628_0079529 | 3300046516 | Bacteria | 2549 |
| 489 | Ga0495630_0003257 | 3300046517 | Bacteria | 11317 |
| 490 | Ga0495630_0058889 | 3300046517 | Bacteria | 2880 |
| 491 | Ga0495648_0016531 | 3300046524 | Bacteria | 5317 |
| 492 | Ga0495648_0019778 | 3300046524 | Bacteria | 4718 |
| 493 | Ga0495648_0027989 | 3300046524 | Bacteria | 3763 |
| 494 | Ga0495666_0011725 | 3300046526 | Bacteria | 4370 |
| 495 | Ga0495666_0031438 | 3300046526 | Bacteria | 2601 |
| 496 | Ga0495652_0040442 | 3300046529 | Bacteria | 4030 |
| 497 | Ga0495652_0047155 | 3300046529 | Bacteria | 3696 |
| 498 | Ga0495652_0061633 | 3300046529 | Bacteria | 3165 |
| 499 | Ga0495652_0101400 | 3300046529 | Bacteria | 2333 |
| 500 | Ga0495665_0000178 | 3300046531 | Bacteria | 32333 |
| 501 | Ga0495665_0044353 | 3300046531 | Bacteria | 2363 |
| 502 | Ga0495640_0003797 | 3300046533 | Bacteria | 12127 |
| 503 | Ga0495640_0004410 | 3300046533 | Bacteria | 11233 |
| 504 | Ga0495640_0022850 | 3300046533 | Bacteria | 4566 |
| 505 | Ga0495587_0087441 | 3300046536 | Bacteria | 1803 |
| 506 | Ga0495587_0127658 | 3300046536 | Bacteria | 1454 |
| 507 | Ga0495597_0014928 | 3300046542 | Bacteria | 3689 |
| 508 | Ga0495645_0033925 | 3300046543 | Bacteria | 3723 |
| 509 | Ga0495645_0052192 | 3300046543 | Bacteria | 2976 |
| 510 | Ga0495645_0100650 | 3300046543 | Bacteria | 2055 |
| 511 | Ga0495622_0002996 | 3300046557 | Bacteria | 8018 |
| 512 | Ga0495622_0015955 | 3300046557 | Bacteria | 3493 |
| 513 | Ga0495622_0031914 | 3300046557 | Bacteria | 2460 |
| 514 | Ga0495622_0044412 | 3300046557 | Bacteria | 2065 |
| 515 | Ga0495622_0046682 | 3300046557 | Bacteria | 2012 |
| 516 | Ga0495667_0003075 | 3300046559 | Bacteria | 11195 |
| 517 | Ga0495667_0074387 | 3300046559 | Bacteria | 2212 |
| 518 | Ga0495667_0088315 | 3300046559 | Bacteria | 2009 |
| 519 | Ga0495656_0007598 | 3300046615 | Bacteria | 3838 |
| 520 | Ga0495656_0008501 | 3300046615 | Bacteria | 3666 |
| 521 | Ga0495656_0023243 | 3300046615 | Bacteria | 2438 |
| 522 | Ga0495668_0148417 | 3300046616 | Bacteria | 1284 |
| 523 | Ga0495634_0000354 | 3300046642 | Bacteria | 44714 |
| 524 | Ga0495634_0002330 | 3300046642 | Bacteria | 15886 |
| 525 | Ga0495634_0023750 | 3300046642 | Bacteria | 4308 |
| 526 | Ga0495634_0033779 | 3300046642 | Bacteria | 3513 |
| 527 | Ga0495634_0037146 | 3300046642 | Bacteria | 3329 |
| 528 | Ga0495634_0162458 | 3300046642 | Bacteria | 1407 |
| 529 | Ga0495611_0053797 | 3300046648 | Bacteria | 1818 |
| 530 | Ga0495625_0014247 | 3300046660 | Bacteria | 6356 |
| 531 | Ga0495625_0030852 | 3300046660 | Bacteria | 3994 |
| 532 | Ga0495635_0000917 | 3300046663 | Bacteria | 19365 |
| 533 | Ga0495635_0002291 | 3300046663 | Bacteria | 13017 |
| 534 | Ga0495635_0006214 | 3300046663 | Bacteria | 8323 |
| 535 | Ga0495635_0018638 | 3300046663 | Bacteria | 4842 |
| 536 | Ga0495659_0049165 | 3300046664 | Bacteria | 1530 |
| 537 | Ga0495588_0020824 | 3300046674 | Bacteria | 3227 |
| 538 | Ga0495657_0003543 | 3300046675 | Bacteria | 12725 |
| 539 | Ga0495657_0005133 | 3300046675 | Bacteria | 10381 |
| 540 | Ga0495657_0009727 | 3300046675 | Bacteria | 7262 |
| 541 | Ga0495657_0066994 | 3300046675 | Bacteria | 2358 |
| 542 | Ga0495599_0005791 | 3300046678 | Bacteria | 7417 |
| 543 | Ga0495599_0036803 | 3300046678 | Bacteria | 3075 |
| 544 | Ga0495599_0038886 | 3300046678 | Bacteria | 2990 |
| 545 | Ga0495599_0051217 | 3300046678 | Bacteria | 2587 |
| 546 | Ga0495623_0010483 | 3300046679 | Bacteria | 5998 |
| 547 | Ga0495623_0013015 | 3300046679 | Bacteria | 5388 |
| 548 | Ga0495646_0000902 | 3300046680 | Bacteria | 16844 |
| 549 | Ga0495646_0003762 | 3300046680 | Bacteria | 9487 |
| 550 | Ga0495646_0037428 | 3300046680 | Bacteria | 3001 |
| 551 | Ga0495646_0056213 | 3300046680 | Bacteria | 2360 |
| 552 | Ga0495647_0002169 | 3300046681 | Bacteria | 6134 |
| 553 | Ga0495647_0025404 | 3300046681 | Bacteria | 2164 |
| 554 | Ga0495658_0000428 | 3300046683 | Bacteria | 23516 |
| 555 | Ga0495658_0013755 | 3300046683 | Bacteria | 4124 |
| 556 | Ga0495669_0057920 | 3300046684 | Bacteria | 1748 |
| 557 | Ga0495613_0001078 | 3300046689 | Bacteria | 20808 |
| 558 | Ga0495613_0012318 | 3300046689 | Bacteria | 6353 |
| 559 | Ga0495613_0067784 | 3300046689 | Bacteria | 2604 |
| 560 | Ga0495613_0067799 | 3300046689 | Bacteria | 2604 |
| 561 | Ga0495624_0000788 | 3300046690 | Bacteria | 24985 |
| 562 | Ga0495624_0039622 | 3300046690 | Bacteria | 3020 |
| 563 | Ga0495624_0065431 | 3300046690 | Bacteria | 2271 |
| 564 | Ga0495670_0006876 | 3300046691 | Bacteria | 5596 |
| 565 | Ga0495671_0049797 | 3300046692 | Bacteria | 2087 |
| 566 | Ga0495649_0067447 | 3300046694 | Bacteria | 1919 |
| 567 | Ga0495600_0002741 | 3300046809 | Bacteria | 10203 |
| 568 | Ga0495600_0006367 | 3300046809 | Bacteria | 7183 |
| 569 | Ga0495600_0091394 | 3300046809 | Bacteria | 1985 |
| 570 | Ga0495660_0030369 | 3300046810 | Bacteria | 3044 |
| 571 | Ga0495581_0000004 | 3300047315 | Bacteria | 84424 |
| 572 | Ga0495581_0029027 | 3300047315 | Bacteria | 3207 |
| 573 | Ga0495581_0064398 | 3300047315 | Bacteria | 2118 |
| 574 | Ga0495581_0096450 | 3300047315 | Bacteria | 1717 |
| 575 | Ga0495604_0000678 | 3300047317 | Bacteria | 28877 |
| 576 | Ga0495604_0007941 | 3300047317 | Bacteria | 8404 |
| 577 | Ga0495604_0024945 | 3300047317 | Bacteria | 4768 |
| 578 | Ga0495674_0000415 | 3300047319 | Bacteria | 38235 |
| 579 | Ga0495674_0007236 | 3300047319 | Bacteria | 10620 |
| 580 | Ga0495674_0026281 | 3300047319 | Bacteria | 5328 |
| 581 | Ga0495672_0018820 | 3300047320 | Bacteria | 4574 |
| 582 | Ga0495672_0041687 | 3300047320 | Bacteria | 2774 |
| 583 | Ga0495672_0084711 | 3300047320 | Bacteria | 1758 |
| 584 | Ga0495676_0019876 | 3300047321 | Bacteria | 5903 |
| 585 | Ga0495676_0032444 | 3300047321 | Bacteria | 4408 |
| 586 | Ga0495676_0037764 | 3300047321 | Bacteria | 4016 |
| 587 | Ga0495676_0109575 | 3300047321 | Bacteria | 2029 |
| 588 | Ga0495676_0110006 | 3300047321 | Bacteria | 2023 |
| 589 | Ga0495680_0001164 | 3300047322 | Bacteria | 28965 |
| 590 | Ga0495680_0239647 | 3300047322 | Bacteria | 1289 |
| 591 | Ga0495687_010280 | 3300047443 | Bacteria | 5141 |
| 592 | Ga0495675_0000901 | 3300047444 | Bacteria | 18140 |
| 593 | Ga0495675_0012017 | 3300047444 | Bacteria | 5442 |
| 594 | Ga0495675_0068840 | 3300047444 | Bacteria | 2235 |
| 595 | Ga0495677_0027542 | 3300047445 | Bacteria | 2062 |
| 596 | Ga0495685_052355 | 3300047447 | Bacteria | 1383 |
| 597 | Ga0495673_0028163 | 3300047469 | Bacteria | 2664 |
| 598 | Ga0495684_0000721 | 3300047471 | Bacteria | 26637 |
| 599 | Ga0495684_0009275 | 3300047471 | Bacteria | 7597 |
| 600 | Ga0495684_0064676 | 3300047471 | Bacteria | 2780 |
| 601 | Ga0495684_0132607 | 3300047471 | Bacteria | 1870 |
| 602 | Ga0495593_0000198 | 3300047673 | Bacteria | 31587 |
| 603 | Ga0495593_0003019 | 3300047673 | Bacteria | 10137 |
| 604 | Ga0495593_0004072 | 3300047673 | Bacteria | 8702 |
| 605 | Ga0495593_0012359 | 3300047673 | Bacteria | 4879 |
| 606 | Ga0495602_0007817 | 3300048088 | Bacteria | 11179 |
| 607 | Ga0495602_0060850 | 3300048088 | Bacteria | 3287 |
| 608 | Ga0495602_0068869 | 3300048088 | Bacteria | 3037 |
| 609 | Ga0495614_0010431 | 3300048089 | Bacteria | 4097 |
| 610 | Ga0495626_0021097 | 3300048091 | Bacteria | 3238 |
| 611 | Ga0495626_0033878 | 3300048091 | Bacteria | 2446 |
| 612 | Ga0496100_0059742 | 3300048903 | Bacteria | 2506 |
| 613 | Ga0496100_0076187 | 3300048903 | Bacteria | 2252 |
| 614 | Ga0496101_0051291 | 3300048904 | Bacteria | 2972 |
| 615 | Ga0496101_0075732 | 3300048904 | Bacteria | 2477 |
| 616 | Ga0496102_0010100 | 3300048905 | Bacteria | 8120 |
| 617 | Ga0496102_0039067 | 3300048905 | Bacteria | 4286 |
| 618 | Ga0496102_0094833 | 3300048905 | Bacteria | 2765 |
| 619 | Ga0496102_0143511 | 3300048905 | Bacteria | 2240 |
| 620 | Ga0496102_0253222 | 3300048905 | Bacteria | 1660 |
| 621 | Ga0496103_0028235 | 3300048906 | Bacteria | 3403 |
| 622 | Ga0496103_0088357 | 3300048906 | Bacteria | 1954 |
| 623 | Ga0496104_0014507 | 3300048907 | Bacteria | 7117 |
| 624 | Ga0496104_0069211 | 3300048907 | Bacteria | 3354 |
| 625 | Ga0496104_0127620 | 3300048907 | Bacteria | 2442 |
| 626 | Ga0496104_0152912 | 3300048907 | Bacteria | 2214 |
| 627 | Ga0496105_0007733 | 3300048908 | Bacteria | 8340 |
| 628 | Ga0496105_0023125 | 3300048908 | Bacteria | 5040 |
| 629 | Ga0496105_0104649 | 3300048908 | Bacteria | 2337 |
| 630 | Ga0496105_0158139 | 3300048908 | Bacteria | 1860 |
| 631 | Ga0496106_0001953 | 3300048909 | Bacteria | 15491 |
| 632 | Ga0496106_0008314 | 3300048909 | Bacteria | 7679 |
| 633 | Ga0496106_0068753 | 3300048909 | Bacteria | 2702 |
| 634 | Ga0496106_0111956 | 3300048909 | Bacteria | 2126 |
| 635 | Ga0496106_0136444 | 3300048909 | Bacteria | 1927 |
| 636 | Ga0496107_0026534 | 3300048910 | Bacteria | 4108 |
| 637 | Ga0496108_0024837 | 3300048911 | Bacteria | 4934 |
| 638 | Ga0496108_0084715 | 3300048911 | Bacteria | 2690 |
| 639 | Ga0496108_0137501 | 3300048911 | Bacteria | 2103 |
| 640 | Ga0496108_0164457 | 3300048911 | Bacteria | 1918 |
| 641 | Ga0496109_0086237 | 3300048912 | Bacteria | 2899 |
| 642 | Ga0496109_0117930 | 3300048912 | Bacteria | 2471 |
| 643 | Ga0496109_0119096 | 3300048912 | Bacteria | 2458 |
| 644 | Ga0496110_0067758 | 3300048913 | Bacteria | 3158 |
| 645 | Ga0496110_0097259 | 3300048913 | Bacteria | 2638 |
| 646 | Ga0496110_0148774 | 3300048913 | Bacteria | 2119 |
| 647 | Ga0496110_0184677 | 3300048913 | Bacteria | 1893 |
| 648 | Ga0496110_0209272 | 3300048913 | Bacteria | 1773 |
| 649 | Ga0496111_0039021 | 3300048914 | Bacteria | 3403 |
| 650 | Ga0496111_0132668 | 3300048914 | Bacteria | 1844 |
| 651 | Ga0496111_0176718 | 3300048914 | Bacteria | 1587 |
| 652 | Ga0496112_0000035 | 3300048915 | Bacteria | 106983 |
| 653 | Ga0496112_0005407 | 3300048915 | Bacteria | 11041 |
| 654 | Ga0496112_0012245 | 3300048915 | Bacteria | 7876 |
| 655 | Ga0496112_0012881 | 3300048915 | Bacteria | 7699 |
| 656 | Ga0496112_0097098 | 3300048915 | Bacteria | 2917 |
| 657 | Ga0496113_0012388 | 3300048916 | Bacteria | 5730 |
| 658 | Ga0496113_0078640 | 3300048916 | Bacteria | 2523 |
| 659 | Ga0496113_0100776 | 3300048916 | Bacteria | 2238 |
| 660 | Ga0496114_0089409 | 3300048917 | Bacteria | 2613 |
| 661 | Ga0496115_0009406 | 3300048918 | Bacteria | 7262 |
| 662 | Ga0496115_0027885 | 3300048918 | Bacteria | 4421 |
| 663 | Ga0496115_0064612 | 3300048918 | Bacteria | 2954 |
| 664 | Ga0496115_0104129 | 3300048918 | Bacteria | 2329 |
| 665 | Ga0496115_0106861 | 3300048918 | Bacteria | 2298 |
| 666 | Ga0496116_0000965 | 3300048919 | Bacteria | 35491 |
| 667 | Ga0496116_0027251 | 3300048919 | Bacteria | 4163 |
| 668 | Ga0496117_0040145 | 3300048920 | Bacteria | 3447 |
| 669 | Ga0496117_0090678 | 3300048920 | Bacteria | 1968 |
| 670 | Ga0496117_0123782 | 3300048920 | Bacteria | 1583 |
| 671 | Ga0496118_0006555 | 3300048921 | Bacteria | 12729 |
| 672 | Ga0496118_0011084 | 3300048921 | Bacteria | 8847 |
| 673 | Ga0496118_0028559 | 3300048921 | Bacteria | 4695 |
| 674 | Ga0496118_0069557 | 3300048921 | Bacteria | 2548 |
| 675 | Ga0496118_0083383 | 3300048921 | Bacteria | 2235 |
| 676 | Ga0496118_0147501 | 3300048921 | Bacteria | 1478 |
| 677 | Ga0496118_0162829 | 3300048921 | Bacteria | 1376 |
| 678 | Ga0496119_0050692 | 3300048922 | Bacteria | 2556 |
| 679 | Ga0496119_0090924 | 3300048922 | Bacteria | 1734 |
| 680 | Ga0496119_0104129 | 3300048922 | Bacteria | 1588 |
| 681 | Ga0496120_0003365 | 3300048923 | Bacteria | 14668 |
| 682 | Ga0496120_0026986 | 3300048923 | Bacteria | 3539 |
| 683 | Ga0496121_0001622 | 3300048924 | Bacteria | 37285 |
| 684 | Ga0496121_0002148 | 3300048924 | Bacteria | 30905 |
| 685 | Ga0496121_0003594 | 3300048924 | Bacteria | 21886 |
| 686 | Ga0496121_0020688 | 3300048924 | Bacteria | 6493 |
| 687 | Ga0496121_0029073 | 3300048924 | Bacteria | 5124 |
| 688 | Ga0496121_0033947 | 3300048924 | Bacteria | 4603 |
| 689 | Ga0496121_0046952 | 3300048924 | Bacteria | 3689 |
| 690 | Ga0496121_0054013 | 3300048924 | Bacteria | 3361 |
| 691 | Ga0496121_0060870 | 3300048924 | Bacteria | 3102 |
| 692 | Ga0496121_0063382 | 3300048924 | Bacteria | 3021 |
| 693 | Ga0496121_0095914 | 3300048924 | Bacteria | 2303 |
| 694 | Ga0496122_0049255 | 3300048925 | Bacteria | 3229 |
| 695 | Ga0496123_0006724 | 3300048926 | Bacteria | 11061 |
| 696 | Ga0496123_0073867 | 3300048926 | Bacteria | 2113 |
| 697 | Ga0496124_0009366 | 3300048927 | Bacteria | 10092 |
| 698 | Ga0496124_0098855 | 3300048927 | Bacteria | 2367 |
| 699 | Ga0496125_0001356 | 3300048928 | Bacteria | 36075 |
| 700 | Ga0496125_0001441 | 3300048928 | Bacteria | 34581 |
| 701 | Ga0496125_0001630 | 3300048928 | Bacteria | 31638 |
| 702 | Ga0496125_0042831 | 3300048928 | Bacteria | 3850 |
| 703 | Ga0496125_0057923 | 3300048928 | Bacteria | 3133 |
| 704 | Ga0496125_0060229 | 3300048928 | Bacteria | 3053 |
| 705 | Ga0496125_0094540 | 3300048928 | Bacteria | 2226 |
| 706 | Ga0496125_0195548 | 3300048928 | Bacteria | 1330 |
| 707 | Ga0496126_0003472 | 3300048929 | Bacteria | 19892 |
| 708 | Ga0496126_0005839 | 3300048929 | Bacteria | 13910 |
| 709 | Ga0496126_0010376 | 3300048929 | Bacteria | 9777 |
| 710 | Ga0496126_0014638 | 3300048929 | Bacteria | 7918 |
| 711 | Ga0496126_0017647 | 3300048929 | Bacteria | 7109 |
| 712 | Ga0496126_0021771 | 3300048929 | Bacteria | 6253 |
| 713 | Ga0496126_0041017 | 3300048929 | Bacteria | 4288 |
| 714 | Ga0496126_0043071 | 3300048929 | Bacteria | 4167 |
| 715 | Ga0496126_0047705 | 3300048929 | Bacteria | 3920 |
| 716 | Ga0496126_0110276 | 3300048929 | Bacteria | 2397 |
| 717 | Ga0501031_0001791 | 3300049568 | Bacteria | 13478 |
| 718 | Ga0501032_0000073 | 3300049569 | Bacteria | 85584 |
| 719 | Ga0501033_0000136 | 3300049570 | Bacteria | 70952 |
| 720 | Ga0501033_0044103 | 3300049570 | Bacteria | 3320 |
| 721 | Ga0501034_0000251 | 3300049571 | Bacteria | 99406 |
| 722 | Ga0501036_0000036 | 3300049572 | Bacteria | 87244 |
| 723 | Ga0501036_0199252 | 3300049572 | Bacteria | 1684 |
| 724 | Ga0501037_0001715 | 3300049573 | Bacteria | 15897 |
| 725 | Ga0501038_0000428 | 3300049574 | Bacteria | 36623 |
| 726 | Ga0501038_0191908 | 3300049574 | Bacteria | 1643 |
| 727 | Ga0501039_0000273 | 3300049575 | Bacteria | 37431 |
| 728 | Ga0501042_0019699 | 3300049578 | Bacteria | 4690 |
| 729 | Ga0501042_0099665 | 3300049578 | Bacteria | 2089 |
| 730 | Ga0501043_0000165 | 3300049579 | Bacteria | 59980 |
| 731 | Ga0501043_0010054 | 3300049579 | Bacteria | 7420 |
| 732 | Ga0501043_0222635 | 3300049579 | Bacteria | 1459 |
| 733 | Ga0501046_0001143 | 3300049580 | Bacteria | 25820 |
| 734 | Ga0501047_0000340 | 3300049581 | Bacteria | 53278 |
| 735 | Ga0501047_0147575 | 3300049581 | Bacteria | 2228 |
| 736 | Ga0501067_0014425 | 3300049583 | Bacteria | 4375 |
| 737 | Ga0501067_0039960 | 3300049583 | Bacteria | 2605 |
| 738 | Ga0501068_0003807 | 3300049584 | Bacteria | 8179 |
| 739 | Ga0501069_0005466 | 3300049585 | Bacteria | 6608 |
| 740 | Ga0501070_0006502 | 3300049586 | Bacteria | 9938 |
| 741 | Ga0501070_0193980 | 3300049586 | Bacteria | 1669 |
| 742 | Ga0501072_0001213 | 3300049588 | Bacteria | 19257 |
| 743 | Ga0501073_0000037 | 3300049589 | Bacteria | 87345 |
| 744 | Ga0501076_0299103 | 3300049592 | Bacteria | 1319 |
| 745 | Ga0501079_0001057 | 3300049741 | Bacteria | 19118 |
| 746 | Ga0501080_0003259 | 3300049742 | Bacteria | 14325 |
| 747 | Ga0501035_0000142 | 3300049822 | Bacteria | 87561 |
| 748 | Ga0501044_0000414 | 3300049823 | Bacteria | 52784 |
| 749 | Ga0501044_0047997 | 3300049823 | Bacteria | 4414 |
| 750 | Ga0501044_0107750 | 3300049823 | Bacteria | 2797 |
| 751 | Ga0501044_0109662 | 3300049823 | Bacteria | 2769 |
| 752 | Ga0501044_0110374 | 3300049823 | Bacteria | 2759 |
| 753 | nmdc:mga03683_46130_c1 | 3300050489 | Bacteria | 1806 |
| 754 | nmdc:mga03n38_17691_c1 | 3300050490 | Bacteria | 2797 |
| 755 | nmdc:mga03n38_18684_c1 | 3300050490 | Bacteria | 2740 |
| 756 | nmdc:mga03n38_70566_c1 | 3300050490 | Bacteria | 1616 |
| 757 | nmdc:mga03n38_957_c1 | 3300050490 | Bacteria | 7831 |
| 758 | nmdc:mga00v17_49103_c1 | 3300050491 | Bacteria | 2559 |
| 759 | nmdc:mga00v17_61593_c1 | 3300050491 | Bacteria | 2307 |
| 760 | nmdc:mga0yw44_16568_c1 | 3300050492 | Bacteria | 3985 |
| 761 | nmdc:mga0yw44_21933_c1 | 3300050492 | Bacteria | 3571 |
| 762 | nmdc:mga0yw44_4551_c1 | 3300050492 | Bacteria | 6383 |
| 763 | nmdc:mga0yw44_50490_c1 | 3300050492 | Bacteria | 2515 |
| 764 | nmdc:mga0yw44_62231_c1 | 3300050492 | Bacteria | 2292 |
| 765 | nmdc:mga0yw44_85060_c1 | 3300050492 | Bacteria | 1990 |
| 766 | nmdc:mga0k408_68589_c1 | 3300050493 | Bacteria | 2069 |
| 767 | nmdc:mga0k408_88982_c1 | 3300050493 | Bacteria | 1813 |
| 768 | nmdc:mga06z11_1871_c1 | 3300050494 | Bacteria | 7925 |
| 769 | nmdc:mga06z11_2498_c1 | 3300050494 | Bacteria | 7030 |
| 770 | nmdc:mga06z11_36176_c1 | 3300050494 | Bacteria | 2436 |
| 771 | nmdc:mga04h51_24891_c1 | 3300050495 | Bacteria | 1838 |
| 772 | nmdc:mga04h51_25760_c1 | 3300050495 | Bacteria | 1813 |
| 773 | nmdc:mga07m45_2419_c1 | 3300050496 | Bacteria | 8757 |
| 774 | nmdc:mga07m45_2500_c2 | 3300050496 | Bacteria | 7815 |
| 775 | nmdc:mga07m45_44349_c1 | 3300050496 | Bacteria | 2496 |
| 776 | nmdc:mga08y16_127311_c1 | 3300050511 | Bacteria | 2649 |
| 777 | nmdc:mga0n895_45691_c1 | 3300050512 | Bacteria | 4274 |
| 778 | nmdc:mga0sz30_72698_c1 | 3300050516 | Bacteria | 1482 |
| 779 | Ga0495601_0041651 | 3300053077 | Bacteria | 2880 |
| 780 | Ga0500635_0009854 | 3300053080 | Bacteria | 2664 |
| 781 | Ga0495595_0000828 | 3300053084 | Bacteria | 11843 |
| 782 | Ga0495595_0073753 | 3300053084 | Bacteria | 1616 |
| 783 | Ga0495619_0000912 | 3300053085 | Bacteria | 19381 |
| 784 | Ga0495619_0198200 | 3300053085 | Bacteria | 1390 |
| 785 | Ga0500578_0126224 | 3300053086 | Bacteria | 1606 |
| 786 | Ga0500643_000048 | 3300053087 | Bacteria | 147879 |
| 787 | Ga0500644_0023241 | 3300053088 | Bacteria | 1880 |
| 788 | Ga0500647_0045982 | 3300053091 | Bacteria | 2097 |
| 789 | Ga0500583_0019068 | 3300053092 | Bacteria | 2804 |
| 790 | Ga0500651_0046117 | 3300053093 | Bacteria | 2741 |
| 791 | Ga0500651_0141612 | 3300053093 | Bacteria | 1449 |
| 792 | Ga0500566_0000223 | 3300053094 | Bacteria | 30380 |
| 793 | Ga0500566_0004965 | 3300053094 | Bacteria | 7920 |
| 794 | Ga0500566_0006352 | 3300053094 | Bacteria | 7020 |
| 795 | Ga0500566_0007034 | 3300053094 | Bacteria | 6659 |
| 796 | Ga0500640_022290 | 3300053095 | Bacteria | 2736 |
| 797 | Ga0500641_0013850 | 3300053096 | Bacteria | 2967 |
| 798 | Ga0500554_038657 | 3300053102 | Bacteria | 1453 |
| 799 | Ga0500555_005336 | 3300053103 | Bacteria | 3646 |
| 800 | Ga0500556_0000003 | 3300053104 | Bacteria | 679379 |
| 801 | Ga0500556_0002950 | 3300053104 | Bacteria | 5142 |
| 802 | Ga0500557_000083 | 3300053105 | Bacteria | 32931 |
| 803 | Ga0500562_026505 | 3300053108 | Bacteria | 1519 |
| 804 | Ga0500572_000389 | 3300053111 | Bacteria | 15536 |
| 805 | Ga0500572_003205 | 3300053111 | Bacteria | 3773 |
| 806 | Ga0500592_005061 | 3300053116 | Bacteria | 2094 |
| 807 | Ga0500594_0018254 | 3300053118 | Bacteria | 1725 |
| 808 | Ga0500594_0041141 | 3300053118 | Bacteria | 1265 |
| 809 | Ga0500595_000333 | 3300053119 | Bacteria | 30925 |
| 810 | Ga0500595_002703 | 3300053119 | Bacteria | 8594 |
| 811 | Ga0500595_017370 | 3300053119 | Bacteria | 2657 |
| 812 | Ga0500595_025546 | 3300053119 | Bacteria | 2045 |
| 813 | Ga0500608_007296 | 3300053122 | Bacteria | 4564 |
| 814 | Ga0500642_0000015 | 3300053130 | Bacteria | 181424 |
| 815 | Ga0500642_0000642 | 3300053130 | Bacteria | 10422 |
| 816 | Ga0500652_000665 | 3300053131 | Bacteria | 11648 |
| 817 | Ga0500559_0000230 | 3300053136 | Bacteria | 44504 |
| 818 | Ga0500559_0000461 | 3300053136 | Bacteria | 28939 |
| 819 | Ga0500559_0009186 | 3300053136 | Bacteria | 4292 |
| 820 | Ga0500568_0000536 | 3300053139 | Bacteria | 27978 |
| 821 | Ga0500568_0022304 | 3300053139 | Bacteria | 2711 |
| 822 | Ga0500577_0003157 | 3300053142 | Bacteria | 4266 |
| 823 | Ga0500577_0056783 | 3300053142 | Bacteria | 1491 |
| 824 | Ga0500577_0061364 | 3300053142 | Bacteria | 1446 |
| 825 | Ga0500586_000256 | 3300053145 | Bacteria | 10561 |
| 826 | Ga0500589_085151 | 3300053147 | Bacteria | 1404 |
| 827 | Ga0500603_000178 | 3300053150 | Bacteria | 16265 |
| 828 | Ga0500603_000237 | 3300053150 | Bacteria | 14490 |
| 829 | Ga0500603_005395 | 3300053150 | Bacteria | 2748 |
| 830 | Ga0500616_0000033 | 3300053153 | Bacteria | 398830 |
| 831 | Ga0500619_014041 | 3300053154 | Bacteria | 2141 |
| 832 | Ga0500622_0020500 | 3300053156 | Bacteria | 3509 |
| 833 | Ga0500630_000468 | 3300053159 | Bacteria | 17761 |
| 834 | Ga0500633_0035066 | 3300053160 | Bacteria | 1650 |
| 835 | Ga0500634_0106454 | 3300053161 | Bacteria | 1393 |
| 836 | Ga0500639_004846 | 3300053163 | Bacteria | 6855 |
| 837 | Ga0500639_067495 | 3300053163 | Bacteria | 1830 |
| 838 | Ga0500636_0000148 | 3300053177 | Bacteria | 36338 |
| 839 | Ga0500636_0000686 | 3300053177 | Bacteria | 18167 |
| 840 | Ga0500636_0029898 | 3300053177 | Bacteria | 3220 |
| 841 | Ga0500637_0000060 | 3300053178 | Bacteria | 38881 |
| 842 | Ga0500637_0030606 | 3300053178 | Bacteria | 2996 |
| 843 | Ga0500637_0038025 | 3300053178 | Bacteria | 2709 |
| 844 | Ga0500637_0133157 | 3300053178 | Bacteria | 1440 |
| 845 | Ga0500645_011592 | 3300053730 | Bacteria | 2873 |
| 846 | Ga0500645_043216 | 3300053730 | Bacteria | 1327 |
| 847 | Ga0500596_000423 | 3300053735 | Bacteria | 7778 |
| 848 | Ga0500599_002459 | 3300053736 | Bacteria | 2220 |
| 849 | Ga0500601_000452 | 3300053737 | Bacteria | 6662 |
| 850 | Ga0501084_0025829 | 3300054114 | Bacteria | 4898 |
| 851 | Ga0500661_000303 | 3300055283 | Bacteria | 8936 |
| 852 | Ga0501082_0002719 | 3300060353 | Bacteria | 15447 |
| 853 | 8016526939 | 8016522445 | Bacteria | 8156687 |
| 854 | 2507505890 | 2507262055 | Bacteria | 8048963 |
| 855 | 2508540081 | 2508501009 | Bacteria | 7784016 |
| 856 | 2508696151 | 2508501042 | Bacteria | 8719808 |
| 857 | 2511396625 | 2511231028 | Bacteria | 8046582 |
| 858 | 2513627472 | 2513237092 | Bacteria | 8341956 |
| 859 | 2513638786 | 2513237094 | Bacteria | 8789602 |
| 860 | 2513649864 | 2513237095 | Bacteria | 8976980 |
| 861 | 2513659778 | 2513237096 | Bacteria | 8722461 |
| 862 | 2513676897 | 2513237098 | Bacteria | 9902361 |
| 863 | 2513696306 | 2513237101 | Bacteria | 7952346 |
| 864 | 2513704349 | 2513237102 | Bacteria | 7703324 |
| 865 | 2513715420 | 2513237104 | Bacteria | 10034502 |
| 866 | 2513857239 | 2513237137 | Bacteria | 9558895 |
| 867 | 2513877274 | 2513237139 | Bacteria | 8737671 |
| 868 | 2513891631 | 2513237141 | Bacteria | 8496279 |
| 869 | 2513918854 | 2513237145 | Bacteria | 8979722 |
| 870 | 2514011239 | 2513237161 | Bacteria | 8871253 |
| 871 | 2515631365 | 2515154112 | Bacteria | 8294334 |
| 872 | 2517105697 | 2517093001 | Bacteria | 9002274 |
| 873 | 2517888180 | 2517572143 | Bacteria | 9484767 |
| 874 | 2524435441 | 2524023205 | Bacteria | 8918781 |
| 875 | 2524468616 | 2524023210 | Bacteria | 9029266 |
| 876 | 2524533355 | 2524023228 | Bacteria | 10118060 |
| 877 | 2528855128 | 2528768022 | Bacteria | 10457665 |
| 878 | 2603860081 | 2602042107 | Bacteria | 6226103 |
| 879 | 2617347774 | 2617270735 | Bacteria | 9163226 |
| 880 | 2617374502 | 2617270741 | Bacteria | 8201522 |
| 881 | 2644290509 | 2643221651 | Bacteria | 4798932 |
| 882 | 2671119361 | 2667528175 | Bacteria | 7532676 |
| 883 | 2723842261 | 2721755755 | Bacteria | 8322773 |
| 884 | 2728753837 | 2728368998 | Bacteria | 8720350 |
| 885 | 2745081395 | 2744054633 | Bacteria | 8678936 |
| 886 | 2793061570 | 2791355196 | Bacteria | 7323613 |
| 887 | 2793073858 | 2791355197 | Bacteria | 8420563 |
| 888 | 2793077969 | |||
| 889 | 2805916126 | 2802429603 | Bacteria | 8777136 |
| 890 | 2818240864 | 2816332527 | Bacteria | 8933356 |
| 891 | 2824605531 | 2824600985 | Bacteria | 8488197 |
| 892 | 2824610829 | 2824609381 | Bacteria | 8672835 |
| 893 | 2824619364 | 2824617872 | Bacteria | 8814715 |
| 894 | 2824627819 | 2824626560 | Bacteria | 8813858 |
| 895 | 2824641889 | 2824635225 | Bacteria | 8785348 |
| 896 | 2824651287 | 2824644064 | Bacteria | 8743947 |
| 897 | 2824653881 | 2824653114 | Bacteria | 8493680 |
| 898 | 2824663766 | 2824661429 | Bacteria | 9877870 |
| 899 | 2824676114 | 2824671348 | Bacteria | 8369588 |
| 900 | 2824680229 | 2824679649 | Bacteria | 8248951 |
| 901 | 2824692467 | 2824687955 | Bacteria | 8360029 |
| 902 | 2824699890 | 2824696289 | Bacteria | 8335049 |
| 903 | 2824706072 | 2824704595 | Bacteria | 9667483 |
| 904 | 2824720081 | 2824714736 | Bacteria | 8717648 |
| 905 | 2824729443 | 2824723954 | Bacteria | 8758240 |
| 906 | 2824737481 | 2824732956 | Bacteria | 7810675 |
| 907 | 2824748036 | 2824746037 | Bacteria | 7911610 |
| 908 | 2824760295 | 2824753945 | Bacteria | 9787441 |
| 909 | 2824771534 | 2824763712 | Bacteria | 9792355 |
| 910 | 2824775746 | 2824773399 | Bacteria | 8360218 |
| 911 | 2838125119 | 2838122688 | Bacteria | 8803140 |
| 912 | 2841945857 | 2841941048 | Bacteria | 8688029 |
| 913 | 2841956816 | 2841949485 | Bacteria | 8680857 |
| 914 | 2841965300 | 2841957949 | Bacteria | 8652217 |
| 915 | 2841973332 | 2841966195 | Bacteria | 8673214 |
| 916 | 2841979504 | 2841974524 | Bacteria | 8931498 |
| 917 | 2841989371 | 2841983080 | Bacteria | 8395090 |
| 918 | 2842044362 | 2842038055 | Bacteria | 8002051 |
| 919 | 2842051649 | 2842045827 | Bacteria | 8006841 |
| 920 | 2844321490 | 2844315083 | Bacteria | 8138177 |
| 921 | 2847939475 | 2847930680 | Bacteria | 9342022 |
| 922 | 2847941223 | 2847939898 | Bacteria | 8606328 |
| 923 | 2849082215 | 2849076700 | Bacteria | 7039503 |
| 924 | 2857513310 | 2857509624 | Bacteria | 7472071 |
| 925 | 2857525064 | 2857524615 | Bacteria | 6615449 |
| 926 | 2874596372 | 2874590934 | Bacteria | 8299676 |
| 927 | 2874610150 | 2874604998 | Bacteria | 7834745 |
| 928 | 2874620215 | 2874612657 | Bacteria | 8252029 |
| 929 | 2874622438 | 2874620515 | Bacteria | 8290088 |
| 930 | 2874633344 | 2874628541 | Bacteria | 8630250 |
| 931 | 2874650360 | 2874645413 | Bacteria | 8214782 |
| 932 | 2876761697 | 2876761206 | Bacteria | 10111113 |
| 933 | 2876776837 | 2876771140 | Bacteria | 8287509 |
| 934 | 2876815702 | 2876808645 | Bacteria | 8824342 |
| 935 | 2876824627 | 2876818435 | Bacteria | 8274608 |
| 936 | 2879080974 | 2879074833 | Bacteria | 8279565 |
| 937 | 2879091083 | 2879083081 | Bacteria | 8587928 |
| 938 | 2879106648 | 2879099564 | Bacteria | 10442239 |
| 939 | 2879117026 | 2879110137 | Bacteria | 8907982 |
| 940 | 2879128205 | 2879127579 | Bacteria | 8294491 |
| 941 | 2879143552 | 2879142872 | Bacteria | 8267021 |
| 942 | 2881369634 | 2881364244 | Bacteria | 7710352 |
| 943 | 2881670157 | 2881665667 | Bacteria | 8175609 |
| 944 | 2885367716 | 2885366525 | Bacteria | 8326213 |
| 945 | 2885380640 | 2885374607 | Bacteria | 8927485 |
| 946 | 2885390784 | 2885383462 | Bacteria | 9473874 |
| 947 | 2885418257 | 2885409591 | Bacteria | 9235467 |
| 948 | 2888387745 | 2888378607 | Bacteria | 9652610 |
| 949 | 2888389964 | 2888388044 | Bacteria | 7304136 |
| 950 | 2888421136 | 2888419890 | Bacteria | 7857137 |
| 951 | 2889036377 | 2889033259 | Bacteria | 9099371 |
| 952 | 2893069651 | 2893066018 | Bacteria | 6158120 |
| 953 | 2903727931 | 2903727486 | Bacteria | 8281579 |
| 954 | 2903754031 | 2903748898 | Bacteria | 9972761 |
| 955 | 2903776661 | 2903768456 | Bacteria | 9749579 |
| 956 | 2904671555 | 2904666416 | Bacteria | 8226587 |
| 957 | 2904695753 | 2904690495 | Bacteria | 9412302 |
| 958 | 2904710022 | |||
| 959 | 2904718099 | 2904711408 | Bacteria | 9771557 |
| 960 | 2906602585 | 2906602504 | Bacteria | 8295279 |
| 961 | 2906614463 | |||
| 962 | 2906629717 | 2906626472 | Bacteria | 8826946 |
| 963 | 2906643414 | 2906635258 | Bacteria | 8601019 |
| 964 | 2906651659 | 2906643746 | Bacteria | 8722424 |
| 965 | 2906666606 | 2906660503 | Bacteria | 8595048 |
| 966 | 2908746707 | 2908739725 | Bacteria | 8628932 |
| 967 | 2908764269 | 2908756301 | Bacteria | 8864324 |
| 968 | 2908776981 | 2908775508 | Bacteria | 8092255 |
| 969 | 2919078952 | 2919073203 | Bacteria | 6531949 |
| 970 | 2922366740 | 2922361189 | Bacteria | 7436256 |
| 971 | 2922377450 | |||
| 972 | 2922389357 | 2922386360 | Bacteria | 7017218 |
| 973 | 2922393375 | 2922393267 | Bacteria | 8285685 |
| 974 | 2922426298 | |||
| 975 | 2929622242 | 2929615660 | Bacteria | 9193770 |
| 976 | 2929630111 | 2929624759 | Bacteria | 9339455 |
| 977 | 2932787956 | 2932784394 | Bacteria | 9704911 |
| 978 | 2932799510 | 2932794094 | Bacteria | 7915132 |
| 979 | 2932805184 | 2932801729 | Bacteria | 7987968 |
| 980 | 2932813331 | 2932809354 | Bacteria | 9135765 |
| 981 | 2932820028 | 2932818245 | Bacteria | 9955613 |
| 982 | 2932832908 | 2932828146 | Bacteria | 9745859 |
| 983 | 2933584144 | 2933577622 | Bacteria | 9116884 |
| 984 | 2935614314 | 2935608549 | Bacteria | 8203142 |
| 985 | 2935620393 | 2935616580 | Bacteria | 9032984 |
| 986 | 2935632682 | 2935630451 | Bacteria | 8169952 |
| 987 | 2935640717 | 2935638405 | Bacteria | 10015038 |
| 988 | 2935649342 | 2935648319 | Bacteria | 8801166 |
| 989 | 2935657886 | 2935656913 | Bacteria | 8965014 |
| 990 | 2935668909 | 2935665750 | Bacteria | 9571747 |
| 991 | 2935681365 | 2935675223 | Bacteria | 9928132 |
| 992 | 2935687218 | 2935684952 | Bacteria | 9590419 |
| 993 | 2935696811 | 2935694250 | Bacteria | 9291695 |
| 994 | 2935709097 | 2935703347 | Bacteria | 10242284 |
| 995 | 2935716906 | 2935713505 | Bacteria | 9608509 |
| 996 | 2935722969 | 2935722832 | Bacteria | 9608746 |
| 997 | 2935734526 | 2935732158 | Bacteria | 9706831 |
| 998 | 2935744683 | 2935741537 | Bacteria | 9707219 |
| 999 | 2935753184 | 2935750917 | Bacteria | 9590372 |
| 1000 | 2935767588 | 2935760218 | Bacteria | 9817913 |
| 1001 | 2935770182 | 2935769743 | Bacteria | 7878163 |
| 1002 | 2935777788 | 2935777560 | Bacteria | 8077691 |
| 1003 | 2935786764 | 2935785616 | Bacteria | 7962367 |
| 1004 | 2935794818 | 2935793552 | Bacteria | 8012592 |
| 1005 | 2935804827 | 2935801545 | Bacteria | 9301974 |
| 1006 | 2935815976 | 2935810662 | Bacteria | 9401221 |
| 1007 | 2935826532 | 2935819856 | Bacteria | 8261050 |
| 1008 | 2935832224 | 2935827899 | Bacteria | 10038562 |
| 1009 | 2935840946 | 2935837841 | Bacteria | 9454360 |
| 1010 | 2935851174 | 2935847175 | Bacteria | 8228321 |
| 1011 | 2935859279 | 2935855204 | Bacteria | 9035059 |
| 1012 | 2935864463 | 2935864058 | Bacteria | 9784707 |
| 1013 | 2935875185 | 2935873716 | Bacteria | 9632195 |
| 1014 | 2935887726 | 2935883170 | Bacteria | 7964738 |
| 1015 | 2935913223 | 2935908558 | Bacteria | 8568796 |
| 1016 | 2935922645 | 2935916978 | Bacteria | 9113783 |
| 1017 | 2935930852 | 2935926038 | Bacteria | 8601059 |
| 1018 | 2935939814 | 2935934488 | Bacteria | 8602579 |
| 1019 | 2935946763 | 2935942939 | Bacteria | 8599779 |
| 1020 | 2935956036 | 2935951376 | Bacteria | 8602333 |
| 1021 | 2935963884 | 2935959822 | Bacteria | 7869783 |
| 1022 | 2935972829 | 2935967501 | Bacteria | 8603075 |
| 1023 | 2935978254 | 2935975950 | Bacteria | 8347125 |
| 1024 | 2935985618 | 2935984226 | Bacteria | 8302647 |
| 1025 | 2935995840 | 2935992306 | Bacteria | 9802711 |
| 1026 | 2936005751 | 2936002035 | Bacteria | 9362176 |
| 1027 | 2936012105 | 2936011229 | Bacteria | 8801034 |
| 1028 | 2936020814 | 2936019824 | Bacteria | 8804134 |
| 1029 | 2936029398 | 2936028420 | Bacteria | 8965941 |
| 1030 | 2936041879 | 2936037263 | Bacteria | 9446081 |
| 1031 | 2936048278 | 2936046547 | Bacteria | 8903709 |
| 1032 | 2936056611 | 2936055302 | Bacteria | 8785755 |
| 1033 | 2940559097 | 2940556831 | Bacteria | 9590747 |
| 1034 | 2941508654 | 2941507105 | Bacteria | 8166816 |
| 1035 | 2941516484 | 2941515067 | Bacteria | 8166720 |
| 1036 | 2941524500 | 2941523033 | Bacteria | 8169134 |
| 1037 | 2941532070 | 2941531003 | Bacteria | 7653939 |
| 1038 | 2941541792 | 2941538514 | Bacteria | 9402094 |
| 1039 | 3005475661 | 3005474847 | Bacteria | 9259049 |
| 1040 | 3005485838 | 3005483717 | Bacteria | 7877331 |
| 1041 | 3005510879 | 3005506211 | Bacteria | 6943378 |
| 1042 | 3005588828 | 3005587118 | Bacteria | 7794411 |
| 1043 | 3005601856 | 3005594810 | Bacteria | 8716512 |
| 1044 | 3005717595 | 3005710791 | Bacteria | 7622528 |
| 1045 | 3005724643 | 3005718088 | Bacteria | 8283608 |
| 1046 | 8006932298 | 8006926726 | Bacteria | 6749210 |
| 1047 | 8006937001 | 8006933436 | Bacteria | 10410654 |
| 1048 | 8006966338 | 8006964411 | Bacteria | 8966052 |
| 1049 | 8006976966 | 8006973647 | Bacteria | 10679141 |
| 1050 | 8006993164 | 8006984368 | Bacteria | 9651211 |
| 1051 | 8006997003 | 8006994254 | Bacteria | 8309700 |
| 1052 | 8016517295 | 8016511872 | Bacteria | 9921665 |
| 1053 | 8016545233 | 8016539877 | Bacteria | 8155419 |
| 1054 | 8016556855 | 8016548790 | Bacteria | 8155074 |
| 1055 | 8016565208 | 8016557553 | Bacteria | 8154380 |
| 1056 | 8016570311 | 8016566248 | Bacteria | 8158151 |
| 1057 | 8016582859 | 8016575299 | Bacteria | 8154085 |
| 1058 | 8016585435 | 8016583857 | Bacteria | 10421953 |
| 1059 | 8016602851 | 8016595262 | Bacteria | 8149947 |
| 1060 | 8016617628 | 8016613128 | Bacteria | 8794220 |
| 1061 | 8016623941 | 8016622563 | Bacteria | 7999408 |
| 1062 | 8017059302 | 8017057580 | Bacteria | 10023680 |
| 1063 | 8019539688 | 8019538911 | Bacteria | 7872763 |
| 1064 | 8019550959 | 8019547302 | Bacteria | 7996444 |
| 1065 | 8019561676 | 8019555841 | Bacteria | 9642137 |
| 1066 | 8019571750 | 8019565922 | Bacteria | 9639779 |
| 1067 | 8019576327 | 8019576017 | Bacteria | 10049540 |
| 1068 | 8019607363 | 8019597564 | Bacteria | 10041141 |
| 1069 | 8019621999 | 8019619141 | Bacteria | 9218857 |
| 1070 | 8019631322 | 8019629233 | Bacteria | 8687553 |
| 1071 | 8019651718 | 8019648815 | Bacteria | 10014479 |
| 1072 | 8019668127 | 8019659431 | Bacteria | 8577854 |
| 1073 | 8019677593 | 8019668869 | Bacteria | 8791617 |
| 1074 | 8019687356 | 8019678201 | Bacteria | 8863603 |
| 1075 | 8019693332 | 8019687851 | Bacteria | 8712826 |
| 1076 | 8055743509 | 8055742211 | Bacteria | 9226248 |
| 1077 | 8056678189 | 8056673599 | Bacteria | 7871253 |
| 1078 | 8056683419 | 8056681323 | Bacteria | 8472857 |
| 1079 | 8056692716 | 8056689827 | Bacteria | 6712655 |
| 1080 | 8056975366 | 8056967851 | Bacteria | 9038162 |
| 1081 | JGI24750J21931_1005265 | |||
| 1082 | JGI25406J46586_10000233 | |||
| 1083 | JGI25406J46586_10031025 | |||
| 1084 | JGI25153J46596_10013655 | |||
| 1085 | JGI25153J46596_10014278 | |||
| 1086 | JGI25160J50197_1000761 | |||
| 1087 | JGI25160J50197_1002871 | |||
| 1088 | JGI25404J52841_10007829 | |||
| 1089 | Ga0055524_1033351 | |||
| 1090 | Ga0055531_10011226 | |||
| 1091 | Ga0055543_1008603 | |||
| 1092 | Ga0065165_1000917 | |||
| 1093 | Ga0065165_1001167 | |||
| 1094 | Ga0070658_10049328 | |||
| 1095 | Ga0070683_100060073 | |||
| 1096 | Ga0070683_100062216 | |||
| 1097 | Ga0070690_100225216 | |||
| 1098 | Ga0070670_100057855 | |||
| 1099 | Ga0068869_100013881 | |||
| 1100 | Ga0068869_100044308 | |||
| 1101 | Ga0070666_10118987 | |||
| 1102 | Ga0070680_100021196 | |||
| 1103 | Ga0070680_100172603 | |||
| 1104 | Ga0068868_100005952 | |||
| 1105 | Ga0068868_100009208 | |||
| 1106 | Ga0068868_100215362 | |||
| 1107 | Ga0070660_100098187 | |||
| 1108 | Ga0070660_100101082 | |||
| 1109 | Ga0070691_10070551 | |||
| 1110 | Ga0070668_100041755 | |||
| 1111 | Ga0070668_100062584 | |||
| 1112 | Ga0070671_100017933 | |||
| 1113 | Ga0070674_100076988 | |||
| 1114 | Ga0070674_100296474 | |||
| 1115 | Ga0070673_100183631 | |||
| 1116 | Ga0070709_10001520 | |||
| 1117 | Ga0070709_10011423 | |||
| 1118 | Ga0070709_10025696 | |||
| 1119 | Ga0070714_100081216 | |||
| 1120 | Ga0070714_100086974 | |||
| 1121 | Ga0070714_100109302 | |||
| 1122 | Ga0070713_100003802 | |||
| 1123 | Ga0070713_100032524 | |||
| 1124 | Ga0070713_100080905 | |||
| 1125 | Ga0070713_100081587 | |||
| 1126 | Ga0070713_100253337 | |||
| 1127 | Ga0070710_10000656 | |||
| 1128 | Ga0070710_10002985 | |||
| 1129 | Ga0070710_10020236 | |||
| 1130 | Ga0070711_100004436 | |||
| 1131 | Ga0070711_100005326 | |||
| 1132 | Ga0070711_100047709 | |||
| 1133 | Ga0070711_100052438 | |||
| 1134 | Ga0070694_100042928 | |||
| 1135 | Ga0070708_100112222 | |||
| 1136 | Ga0070663_100049161 | |||
| 1137 | Ga0070663_100051373 | |||
| 1138 | Ga0070663_100190735 | |||
| 1139 | Ga0070678_100030437 | |||
| 1140 | Ga0070678_100031850 | |||
| 1141 | Ga0070681_10034725 | |||
| 1142 | Ga0070698_100087771 | |||
| 1143 | Ga0070698_100151618 | |||
| 1144 | Ga0070679_100017100 | |||
| 1145 | Ga0070679_100031850 | |||
| 1146 | Ga0070679_100110000 | |||
| 1147 | Ga0070684_100027140 | |||
| 1148 | Ga0068853_100090980 | |||
| 1149 | Ga0068853_100385225 | |||
| 1150 | Ga0070686_100101383 | |||
| 1151 | Ga0070665_100004629 | |||
| 1152 | Ga0070665_100015575 | |||
| 1153 | Ga0068855_100181157 | |||
| 1154 | Ga0068857_100019162 | |||
| 1155 | Ga0068854_100144716 | |||
| 1156 | Ga0068856_100000137 | |||
| 1157 | Ga0068856_100089592 | |||
| 1158 | Ga0068856_100151171 | |||
| 1159 | Ga0070702_100037542 | |||
| 1160 | Ga0068852_100045438 | |||
| 1161 | Ga0068859_100119183 | |||
| 1162 | Ga0068864_100127071 | |||
| 1163 | Ga0068864_100206508 | |||
| 1164 | Ga0068866_10120683 | |||
| 1165 | Ga0068861_100034317 | |||
| 1166 | Ga0068870_10064809 | |||
| 1167 | Ga0068858_100045860 | |||
| 1168 | Ga0068858_100127363 | |||
| 1169 | Ga0068860_100000313 | |||
| 1170 | Ga0068860_100285936 | |||
| 1171 | Ga0068862_100075315 | |||
| 1172 | Ga0081455_10003860 | |||
| 1173 | Ga0081455_10007493 | |||
| 1174 | Ga0081455_10023465 | |||
| 1175 | Ga0081455_10054097 | |||
| 1176 | Ga0081538_10047308 | |||
| 1177 | Ga0081540_1003389 | |||
| 1178 | Ga0081540_1005657 | |||
| 1179 | Ga0081540_1012479 | |||
| 1180 | Ga0081540_1013267 | |||
| 1181 | Ga0081540_1019710 | |||
| 1182 | Ga0081540_1030350 | |||
| 1183 | Ga0081540_1032245 | |||
| 1184 | Ga0081540_1060906 | |||
| 1185 | Ga0081539_10000157 | |||
| 1186 | Ga0081539_10002599 | |||
| 1187 | Ga0081539_10017515 | |||
| 1188 | Ga0081539_10022796 | |||
| 1189 | Ga0081539_10057358 | |||
| 1190 | Ga0070717_10001671 | |||
| 1191 | Ga0070717_10017257 | |||
| 1192 | Ga0070717_10204002 | |||
| 1193 | Ga0075365_10012998 | |||
| 1194 | Ga0075365_10042277 | |||
| 1195 | Ga0075365_10065794 | |||
| 1196 | Ga0075365_10158192 | |||
| 1197 | Ga0075365_10211792 | |||
| 1198 | Ga0075368_10041613 | |||
| 1199 | Ga0075368_10056347 | |||
| 1200 | Ga0075363_100013603 | |||
| 1201 | Ga0075363_100021149 | |||
| 1202 | Ga0075363_100031275 | |||
| 1203 | Ga0075363_100041425 | |||
| 1204 | Ga0075363_100059526 | |||
| 1205 | Ga0075364_10047292 | |||
| 1206 | Ga0075364_10137182 | |||
| 1207 | Ga0070715_10000590 | |||
| 1208 | Ga0070715_10071086 | |||
| 1209 | Ga0070716_100017234 | |||
| 1210 | Ga0070712_100021384 | |||
| 1211 | Ga0075362_10051603 | |||
| 1212 | Ga0075367_10000722 | |||
| 1213 | Ga0075367_10001394 | |||
| 1214 | Ga0075367_10012975 | |||
| 1215 | Ga0075367_10102176 | |||
| 1216 | Ga0075366_10032723 | |||
| 1217 | Ga0097621_100014735 | |||
| 1218 | Ga0075370_10001262 | |||
| 1219 | Ga0075370_10008731 | |||
| 1220 | Ga0075370_10019237 | |||
| 1221 | Ga0075370_10083319 | |||
| 1222 | Ga0075434_100104354 | |||
| 1223 | Ga0075434_100271941 | |||
| 1224 | Ga0097620_100119191 | |||
| 1225 | Ga0099824_1008303 | |||
| 1226 | Ga0099822_1000541 | |||
| 1227 | Ga0105250_10049362 | |||
| 1228 | Ga0105240_10002492 | |||
| 1229 | Ga0105240_10031167 | |||
| 1230 | Ga0105240_10033967 | |||
| 1231 | Ga0105240_10094752 | |||
| 1232 | Ga0105240_10174427 | |||
| 1233 | Ga0105245_10117978 | |||
| 1234 | Ga0105247_10073098 | |||
| 1235 | Ga0114129_10285040 | |||
| 1236 | Ga0105241_10004267 | |||
| 1237 | Ga0105241_10026939 | |||
| 1238 | Ga0105248_10251915 | |||
| 1239 | Ga0105237_10017841 | |||
| 1240 | Ga0105237_10020566 | |||
| 1241 | Ga0105237_10082692 | |||
| 1242 | Ga0105237_10111420 | |||
| 1243 | Ga0105237_10148154 | |||
| 1244 | Ga0105237_10339257 | |||
| 1245 | Ga0105238_10191493 | |||
| 1246 | Ga0105238_10192363 | |||
| 1247 | Ga0105249_10097572 | |||
| 1248 | Ga0105239_10023011 | |||
| 1249 | Ga0105239_10031553 | |||
| 1250 | Ga0105239_10066232 | |||
| 1251 | Ga0105239_10091046 | |||
| 1252 | Ga0105239_10099249 | |||
| 1253 | Ga0105239_10354237 | |||
| 1254 | Ga0105246_10031978 | |||
| 1255 | Ga0157371_10082442 | |||
| 1256 | Ga0157369_10006548 | |||
| 1257 | Ga0157374_10057255 | |||
| 1258 | Ga0157374_10129159 | |||
| 1259 | Ga0157378_10001192 | |||
| 1260 | Ga0157378_10031729 | |||
| 1261 | Ga0157378_10206002 | |||
| 1262 | Ga0157378_10264155 | |||
| 1263 | Ga0163162_10081273 | |||
| 1264 | Ga0163162_10141798 | |||
| 1265 | Ga0157372_10139256 | |||
| 1266 | Ga0157372_10172733 | |||
| 1267 | Ga0157375_10006444 | |||
| 1268 | Ga0157375_10195176 | |||
| 1269 | Ga0157375_10480788 | |||
| 1270 | Ga0163163_10010769 | |||
| 1271 | Ga0163163_10031158 | |||
| 1272 | Ga0157380_10136861 | |||
| 1273 | Ga0157377_10060704 | |||
| 1274 | Ga0157376_10106890 | |||
| 1275 | Ga0206353_11382579 | |||
| 1276 | Ga0214544_1000003 | |||
| 1277 | Ga0214542_1000022 | |||
| 1278 | Ga0214545_1000010 | |||
| 1279 | Ga0214543_1000035 | |||
| 1280 | Ga0213876_10017171 | |||
| 1281 | Ga0213876_10044681 | |||
| 1282 | Ga0213876_10046958 | |||
| 1283 | Ga0213876_10108812 | |||
| 1284 | Ga0209677_100492 | |||
| 1285 | Ga0209148_1000267 | |||
| 1286 | Ga0209233_1001870 | |||
| 1287 | Ga0209233_1013744 | |||
| 1288 | Ga0209455_1004219 | |||
| 1289 | Ga0209455_1004254 | |||
| 1290 | Ga0209455_1008390 | |||
| 1291 | Ga0209564_1000718 | |||
| 1292 | Ga0209564_1002404 | |||
| 1293 | Ga0209564_1011905 | |||
| 1294 | Ga0209564_1028080 | |||
| 1295 | Ga0209758_1000015 | |||
| 1296 | Ga0209758_1000711 | |||
| 1297 | Ga0209758_1000764 | |||
| 1298 | Ga0209758_1001094 | |||
| 1299 | Ga0209758_1004096 | |||
| 1300 | Ga0209758_1011473 | |||
| 1301 | Ga0209256_1002592 | |||
| 1302 | Ga0209256_1019435 | |||
| 1303 | Ga0207426_1000368 | |||
| 1304 | Ga0207426_1013131 | |||
| 1305 | Ga0209257_1002989 | |||
| 1306 | Ga0207692_10004867 | |||
| 1307 | Ga0207692_10054264 | |||
| 1308 | Ga0207710_10096088 | |||
| 1309 | Ga0207688_10016777 | |||
| 1310 | Ga0207688_10063558 | |||
| 1311 | Ga0207699_10001435 | |||
| 1312 | Ga0207699_10003885 | |||
| 1313 | Ga0207699_10006921 | |||
| 1314 | Ga0207645_10149547 | |||
| 1315 | Ga0207643_10076315 | |||
| 1316 | Ga0207705_10029183 | |||
| 1317 | Ga0207684_10142304 | |||
| 1318 | Ga0207707_10000143 | |||
| 1319 | Ga0207707_10000613 | |||
| 1320 | Ga0207707_10030362 | |||
| 1321 | Ga0207707_10090452 | |||
| 1322 | Ga0207695_10000059 | |||
| 1323 | Ga0207695_10020632 | |||
| 1324 | Ga0207695_10177667 | |||
| 1325 | Ga0207671_10013578 | |||
| 1326 | Ga0207671_10088574 | |||
| 1327 | Ga0207671_10106177 | |||
| 1328 | Ga0207671_10145151 | |||
| 1329 | Ga0207671_10242235 | |||
| 1330 | Ga0207693_10005195 | |||
| 1331 | Ga0207693_10056281 | |||
| 1332 | Ga0207693_10159692 | |||
| 1333 | Ga0207663_10001411 | |||
| 1334 | Ga0207663_10099070 | |||
| 1335 | Ga0207663_10170928 | |||
| 1336 | Ga0207660_10026752 | |||
| 1337 | Ga0207660_10038751 | |||
| 1338 | Ga0207660_10173529 | |||
| 1339 | Ga0207657_10096510 | |||
| 1340 | Ga0207652_10023738 | |||
| 1341 | Ga0207694_10133399 | |||
| 1342 | Ga0207694_10152670 | |||
| 1343 | Ga0207687_10112719 | |||
| 1344 | Ga0207700_10007542 | |||
| 1345 | Ga0207700_10045941 | |||
| 1346 | Ga0207700_10064374 | |||
| 1347 | Ga0207700_10072426 | |||
| 1348 | Ga0207664_10064293 | |||
| 1349 | Ga0207664_10094469 | |||
| 1350 | Ga0207664_10176777 | |||
| 1351 | Ga0207664_10283691 | |||
| 1352 | Ga0207644_10025584 | |||
| 1353 | Ga0207690_10240562 | |||
| 1354 | Ga0207686_10030104 | |||
| 1355 | Ga0207686_10146933 | |||
| 1356 | Ga0207670_10263755 | |||
| 1357 | Ga0207665_10006088 | |||
| 1358 | Ga0207665_10031878 | |||
| 1359 | Ga0207711_10052528 | |||
| 1360 | Ga0207711_10055306 | |||
| 1361 | Ga0207661_10065867 | |||
| 1362 | Ga0207651_10171886 | |||
| 1363 | Ga0207651_10176730 | |||
| 1364 | Ga0207640_10008004 | |||
| 1365 | Ga0207677_10060703 | |||
| 1366 | Ga0207703_10128866 | |||
| 1367 | Ga0207639_10214675 | |||
| 1368 | Ga0207678_10016337 | |||
| 1369 | Ga0207678_10017766 | |||
| 1370 | Ga0207678_10019513 | |||
| 1371 | Ga0207678_10033040 | |||
| 1372 | Ga0207678_10059483 | |||
| 1373 | Ga0207678_10060315 | |||
| 1374 | Ga0207678_10090054 | |||
| 1375 | Ga0207702_10000063 | |||
| 1376 | Ga0207702_10042949 | |||
| 1377 | Ga0207702_10091162 | |||
| 1378 | Ga0207641_10037994 | |||
| 1379 | Ga0207641_10079791 | |||
| 1380 | Ga0207648_10023956 | |||
| 1381 | Ga0207674_10027211 | |||
| 1382 | Ga0207674_10061985 | |||
| 1383 | Ga0207675_100037599 | |||
| 1384 | Ga0207683_10038422 | |||
| 1385 | Ga0207683_10040055 | |||
| 1386 | Ga0207698_10314242 | |||
| 1387 | Ga0209389_1000012 | |||
| 1388 | Ga0209389_1000069 | |||
| 1389 | Ga0209589_1000015 | |||
| 1390 | Ga0209589_1000077 | |||
| 1391 | Ga0209489_100015 | |||
| 1392 | Ga0209489_100019 | |||
| 1393 | Ga0209489_100020 | |||
| 1394 | Ga0209700_100018 | |||
| 1395 | Ga0209700_100025 | |||
| 1396 | Ga0209179_1004877 | |||
| 1397 | Ga0207428_10148947 | |||
| 1398 | Ga0268266_10003840 | |||
| 1399 | Ga0268266_10008431 | |||
| 1400 | Ga0268266_10034518 | |||
| 1401 | Ga0268264_10000356 | |||
| 1402 | Ga0265323_10007414 | |||
| 1403 | Ga0265336_10000346 | |||
| 1404 | Ga0307517_10001423 | |||
| 1405 | Ga0307515_10032146 | |||
| 1406 | Ga0307515_10090460 | |||
| 1407 | Ga0307515_10252869 | |||
| 1408 | Ga0265338_10000417 | |||
| 1409 | Ga0307511_10087863 | |||
| 1410 | Ga0265325_10109984 | |||
| 1411 | Ga0265340_10002373 | |||
| 1412 | Ga0265339_10003359 | |||
| 1413 | Ga0265339_10008317 | |||
| 1414 | Ga0307509_10119372 | |||
| 1415 | Ga0307508_10000012 | |||
| 1416 | Ga0307508_10013966 | |||
| 1417 | Ga0307508_10095708 | |||
| 1418 | Ga0307508_10148584 | |||
| 1419 | Ga0265314_10032879 | |||
| 1420 | Ga0265314_10043122 | |||
| 1421 | Ga0307516_10010102 | |||
| 1422 | Ga0307516_10074049 | |||
| 1423 | Ga0307516_10118097 | |||
| 1424 | Ga0307516_10167679 | |||
| 1425 | Ga0307409_100106920 | |||
| 1426 | Ga0307416_100170057 | |||
| 1427 | Ga0307415_100136139 | |||
| 1428 | Ga0307507_10092970 | |||
| 1429 | Ga0307510_10015377 | |||
| 1430 | Ga0307510_10023362 | |||
| 1431 | Ga0307510_10068023 | |||
| 1432 | Ga0307510_10100483 | |||
| 1433 | Ga0315911_1000037 | |||
| 1434 | Ga0373930_0020548 | |||
| 1435 | Ga0373934_0002532 | |||
| 1436 | Ga0373923_0003267 | |||
| 1437 | Ga0373923_0059362 | |||
| 1438 | Ga0373936_0001098 | |||
| 1439 | Ga0373936_0042302 | |||
| 1440 | Ga0373936_0043904 | |||
| 1441 | Ga0373945_0001922 | |||
| 1442 | Ga0373953_0001769 | |||
| 1443 | Ga0373953_0009391 | |||
| 1444 | Ga0373954_0002946 | |||
| 1445 | Ga0373954_0006705 | |||
| 1446 | Ga0373956_0000376 | |||
| 1447 | Ga0373957_0005684 | |||
| 1448 | Ga0373957_0046825 | |||
| 1449 | Ga0373943_0071667 | |||
| 1450 | Ga0373955_0000325 | |||
| 1451 | Ga0373955_0067917 | |||
| 1452 | Ga0373955_0086410 | |||
| 1453 | Ga0373942_0033799 | |||
| 1454 | Ga0373924_0007619 | |||
| 1455 | Ga0373924_0007815 | |||
| 1456 | Ga0373924_0065537 | |||
| 1457 | Ga0373931_0009747 | |||
| 1458 | Ga0373935_0007815 | |||
| 1459 | Ga0373935_0050257 | |||
| 1460 | Ga0373935_0127495 | |||
| 1461 | Ga0373927_0000137 | |||
| 1462 | Ga0373927_0017402 | |||
| 1463 | Ga0373927_0036587 | |||
| 1464 | Ga0373927_0068754 | |||
| 1465 | Ga0373927_0082856 | |||
| 1466 | Ga0373927_0121167 | |||
| 1467 | Ga0373933_0000108 | |||
| 1468 | Ga0373933_0099071 | |||
| 1469 | Ga0373947_0000902 | |||
| 1470 | Ga0373947_0012959 | |||
| 1471 | Ga0373947_0141466 | |||
| 1472 | Ga0373937_0007855 | |||
| 1473 | Ga0373937_0024716 | |||
| 1474 | Ga0373925_0002159 | |||
| 1475 | Ga0373925_0010829 | |||
| 1476 | Ga0373925_0027502 | |||
| 1477 | Ga0373925_0036147 | |||
| 1478 | Ga0373925_0062118 | |||
| 1479 | Ga0373925_0173665 | |||
| 1480 | Ga0373925_0203260 | |||
| 1481 | Ga0373925_0219803 | |||
| 1482 | Ga0395900_0001756 | |||
| 1483 | Ga0395900_0010446 | |||
| 1484 | Ga0395900_0351119 | |||
| 1485 | Ga0395898_0035306 | |||
| 1486 | Ga0395898_0058280 | |||
| 1487 | Ga0395905_0098242 | |||
| 1488 | Ga0395905_0161755 | |||
| 1489 | Ga0395905_0196810 | |||
| 1490 | Ga0395905_0221082 | |||
| 1491 | Ga0436364_0461113 | |||
| 1492 | Ga0436364_0735016 | |||
| 1493 | Ga0436364_0948768 | |||
| 1494 | Ga0395901_0028786 | |||
| 1495 | Ga0395901_0109804 | |||
| 1496 | Ga0436365_0457714 | |||
| 1497 | Ga0436365_0592130 | |||
| 1498 | Ga0436365_1312844 | |||
| 1499 | Ga0436361_0474776 | |||
| 1500 | Ga0439465_0024103 | |||
| 1501 | Ga0439465_0029460 | |||
| 1502 | Ga0451795_0601895 | |||
| 1503 | Ga0466969_0050676 | |||
| 1504 | Ga0466972_0000100 | |||
| 1505 | Ga0466972_0014629 | |||
| 1506 | Ga0466965_0011221 | |||
| 1507 | Ga0466966_0001463 | |||
| 1508 | Ga0466961_0000601 | |||
| 1509 | Ga0466963_0058249 | |||
| 1510 | Ga0466963_0121410 | |||
| 1511 | Ga0466968_0008001 | |||
| 1512 | Ga0466957_0117662 | |||
| 1513 | Ga0466959_0000634 | |||
| 1514 | Ga0466958_0012458 | |||
| 1515 | Ga0466967_0161245 | |||
| 1516 | Ga0466967_0227567 | |||
| 1517 | Ga0466967_0302164 | |||
| 1518 | Ga0495592_0000339 | |||
| 1519 | Ga0495592_0008958 | |||
| 1520 | Ga0495592_0033013 | |||
| 1521 | Ga0495592_0034020 | |||
| 1522 | Ga0495592_0058113 | |||
| 1523 | Ga0495603_0000277 | |||
| 1524 | Ga0495603_0011788 | |||
| 1525 | Ga0495603_0030573 | |||
| 1526 | Ga0495603_0058565 | |||
| 1527 | Ga0495603_0063865 | |||
| 1528 | Ga0495603_0064886 | |||
| 1529 | Ga0495629_0000029 | |||
| 1530 | Ga0495629_0001483 | |||
| 1531 | Ga0495629_0043490 | |||
| 1532 | Ga0495629_0056255 | |||
| 1533 | Ga0495629_0057452 | |||
| 1534 | Ga0495629_0081882 | |||
| 1535 | Ga0495641_0003605 | |||
| 1536 | Ga0495651_0031486 | |||
| 1537 | Ga0495651_0034091 | |||
| 1538 | Ga0495651_0042153 | |||
| 1539 | Ga0495651_0053385 | |||
| 1540 | Ga0495651_0105986 | |||
| 1541 | Ga0495653_0001063 | |||
| 1542 | Ga0495580_0002567 | |||
| 1543 | Ga0495582_0000024 | |||
| 1544 | Ga0495582_0008119 | |||
| 1545 | Ga0495605_0056580 | |||
| 1546 | Ga0495639_0000006 | |||
| 1547 | Ga0495639_0127276 | |||
| 1548 | Ga0495662_0000348 | |||
| 1549 | Ga0495662_0062304 | |||
| 1550 | Ga0495664_0007034 | |||
| 1551 | Ga0495664_0013716 | |||
| 1552 | Ga0495664_0163539 | |||
| 1553 | Ga0495584_0035543 | |||
| 1554 | Ga0495585_0105255 | |||
| 1555 | Ga0495594_0000170 | |||
| 1556 | Ga0495606_0013516 | |||
| 1557 | Ga0495606_0083744 | |||
| 1558 | Ga0495608_0075302 | |||
| 1559 | Ga0495608_0190980 | |||
| 1560 | Ga0495610_0044538 | |||
| 1561 | Ga0495610_0058795 | |||
| 1562 | Ga0495610_0112766 | |||
| 1563 | Ga0495616_0038012 | |||
| 1564 | Ga0495618_0018824 | |||
| 1565 | Ga0495628_0010789 | |||
| 1566 | Ga0495628_0014226 | |||
| 1567 | Ga0495628_0074634 | |||
| 1568 | Ga0495628_0079529 | |||
| 1569 | Ga0495630_0003257 | |||
| 1570 | Ga0495630_0058889 | |||
| 1571 | Ga0495648_0016531 | |||
| 1572 | Ga0495648_0019778 | |||
| 1573 | Ga0495648_0027989 | |||
| 1574 | Ga0495666_0011725 | |||
| 1575 | Ga0495666_0031438 | |||
| 1576 | Ga0495652_0040442 | |||
| 1577 | Ga0495652_0047155 | |||
| 1578 | Ga0495652_0061633 | |||
| 1579 | Ga0495652_0101400 | |||
| 1580 | Ga0495665_0000178 | |||
| 1581 | Ga0495665_0044353 | |||
| 1582 | Ga0495640_0003797 | |||
| 1583 | Ga0495640_0004410 | |||
| 1584 | Ga0495640_0022850 | |||
| 1585 | Ga0495587_0087441 | |||
| 1586 | Ga0495587_0127658 | |||
| 1587 | Ga0495597_0014928 | |||
| 1588 | Ga0495645_0033925 | |||
| 1589 | Ga0495645_0052192 | |||
| 1590 | Ga0495645_0100650 | |||
| 1591 | Ga0495622_0002996 | |||
| 1592 | Ga0495622_0015955 | |||
| 1593 | Ga0495622_0031914 | |||
| 1594 | Ga0495622_0044412 | |||
| 1595 | Ga0495622_0046682 | |||
| 1596 | Ga0495667_0003075 | |||
| 1597 | Ga0495667_0074387 | |||
| 1598 | Ga0495667_0088315 | |||
| 1599 | Ga0495656_0007598 | |||
| 1600 | Ga0495656_0008501 | |||
| 1601 | Ga0495656_0023243 | |||
| 1602 | Ga0495668_0148417 | |||
| 1603 | Ga0495634_0000354 | |||
| 1604 | Ga0495634_0002330 | |||
| 1605 | Ga0495634_0023750 | |||
| 1606 | Ga0495634_0033779 | |||
| 1607 | Ga0495634_0037146 | |||
| 1608 | Ga0495634_0162458 | |||
| 1609 | Ga0495611_0053797 | |||
| 1610 | Ga0495625_0014247 | |||
| 1611 | Ga0495625_0030852 | |||
| 1612 | Ga0495635_0000917 | |||
| 1613 | Ga0495635_0002291 | |||
| 1614 | Ga0495635_0006214 | |||
| 1615 | Ga0495635_0018638 | |||
| 1616 | Ga0495659_0049165 | |||
| 1617 | Ga0495588_0020824 | |||
| 1618 | Ga0495657_0003543 | |||
| 1619 | Ga0495657_0005133 | |||
| 1620 | Ga0495657_0009727 | |||
| 1621 | Ga0495657_0066994 | |||
| 1622 | Ga0495599_0005791 | |||
| 1623 | Ga0495599_0036803 | |||
| 1624 | Ga0495599_0038886 | |||
| 1625 | Ga0495599_0051217 | |||
| 1626 | Ga0495623_0010483 | |||
| 1627 | Ga0495623_0013015 | |||
| 1628 | Ga0495646_0000902 | |||
| 1629 | Ga0495646_0003762 | |||
| 1630 | Ga0495646_0037428 | |||
| 1631 | Ga0495646_0056213 | |||
| 1632 | Ga0495647_0002169 | |||
| 1633 | Ga0495647_0025404 | |||
| 1634 | Ga0495658_0000428 | |||
| 1635 | Ga0495658_0013755 | |||
| 1636 | Ga0495669_0057920 | |||
| 1637 | Ga0495613_0001078 | |||
| 1638 | Ga0495613_0012318 | |||
| 1639 | Ga0495613_0067784 | |||
| 1640 | Ga0495613_0067799 | |||
| 1641 | Ga0495624_0000788 | |||
| 1642 | Ga0495624_0039622 | |||
| 1643 | Ga0495624_0065431 | |||
| 1644 | Ga0495670_0006876 | |||
| 1645 | Ga0495671_0049797 | |||
| 1646 | Ga0495649_0067447 | |||
| 1647 | Ga0495600_0002741 | |||
| 1648 | Ga0495600_0006367 | |||
| 1649 | Ga0495600_0091394 | |||
| 1650 | Ga0495660_0030369 | |||
| 1651 | Ga0495581_0000004 | |||
| 1652 | Ga0495581_0029027 | |||
| 1653 | Ga0495581_0064398 | |||
| 1654 | Ga0495581_0096450 | |||
| 1655 | Ga0495604_0000678 | |||
| 1656 | Ga0495604_0007941 | |||
| 1657 | Ga0495604_0024945 | |||
| 1658 | Ga0495674_0000415 | |||
| 1659 | Ga0495674_0007236 | |||
| 1660 | Ga0495674_0026281 | |||
| 1661 | Ga0495672_0018820 | |||
| 1662 | Ga0495672_0041687 | |||
| 1663 | Ga0495672_0084711 | |||
| 1664 | Ga0495676_0019876 | |||
| 1665 | Ga0495676_0032444 | |||
| 1666 | Ga0495676_0037764 | |||
| 1667 | Ga0495676_0109575 | |||
| 1668 | Ga0495676_0110006 | |||
| 1669 | Ga0495680_0001164 | |||
| 1670 | Ga0495680_0239647 | |||
| 1671 | Ga0495687_010280 | |||
| 1672 | Ga0495675_0000901 | |||
| 1673 | Ga0495675_0012017 | |||
| 1674 | Ga0495675_0068840 | |||
| 1675 | Ga0495677_0027542 | |||
| 1676 | Ga0495685_052355 | |||
| 1677 | Ga0495673_0028163 | |||
| 1678 | Ga0495684_0000721 | |||
| 1679 | Ga0495684_0009275 | |||
| 1680 | Ga0495684_0064676 | |||
| 1681 | Ga0495684_0132607 | |||
| 1682 | Ga0495593_0000198 | |||
| 1683 | Ga0495593_0003019 | |||
| 1684 | Ga0495593_0004072 | |||
| 1685 | Ga0495593_0012359 | |||
| 1686 | Ga0495602_0007817 | |||
| 1687 | Ga0495602_0060850 | |||
| 1688 | Ga0495602_0068869 | |||
| 1689 | Ga0495614_0010431 | |||
| 1690 | Ga0495626_0021097 | |||
| 1691 | Ga0495626_0033878 | |||
| 1692 | Ga0496100_0059742 | |||
| 1693 | Ga0496100_0076187 | |||
| 1694 | Ga0496101_0051291 | |||
| 1695 | Ga0496101_0075732 | |||
| 1696 | Ga0496102_0010100 | |||
| 1697 | Ga0496102_0039067 | |||
| 1698 | Ga0496102_0094833 | |||
| 1699 | Ga0496102_0143511 | |||
| 1700 | Ga0496102_0253222 | |||
| 1701 | Ga0496103_0028235 | |||
| 1702 | Ga0496103_0088357 | |||
| 1703 | Ga0496104_0014507 | |||
| 1704 | Ga0496104_0069211 | |||
| 1705 | Ga0496104_0127620 | |||
| 1706 | Ga0496104_0152912 | |||
| 1707 | Ga0496105_0007733 | |||
| 1708 | Ga0496105_0023125 | |||
| 1709 | Ga0496105_0104649 | |||
| 1710 | Ga0496105_0158139 | |||
| 1711 | Ga0496106_0001953 | |||
| 1712 | Ga0496106_0008314 | |||
| 1713 | Ga0496106_0068753 | |||
| 1714 | Ga0496106_0111956 | |||
| 1715 | Ga0496106_0136444 | |||
| 1716 | Ga0496107_0026534 | |||
| 1717 | Ga0496108_0024837 | |||
| 1718 | Ga0496108_0084715 | |||
| 1719 | Ga0496108_0137501 | |||
| 1720 | Ga0496108_0164457 | |||
| 1721 | Ga0496109_0086237 | |||
| 1722 | Ga0496109_0117930 | |||
| 1723 | Ga0496109_0119096 | |||
| 1724 | Ga0496110_0067758 | |||
| 1725 | Ga0496110_0097259 | |||
| 1726 | Ga0496110_0148774 | |||
| 1727 | Ga0496110_0184677 | |||
| 1728 | Ga0496110_0209272 | |||
| 1729 | Ga0496111_0039021 | |||
| 1730 | Ga0496111_0132668 | |||
| 1731 | Ga0496111_0176718 | |||
| 1732 | Ga0496112_0000035 | |||
| 1733 | Ga0496112_0005407 | |||
| 1734 | Ga0496112_0012245 | |||
| 1735 | Ga0496112_0012881 | |||
| 1736 | Ga0496112_0097098 | |||
| 1737 | Ga0496113_0012388 | |||
| 1738 | Ga0496113_0078640 | |||
| 1739 | Ga0496113_0100776 | |||
| 1740 | Ga0496114_0089409 | |||
| 1741 | Ga0496115_0009406 | |||
| 1742 | Ga0496115_0027885 | |||
| 1743 | Ga0496115_0064612 | |||
| 1744 | Ga0496115_0104129 | |||
| 1745 | Ga0496115_0106861 | |||
| 1746 | Ga0496116_0000965 | |||
| 1747 | Ga0496116_0027251 | |||
| 1748 | Ga0496117_0040145 | |||
| 1749 | Ga0496117_0090678 | |||
| 1750 | Ga0496117_0123782 | |||
| 1751 | Ga0496118_0006555 | |||
| 1752 | Ga0496118_0011084 | |||
| 1753 | Ga0496118_0028559 | |||
| 1754 | Ga0496118_0069557 | |||
| 1755 | Ga0496118_0083383 | |||
| 1756 | Ga0496118_0147501 | |||
| 1757 | Ga0496118_0162829 | |||
| 1758 | Ga0496119_0050692 | |||
| 1759 | Ga0496119_0090924 | |||
| 1760 | Ga0496119_0104129 | |||
| 1761 | Ga0496120_0003365 | |||
| 1762 | Ga0496120_0026986 | |||
| 1763 | Ga0496121_0001622 | |||
| 1764 | Ga0496121_0002148 | |||
| 1765 | Ga0496121_0003594 | |||
| 1766 | Ga0496121_0020688 | |||
| 1767 | Ga0496121_0029073 | |||
| 1768 | Ga0496121_0033947 | |||
| 1769 | Ga0496121_0046952 | |||
| 1770 | Ga0496121_0054013 | |||
| 1771 | Ga0496121_0060870 | |||
| 1772 | Ga0496121_0063382 | |||
| 1773 | Ga0496121_0095914 | |||
| 1774 | Ga0496122_0049255 | |||
| 1775 | Ga0496123_0006724 | |||
| 1776 | Ga0496123_0073867 | |||
| 1777 | Ga0496124_0009366 | |||
| 1778 | Ga0496124_0098855 | |||
| 1779 | Ga0496125_0001356 | |||
| 1780 | Ga0496125_0001441 | |||
| 1781 | Ga0496125_0001630 | |||
| 1782 | Ga0496125_0042831 | |||
| 1783 | Ga0496125_0057923 | |||
| 1784 | Ga0496125_0060229 | |||
| 1785 | Ga0496125_0094540 | |||
| 1786 | Ga0496125_0195548 | |||
| 1787 | Ga0496126_0003472 | |||
| 1788 | Ga0496126_0005839 | |||
| 1789 | Ga0496126_0010376 | |||
| 1790 | Ga0496126_0014638 | |||
| 1791 | Ga0496126_0017647 | |||
| 1792 | Ga0496126_0021771 | |||
| 1793 | Ga0496126_0041017 | |||
| 1794 | Ga0496126_0043071 | |||
| 1795 | Ga0496126_0047705 | |||
| 1796 | Ga0496126_0110276 | |||
| 1797 | Ga0501031_0001791 | |||
| 1798 | Ga0501032_0000073 | |||
| 1799 | Ga0501033_0000136 | |||
| 1800 | Ga0501033_0044103 | |||
| 1801 | Ga0501034_0000251 | |||
| 1802 | Ga0501036_0000036 | |||
| 1803 | Ga0501036_0199252 | |||
| 1804 | Ga0501037_0001715 | |||
| 1805 | Ga0501038_0000428 | |||
| 1806 | Ga0501038_0191908 | |||
| 1807 | Ga0501039_0000273 | |||
| 1808 | Ga0501042_0019699 | |||
| 1809 | Ga0501042_0099665 | |||
| 1810 | Ga0501043_0000165 | |||
| 1811 | Ga0501043_0010054 | |||
| 1812 | Ga0501043_0222635 | |||
| 1813 | Ga0501046_0001143 | |||
| 1814 | Ga0501047_0000340 | |||
| 1815 | Ga0501047_0147575 | |||
| 1816 | Ga0501067_0014425 | |||
| 1817 | Ga0501067_0039960 | |||
| 1818 | Ga0501068_0003807 | |||
| 1819 | Ga0501069_0005466 | |||
| 1820 | Ga0501070_0006502 | |||
| 1821 | Ga0501070_0193980 | |||
| 1822 | Ga0501072_0001213 | |||
| 1823 | Ga0501073_0000037 | |||
| 1824 | Ga0501076_0299103 | |||
| 1825 | Ga0501079_0001057 | |||
| 1826 | Ga0501080_0003259 | |||
| 1827 | Ga0501035_0000142 | |||
| 1828 | Ga0501044_0000414 | |||
| 1829 | Ga0501044_0047997 | |||
| 1830 | Ga0501044_0107750 | |||
| 1831 | Ga0501044_0109662 | |||
| 1832 | Ga0501044_0110374 | |||
| 1833 | nmdc:mga03683_46130_c1 | |||
| 1834 | nmdc:mga03n38_17691_c1 | |||
| 1835 | nmdc:mga03n38_18684_c1 | |||
| 1836 | nmdc:mga03n38_70566_c1 | |||
| 1837 | nmdc:mga03n38_957_c1 | |||
| 1838 | nmdc:mga00v17_49103_c1 | |||
| 1839 | nmdc:mga00v17_61593_c1 | |||
| 1840 | nmdc:mga0yw44_16568_c1 | |||
| 1841 | nmdc:mga0yw44_21933_c1 | |||
| 1842 | nmdc:mga0yw44_4551_c1 | |||
| 1843 | nmdc:mga0yw44_50490_c1 | |||
| 1844 | nmdc:mga0yw44_62231_c1 | |||
| 1845 | nmdc:mga0yw44_85060_c1 | |||
| 1846 | nmdc:mga0k408_68589_c1 | |||
| 1847 | nmdc:mga0k408_88982_c1 | |||
| 1848 | nmdc:mga06z11_1871_c1 | |||
| 1849 | nmdc:mga06z11_2498_c1 | |||
| 1850 | nmdc:mga06z11_36176_c1 | |||
| 1851 | nmdc:mga04h51_24891_c1 | |||
| 1852 | nmdc:mga04h51_25760_c1 | |||
| 1853 | nmdc:mga07m45_2419_c1 | |||
| 1854 | nmdc:mga07m45_2500_c2 | |||
| 1855 | nmdc:mga07m45_44349_c1 | |||
| 1856 | nmdc:mga08y16_127311_c1 | |||
| 1857 | nmdc:mga0n895_45691_c1 | |||
| 1858 | nmdc:mga0sz30_72698_c1 | |||
| 1859 | Ga0495601_0041651 | |||
| 1860 | Ga0500635_0009854 | |||
| 1861 | Ga0495595_0000828 | |||
| 1862 | Ga0495595_0073753 | |||
| 1863 | Ga0495619_0000912 | |||
| 1864 | Ga0495619_0198200 | |||
| 1865 | Ga0500578_0126224 | |||
| 1866 | Ga0500643_000048 | |||
| 1867 | Ga0500644_0023241 | |||
| 1868 | Ga0500647_0045982 | |||
| 1869 | Ga0500583_0019068 | |||
| 1870 | Ga0500651_0046117 | |||
| 1871 | Ga0500651_0141612 | |||
| 1872 | Ga0500566_0000223 | |||
| 1873 | Ga0500566_0004965 | |||
| 1874 | Ga0500566_0006352 | |||
| 1875 | Ga0500566_0007034 | |||
| 1876 | Ga0500640_022290 | |||
| 1877 | Ga0500641_0013850 | |||
| 1878 | Ga0500554_038657 | |||
| 1879 | Ga0500555_005336 | |||
| 1880 | Ga0500556_0000003 | |||
| 1881 | Ga0500556_0002950 | |||
| 1882 | Ga0500557_000083 | |||
| 1883 | Ga0500562_026505 | |||
| 1884 | Ga0500572_000389 | |||
| 1885 | Ga0500572_003205 | |||
| 1886 | Ga0500592_005061 | |||
| 1887 | Ga0500594_0018254 | |||
| 1888 | Ga0500594_0041141 | |||
| 1889 | Ga0500595_000333 | |||
| 1890 | Ga0500595_002703 | |||
| 1891 | Ga0500595_017370 | |||
| 1892 | Ga0500595_025546 | |||
| 1893 | Ga0500608_007296 | |||
| 1894 | Ga0500642_0000015 | |||
| 1895 | Ga0500642_0000642 | |||
| 1896 | Ga0500652_000665 | |||
| 1897 | Ga0500559_0000230 | |||
| 1898 | Ga0500559_0000461 | |||
| 1899 | Ga0500559_0009186 | |||
| 1900 | Ga0500568_0000536 | |||
| 1901 | Ga0500568_0022304 | |||
| 1902 | Ga0500577_0003157 | |||
| 1903 | Ga0500577_0056783 | |||
| 1904 | Ga0500577_0061364 | |||
| 1905 | Ga0500586_000256 | |||
| 1906 | Ga0500589_085151 | |||
| 1907 | Ga0500603_000178 | |||
| 1908 | Ga0500603_000237 | |||
| 1909 | Ga0500603_005395 | |||
| 1910 | Ga0500616_0000033 | |||
| 1911 | Ga0500619_014041 | |||
| 1912 | Ga0500622_0020500 | |||
| 1913 | Ga0500630_000468 | |||
| 1914 | Ga0500633_0035066 | |||
| 1915 | Ga0500634_0106454 | |||
| 1916 | Ga0500639_004846 | |||
| 1917 | Ga0500639_067495 | |||
| 1918 | Ga0500636_0000148 | |||
| 1919 | Ga0500636_0000686 | |||
| 1920 | Ga0500636_0029898 | |||
| 1921 | Ga0500637_0000060 | |||
| 1922 | Ga0500637_0030606 | |||
| 1923 | Ga0500637_0038025 | |||
| 1924 | Ga0500637_0133157 | |||
| 1925 | Ga0500645_011592 | |||
| 1926 | Ga0500645_043216 | |||
| 1927 | Ga0500596_000423 | |||
| 1928 | Ga0500599_002459 | |||
| 1929 | Ga0500601_000452 | |||
| 1930 | Ga0501084_0025829 | |||
| 1931 | Ga0500661_000303 | |||
| 1932 | Ga0501082_0002719 | |||
| 1933 | 8016526939 | |||
| 1934 | 2507505890 | |||
| 1935 | 2508540081 | |||
| 1936 | 2508696151 | |||
| 1937 | 2511396625 | |||
| 1938 | 2513627472 | |||
| 1939 | 2513638786 | |||
| 1940 | 2513649864 | |||
| 1941 | 2513659778 | |||
| 1942 | 2513676897 | |||
| 1943 | 2513696306 | |||
| 1944 | 2513704349 | |||
| 1945 | 2513715420 | |||
| 1946 | 2513857239 | |||
| 1947 | 2513877274 | |||
| 1948 | 2513891631 | |||
| 1949 | 2513918854 | |||
| 1950 | 2514011239 | |||
| 1951 | 2515631365 | |||
| 1952 | 2517105697 | |||
| 1953 | 2517888180 | |||
| 1954 | 2524435441 | |||
| 1955 | 2524468616 | |||
| 1956 | 2524533355 | |||
| 1957 | 2528855128 | |||
| 1958 | 2603860081 | |||
| 1959 | 2617347774 | |||
| 1960 | 2617374502 | |||
| 1961 | 2644290509 | |||
| 1962 | 2671119361 | |||
| 1963 | 2723842261 | |||
| 1964 | 2728753837 | |||
| 1965 | 2745081395 | |||
| 1966 | 2793061570 | |||
| 1967 | 2793073858 | |||
| 1968 | 2793077969 | |||
| 1969 | 2805916126 | |||
| 1970 | 2818240864 | |||
| 1971 | 2824605531 | |||
| 1972 | 2824610829 | |||
| 1973 | 2824619364 | |||
| 1974 | 2824627819 | |||
| 1975 | 2824641889 | |||
| 1976 | 2824651287 | |||
| 1977 | 2824653881 | |||
| 1978 | 2824663766 | |||
| 1979 | 2824676114 | |||
| 1980 | 2824680229 | |||
| 1981 | 2824692467 | |||
| 1982 | 2824699890 | |||
| 1983 | 2824706072 | |||
| 1984 | 2824720081 | |||
| 1985 | 2824729443 | |||
| 1986 | 2824737481 | |||
| 1987 | 2824748036 | |||
| 1988 | 2824760295 | |||
| 1989 | 2824771534 | |||
| 1990 | 2824775746 | |||
| 1991 | 2838125119 | |||
| 1992 | 2841945857 | |||
| 1993 | 2841956816 | |||
| 1994 | 2841965300 | |||
| 1995 | 2841973332 | |||
| 1996 | 2841979504 | |||
| 1997 | 2841989371 | |||
| 1998 | 2842044362 | |||
| 1999 | 2842051649 | |||
| 2000 | 2844321490 | |||
| 2001 | 2847939475 | |||
| 2002 | 2847941223 | |||
| 2003 | 2849082215 | |||
| 2004 | 2857513310 | |||
| 2005 | 2857525064 | |||
| 2006 | 2874596372 | |||
| 2007 | 2874610150 | |||
| 2008 | 2874620215 | |||
| 2009 | 2874622438 | |||
| 2010 | 2874633344 | |||
| 2011 | 2874650360 | |||
| 2012 | 2876761697 | |||
| 2013 | 2876776837 | |||
| 2014 | 2876815702 | |||
| 2015 | 2876824627 | |||
| 2016 | 2879080974 | |||
| 2017 | 2879091083 | |||
| 2018 | 2879106648 | |||
| 2019 | 2879117026 | |||
| 2020 | 2879128205 | |||
| 2021 | 2879143552 | |||
| 2022 | 2881369634 | |||
| 2023 | 2881670157 | |||
| 2024 | 2885367716 | |||
| 2025 | 2885380640 | |||
| 2026 | 2885390784 | |||
| 2027 | 2885418257 | |||
| 2028 | 2888387745 | |||
| 2029 | 2888389964 | |||
| 2030 | 2888421136 | |||
| 2031 | 2889036377 | |||
| 2032 | 2893069651 | |||
| 2033 | 2903727931 | |||
| 2034 | 2903754031 | |||
| 2035 | 2903776661 | |||
| 2036 | 2904671555 | |||
| 2037 | 2904695753 | |||
| 2038 | 2904710022 | |||
| 2039 | 2904718099 | |||
| 2040 | 2906602585 | |||
| 2041 | 2906614463 | |||
| 2042 | 2906629717 | |||
| 2043 | 2906643414 | |||
| 2044 | 2906651659 | |||
| 2045 | 2906666606 | |||
| 2046 | 2908746707 | |||
| 2047 | 2908764269 | |||
| 2048 | 2908776981 | |||
| 2049 | 2919078952 | |||
| 2050 | 2922366740 | |||
| 2051 | 2922377450 | |||
| 2052 | 2922389357 | |||
| 2053 | 2922393375 | |||
| 2054 | 2922426298 | |||
| 2055 | 2929622242 | |||
| 2056 | 2929630111 | |||
| 2057 | 2932787956 | |||
| 2058 | 2932799510 | |||
| 2059 | 2932805184 | |||
| 2060 | 2932813331 | |||
| 2061 | 2932820028 | |||
| 2062 | 2932832908 | |||
| 2063 | 2933584144 | |||
| 2064 | 2935614314 | |||
| 2065 | 2935620393 | |||
| 2066 | 2935632682 | |||
| 2067 | 2935640717 | |||
| 2068 | 2935649342 | |||
| 2069 | 2935657886 | |||
| 2070 | 2935668909 | |||
| 2071 | 2935681365 | |||
| 2072 | 2935687218 | |||
| 2073 | 2935696811 | |||
| 2074 | 2935709097 | |||
| 2075 | 2935716906 | |||
| 2076 | 2935722969 | |||
| 2077 | 2935734526 | |||
| 2078 | 2935744683 | |||
| 2079 | 2935753184 | |||
| 2080 | 2935767588 | |||
| 2081 | 2935770182 | |||
| 2082 | 2935777788 | |||
| 2083 | 2935786764 | |||
| 2084 | 2935794818 | |||
| 2085 | 2935804827 | |||
| 2086 | 2935815976 | |||
| 2087 | 2935826532 | |||
| 2088 | 2935832224 | |||
| 2089 | 2935840946 | |||
| 2090 | 2935851174 | |||
| 2091 | 2935859279 | |||
| 2092 | 2935864463 | |||
| 2093 | 2935875185 | |||
| 2094 | 2935887726 | |||
| 2095 | 2935913223 | |||
| 2096 | 2935922645 | |||
| 2097 | 2935930852 | |||
| 2098 | 2935939814 | |||
| 2099 | 2935946763 | |||
| 2100 | 2935956036 | |||
| 2101 | 2935963884 | |||
| 2102 | 2935972829 | |||
| 2103 | 2935978254 | |||
| 2104 | 2935985618 | |||
| 2105 | 2935995840 | |||
| 2106 | 2936005751 | |||
| 2107 | 2936012105 | |||
| 2108 | 2936020814 | |||
| 2109 | 2936029398 | |||
| 2110 | 2936041879 | |||
| 2111 | 2936048278 | |||
| 2112 | 2936056611 | |||
| 2113 | 2940559097 | |||
| 2114 | 2941508654 | |||
| 2115 | 2941516484 | |||
| 2116 | 2941524500 | |||
| 2117 | 2941532070 | |||
| 2118 | 2941541792 | |||
| 2119 | 3005475661 | |||
| 2120 | 3005485838 | |||
| 2121 | 3005510879 | |||
| 2122 | 3005588828 | |||
| 2123 | 3005601856 | |||
| 2124 | 3005717595 | |||
| 2125 | 3005724643 | |||
| 2126 | 8006932298 | |||
| 2127 | 8006937001 | |||
| 2128 | 8006966338 | |||
| 2129 | 8006976966 | |||
| 2130 | 8006993164 | |||
| 2131 | 8006997003 | |||
| 2132 | 8016517295 | |||
| 2133 | 8016545233 | |||
| 2134 | 8016556855 | |||
| 2135 | 8016565208 | |||
| 2136 | 8016570311 | |||
| 2137 | 8016582859 | |||
| 2138 | 8016585435 | |||
| 2139 | 8016602851 | |||
| 2140 | 8016617628 | |||
| 2141 | 8016623941 | |||
| 2142 | 8017059302 | |||
| 2143 | 8019539688 | |||
| 2144 | 8019550959 | |||
| 2145 | 8019561676 | |||
| 2146 | 8019571750 | |||
| 2147 | 8019576327 | |||
| 2148 | 8019607363 | |||
| 2149 | 8019621999 | |||
| 2150 | 8019631322 | |||
| 2151 | 8019651718 | |||
| 2152 | 8019668127 | |||
| 2153 | 8019677593 | |||
| 2154 | 8019687356 | |||
| 2155 | 8019693332 | |||
| 2156 | 8055743509 | |||
| 2157 | 8056678189 | |||
| 2158 | 8056683419 | |||
| 2159 | 8056692716 | |||
| 2160 | 8056975366 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4f8j-assembly1.cif.gz_A | the structure of an aromatic compound transport protein from rhodopseudomonas palustris in complex with p-coumarate | 0.9439 | 26 | 351 |
| 3uk0-assembly1.cif.gz_A | rpd_1889 protein, an extracellular ligand-binding receptor from rhodopseudomonas palustris. | 0.9366 | 26 | 351 |
| 3ukj-assembly1.cif.gz_A | crystal structure of extracellular ligand-binding receptor from rhodopseudomonas palustris haa2 | 0.9355 | 27 | 351 |
| 7ylt-assembly2.cif.gz_D | structure of a bacteria protein | 0.9102 | 28 | 351 |
| 7ylt-assembly3.cif.gz_C | structure of a bacteria protein | 0.8999 | 28 | 351 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4jb2A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.928 | 109 | 351 | 3.40.50.2300 |
| 4jb2A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9156 | 109 | 351 | 3.40.50.2300 |
| 3sg0A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9061 | 114 | 236 | 3.40.50.2300 |
| 3i45A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8437 | 107 | 233 | 3.40.50.2300 |
| 3lkbB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8402 | 110 | 235 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A401U0T1-F1-model_v4 | Receptor ligand binding region domain-containing protein | 0.9664 | 242 | 351 |
|
| AF-A0A401U0T1-F1-model_v4 | Receptor ligand binding region domain-containing protein | 0.9578 | 242 | 351 |
|
| AF-A0A3M1SD04-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9195 | 166 | 351 |
|
| AF-A0A7C1G6Q7-F1-model_v4 | Branched-chain amino acid ABC transporter substrate-binding protein | 0.9101 | 123 | 351 |
|
| AF-A0A0H4WIU1-F1-model_v4 | deleted | 0.9057 | 21 | 350 |
|