F489758

General Info

Members Datasets Scaffolds Average Seq Length
1085 348 2170 97

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100410868|Ga0068859_1004108682
Length 110
Sequence MPGLKARPTGIMNIQKMMQQAQEMQXRLQKQMADMRVDATAGGGMVTVVVSGHKQLMKITIDPEVVSKDDVPMLQDLILAAINDAHRKVDQALAQQMSGLMGGMQNSGLV

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
189 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
190 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
191 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
200 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
210 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
211 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
212 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
216 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
217 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
218 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
221 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
222 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
223 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
224 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
225 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
226 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
227 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
228 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
229 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
230 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
234 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
235 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
236 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
237 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
254 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
255 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
256 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
259 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
260 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
261 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
262 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
273 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
274 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
288 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
309 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
310 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
316 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
324 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
325 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
326 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
327 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
328 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
329 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
330 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
331 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
332 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
333 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
334 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
335 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
336 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
337 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
338 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
339 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
340 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
341 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
342 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
343 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
344 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
345 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
346 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
347 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
348 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.91
Metatranscriptomes 0.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.21
Nodule 0
Rhizoplane 2.58
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 7.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100410868 3300005617 Bacteria 1449
2 JGI25406J46586_10083124 3300003203 Bacteria 978
3 JGI25406J46586_10092444 3300003203 Bacteria 911
4 JGI25406J46586_10213409 3300003203 Unclassified 564
5 Ga0065714_10106583 3300005288 Bacteria 1546
6 Ga0065712_10025310 3300005290 Bacteria 1411
7 Ga0065712_10153694 3300005290 Bacteria 1350
8 Ga0065715_10138994 3300005293 Bacteria 1883
9 Ga0065715_10149341 3300005293 Bacteria 1748
10 Ga0065707_10086703 3300005295 Bacteria 5336
11 Ga0065707_10149428 3300005295 Bacteria 1675
12 Ga0065707_10170689 3300005295 Bacteria 1487
13 Ga0065707_10591340 3300005295 Bacteria 695
14 Ga0065707_10707279 3300005295 Unclassified 636
15 Ga0065707_11046822 3300005295 Bacteria 528
16 Ga0065707_11122576 3300005295 Unclassified 511
17 Ga0065707_11136378 3300005295 Bacteria 507
18 Ga0070676_10028956 3300005328 Bacteria 3147
19 Ga0070683_100007552 3300005329 Bacteria 9189
20 Ga0070690_100027789 3300005330 Bacteria 3500
21 Ga0070690_100149010 3300005330 Bacteria 1594
22 Ga0070690_100170683 3300005330 Bacteria 1497
23 Ga0070690_100257315 3300005330 Bacteria 1237
24 Ga0070670_100004413 3300005331 Bacteria 11779
25 Ga0070670_100007462 3300005331 Bacteria 9285
26 Ga0070670_100464699 3300005331 Unclassified 1122
27 Ga0070677_10762496 3300005333 Bacteria 550
28 Ga0068869_100058451 3300005334 Bacteria 2820
29 Ga0068869_100084729 3300005334 Bacteria 2373
30 Ga0068869_100823931 3300005334 Bacteria 799
31 Ga0070666_10045960 3300005335 Bacteria 2927
32 Ga0070666_10063575 3300005335 Bacteria 2502
33 Ga0070666_10859068 3300005335 Bacteria 670
34 Ga0070666_10908227 3300005335 Bacteria 651
35 Ga0070680_100111780 3300005336 Bacteria 2275
36 Ga0070680_100415668 3300005336 Bacteria 1147
37 Ga0070680_100778601 3300005336 Bacteria 824
38 Ga0070680_101163650 3300005336 Bacteria 667
39 Ga0070682_100493593 3300005337 Bacteria 947
40 Ga0070682_101400767 3300005337 Bacteria 598
41 Ga0070682_101904942 3300005337 Bacteria 521
42 Ga0068868_100315931 3300005338 Unclassified 1330
43 Ga0068868_100389144 3300005338 Bacteria 1201
44 Ga0070660_101496559 3300005339 Bacteria 574
45 Ga0070689_100030548 3300005340 Bacteria 4090
46 Ga0070689_100176159 3300005340 Bacteria 1735
47 Ga0070689_100256727 3300005340 Bacteria 1444
48 Ga0070689_100275519 3300005340 Bacteria 1394
49 Ga0070689_100725728 3300005340 Bacteria 869
50 Ga0070689_102143232 3300005340 Bacteria 512
51 Ga0070691_10017904 3300005341 Bacteria 3261
52 Ga0070691_10182267 3300005341 Bacteria 1094
53 Ga0070687_100008463 3300005343 Bacteria 4361
54 Ga0070687_100023052 3300005343 Bacteria 2954
55 Ga0070687_100051971 3300005343 Bacteria 2125
56 Ga0070661_100012520 3300005344 Bacteria 5935
57 Ga0070661_100098211 3300005344 Bacteria 2175
58 Ga0070692_10028201 3300005345 Bacteria 2789
59 Ga0070692_10314983 3300005345 Bacteria 960
60 Ga0070668_100269987 3300005347 Unclassified 1417
61 Ga0070668_100636083 3300005347 Bacteria 936
62 Ga0070668_100763258 3300005347 Bacteria 857
63 Ga0070668_101644322 3300005347 Bacteria 589
64 Ga0070669_100051895 3300005353 Bacteria 2998
65 Ga0070669_100102174 3300005353 Bacteria 2164
66 Ga0070669_100155395 3300005353 Bacteria 1773
67 Ga0070669_100156483 3300005353 Bacteria 1768
68 Ga0070669_100336184 3300005353 Bacteria 1223
69 Ga0070669_100350581 3300005353 Bacteria 1198
70 Ga0070669_100960175 3300005353 Bacteria 732
71 Ga0070669_101158658 3300005353 Bacteria 667
72 Ga0070675_100016827 3300005354 Bacteria 5806
73 Ga0070675_100179773 3300005354 Bacteria 1828
74 Ga0070675_100197845 3300005354 Bacteria 1744
75 Ga0070675_100253317 3300005354 Bacteria 1541
76 Ga0070675_100597189 3300005354 Bacteria 1001
77 Ga0070675_100702999 3300005354 Bacteria 921
78 Ga0070675_102161713 3300005354 Bacteria 513
79 Ga0070671_100037051 3300005355 Bacteria 4044
80 Ga0070671_100409430 3300005355 Bacteria 1161
81 Ga0070671_101165111 3300005355 Bacteria 678
82 Ga0070674_100168717 3300005356 Bacteria 1667
83 Ga0070674_100724991 3300005356 Bacteria 852
84 Ga0070674_101939626 3300005356 Bacteria 536
85 Ga0070673_100011151 3300005364 Bacteria 6127
86 Ga0070673_100016210 3300005364 Bacteria 5261
87 Ga0070673_100409025 3300005364 Bacteria 1214
88 Ga0070688_100025746 3300005365 Bacteria 3488
89 Ga0070688_100095705 3300005365 Bacteria 1949
90 Ga0070688_100112936 3300005365 Bacteria 1809
91 Ga0070688_100217497 3300005365 Unclassified 1345
92 Ga0070688_100428286 3300005365 Bacteria 985
93 Ga0070688_100526803 3300005365 Bacteria 895
94 Ga0070688_100631478 3300005365 Bacteria 823
95 Ga0070688_100854438 3300005365 Bacteria 715
96 Ga0070688_101624904 3300005365 Bacteria 528
97 Ga0070659_100100205 3300005366 Bacteria 2331
98 Ga0070659_100976545 3300005366 Bacteria 743
99 Ga0070667_100102344 3300005367 Bacteria 2475
100 Ga0070667_100105118 3300005367 Bacteria 2443
101 Ga0070667_100166117 3300005367 Bacteria 1947
102 Ga0070667_100579633 3300005367 Bacteria 1033
103 Ga0070667_102254858 3300005367 Bacteria 513
104 Ga0070709_10429129 3300005434 Bacteria 992
105 Ga0070714_100012428 3300005435 Bacteria 6798
106 Ga0070713_100371955 3300005436 Bacteria 1330
107 Ga0070701_10019829 3300005438 Bacteria 3182
108 Ga0070701_10043041 3300005438 Bacteria 2308
109 Ga0070701_10325118 3300005438 Bacteria 953
110 Ga0070701_10332515 3300005438 Bacteria 943
111 Ga0070701_10890246 3300005438 Unclassified 614
112 Ga0070701_11346115 3300005438 Bacteria 512
113 Ga0070705_100010925 3300005440 Bacteria 4562
114 Ga0070705_100077195 3300005440 Bacteria 2034
115 Ga0070705_100383867 3300005440 Bacteria 1035
116 Ga0070700_100044430 3300005441 Bacteria 2736
117 Ga0070700_100067920 3300005441 Bacteria 2265
118 Ga0070700_100111792 3300005441 Bacteria 1817
119 Ga0070700_100229740 3300005441 Bacteria 1320
120 Ga0070700_100288007 3300005441 Bacteria 1194
121 Ga0070700_101225102 3300005441 Bacteria 628
122 Ga0070700_101391223 3300005441 Bacteria 593
123 Ga0070700_101766357 3300005441 Bacteria 532
124 Ga0070694_100002811 3300005444 Bacteria 10330
125 Ga0070694_100006907 3300005444 Bacteria 6898
126 Ga0070694_100097721 3300005444 Bacteria 2072
127 Ga0070694_100420609 3300005444 Bacteria 1050
128 Ga0070694_100673681 3300005444 Bacteria 839
129 Ga0070694_100952934 3300005444 Bacteria 711
130 Ga0070663_100219852 3300005455 Bacteria 1491
131 Ga0070678_100505484 3300005456 Bacteria 1067
132 Ga0070678_100676007 3300005456 Bacteria 928
133 Ga0070662_101702549 3300005457 Bacteria 544
134 Ga0070681_10570750 3300005458 Bacteria 1045
135 Ga0068867_100087743 3300005459 Bacteria 2356
136 Ga0068867_100203840 3300005459 Bacteria 1585
137 Ga0068867_100256849 3300005459 Bacteria 1423
138 Ga0068867_100286403 3300005459 Unclassified 1353
139 Ga0068867_100470492 3300005459 Bacteria 1075
140 Ga0068867_100648207 3300005459 Bacteria 926
141 Ga0070685_10038256 3300005466 Bacteria 2720
142 Ga0070685_10263185 3300005466 Unclassified 1148
143 Ga0070685_10267026 3300005466 Bacteria 1140
144 Ga0070685_11021502 3300005466 Bacteria 621
145 Ga0070685_11391578 3300005466 Bacteria 538
146 Ga0070706_100059841 3300005467 Bacteria 3516
147 Ga0070706_101859534 3300005467 Bacteria 547
148 Ga0070707_100328591 3300005468 Bacteria 1486
149 Ga0070707_100550545 3300005468 Bacteria 1116
150 Ga0070707_100964469 3300005468 Unclassified 818
151 Ga0070707_101543588 3300005468 Bacteria 631
152 Ga0070698_100001914 3300005471 Bacteria 23193
153 Ga0070698_100008781 3300005471 Bacteria 10875
154 Ga0070698_100367484 3300005471 Bacteria 1371
155 Ga0070698_100734923 3300005471 Bacteria 930
156 Ga0070698_101784181 3300005471 Bacteria 568
157 Ga0070699_100005726 3300005518 Bacteria 10873
158 Ga0070699_100005918 3300005518 Bacteria 10685
159 Ga0070699_100021870 3300005518 Bacteria 5512
160 Ga0070699_100927027 3300005518 Bacteria 798
161 Ga0070679_100677308 3300005530 Bacteria 974
162 Ga0070684_100005231 3300005535 Bacteria 9925
163 Ga0070684_100245419 3300005535 Bacteria 1636
164 Ga0070684_100578208 3300005535 Bacteria 1044
165 Ga0070697_100597651 3300005536 Bacteria 970
166 Ga0070697_100864185 3300005536 Bacteria 802
167 Ga0068853_101811238 3300005539 Bacteria 592
168 Ga0070672_100041632 3300005543 Bacteria 3533
169 Ga0070672_100471306 3300005543 Bacteria 1083
170 Ga0070672_101492071 3300005543 Bacteria 606
171 Ga0070672_101977229 3300005543 Bacteria 525
172 Ga0070686_100031148 3300005544 Bacteria 3259
173 Ga0070686_100190371 3300005544 Bacteria 1464
174 Ga0070686_100611433 3300005544 Bacteria 860
175 Ga0070686_101393912 3300005544 Unclassified 588
176 Ga0070695_100110617 3300005545 Bacteria 1863
177 Ga0070695_100496908 3300005545 Unclassified 943
178 Ga0070695_100980094 3300005545 Bacteria 686
179 Ga0070695_100998378 3300005545 Bacteria 681
180 Ga0070696_100005487 3300005546 Bacteria 8462
181 Ga0070696_100050068 3300005546 Bacteria 2903
182 Ga0070693_100185296 3300005547 Bacteria 1343
183 Ga0070693_100469191 3300005547 Bacteria 887
184 Ga0070693_100699894 3300005547 Archaea 742
185 Ga0070665_100033864 3300005548 Bacteria 5139
186 Ga0070665_101164879 3300005548 Bacteria 782
187 Ga0070704_100031294 3300005549 Bacteria 3577
188 Ga0070704_100057843 3300005549 Bacteria 2759
189 Ga0070704_100464129 3300005549 Bacteria 1093
190 Ga0070704_100466830 3300005549 Bacteria 1090
191 Ga0070704_100736766 3300005549 Bacteria 877
192 Ga0070704_100739832 3300005549 Unclassified 875
193 Ga0070704_100985458 3300005549 Bacteria 762
194 Ga0070704_101122451 3300005549 Bacteria 715
195 Ga0070664_100001608 3300005564 Bacteria 18074
196 Ga0070664_100026140 3300005564 Bacteria 4841
197 Ga0070664_100095017 3300005564 Bacteria 2585
198 Ga0070664_100257859 3300005564 Unclassified 1568
199 Ga0068857_100021160 3300005577 Bacteria 5724
200 Ga0068857_100417081 3300005577 Bacteria 1251
201 Ga0068854_100015949 3300005578 Bacteria 4995
202 Ga0070702_100111378 3300005615 Bacteria 1697
203 Ga0070702_100152589 3300005615 Unclassified 1485
204 Ga0070702_100677648 3300005615 Bacteria 783
205 Ga0068852_101063555 3300005616 Bacteria 829
206 Ga0068859_100027743 3300005617 Bacteria 5679
207 Ga0068859_100197425 3300005617 Bacteria 2096
208 Ga0068859_100244855 3300005617 Bacteria 1882
209 Ga0068859_100379594 3300005617 Bacteria 1509
210 Ga0068859_100505474 3300005617 Unclassified 1304
211 Ga0068859_102508717 3300005617 Unclassified 568
212 Ga0068859_102628729 3300005617 Bacteria 554
213 Ga0068864_100016044 3300005618 Bacteria 6232
214 Ga0068864_100593820 3300005618 Bacteria 1074
215 Ga0068864_101179039 3300005618 Bacteria 764
216 Ga0068864_102118915 3300005618 Bacteria 569
217 Ga0068866_10108018 3300005718 Bacteria 1547
218 Ga0068866_11236171 3300005718 Bacteria 540
219 Ga0068861_100030884 3300005719 Bacteria 3930
220 Ga0068861_100137258 3300005719 Bacteria 1991
221 Ga0068861_100429375 3300005719 Bacteria 1179
222 Ga0068861_101097131 3300005719 Bacteria 765
223 Ga0068851_10041209 3300005834 Bacteria 2321
224 Ga0068870_10154775 3300005840 Bacteria 1354
225 Ga0068870_10458441 3300005840 Bacteria 842
226 Ga0068863_100429611 3300005841 Bacteria 1295
227 Ga0068863_101602832 3300005841 Bacteria 660
228 Ga0068858_100014560 3300005842 Bacteria 7411
229 Ga0068858_100119501 3300005842 Bacteria 2464
230 Ga0068858_100221343 3300005842 Bacteria 1792
231 Ga0068858_100298054 3300005842 Unclassified 1538
232 Ga0068858_100405010 3300005842 Bacteria 1311
233 Ga0068858_100700445 3300005842 Bacteria 986
234 Ga0068858_100991570 3300005842 Bacteria 823
235 Ga0068858_101841938 3300005842 Bacteria 598
236 Ga0068860_100288994 3300005843 Bacteria 1604
237 Ga0068860_100382474 3300005843 Unclassified 1390
238 Ga0068860_100430620 3300005843 Bacteria 1309
239 Ga0068860_101142187 3300005843 Bacteria 799
240 Ga0068860_102243004 3300005843 Bacteria 567
241 Ga0068862_100023246 3300005844 Bacteria 5192
242 Ga0068862_100479185 3300005844 Unclassified 1177
243 Ga0068862_100577193 3300005844 Bacteria 1077
244 Ga0068862_100772970 3300005844 Bacteria 936
245 Ga0068862_100842579 3300005844 Bacteria 898
246 Ga0068862_100966043 3300005844 Bacteria 841
247 Ga0068862_101822497 3300005844 Unclassified 618
248 Ga0068862_102209706 3300005844 Bacteria 562
249 Ga0081539_10001702 3300005985 Bacteria 35478
250 Ga0081539_10038590 3300005985 Bacteria 2828
251 Ga0081539_10040663 3300005985 Bacteria 2727
252 Ga0081539_10075209 3300005985 Bacteria 1795
253 Ga0070717_11791795 3300006028 Bacteria 555
254 Ga0075365_10022822 3300006038 Bacteria 3926
255 Ga0075368_10107148 3300006042 Bacteria 1150
256 Ga0075363_100266427 3300006048 Archaea 989
257 Ga0075364_10021212 3300006051 Bacteria 4093
258 Ga0075364_10087665 3300006051 Bacteria 2063
259 Ga0075364_10288778 3300006051 Bacteria 1116
260 Ga0075432_10210689 3300006058 Bacteria 773
261 Ga0075432_10474815 3300006058 Bacteria 553
262 Ga0070716_101529411 3300006173 Bacteria 546
263 Ga0070712_100295073 3300006175 Bacteria 1310
264 Ga0075362_10006980 3300006177 Bacteria 4240
265 Ga0075367_10055938 3300006178 Bacteria 2343
266 Ga0075369_10335085 3300006186 Archaea 709
267 Ga0075366_10009667 3300006195 Bacteria 5390
268 Ga0097621_100073548 3300006237 Bacteria 2829
269 Ga0097621_100183506 3300006237 Unclassified 1809
270 Ga0097621_102434840 3300006237 Unclassified 501
271 Ga0075370_10033251 3300006353 Bacteria 2887
272 Ga0068871_100064962 3300006358 Bacteria 2988
273 Ga0068871_100297997 3300006358 Bacteria 1415
274 Ga0068871_100402308 3300006358 Bacteria 1219
275 Ga0068871_100927422 3300006358 Bacteria 808
276 Ga0068871_100996510 3300006358 Bacteria 780
277 Ga0068871_101599655 3300006358 Bacteria 617
278 Ga0068871_101686193 3300006358 Bacteria 601
279 Ga0075428_100010724 3300006844 Bacteria 10187
280 Ga0075428_100071091 3300006844 Bacteria 3803
281 Ga0075428_100132288 3300006844 Bacteria 2713
282 Ga0075428_100336039 3300006844 Bacteria 1622
283 Ga0075428_100941311 3300006844 Bacteria 915
284 Ga0075428_101148545 3300006844 Bacteria 819
285 Ga0075428_102631023 3300006844 Bacteria 514
286 Ga0075430_100017805 3300006846 Bacteria 6048
287 Ga0075430_100019061 3300006846 Bacteria 5837
288 Ga0075430_100061518 3300006846 Bacteria 3155
289 Ga0075430_100202398 3300006846 Unclassified 1648
290 Ga0075430_100382920 3300006846 Unclassified 1161
291 Ga0075430_100708444 3300006846 Bacteria 830
292 Ga0075430_100866753 3300006846 Bacteria 744
293 Ga0075430_101112134 3300006846 Bacteria 651
294 Ga0075430_101263071 3300006846 Bacteria 608
295 Ga0075431_100595588 3300006847 Bacteria 1090
296 Ga0075431_101231372 3300006847 Archaea 711
297 Ga0075431_101264756 3300006847 Unclassified 699
298 Ga0075431_101418004 3300006847 Unclassified 654
299 Ga0075433_10026046 3300006852 Bacteria 4947
300 Ga0075433_10028333 3300006852 Bacteria 4760
301 Ga0075433_10104570 3300006852 Bacteria 2508
302 Ga0075433_10500118 3300006852 Bacteria 1070
303 Ga0075433_10895592 3300006852 Bacteria 774
304 Ga0075434_100002784 3300006871 Bacteria 15480
305 Ga0075434_100027981 3300006871 Bacteria 5535
306 Ga0075434_100031212 3300006871 Bacteria 5252
307 Ga0075434_100116835 3300006871 Unclassified 2681
308 Ga0075434_100295964 3300006871 Bacteria 1638
309 Ga0075434_100419277 3300006871 Bacteria 1360
310 Ga0075434_100848793 3300006871 Bacteria 929
311 Ga0075434_101276311 3300006871 Unclassified 745
312 Ga0075429_100031024 3300006880 Bacteria 4645
313 Ga0075429_100031059 3300006880 Bacteria 4643
314 Ga0075429_100131023 3300006880 Bacteria 2193
315 Ga0075429_100131370 3300006880 Bacteria 2190
316 Ga0075429_100152347 3300006880 Bacteria 2024
317 Ga0075429_100235486 3300006880 Unclassified 1604
318 Ga0075429_100310362 3300006880 Bacteria 1381
319 Ga0075429_100633518 3300006880 Bacteria 937
320 Ga0075429_101413257 3300006880 Bacteria 606
321 Ga0068865_100121111 3300006881 Bacteria 1946
322 Ga0068865_100187815 3300006881 Bacteria 1596
323 Ga0068865_100415698 3300006881 Bacteria 1105
324 Ga0068865_101291166 3300006881 Bacteria 649
325 Ga0075436_100015139 3300006914 Bacteria 5286
326 Ga0075436_100090650 3300006914 Bacteria 2125
327 Ga0097620_100027741 3300006931 Bacteria 5679
328 Ga0097620_100197407 3300006931 Bacteria 2096
329 Ga0097620_100244853 3300006931 Bacteria 1882
330 Ga0097620_100379593 3300006931 Bacteria 1509
331 Ga0097620_100410879 3300006931 Bacteria 1449
332 Ga0097620_100505469 3300006931 Unclassified 1304
333 Ga0097620_101849231 3300006931 Bacteria 667
334 Ga0097620_102508684 3300006931 Unclassified 568
335 Ga0097620_102628332 3300006931 Bacteria 554
336 Ga0075435_100102968 3300007076 Bacteria 2367
337 Ga0075435_101178059 3300007076 Unclassified 670
338 Ga0105250_10262023 3300009092 Bacteria 740
339 Ga0105240_10635565 3300009093 Bacteria 1171
340 Ga0111539_10000002 3300009094 Bacteria 983359
341 Ga0111539_10000494 3300009094 Bacteria 50039
342 Ga0111539_10000981 3300009094 Bacteria 37479
343 Ga0111539_10004818 3300009094 Bacteria 17588
344 Ga0111539_10009303 3300009094 Bacteria 12406
345 Ga0111539_10014610 3300009094 Bacteria 9799
346 Ga0111539_10031561 3300009094 Bacteria 6435
347 Ga0111539_10031711 3300009094 Bacteria 6420
348 Ga0111539_10088335 3300009094 Bacteria 3642
349 Ga0111539_10211131 3300009094 Bacteria 2262
350 Ga0111539_10375909 3300009094 Bacteria 1654
351 Ga0111539_10718218 3300009094 Unclassified 1163
352 Ga0111539_10729901 3300009094 Bacteria 1153
353 Ga0111539_11166340 3300009094 Unclassified 895
354 Ga0111539_11225417 3300009094 Bacteria 871
355 Ga0111539_11775921 3300009094 Bacteria 715
356 Ga0111539_12396531 3300009094 Bacteria 612
357 Ga0111539_12407837 3300009094 Bacteria 611
358 Ga0111539_12423775 3300009094 Bacteria 609
359 Ga0111539_13278058 3300009094 Bacteria 521
360 Ga0105245_10362090 3300009098 Unclassified 1440
361 Ga0105245_11009328 3300009098 Bacteria 877
362 Ga0105245_11092064 3300009098 Bacteria 844
363 Ga0105247_10766862 3300009101 Bacteria 733
364 Ga0114129_10000410 3300009147 Bacteria 50569
365 Ga0114129_10010375 3300009147 Bacteria 13286
366 Ga0114129_10021226 3300009147 Bacteria 9221
367 Ga0114129_10103495 3300009147 Bacteria 3936
368 Ga0114129_10131662 3300009147 Bacteria 3434
369 Ga0114129_10448604 3300009147 Bacteria 1692
370 Ga0114129_10491555 3300009147 Bacteria 1604
371 Ga0114129_10491991 3300009147 Bacteria 1603
372 Ga0114129_11290882 3300009147 Bacteria 905
373 Ga0114129_11439070 3300009147 Bacteria 849
374 Ga0114129_11785621 3300009147 Bacteria 748
375 Ga0114129_12031475 3300009147 Bacteria 695
376 Ga0114129_12975644 3300009147 Bacteria 558
377 Ga0105243_10214883 3300009148 Bacteria 1696
378 Ga0105243_10499044 3300009148 Unclassified 1153
379 Ga0105243_10540476 3300009148 Bacteria 1111
380 Ga0105243_11355771 3300009148 Bacteria 730
381 Ga0105243_12573886 3300009148 Bacteria 548
382 Ga0105241_10227160 3300009174 Bacteria 1572
383 Ga0105241_11718821 3300009174 Bacteria 610
384 Ga0105242_10027112 3300009176 Bacteria 4546
385 Ga0105242_10148153 3300009176 Bacteria 2044
386 Ga0105242_10704730 3300009176 Bacteria 988
387 Ga0105242_11123983 3300009176 Bacteria 801
388 Ga0105242_11429965 3300009176 Bacteria 720
389 Ga0105242_12066370 3300009176 Bacteria 613
390 Ga0105242_12556086 3300009176 Bacteria 559
391 Ga0105242_12829305 3300009176 Bacteria 536
392 Ga0105248_10056208 3300009177 Bacteria 4415
393 Ga0105248_10078834 3300009177 Bacteria 3702
394 Ga0105248_10185719 3300009177 Bacteria 2343
395 Ga0105248_10200924 3300009177 Bacteria 2246
396 Ga0105248_10268822 3300009177 Bacteria 1920
397 Ga0105248_10588409 3300009177 Bacteria 1256
398 Ga0105248_10639528 3300009177 Bacteria 1200
399 Ga0105237_10789770 3300009545 Bacteria 956
400 Ga0105249_10193204 3300009553 Unclassified 1988
401 Ga0105249_10288108 3300009553 Unclassified 1643
402 Ga0105249_10334000 3300009553 Bacteria 1530
403 Ga0105249_10536530 3300009553 Bacteria 1219
404 Ga0105249_11500721 3300009553 Bacteria 746
405 Ga0105249_12119870 3300009553 Bacteria 635
406 Ga0105249_12177084 3300009553 Bacteria 627
407 Ga0105249_13359684 3300009553 Bacteria 515
408 Ga0105239_13254207 3300010375 Bacteria 529
409 Ga0105246_10072654 3300011119 Bacteria 2426
410 Ga0105246_10655482 3300011119 Bacteria 914
411 Ga0105246_11465365 3300011119 Bacteria 640
412 Ga0157370_10473771 3300013104 Bacteria 1151
413 Ga0157370_11605225 3300013104 Bacteria 584
414 Ga0157374_10091418 3300013296 Bacteria 2902
415 Ga0157374_10392762 3300013296 Bacteria 1383
416 Ga0157378_10493590 3300013297 Bacteria 1222
417 Ga0157378_10701691 3300013297 Bacteria 1031
418 Ga0157378_10705802 3300013297 Bacteria 1028
419 Ga0157378_10816167 3300013297 Bacteria 959
420 Ga0157378_11217201 3300013297 Unclassified 793
421 Ga0157378_11424839 3300013297 Bacteria 736
422 Ga0163162_10081557 3300013306 Bacteria 3305
423 Ga0163162_10916219 3300013306 Bacteria 989
424 Ga0163162_12960292 3300013306 Bacteria 546
425 Ga0157375_10122515 3300013308 Bacteria 2712
426 Ga0157375_10748925 3300013308 Bacteria 1128
427 Ga0157375_10922867 3300013308 Bacteria 1016
428 Ga0157375_12004728 3300013308 Bacteria 688
429 Ga0163163_10000663 3300014325 Bacteria 29504
430 Ga0163163_10051186 3300014325 Bacteria 4072
431 Ga0163163_10051300 3300014325 Bacteria 4067
432 Ga0163163_12535584 3300014325 Bacteria 571
433 Ga0157380_10019060 3300014326 Bacteria 5107
434 Ga0157380_10147873 3300014326 Bacteria 2027
435 Ga0157380_10159384 3300014326 Bacteria 1960
436 Ga0157380_10244769 3300014326 Bacteria 1619
437 Ga0157380_10377514 3300014326 Unclassified 1337
438 Ga0157380_11045784 3300014326 Bacteria 852
439 Ga0157380_11440155 3300014326 Unclassified 740
440 Ga0157380_11467623 3300014326 Bacteria 734
441 Ga0157380_11483884 3300014326 Unclassified 731
442 Ga0157380_13327703 3300014326 Unclassified 514
443 Ga0157377_10168058 3300014745 Bacteria 1369
444 Ga0157377_10182204 3300014745 Bacteria 1322
445 Ga0157377_10409306 3300014745 Bacteria 926
446 Ga0157379_10018789 3300014968 Bacteria 6095
447 Ga0157379_10362481 3300014968 Unclassified 1328
448 Ga0157379_10739262 3300014968 Bacteria 926
449 Ga0157379_10961823 3300014968 Bacteria 813
450 Ga0157379_11628553 3300014968 Bacteria 631
451 Ga0157376_10102217 3300014969 Bacteria 2507
452 Ga0157376_10932279 3300014969 Bacteria 888
453 Ga0157376_10947980 3300014969 Bacteria 881
454 Ga0157376_11326572 3300014969 Bacteria 750
455 Ga0157376_12532350 3300014969 Bacteria 553
456 Ga0163161_10344775 3300017792 Bacteria 1183
457 Ga0163161_10598561 3300017792 Bacteria 909
458 Ga0207697_10028355 3300025315 Bacteria 2290
459 Ga0207697_10104649 3300025315 Bacteria 1209
460 Ga0207656_10114764 3300025321 Bacteria 1248
461 Ga0207682_10141899 3300025893 Bacteria 1078
462 Ga0207642_10361294 3300025899 Bacteria 859
463 Ga0207642_10390764 3300025899 Bacteria 830
464 Ga0207642_10564474 3300025899 Bacteria 704
465 Ga0207710_10728913 3300025900 Bacteria 520
466 Ga0207688_10411373 3300025901 Bacteria 840
467 Ga0207688_10641101 3300025901 Bacteria 670
468 Ga0207680_10012973 3300025903 Bacteria 4261
469 Ga0207680_10175344 3300025903 Bacteria 1446
470 Ga0207680_10802893 3300025903 Bacteria 675
471 Ga0207680_11198531 3300025903 Bacteria 541
472 Ga0207647_10353135 3300025904 Bacteria 832
473 Ga0207699_10369831 3300025906 Bacteria 1016
474 Ga0207645_10006858 3300025907 Bacteria 8126
475 Ga0207645_10092758 3300025907 Bacteria 1942
476 Ga0207645_10139529 3300025907 Bacteria 1579
477 Ga0207643_10160496 3300025908 Bacteria 1352
478 Ga0207643_10468671 3300025908 Bacteria 803
479 Ga0207684_10050119 3300025910 Bacteria 3542
480 Ga0207707_10755878 3300025912 Bacteria 813
481 Ga0207693_10404735 3300025915 Bacteria 1067
482 Ga0207660_10126900 3300025917 Bacteria 1938
483 Ga0207660_10489262 3300025917 Bacteria 997
484 Ga0207662_10000724 3300025918 Bacteria 15073
485 Ga0207662_10036889 3300025918 Bacteria 2859
486 Ga0207662_10079506 3300025918 Bacteria 1998
487 Ga0207662_10213307 3300025918 Bacteria 1254
488 Ga0207649_10014442 3300025920 Bacteria 4422
489 Ga0207649_10074085 3300025920 Bacteria 2184
490 Ga0207652_10753920 3300025921 Bacteria 866
491 Ga0207646_10119235 3300025922 Bacteria 2370
492 Ga0207646_10452790 3300025922 Bacteria 1158
493 Ga0207646_10683837 3300025922 Unclassified 918
494 Ga0207646_11431012 3300025922 Bacteria 600
495 Ga0207681_10108834 3300025923 Bacteria 2012
496 Ga0207681_10170620 3300025923 Bacteria 1649
497 Ga0207681_10242915 3300025923 Bacteria 1402
498 Ga0207681_10849591 3300025923 Bacteria 763
499 Ga0207681_11180808 3300025923 Bacteria 643
500 Ga0207650_10005949 3300025925 Bacteria 8327
501 Ga0207650_10212934 3300025925 Bacteria 1552
502 Ga0207650_10862600 3300025925 Bacteria 768
503 Ga0207659_10070657 3300025926 Bacteria 2546
504 Ga0207659_10218667 3300025926 Bacteria 1530
505 Ga0207659_10245933 3300025926 Bacteria 1449
506 Ga0207659_10860743 3300025926 Bacteria 779
507 Ga0207659_11157736 3300025926 Bacteria 665
508 Ga0207687_10424821 3300025927 Unclassified 1097
509 Ga0207687_10455804 3300025927 Bacteria 1061
510 Ga0207687_10735457 3300025927 Bacteria 839
511 Ga0207700_10407357 3300025928 Bacteria 1192
512 Ga0207664_10019126 3300025929 Bacteria 5057
513 Ga0207644_10025621 3300025931 Bacteria 4056
514 Ga0207644_11804282 3300025931 Bacteria 512
515 Ga0207690_10090510 3300025932 Bacteria 2160
516 Ga0207706_10255567 3300025933 Bacteria 1530
517 Ga0207706_11009822 3300025933 Unclassified 699
518 Ga0207686_10586134 3300025934 Bacteria 876
519 Ga0207686_10829244 3300025934 Unclassified 743
520 Ga0207709_10218683 3300025935 Bacteria 1372
521 Ga0207709_11603613 3300025935 Archaea 541
522 Ga0207670_10009947 3300025936 Bacteria 5451
523 Ga0207670_10055982 3300025936 Bacteria 2668
524 Ga0207670_10154626 3300025936 Bacteria 1706
525 Ga0207670_10213452 3300025936 Bacteria 1473
526 Ga0207670_10856524 3300025936 Bacteria 759
527 Ga0207670_10882285 3300025936 Bacteria 748
528 Ga0207670_11124515 3300025936 Bacteria 664
529 Ga0207669_10163951 3300025937 Bacteria 1574
530 Ga0207669_10513240 3300025937 Bacteria 961
531 Ga0207669_10577353 3300025937 Bacteria 911
532 Ga0207669_10949103 3300025937 Bacteria 721
533 Ga0207704_10293654 3300025938 Bacteria 1242
534 Ga0207665_10708488 3300025939 Bacteria 792
535 Ga0207691_10035117 3300025940 Bacteria 4658
536 Ga0207691_10589775 3300025940 Bacteria 941
537 Ga0207711_10052374 3300025941 Bacteria 3498
538 Ga0207711_10059255 3300025941 Bacteria 3296
539 Ga0207711_10231968 3300025941 Bacteria 1691
540 Ga0207711_10449608 3300025941 Bacteria 1199
541 Ga0207711_11147549 3300025941 Bacteria 718
542 Ga0207711_11383338 3300025941 Bacteria 646
543 Ga0207689_10006797 3300025942 Bacteria 10066
544 Ga0207689_10089587 3300025942 Bacteria 2527
545 Ga0207689_10155386 3300025942 Bacteria 1886
546 Ga0207689_10276070 3300025942 Bacteria 1391
547 Ga0207661_10003359 3300025944 Bacteria 11114
548 Ga0207679_10003327 3300025945 Bacteria 9926
549 Ga0207679_10099569 3300025945 Bacteria 2270
550 Ga0207679_10743898 3300025945 Unclassified 892
551 Ga0207679_10775176 3300025945 Bacteria 873
552 Ga0207651_10063293 3300025960 Bacteria 2583
553 Ga0207651_10113967 3300025960 Bacteria 2035
554 Ga0207651_10146104 3300025960 Bacteria 1834
555 Ga0207651_10284456 3300025960 Bacteria 1368
556 Ga0207712_10684787 3300025961 Bacteria 894
557 Ga0207712_11565837 3300025961 Bacteria 591
558 Ga0207712_11928752 3300025961 Unclassified 529
559 Ga0207668_10241305 3300025972 Unclassified 1462
560 Ga0207668_10388884 3300025972 Bacteria 1176
561 Ga0207668_10566262 3300025972 Bacteria 986
562 Ga0207640_10136137 3300025981 Bacteria 1783
563 Ga0207640_10425090 3300025981 Unclassified 1088
564 Ga0207658_10177662 3300025986 Bacteria 1759
565 Ga0207658_10219745 3300025986 Bacteria 1598
566 Ga0207658_10233156 3300025986 Bacteria 1555
567 Ga0207658_10471730 3300025986 Bacteria 1114
568 Ga0207658_10571006 3300025986 Bacteria 1014
569 Ga0207677_11892456 3300026023 Bacteria 554
570 Ga0207677_11922384 3300026023 Unclassified 550
571 Ga0207703_10028166 3300026035 Bacteria 4426
572 Ga0207703_10277807 3300026035 Bacteria 1520
573 Ga0207703_10481808 3300026035 Bacteria 1162
574 Ga0207703_11466846 3300026035 Bacteria 656
575 Ga0207639_10948082 3300026041 Bacteria 805
576 Ga0207678_10003414 3300026067 Bacteria 14300
577 Ga0207678_10036078 3300026067 Bacteria 4303
578 Ga0207678_11021343 3300026067 Bacteria 732
579 Ga0207678_11704107 3300026067 Bacteria 553
580 Ga0207708_10008073 3300026075 Bacteria 7802
581 Ga0207708_10035538 3300026075 Bacteria 3791
582 Ga0207708_10050949 3300026075 Bacteria 3152
583 Ga0207708_10097773 3300026075 Bacteria 2269
584 Ga0207708_10383685 3300026075 Bacteria 1159
585 Ga0207708_11271275 3300026075 Bacteria 644
586 Ga0207641_10190676 3300026088 Bacteria 1884
587 Ga0207641_10491030 3300026088 Bacteria 1191
588 Ga0207641_10689032 3300026088 Bacteria 1006
589 Ga0207641_10753911 3300026088 Bacteria 961
590 Ga0207648_10034858 3300026089 Bacteria 4437
591 Ga0207648_10049704 3300026089 Bacteria 3668
592 Ga0207648_10138059 3300026089 Bacteria 2148
593 Ga0207648_10484744 3300026089 Bacteria 1130
594 Ga0207648_10878959 3300026089 Bacteria 836
595 Ga0207676_10057882 3300026095 Bacteria 3054
596 Ga0207676_10232121 3300026095 Bacteria 1650
597 Ga0207676_10764784 3300026095 Bacteria 940
598 Ga0207674_10029870 3300026116 Bacteria 5735
599 Ga0207674_10284441 3300026116 Bacteria 1602
600 Ga0207674_10509282 3300026116 Bacteria 1163
601 Ga0207674_10775663 3300026116 Unclassified 925
602 Ga0207674_11322739 3300026116 Bacteria 690
603 Ga0207675_100056601 3300026118 Bacteria 3658
604 Ga0207675_100125191 3300026118 Bacteria 2434
605 Ga0207675_100152156 3300026118 Bacteria 2202
606 Ga0207675_100224347 3300026118 Bacteria 1811
607 Ga0207675_100252953 3300026118 Bacteria 1706
608 Ga0207675_100278724 3300026118 Bacteria 1624
609 Ga0207675_100927920 3300026118 Bacteria 887
610 Ga0207675_100972704 3300026118 Bacteria 867
611 Ga0207675_101036903 3300026118 Bacteria 839
612 Ga0207675_102309182 3300026118 Bacteria 552
613 Ga0207683_11075672 3300026121 Bacteria 746
614 Ga0207683_11153016 3300026121 Bacteria 719
615 Ga0209969_1023274 3300027360 Bacteria 928
616 Ga0209967_1062605 3300027364 Unclassified 578
617 Ga0209974_10469283 3300027876 Bacteria 501
618 Ga0207428_10000004 3300027907 Bacteria 727800
619 Ga0207428_10000066 3300027907 Bacteria 150622
620 Ga0207428_10001093 3300027907 Bacteria 29501
621 Ga0207428_10005537 3300027907 Bacteria 11764
622 Ga0207428_10055858 3300027907 Bacteria 3138
623 Ga0207428_10066960 3300027907 Bacteria 2829
624 Ga0207428_10071304 3300027907 Bacteria 2729
625 Ga0207428_10092199 3300027907 Bacteria 2351
626 Ga0207428_10384192 3300027907 Bacteria 1030
627 Ga0207428_11004282 3300027907 Bacteria 586
628 Ga0268266_10212024 3300028379 Bacteria 1776
629 Ga0268266_11470027 3300028379 Bacteria 657
630 Ga0268265_11107770 3300028380 Bacteria 786
631 Ga0268265_11319233 3300028380 Bacteria 722
632 Ga0268265_11349863 3300028380 Bacteria 714
633 Ga0268265_12339696 3300028380 Bacteria 541
634 Ga0268264_10115035 3300028381 Bacteria 2363
635 Ga0268264_10192729 3300028381 Bacteria 1859
636 Ga0268264_10527165 3300028381 Unclassified 1155
637 Ga0268264_10594671 3300028381 Bacteria 1090
638 Ga0268264_11086496 3300028381 Bacteria 808
639 Ga0268264_11789745 3300028381 Bacteria 624
640 Ga0268264_12631312 3300028381 Bacteria 507
641 Ga0307408_100023632 3300031548 Bacteria 4190
642 Ga0307408_100261771 3300031548 Bacteria 1432
643 Ga0307408_100402624 3300031548 Bacteria 1175
644 Ga0307405_10006893 3300031731 Bacteria 5637
645 Ga0307405_10221650 3300031731 Bacteria 1388
646 Ga0307413_10239745 3300031824 Bacteria 1338
647 Ga0307413_10331048 3300031824 Bacteria 1167
648 Ga0307413_10364976 3300031824 Bacteria 1119
649 Ga0307413_10382255 3300031824 Unclassified 1097
650 Ga0307413_10417206 3300031824 Bacteria 1056
651 Ga0307413_10519559 3300031824 Bacteria 960
652 Ga0307413_10626788 3300031824 Bacteria 884
653 Ga0307410_10002658 3300031852 Bacteria 8714
654 Ga0307410_10042686 3300031852 Bacteria 3000
655 Ga0307410_10147912 3300031852 Bacteria 1745
656 Ga0307410_10508726 3300031852 Bacteria 992
657 Ga0307410_10782691 3300031852 Bacteria 810
658 Ga0307406_10030254 3300031901 Bacteria 3286
659 Ga0307406_10098326 3300031901 Bacteria 1987
660 Ga0307406_10736648 3300031901 Bacteria 826
661 Ga0307407_10033690 3300031903 Bacteria 2797
662 Ga0307407_10051437 3300031903 Bacteria 2362
663 Ga0307407_10090709 3300031903 Bacteria 1872
664 Ga0307407_10331626 3300031903 Bacteria 1071
665 Ga0307407_10411242 3300031903 Bacteria 973
666 Ga0307412_10002780 3300031911 Bacteria 9729
667 Ga0307412_10281513 3300031911 Bacteria 1306
668 Ga0307412_10367850 3300031911 Unclassified 1160
669 Ga0307412_10941510 3300031911 Bacteria 760
670 Ga0307412_11208239 3300031911 Bacteria 677
671 Ga0307409_100026062 3300031995 Bacteria 4116
672 Ga0307409_100027404 3300031995 Bacteria 4037
673 Ga0307409_100061598 3300031995 Bacteria 2933
674 Ga0307409_100067913 3300031995 Bacteria 2817
675 Ga0307409_100110777 3300031995 Bacteria 2301
676 Ga0307409_100188142 3300031995 Bacteria 1835
677 Ga0307416_100064487 3300032002 Bacteria 3005
678 Ga0307416_100084872 3300032002 Bacteria 2693
679 Ga0307416_100163096 3300032002 Bacteria 2063
680 Ga0307416_100374872 3300032002 Bacteria 1450
681 Ga0307416_100634802 3300032002 Bacteria 1151
682 Ga0307416_100812870 3300032002 Bacteria 1031
683 Ga0307416_102169404 3300032002 Unclassified 657
684 Ga0307414_10188975 3300032004 Bacteria 1665
685 Ga0307414_10235540 3300032004 Bacteria 1512
686 Ga0307414_10371664 3300032004 Bacteria 1233
687 Ga0307414_10400370 3300032004 Bacteria 1192
688 Ga0307414_11165783 3300032004 Bacteria 713
689 Ga0307411_10111433 3300032005 Bacteria 1959
690 Ga0307411_10219441 3300032005 Bacteria 1474
691 Ga0307411_10267673 3300032005 Bacteria 1353
692 Ga0307411_10301332 3300032005 Bacteria 1285
693 Ga0307411_10329942 3300032005 Bacteria 1236
694 Ga0307411_10469000 3300032005 Unclassified 1057
695 Ga0307411_10469203 3300032005 Bacteria 1057
696 Ga0307411_11645149 3300032005 Unclassified 593
697 Ga0307415_100043485 3300032126 Bacteria 2997
698 Ga0307415_100179480 3300032126 Bacteria 1660
699 Ga0307415_100347555 3300032126 Bacteria 1247
700 Ga0307415_100829886 3300032126 Unclassified 846
701 Ga0307415_101304893 3300032126 Bacteria 688
702 Ga0373938_0188269 3300034957 Archaea 567
703 Ga0373936_0400656 3300035113 Bacteria 630
704 Ga0373936_0611281 3300035113 Bacteria 512
705 Ga0373954_0047240 3300035118 Bacteria 2014
706 Ga0373957_0007399 3300035120 Bacteria 3513
707 Ga0373960_0190300 3300035121 Bacteria 721
708 Ga0373955_0012700 3300035172 Bacteria 4055
709 Ga0373955_0499374 3300035172 Bacteria 743
710 Ga0373955_0865220 3300035172 Bacteria 556
711 Ga0373961_0445509 3300035241 Bacteria 504
712 Ga0373933_0003937 3300035724 Bacteria 8198
713 Ga0373937_0002473 3300036401 Bacteria 15364
714 Ga0373937_0185689 3300036401 Bacteria 1953
715 Ga0373937_1732953 3300036401 Bacteria 571
716 Ga0395898_1768798 3300037466 Bacteria 540
717 Ga0436362_0045085 3300039453 Bacteria 801
718 Ga0439453_0185251 3300041408 Bacteria 510
719 Ga0451795_0189527 3300041456 Bacteria 621
720 Ga0451800_0575700 3300041459 Bacteria 1231
721 Ga0451807_0021731 3300041486 Bacteria 520
722 Ga0451807_0526429 3300041486 Bacteria 721
723 Ga0451807_0793962 3300041486 Bacteria 618
724 Ga0451839_0563425 3300041496 Bacteria 702
725 Ga0451849_1226666 3300041505 Bacteria 548
726 Ga0451853_2084722 3300041512 Bacteria 759
727 Ga0451853_2545316 3300041512 Bacteria 1419
728 Ga0451853_3669051 3300041512 Bacteria 859
729 Ga0451853_3745927 3300041512 Bacteria 1019
730 Ga0439433_0083770 3300041999 Bacteria 778
731 Ga0439443_055794 3300042003 Bacteria 699
732 Ga0439454_099419 3300042011 Bacteria 545
733 Ga0439456_161775 3300042013 Bacteria 524
734 Ga0450923_018237 3300042125 Bacteria 1341
735 Ga0450923_021563 3300042125 Bacteria 1257
736 Ga0450923_040523 3300042125 Bacteria 977
737 Ga0450890_041317 3300042127 Bacteria 683
738 Ga0450897_038392 3300042128 Bacteria 558
739 Ga0450892_010298 3300042130 Bacteria 818
740 Ga0450894_003529 3300042131 Bacteria 2044
741 Ga0450895_024623 3300042132 Bacteria 570
742 Ga0450896_024701 3300042133 Bacteria 891
743 Ga0450899_021474 3300042135 Unclassified 756
744 Ga0450906_021096 3300042145 Bacteria 1165
745 Ga0450909_009430 3300042185 Bacteria 1425
746 Ga0439434_0245718 3300042435 Bacteria 611
747 Ga0439435_0072151 3300042436 Bacteria 1024
748 Ga0439464_0033332 3300042439 Bacteria 1450
749 Ga0439460_0181914 3300042461 Unclassified 711
750 Ga0450916_008974 3300042530 Bacteria 1228
751 Ga0450916_096513 3300042530 Bacteria 520
752 Ga0450918_034014 3300042531 Bacteria 905
753 Ga0450893_0098999 3300042532 Bacteria 592
754 Ga0451577_0132777 3300042876 Bacteria 2234
755 Ga0453683_0623424 3300044673 Bacteria 704
756 Ga0453683_0726699 3300044673 Bacteria 651
757 Ga0453684_0107756 3300044712 Bacteria 3392
758 Ga0466960_0876213 3300044901 Bacteria 547
759 Ga0451576_0023050 3300045051 Bacteria 6747
760 Ga0451576_2085483 3300045051 Bacteria 583
761 Ga0451576_2247038 3300045051 Unclassified 560
762 Ga0466967_0877877 3300045976 Bacteria 892
763 Ga0466967_1607584 3300045976 Bacteria 647
764 Ga0495592_0475807 3300046454 Bacteria 779
765 Ga0495603_0209070 3300046455 Bacteria 1127
766 Ga0495651_0076455 3300046462 Bacteria 2536
767 Ga0495653_0708482 3300046463 Bacteria 611
768 Ga0495582_0361365 3300046473 Bacteria 836
769 Ga0495664_0707613 3300046477 Bacteria 595
770 Ga0495584_0031669 3300046491 Bacteria 2676
771 Ga0495594_0669086 3300046499 Bacteria 587
772 Ga0495628_0940909 3300046516 Bacteria 597
773 Ga0495630_0715786 3300046517 Bacteria 766
774 Ga0495637_0207938 3300046520 Bacteria 717
775 Ga0495643_0001941 3300046522 Bacteria 17402
776 Ga0495663_0134012 3300046525 Bacteria 837
777 Ga0495587_0098139 3300046536 Bacteria 1689
778 Ga0495598_0009390 3300046537 Bacteria 2311
779 Ga0495598_0015886 3300046537 Bacteria 1910
780 Ga0495598_0134260 3300046537 Bacteria 851
781 Ga0495609_0079851 3300046538 Bacteria 1431
782 Ga0495621_0094454 3300046539 Bacteria 1131
783 Ga0495621_0167157 3300046539 Bacteria 872
784 Ga0495597_0351223 3300046542 Unclassified 566
785 Ga0495633_0193656 3300046558 Bacteria 934
786 Ga0495656_0107445 3300046615 Bacteria 1300
787 Ga0495659_0102391 3300046664 Bacteria 1110
788 Ga0495647_0003465 3300046681 Bacteria 5047
789 Ga0495647_0275437 3300046681 Bacteria 754
790 Ga0495647_0324119 3300046681 Bacteria 698
791 Ga0495669_0114625 3300046684 Bacteria 1261
792 Ga0495669_0338223 3300046684 Bacteria 727
793 Ga0495649_0409512 3300046694 Bacteria 680
794 Ga0495604_0347158 3300047317 Unclassified 987
795 Ga0495672_0320193 3300047320 Bacteria 729
796 Ga0495680_0380536 3300047322 Bacteria 978
797 Ga0495675_0755088 3300047444 Bacteria 541
798 Ga0495685_080951 3300047447 Bacteria 1081
799 Ga0495614_0230281 3300048089 Bacteria 844
800 Ga0495615_0145672 3300048090 Bacteria 702
801 Ga0496101_0614809 3300048904 Bacteria 859
802 Ga0496104_0003082 3300048907 Bacteria 14367
803 Ga0496104_1271719 3300048907 Bacteria 639
804 Ga0496105_0019761 3300048908 Bacteria 5435
805 Ga0496105_0343643 3300048908 Bacteria 1193
806 Ga0496106_0249197 3300048909 Bacteria 1420
807 Ga0496106_0500743 3300048909 Bacteria 976
808 Ga0496107_0318703 3300048910 Bacteria 1157
809 Ga0496108_0003036 3300048911 Bacteria 13496
810 Ga0496108_1012114 3300048911 Bacteria 709
811 Ga0496109_0004537 3300048912 Bacteria 11602
812 Ga0496109_0818684 3300048912 Bacteria 869
813 Ga0496110_0004868 3300048913 Bacteria 10477
814 Ga0496110_0215709 3300048913 Bacteria 1745
815 Ga0496110_0891015 3300048913 Bacteria 796
816 Ga0496111_0005731 3300048914 Bacteria 8009
817 Ga0496111_0127638 3300048914 Bacteria 1881
818 Ga0496112_0001468 3300048915 Bacteria 18097
819 Ga0496113_0167493 3300048916 Bacteria 1739
820 Ga0496113_0994574 3300048916 Bacteria 661
821 Ga0496114_0053394 3300048917 Bacteria 3369
822 Ga0496114_0171724 3300048917 Bacteria 1890
823 Ga0496114_1337213 3300048917 Bacteria 603
824 Ga0501300_021039 3300049523 Bacteria 953
825 Ga0501311_082027 3300049527 Bacteria 550
826 Ga0501031_0046471 3300049568 Bacteria 2831
827 Ga0501031_0511735 3300049568 Bacteria 774
828 Ga0501032_0520296 3300049569 Bacteria 759
829 Ga0501033_0037295 3300049570 Bacteria 3639
830 Ga0501034_0115513 3300049571 Bacteria 2672
831 Ga0501034_0705034 3300049571 Bacteria 907
832 Ga0501036_0104742 3300049572 Unclassified 2392
833 Ga0501036_0273501 3300049572 Bacteria 1414
834 Ga0501036_0521110 3300049572 Bacteria 989
835 Ga0501036_0591953 3300049572 Bacteria 920
836 Ga0501036_0652360 3300049572 Bacteria 871
837 Ga0501036_0865534 3300049572 Bacteria 742
838 Ga0501036_1015335 3300049572 Bacteria 679
839 Ga0501037_0098874 3300049573 Bacteria 2107
840 Ga0501037_0557127 3300049573 Bacteria 773
841 Ga0501037_0728156 3300049573 Bacteria 658
842 Ga0501038_0135132 3300049574 Bacteria 2021
843 Ga0501038_0399459 3300049574 Bacteria 1063
844 Ga0501038_0589329 3300049574 Bacteria 842
845 Ga0501038_0834415 3300049574 Bacteria 683
846 Ga0501039_0089734 3300049575 Bacteria 2395
847 Ga0501039_0258539 3300049575 Bacteria 1369
848 Ga0501039_0368660 3300049575 Bacteria 1128
849 Ga0501039_0497179 3300049575 Bacteria 958
850 Ga0501039_0504529 3300049575 Bacteria 950
851 Ga0501040_0068905 3300049576 Bacteria 2440
852 Ga0501040_0286680 3300049576 Bacteria 1176
853 Ga0501040_0511750 3300049576 Bacteria 865
854 Ga0501040_1230390 3300049576 Bacteria 543
855 Ga0501041_0144688 3300049577 Bacteria 1483
856 Ga0501041_0235132 3300049577 Bacteria 1151
857 Ga0501041_0427339 3300049577 Bacteria 840
858 Ga0501041_0530679 3300049577 Bacteria 750
859 Ga0501042_0075928 3300049578 Bacteria 2405
860 Ga0501042_0085131 3300049578 Bacteria 2267
861 Ga0501042_0210948 3300049578 Bacteria 1401
862 Ga0501042_0233859 3300049578 Bacteria 1326
863 Ga0501042_0874338 3300049578 Bacteria 654
864 Ga0501042_1258217 3300049578 Bacteria 540
865 Ga0501042_1373781 3300049578 Bacteria 515
866 Ga0501043_0106136 3300049579 Bacteria 2206
867 Ga0501046_0015798 3300049580 Bacteria 6334
868 Ga0501046_0046528 3300049580 Bacteria 3443
869 Ga0501046_0285268 3300049580 Bacteria 1209
870 Ga0501046_0536254 3300049580 Bacteria 835
871 Ga0501046_0610915 3300049580 Bacteria 773
872 Ga0501046_1168724 3300049580 Bacteria 530
873 Ga0501047_0006623 3300049581 Bacteria 10895
874 Ga0501047_0071383 3300049581 Bacteria 3342
875 Ga0501047_0988841 3300049581 Bacteria 654
876 Ga0501048_0200008 3300049582 Bacteria 1416
877 Ga0501067_0144682 3300049583 Bacteria 1324
878 Ga0501067_0544826 3300049583 Bacteria 650
879 Ga0501067_0588831 3300049583 Bacteria 623
880 Ga0501068_0058634 3300049584 Bacteria 2336
881 Ga0501068_0075221 3300049584 Bacteria 2066
882 Ga0501068_0211500 3300049584 Bacteria 1231
883 Ga0501069_0006243 3300049585 Bacteria 6228
884 Ga0501070_0343688 3300049586 Bacteria 1212
885 Ga0501070_0661706 3300049586 Bacteria 828
886 Ga0501070_1497282 3300049586 Bacteria 511
887 Ga0501071_0149591 3300049587 Bacteria 1741
888 Ga0501071_0159629 3300049587 Bacteria 1685
889 Ga0501071_0166359 3300049587 Bacteria 1650
890 Ga0501071_0189283 3300049587 Bacteria 1543
891 Ga0501071_0239367 3300049587 Bacteria 1368
892 Ga0501071_0435316 3300049587 Bacteria 1003
893 Ga0501071_0484897 3300049587 Bacteria 948
894 Ga0501071_0672350 3300049587 Bacteria 797
895 Ga0501071_1099832 3300049587 Bacteria 614
896 Ga0501072_0075990 3300049588 Bacteria 2657
897 Ga0501072_0109368 3300049588 Bacteria 2200
898 Ga0501072_0127443 3300049588 Bacteria 2028
899 Ga0501072_0210167 3300049588 Bacteria 1551
900 Ga0501072_0220493 3300049588 Bacteria 1512
901 Ga0501072_0254797 3300049588 Bacteria 1397
902 Ga0501073_0347179 3300049589 Bacteria 1024
903 Ga0501073_0454940 3300049589 Bacteria 885
904 Ga0501073_0580333 3300049589 Bacteria 774
905 Ga0501073_1058910 3300049589 Bacteria 558
906 Ga0501074_0017869 3300049590 Bacteria 5153
907 Ga0501074_0162295 3300049590 Bacteria 1596
908 Ga0501074_0194780 3300049590 Bacteria 1445
909 Ga0501074_0314169 3300049590 Bacteria 1113
910 Ga0501074_0929107 3300049590 Bacteria 612
911 Ga0501075_0121589 3300049591 Bacteria 1987
912 Ga0501075_0144066 3300049591 Bacteria 1816
913 Ga0501075_0165360 3300049591 Bacteria 1688
914 Ga0501075_0423995 3300049591 Bacteria 1014
915 Ga0501075_0606554 3300049591 Bacteria 835
916 Ga0501075_1375790 3300049591 Bacteria 535
917 Ga0501075_1442648 3300049591 Bacteria 521
918 Ga0501075_1530664 3300049591 Bacteria 505
919 Ga0501076_0085979 3300049592 Bacteria 2527
920 Ga0501076_0159376 3300049592 Bacteria 1838
921 Ga0501076_0185119 3300049592 Bacteria 1698
922 Ga0501076_0347888 3300049592 Bacteria 1217
923 Ga0501076_0404539 3300049592 Bacteria 1122
924 Ga0501076_0454774 3300049592 Bacteria 1054
925 Ga0501076_0472907 3300049592 Bacteria 1032
926 Ga0501076_0517199 3300049592 Bacteria 984
927 Ga0501076_0546117 3300049592 Bacteria 955
928 Ga0501076_0979298 3300049592 Bacteria 697
929 Ga0501076_1557296 3300049592 Bacteria 542
930 Ga0501077_0102406 3300049593 Bacteria 1814
931 Ga0501077_0253061 3300049593 Bacteria 1120
932 Ga0501077_0384601 3300049593 Bacteria 897
933 Ga0501077_0454925 3300049593 Bacteria 820
934 Ga0501077_0488621 3300049593 Unclassified 789
935 Ga0501077_0747206 3300049593 Unclassified 629
936 Ga0501077_0835607 3300049593 Bacteria 592
937 Ga0501211_043925 3300049658 Bacteria 539
938 Ga0501243_130230 3300049675 Unclassified 525
939 Ga0501079_0027969 3300049741 Bacteria 4325
940 Ga0501079_0332455 3300049741 Bacteria 1190
941 Ga0501079_0832907 3300049741 Unclassified 726
942 Ga0501080_0019050 3300049742 Bacteria 6354
943 Ga0501080_0102787 3300049742 Bacteria 2651
944 Ga0501080_0393028 3300049742 Bacteria 1248
945 Ga0501080_1833734 3300049742 Bacteria 509
946 Ga0501081_0046801 3300049743 Bacteria 2975
947 Ga0501081_0354441 3300049743 Bacteria 1082
948 Ga0501081_0398270 3300049743 Bacteria 1019
949 Ga0501083_0009096 3300049744 Bacteria 7015
950 Ga0501083_0139058 3300049744 Bacteria 1590
951 Ga0501083_0180486 3300049744 Bacteria 1378
952 Ga0501083_1035306 3300049744 Bacteria 534
953 Ga0501035_0128300 3300049822 Bacteria 2212
954 Ga0501035_0250609 3300049822 Bacteria 1504
955 Ga0501035_0296453 3300049822 Bacteria 1363
956 Ga0501035_0812271 3300049822 Bacteria 746
957 Ga0501044_0116255 3300049823 Bacteria 2680
958 Ga0501044_0144191 3300049823 Bacteria 2368
959 Ga0501044_0723691 3300049823 Bacteria 879
960 Ga0501045_0013621 3300049824 Bacteria 5748
961 Ga0501045_0026599 3300049824 Bacteria 4164
962 Ga0501045_0044615 3300049824 Bacteria 3230
963 Ga0501045_0091558 3300049824 Bacteria 2248
964 Ga0501045_0984409 3300049824 Bacteria 619
965 nmdc:mga03683_152060_c1 3300050489 Bacteria 1045
966 nmdc:mga03n38_328724_c1 3300050490 Archaea 827
967 nmdc:mga00v17_169127_c1 3300050491 Bacteria 1409
968 nmdc:mga00v17_373533_c1 3300050491 Bacteria 927
969 nmdc:mga0yw44_16488_c1 3300050492 Unclassified 1930
970 nmdc:mga0k408_11298_c1 3300050493 Bacteria 4858
971 nmdc:mga0k408_601469_c1 3300050493 Bacteria 648
972 nmdc:mga0k408_842942_c1 3300050493 Bacteria 533
973 nmdc:mga06z11_128855_c1 3300050494 Bacteria 1419
974 nmdc:mga06z11_640735_c1 3300050494 Bacteria 647
975 nmdc:mga04h51_80670_c1 3300050495 Bacteria 1154
976 nmdc:mga07m45_99236_c1 3300050496 Bacteria 1249
977 nmdc:mga05p37_1102340_c1 3300050507 Bacteria 831
978 nmdc:mga05p37_11849_c1 3300050507 Bacteria 10393
979 nmdc:mga05p37_1408827_c1 3300050507 Bacteria 701
980 nmdc:mga05p37_1775674_c1 3300050507 Bacteria 597
981 nmdc:mga05p37_2244117_c1 3300050507 Bacteria 505
982 nmdc:mga05p37_288705_c1 3300050507 Bacteria 1953
983 nmdc:mga05p37_359328_c1 3300050507 Bacteria 1712
984 nmdc:mga05p37_39335_c1 3300050507 Bacteria 5806
985 nmdc:mga05p37_54_c2 3300050507 Bacteria 73831
986 nmdc:mga05p37_554256_c1 3300050507 Bacteria 1308
987 nmdc:mga05p37_59208_c1 3300050507 Bacteria 4717
988 nmdc:mga05p37_62626_c1 3300050507 Bacteria 4578
989 nmdc:mga05p37_69250_c1 3300050507 Bacteria 4340
990 nmdc:mga05p37_979152_c1 3300050507 Bacteria 901
991 nmdc:mga09592_1053806_c1 3300050508 Bacteria 678
992 nmdc:mga09592_1101508_c1 3300050508 Bacteria 660
993 nmdc:mga09592_1258644_c1 3300050508 Unclassified 610
994 nmdc:mga09592_1521423_c1 3300050508 Bacteria 544
995 nmdc:mga09592_1709847_c1 3300050508 Unclassified 507
996 nmdc:mga09592_27877_c1 3300050508 Bacteria 4688
997 nmdc:mga09592_475652_c1 3300050508 Bacteria 1077
998 nmdc:mga09592_553605_c1 3300050508 Bacteria 988
999 nmdc:mga09592_624290_c1 3300050508 Bacteria 922
1000 nmdc:mga09592_686212_c1 3300050508 Bacteria 872
1001 nmdc:mga09592_848199_c1 3300050508 Bacteria 771
1002 nmdc:mga0qj67_146515_c1 3300050509 Bacteria 1914
1003 nmdc:mga0qj67_23200_c1 3300050509 Unclassified 4771
1004 nmdc:mga0qj67_325561_c1 3300050509 Bacteria 1244
1005 nmdc:mga0qj67_398643_c1 3300050509 Bacteria 1110
1006 nmdc:mga0qj67_496222_c1 3300050509 Bacteria 982
1007 nmdc:mga0qj67_563773_c1 3300050509 Bacteria 913
1008 nmdc:mga0qj67_566669_c1 3300050509 Bacteria 910
1009 nmdc:mga0qj67_61432_c1 3300050509 Bacteria 2983
1010 nmdc:mga0qj67_915933_c1 3300050509 Bacteria 690
1011 nmdc:mga06r32_128077_c1 3300050510 Bacteria 2509
1012 nmdc:mga06r32_672116_c1 3300050510 Unclassified 1003
1013 nmdc:mga06r32_71740_c1 3300050510 Bacteria 3352
1014 nmdc:mga08y16_1015049_c1 3300050511 Bacteria 809
1015 nmdc:mga08y16_1141985_c1 3300050511 Bacteria 752
1016 nmdc:mga08y16_1172445_c1 3300050511 Unclassified 740
1017 nmdc:mga08y16_1409804_c1 3300050511 Bacteria 660
1018 nmdc:mga08y16_1947641_c1 3300050511 Bacteria 538
1019 nmdc:mga08y16_19906_c1 3300050511 Bacteria 7079
1020 nmdc:mga08y16_19984_c1 3300050511 Bacteria 7066
1021 nmdc:mga08y16_244307_c1 3300050511 Bacteria 1855
1022 nmdc:mga08y16_2979_c1 3300050511 Bacteria 17456
1023 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
1024 nmdc:mga08y16_46458_c1 3300050511 Bacteria 4546
1025 nmdc:mga08y16_53015_c1 3300050511 Bacteria 4242
1026 nmdc:mga08y16_53496_c1 3300050511 Bacteria 4222
1027 nmdc:mga08y16_634696_c1 3300050511 Bacteria 1074
1028 nmdc:mga08y16_67967_c1 3300050511 Bacteria 3717
1029 nmdc:mga08y16_87982_c1 3300050511 Bacteria 3237
1030 nmdc:mga0n895_1424093_c1 3300050512 Bacteria 661
1031 nmdc:mga0n895_1576179_c1 3300050512 Unclassified 622
1032 nmdc:mga0n895_2047167_c1 3300050512 Bacteria 530
1033 nmdc:mga0n895_220970_c1 3300050512 Bacteria 1923
1034 nmdc:mga0n895_281_c1 3300050512 Bacteria 33522
1035 nmdc:mga0n895_285856_c1 3300050512 Unclassified 1672
1036 nmdc:mga0n895_31613_c1 3300050512 Bacteria 5071
1037 nmdc:mga0n895_35411_c1 3300050512 Bacteria 4813
1038 nmdc:mga0n895_627410_c1 3300050512 Bacteria 1075
1039 nmdc:mga0n895_73517_c1 3300050512 Bacteria 3394
1040 nmdc:mga0rr50_12769_c1 3300050513 Bacteria 5443
1041 nmdc:mga0rr50_597653_c1 3300050513 Bacteria 941
1042 nmdc:mga0rr50_99442_c1 3300050513 Bacteria 2282
1043 nmdc:mga08x19_1442_c1 3300050514 Bacteria 14702
1044 nmdc:mga08x19_15948_c1 3300050514 Bacteria 4578
1045 nmdc:mga0a205_1430760_c1 3300050515 Bacteria 539
1046 nmdc:mga0a205_205039_c1 3300050515 Bacteria 1861
1047 nmdc:mga0a205_249539_c1 3300050515 Bacteria 1655
1048 nmdc:mga0a205_34105_c1 3300050515 Bacteria 4883
1049 nmdc:mga0a205_469_c1 3300050515 Bacteria 31359
1050 nmdc:mga0a205_495605_c1 3300050515 Bacteria 1079
1051 nmdc:mga0a205_509325_c1 3300050515 Bacteria 1060
1052 nmdc:mga0a205_516667_c1 3300050515 Bacteria 1051
1053 nmdc:mga0a205_56533_c1 3300050515 Bacteria 3788
1054 nmdc:mga0a205_964118_c1 3300050515 Bacteria 700
1055 nmdc:mga0sz30_200081_c1 3300050516 Unclassified 887
1056 Ga0495619_0465123 3300053085 Bacteria 871
1057 Ga0501084_0028026 3300054114 Bacteria 4706
1058 Ga0501084_0087693 3300054114 Bacteria 2613
1059 Ga0501084_0221203 3300054114 Bacteria 1598
1060 Ga0501084_0516083 3300054114 Bacteria 1010
1061 Ga0501084_0617930 3300054114 Bacteria 915
1062 Ga0501084_1046619 3300054114 Bacteria 685
1063 Ga0501084_1642936 3300054114 Bacteria 537
1064 Ga0590071_056342 3300059421 Bacteria 956
1065 Ga0590074_115496 3300059423 Bacteria 532
1066 Ga0590077_000518 3300059426 Bacteria 10686
1067 Ga0590077_030411 3300059426 Bacteria 1177
1068 Ga0501082_0037262 3300060353 Bacteria 4191
1069 Ga0501082_0164047 3300060353 Bacteria 1931
1070 Ga0501082_0198840 3300060353 Bacteria 1744
1071 Ga0501082_0258610 3300060353 Bacteria 1514
1072 Ga0501082_0340092 3300060353 Bacteria 1308
1073 Ga0501082_0342075 3300060353 Bacteria 1304
1074 Ga0501082_0449738 3300060353 Bacteria 1125
1075 Ga0501082_0558647 3300060353 Bacteria 1001
1076 Ga0501082_1486509 3300060353 Bacteria 592
1077 Ga0501082_1712595 3300060353 Bacteria 548
1078 Ga0501082_1850452 3300060353 Bacteria 526
1079 Ga0530510_0011089 3300061734 Bacteria 6323
1080 Ga0530510_0247570 3300061734 Bacteria 1328
1081 Ga0530510_0332525 3300061734 Bacteria 1140
1082 Ga0530510_0439828 3300061734 Bacteria 985
1083 Ga0530510_0564265 3300061734 Bacteria 865
1084 Ga0530510_0942225 3300061734 Bacteria 660
1085 Ga0530510_0987283 3300061734 Unclassified 644
1086 Ga0068859_100410868
1087 JGI25406J46586_10083124
1088 JGI25406J46586_10092444
1089 JGI25406J46586_10213409
1090 Ga0065714_10106583
1091 Ga0065712_10025310
1092 Ga0065712_10153694
1093 Ga0065715_10138994
1094 Ga0065715_10149341
1095 Ga0065707_10086703
1096 Ga0065707_10149428
1097 Ga0065707_10170689
1098 Ga0065707_10591340
1099 Ga0065707_10707279
1100 Ga0065707_11046822
1101 Ga0065707_11122576
1102 Ga0065707_11136378
1103 Ga0070676_10028956
1104 Ga0070683_100007552
1105 Ga0070690_100027789
1106 Ga0070690_100149010
1107 Ga0070690_100170683
1108 Ga0070690_100257315
1109 Ga0070670_100004413
1110 Ga0070670_100007462
1111 Ga0070670_100464699
1112 Ga0070677_10762496
1113 Ga0068869_100058451
1114 Ga0068869_100084729
1115 Ga0068869_100823931
1116 Ga0070666_10045960
1117 Ga0070666_10063575
1118 Ga0070666_10859068
1119 Ga0070666_10908227
1120 Ga0070680_100111780
1121 Ga0070680_100415668
1122 Ga0070680_100778601
1123 Ga0070680_101163650
1124 Ga0070682_100493593
1125 Ga0070682_101400767
1126 Ga0070682_101904942
1127 Ga0068868_100315931
1128 Ga0068868_100389144
1129 Ga0070660_101496559
1130 Ga0070689_100030548
1131 Ga0070689_100176159
1132 Ga0070689_100256727
1133 Ga0070689_100275519
1134 Ga0070689_100725728
1135 Ga0070689_102143232
1136 Ga0070691_10017904
1137 Ga0070691_10182267
1138 Ga0070687_100008463
1139 Ga0070687_100023052
1140 Ga0070687_100051971
1141 Ga0070661_100012520
1142 Ga0070661_100098211
1143 Ga0070692_10028201
1144 Ga0070692_10314983
1145 Ga0070668_100269987
1146 Ga0070668_100636083
1147 Ga0070668_100763258
1148 Ga0070668_101644322
1149 Ga0070669_100051895
1150 Ga0070669_100102174
1151 Ga0070669_100155395
1152 Ga0070669_100156483
1153 Ga0070669_100336184
1154 Ga0070669_100350581
1155 Ga0070669_100960175
1156 Ga0070669_101158658
1157 Ga0070675_100016827
1158 Ga0070675_100179773
1159 Ga0070675_100197845
1160 Ga0070675_100253317
1161 Ga0070675_100597189
1162 Ga0070675_100702999
1163 Ga0070675_102161713
1164 Ga0070671_100037051
1165 Ga0070671_100409430
1166 Ga0070671_101165111
1167 Ga0070674_100168717
1168 Ga0070674_100724991
1169 Ga0070674_101939626
1170 Ga0070673_100011151
1171 Ga0070673_100016210
1172 Ga0070673_100409025
1173 Ga0070688_100025746
1174 Ga0070688_100095705
1175 Ga0070688_100112936
1176 Ga0070688_100217497
1177 Ga0070688_100428286
1178 Ga0070688_100526803
1179 Ga0070688_100631478
1180 Ga0070688_100854438
1181 Ga0070688_101624904
1182 Ga0070659_100100205
1183 Ga0070659_100976545
1184 Ga0070667_100102344
1185 Ga0070667_100105118
1186 Ga0070667_100166117
1187 Ga0070667_100579633
1188 Ga0070667_102254858
1189 Ga0070709_10429129
1190 Ga0070714_100012428
1191 Ga0070713_100371955
1192 Ga0070701_10019829
1193 Ga0070701_10043041
1194 Ga0070701_10325118
1195 Ga0070701_10332515
1196 Ga0070701_10890246
1197 Ga0070701_11346115
1198 Ga0070705_100010925
1199 Ga0070705_100077195
1200 Ga0070705_100383867
1201 Ga0070700_100044430
1202 Ga0070700_100067920
1203 Ga0070700_100111792
1204 Ga0070700_100229740
1205 Ga0070700_100288007
1206 Ga0070700_101225102
1207 Ga0070700_101391223
1208 Ga0070700_101766357
1209 Ga0070694_100002811
1210 Ga0070694_100006907
1211 Ga0070694_100097721
1212 Ga0070694_100420609
1213 Ga0070694_100673681
1214 Ga0070694_100952934
1215 Ga0070663_100219852
1216 Ga0070678_100505484
1217 Ga0070678_100676007
1218 Ga0070662_101702549
1219 Ga0070681_10570750
1220 Ga0068867_100087743
1221 Ga0068867_100203840
1222 Ga0068867_100256849
1223 Ga0068867_100286403
1224 Ga0068867_100470492
1225 Ga0068867_100648207
1226 Ga0070685_10038256
1227 Ga0070685_10263185
1228 Ga0070685_10267026
1229 Ga0070685_11021502
1230 Ga0070685_11391578
1231 Ga0070706_100059841
1232 Ga0070706_101859534
1233 Ga0070707_100328591
1234 Ga0070707_100550545
1235 Ga0070707_100964469
1236 Ga0070707_101543588
1237 Ga0070698_100001914
1238 Ga0070698_100008781
1239 Ga0070698_100367484
1240 Ga0070698_100734923
1241 Ga0070698_101784181
1242 Ga0070699_100005726
1243 Ga0070699_100005918
1244 Ga0070699_100021870
1245 Ga0070699_100927027
1246 Ga0070679_100677308
1247 Ga0070684_100005231
1248 Ga0070684_100245419
1249 Ga0070684_100578208
1250 Ga0070697_100597651
1251 Ga0070697_100864185
1252 Ga0068853_101811238
1253 Ga0070672_100041632
1254 Ga0070672_100471306
1255 Ga0070672_101492071
1256 Ga0070672_101977229
1257 Ga0070686_100031148
1258 Ga0070686_100190371
1259 Ga0070686_100611433
1260 Ga0070686_101393912
1261 Ga0070695_100110617
1262 Ga0070695_100496908
1263 Ga0070695_100980094
1264 Ga0070695_100998378
1265 Ga0070696_100005487
1266 Ga0070696_100050068
1267 Ga0070693_100185296
1268 Ga0070693_100469191
1269 Ga0070693_100699894
1270 Ga0070665_100033864
1271 Ga0070665_101164879
1272 Ga0070704_100031294
1273 Ga0070704_100057843
1274 Ga0070704_100464129
1275 Ga0070704_100466830
1276 Ga0070704_100736766
1277 Ga0070704_100739832
1278 Ga0070704_100985458
1279 Ga0070704_101122451
1280 Ga0070664_100001608
1281 Ga0070664_100026140
1282 Ga0070664_100095017
1283 Ga0070664_100257859
1284 Ga0068857_100021160
1285 Ga0068857_100417081
1286 Ga0068854_100015949
1287 Ga0070702_100111378
1288 Ga0070702_100152589
1289 Ga0070702_100677648
1290 Ga0068852_101063555
1291 Ga0068859_100027743
1292 Ga0068859_100197425
1293 Ga0068859_100244855
1294 Ga0068859_100379594
1295 Ga0068859_100505474
1296 Ga0068859_102508717
1297 Ga0068859_102628729
1298 Ga0068864_100016044
1299 Ga0068864_100593820
1300 Ga0068864_101179039
1301 Ga0068864_102118915
1302 Ga0068866_10108018
1303 Ga0068866_11236171
1304 Ga0068861_100030884
1305 Ga0068861_100137258
1306 Ga0068861_100429375
1307 Ga0068861_101097131
1308 Ga0068851_10041209
1309 Ga0068870_10154775
1310 Ga0068870_10458441
1311 Ga0068863_100429611
1312 Ga0068863_101602832
1313 Ga0068858_100014560
1314 Ga0068858_100119501
1315 Ga0068858_100221343
1316 Ga0068858_100298054
1317 Ga0068858_100405010
1318 Ga0068858_100700445
1319 Ga0068858_100991570
1320 Ga0068858_101841938
1321 Ga0068860_100288994
1322 Ga0068860_100382474
1323 Ga0068860_100430620
1324 Ga0068860_101142187
1325 Ga0068860_102243004
1326 Ga0068862_100023246
1327 Ga0068862_100479185
1328 Ga0068862_100577193
1329 Ga0068862_100772970
1330 Ga0068862_100842579
1331 Ga0068862_100966043
1332 Ga0068862_101822497
1333 Ga0068862_102209706
1334 Ga0081539_10001702
1335 Ga0081539_10038590
1336 Ga0081539_10040663
1337 Ga0081539_10075209
1338 Ga0070717_11791795
1339 Ga0075365_10022822
1340 Ga0075368_10107148
1341 Ga0075363_100266427
1342 Ga0075364_10021212
1343 Ga0075364_10087665
1344 Ga0075364_10288778
1345 Ga0075432_10210689
1346 Ga0075432_10474815
1347 Ga0070716_101529411
1348 Ga0070712_100295073
1349 Ga0075362_10006980
1350 Ga0075367_10055938
1351 Ga0075369_10335085
1352 Ga0075366_10009667
1353 Ga0097621_100073548
1354 Ga0097621_100183506
1355 Ga0097621_102434840
1356 Ga0075370_10033251
1357 Ga0068871_100064962
1358 Ga0068871_100297997
1359 Ga0068871_100402308
1360 Ga0068871_100927422
1361 Ga0068871_100996510
1362 Ga0068871_101599655
1363 Ga0068871_101686193
1364 Ga0075428_100010724
1365 Ga0075428_100071091
1366 Ga0075428_100132288
1367 Ga0075428_100336039
1368 Ga0075428_100941311
1369 Ga0075428_101148545
1370 Ga0075428_102631023
1371 Ga0075430_100017805
1372 Ga0075430_100019061
1373 Ga0075430_100061518
1374 Ga0075430_100202398
1375 Ga0075430_100382920
1376 Ga0075430_100708444
1377 Ga0075430_100866753
1378 Ga0075430_101112134
1379 Ga0075430_101263071
1380 Ga0075431_100595588
1381 Ga0075431_101231372
1382 Ga0075431_101264756
1383 Ga0075431_101418004
1384 Ga0075433_10026046
1385 Ga0075433_10028333
1386 Ga0075433_10104570
1387 Ga0075433_10500118
1388 Ga0075433_10895592
1389 Ga0075434_100002784
1390 Ga0075434_100027981
1391 Ga0075434_100031212
1392 Ga0075434_100116835
1393 Ga0075434_100295964
1394 Ga0075434_100419277
1395 Ga0075434_100848793
1396 Ga0075434_101276311
1397 Ga0075429_100031024
1398 Ga0075429_100031059
1399 Ga0075429_100131023
1400 Ga0075429_100131370
1401 Ga0075429_100152347
1402 Ga0075429_100235486
1403 Ga0075429_100310362
1404 Ga0075429_100633518
1405 Ga0075429_101413257
1406 Ga0068865_100121111
1407 Ga0068865_100187815
1408 Ga0068865_100415698
1409 Ga0068865_101291166
1410 Ga0075436_100015139
1411 Ga0075436_100090650
1412 Ga0097620_100027741
1413 Ga0097620_100197407
1414 Ga0097620_100244853
1415 Ga0097620_100379593
1416 Ga0097620_100410879
1417 Ga0097620_100505469
1418 Ga0097620_101849231
1419 Ga0097620_102508684
1420 Ga0097620_102628332
1421 Ga0075435_100102968
1422 Ga0075435_101178059
1423 Ga0105250_10262023
1424 Ga0105240_10635565
1425 Ga0111539_10000002
1426 Ga0111539_10000494
1427 Ga0111539_10000981
1428 Ga0111539_10004818
1429 Ga0111539_10009303
1430 Ga0111539_10014610
1431 Ga0111539_10031561
1432 Ga0111539_10031711
1433 Ga0111539_10088335
1434 Ga0111539_10211131
1435 Ga0111539_10375909
1436 Ga0111539_10718218
1437 Ga0111539_10729901
1438 Ga0111539_11166340
1439 Ga0111539_11225417
1440 Ga0111539_11775921
1441 Ga0111539_12396531
1442 Ga0111539_12407837
1443 Ga0111539_12423775
1444 Ga0111539_13278058
1445 Ga0105245_10362090
1446 Ga0105245_11009328
1447 Ga0105245_11092064
1448 Ga0105247_10766862
1449 Ga0114129_10000410
1450 Ga0114129_10010375
1451 Ga0114129_10021226
1452 Ga0114129_10103495
1453 Ga0114129_10131662
1454 Ga0114129_10448604
1455 Ga0114129_10491555
1456 Ga0114129_10491991
1457 Ga0114129_11290882
1458 Ga0114129_11439070
1459 Ga0114129_11785621
1460 Ga0114129_12031475
1461 Ga0114129_12975644
1462 Ga0105243_10214883
1463 Ga0105243_10499044
1464 Ga0105243_10540476
1465 Ga0105243_11355771
1466 Ga0105243_12573886
1467 Ga0105241_10227160
1468 Ga0105241_11718821
1469 Ga0105242_10027112
1470 Ga0105242_10148153
1471 Ga0105242_10704730
1472 Ga0105242_11123983
1473 Ga0105242_11429965
1474 Ga0105242_12066370
1475 Ga0105242_12556086
1476 Ga0105242_12829305
1477 Ga0105248_10056208
1478 Ga0105248_10078834
1479 Ga0105248_10185719
1480 Ga0105248_10200924
1481 Ga0105248_10268822
1482 Ga0105248_10588409
1483 Ga0105248_10639528
1484 Ga0105237_10789770
1485 Ga0105249_10193204
1486 Ga0105249_10288108
1487 Ga0105249_10334000
1488 Ga0105249_10536530
1489 Ga0105249_11500721
1490 Ga0105249_12119870
1491 Ga0105249_12177084
1492 Ga0105249_13359684
1493 Ga0105239_13254207
1494 Ga0105246_10072654
1495 Ga0105246_10655482
1496 Ga0105246_11465365
1497 Ga0157370_10473771
1498 Ga0157370_11605225
1499 Ga0157374_10091418
1500 Ga0157374_10392762
1501 Ga0157378_10493590
1502 Ga0157378_10701691
1503 Ga0157378_10705802
1504 Ga0157378_10816167
1505 Ga0157378_11217201
1506 Ga0157378_11424839
1507 Ga0163162_10081557
1508 Ga0163162_10916219
1509 Ga0163162_12960292
1510 Ga0157375_10122515
1511 Ga0157375_10748925
1512 Ga0157375_10922867
1513 Ga0157375_12004728
1514 Ga0163163_10000663
1515 Ga0163163_10051186
1516 Ga0163163_10051300
1517 Ga0163163_12535584
1518 Ga0157380_10019060
1519 Ga0157380_10147873
1520 Ga0157380_10159384
1521 Ga0157380_10244769
1522 Ga0157380_10377514
1523 Ga0157380_11045784
1524 Ga0157380_11440155
1525 Ga0157380_11467623
1526 Ga0157380_11483884
1527 Ga0157380_13327703
1528 Ga0157377_10168058
1529 Ga0157377_10182204
1530 Ga0157377_10409306
1531 Ga0157379_10018789
1532 Ga0157379_10362481
1533 Ga0157379_10739262
1534 Ga0157379_10961823
1535 Ga0157379_11628553
1536 Ga0157376_10102217
1537 Ga0157376_10932279
1538 Ga0157376_10947980
1539 Ga0157376_11326572
1540 Ga0157376_12532350
1541 Ga0163161_10344775
1542 Ga0163161_10598561
1543 Ga0207697_10028355
1544 Ga0207697_10104649
1545 Ga0207656_10114764
1546 Ga0207682_10141899
1547 Ga0207642_10361294
1548 Ga0207642_10390764
1549 Ga0207642_10564474
1550 Ga0207710_10728913
1551 Ga0207688_10411373
1552 Ga0207688_10641101
1553 Ga0207680_10012973
1554 Ga0207680_10175344
1555 Ga0207680_10802893
1556 Ga0207680_11198531
1557 Ga0207647_10353135
1558 Ga0207699_10369831
1559 Ga0207645_10006858
1560 Ga0207645_10092758
1561 Ga0207645_10139529
1562 Ga0207643_10160496
1563 Ga0207643_10468671
1564 Ga0207684_10050119
1565 Ga0207707_10755878
1566 Ga0207693_10404735
1567 Ga0207660_10126900
1568 Ga0207660_10489262
1569 Ga0207662_10000724
1570 Ga0207662_10036889
1571 Ga0207662_10079506
1572 Ga0207662_10213307
1573 Ga0207649_10014442
1574 Ga0207649_10074085
1575 Ga0207652_10753920
1576 Ga0207646_10119235
1577 Ga0207646_10452790
1578 Ga0207646_10683837
1579 Ga0207646_11431012
1580 Ga0207681_10108834
1581 Ga0207681_10170620
1582 Ga0207681_10242915
1583 Ga0207681_10849591
1584 Ga0207681_11180808
1585 Ga0207650_10005949
1586 Ga0207650_10212934
1587 Ga0207650_10862600
1588 Ga0207659_10070657
1589 Ga0207659_10218667
1590 Ga0207659_10245933
1591 Ga0207659_10860743
1592 Ga0207659_11157736
1593 Ga0207687_10424821
1594 Ga0207687_10455804
1595 Ga0207687_10735457
1596 Ga0207700_10407357
1597 Ga0207664_10019126
1598 Ga0207644_10025621
1599 Ga0207644_11804282
1600 Ga0207690_10090510
1601 Ga0207706_10255567
1602 Ga0207706_11009822
1603 Ga0207686_10586134
1604 Ga0207686_10829244
1605 Ga0207709_10218683
1606 Ga0207709_11603613
1607 Ga0207670_10009947
1608 Ga0207670_10055982
1609 Ga0207670_10154626
1610 Ga0207670_10213452
1611 Ga0207670_10856524
1612 Ga0207670_10882285
1613 Ga0207670_11124515
1614 Ga0207669_10163951
1615 Ga0207669_10513240
1616 Ga0207669_10577353
1617 Ga0207669_10949103
1618 Ga0207704_10293654
1619 Ga0207665_10708488
1620 Ga0207691_10035117
1621 Ga0207691_10589775
1622 Ga0207711_10052374
1623 Ga0207711_10059255
1624 Ga0207711_10231968
1625 Ga0207711_10449608
1626 Ga0207711_11147549
1627 Ga0207711_11383338
1628 Ga0207689_10006797
1629 Ga0207689_10089587
1630 Ga0207689_10155386
1631 Ga0207689_10276070
1632 Ga0207661_10003359
1633 Ga0207679_10003327
1634 Ga0207679_10099569
1635 Ga0207679_10743898
1636 Ga0207679_10775176
1637 Ga0207651_10063293
1638 Ga0207651_10113967
1639 Ga0207651_10146104
1640 Ga0207651_10284456
1641 Ga0207712_10684787
1642 Ga0207712_11565837
1643 Ga0207712_11928752
1644 Ga0207668_10241305
1645 Ga0207668_10388884
1646 Ga0207668_10566262
1647 Ga0207640_10136137
1648 Ga0207640_10425090
1649 Ga0207658_10177662
1650 Ga0207658_10219745
1651 Ga0207658_10233156
1652 Ga0207658_10471730
1653 Ga0207658_10571006
1654 Ga0207677_11892456
1655 Ga0207677_11922384
1656 Ga0207703_10028166
1657 Ga0207703_10277807
1658 Ga0207703_10481808
1659 Ga0207703_11466846
1660 Ga0207639_10948082
1661 Ga0207678_10003414
1662 Ga0207678_10036078
1663 Ga0207678_11021343
1664 Ga0207678_11704107
1665 Ga0207708_10008073
1666 Ga0207708_10035538
1667 Ga0207708_10050949
1668 Ga0207708_10097773
1669 Ga0207708_10383685
1670 Ga0207708_11271275
1671 Ga0207641_10190676
1672 Ga0207641_10491030
1673 Ga0207641_10689032
1674 Ga0207641_10753911
1675 Ga0207648_10034858
1676 Ga0207648_10049704
1677 Ga0207648_10138059
1678 Ga0207648_10484744
1679 Ga0207648_10878959
1680 Ga0207676_10057882
1681 Ga0207676_10232121
1682 Ga0207676_10764784
1683 Ga0207674_10029870
1684 Ga0207674_10284441
1685 Ga0207674_10509282
1686 Ga0207674_10775663
1687 Ga0207674_11322739
1688 Ga0207675_100056601
1689 Ga0207675_100125191
1690 Ga0207675_100152156
1691 Ga0207675_100224347
1692 Ga0207675_100252953
1693 Ga0207675_100278724
1694 Ga0207675_100927920
1695 Ga0207675_100972704
1696 Ga0207675_101036903
1697 Ga0207675_102309182
1698 Ga0207683_11075672
1699 Ga0207683_11153016
1700 Ga0209969_1023274
1701 Ga0209967_1062605
1702 Ga0209974_10469283
1703 Ga0207428_10000004
1704 Ga0207428_10000066
1705 Ga0207428_10001093
1706 Ga0207428_10005537
1707 Ga0207428_10055858
1708 Ga0207428_10066960
1709 Ga0207428_10071304
1710 Ga0207428_10092199
1711 Ga0207428_10384192
1712 Ga0207428_11004282
1713 Ga0268266_10212024
1714 Ga0268266_11470027
1715 Ga0268265_11107770
1716 Ga0268265_11319233
1717 Ga0268265_11349863
1718 Ga0268265_12339696
1719 Ga0268264_10115035
1720 Ga0268264_10192729
1721 Ga0268264_10527165
1722 Ga0268264_10594671
1723 Ga0268264_11086496
1724 Ga0268264_11789745
1725 Ga0268264_12631312
1726 Ga0307408_100023632
1727 Ga0307408_100261771
1728 Ga0307408_100402624
1729 Ga0307405_10006893
1730 Ga0307405_10221650
1731 Ga0307413_10239745
1732 Ga0307413_10331048
1733 Ga0307413_10364976
1734 Ga0307413_10382255
1735 Ga0307413_10417206
1736 Ga0307413_10519559
1737 Ga0307413_10626788
1738 Ga0307410_10002658
1739 Ga0307410_10042686
1740 Ga0307410_10147912
1741 Ga0307410_10508726
1742 Ga0307410_10782691
1743 Ga0307406_10030254
1744 Ga0307406_10098326
1745 Ga0307406_10736648
1746 Ga0307407_10033690
1747 Ga0307407_10051437
1748 Ga0307407_10090709
1749 Ga0307407_10331626
1750 Ga0307407_10411242
1751 Ga0307412_10002780
1752 Ga0307412_10281513
1753 Ga0307412_10367850
1754 Ga0307412_10941510
1755 Ga0307412_11208239
1756 Ga0307409_100026062
1757 Ga0307409_100027404
1758 Ga0307409_100061598
1759 Ga0307409_100067913
1760 Ga0307409_100110777
1761 Ga0307409_100188142
1762 Ga0307416_100064487
1763 Ga0307416_100084872
1764 Ga0307416_100163096
1765 Ga0307416_100374872
1766 Ga0307416_100634802
1767 Ga0307416_100812870
1768 Ga0307416_102169404
1769 Ga0307414_10188975
1770 Ga0307414_10235540
1771 Ga0307414_10371664
1772 Ga0307414_10400370
1773 Ga0307414_11165783
1774 Ga0307411_10111433
1775 Ga0307411_10219441
1776 Ga0307411_10267673
1777 Ga0307411_10301332
1778 Ga0307411_10329942
1779 Ga0307411_10469000
1780 Ga0307411_10469203
1781 Ga0307411_11645149
1782 Ga0307415_100043485
1783 Ga0307415_100179480
1784 Ga0307415_100347555
1785 Ga0307415_100829886
1786 Ga0307415_101304893
1787 Ga0373938_0188269
1788 Ga0373936_0400656
1789 Ga0373936_0611281
1790 Ga0373954_0047240
1791 Ga0373957_0007399
1792 Ga0373960_0190300
1793 Ga0373955_0012700
1794 Ga0373955_0499374
1795 Ga0373955_0865220
1796 Ga0373961_0445509
1797 Ga0373933_0003937
1798 Ga0373937_0002473
1799 Ga0373937_0185689
1800 Ga0373937_1732953
1801 Ga0395898_1768798
1802 Ga0436362_0045085
1803 Ga0439453_0185251
1804 Ga0451795_0189527
1805 Ga0451800_0575700
1806 Ga0451807_0021731
1807 Ga0451807_0526429
1808 Ga0451807_0793962
1809 Ga0451839_0563425
1810 Ga0451849_1226666
1811 Ga0451853_2084722
1812 Ga0451853_2545316
1813 Ga0451853_3669051
1814 Ga0451853_3745927
1815 Ga0439433_0083770
1816 Ga0439443_055794
1817 Ga0439454_099419
1818 Ga0439456_161775
1819 Ga0450923_018237
1820 Ga0450923_021563
1821 Ga0450923_040523
1822 Ga0450890_041317
1823 Ga0450897_038392
1824 Ga0450892_010298
1825 Ga0450894_003529
1826 Ga0450895_024623
1827 Ga0450896_024701
1828 Ga0450899_021474
1829 Ga0450906_021096
1830 Ga0450909_009430
1831 Ga0439434_0245718
1832 Ga0439435_0072151
1833 Ga0439464_0033332
1834 Ga0439460_0181914
1835 Ga0450916_008974
1836 Ga0450916_096513
1837 Ga0450918_034014
1838 Ga0450893_0098999
1839 Ga0451577_0132777
1840 Ga0453683_0623424
1841 Ga0453683_0726699
1842 Ga0453684_0107756
1843 Ga0466960_0876213
1844 Ga0451576_0023050
1845 Ga0451576_2085483
1846 Ga0451576_2247038
1847 Ga0466967_0877877
1848 Ga0466967_1607584
1849 Ga0495592_0475807
1850 Ga0495603_0209070
1851 Ga0495651_0076455
1852 Ga0495653_0708482
1853 Ga0495582_0361365
1854 Ga0495664_0707613
1855 Ga0495584_0031669
1856 Ga0495594_0669086
1857 Ga0495628_0940909
1858 Ga0495630_0715786
1859 Ga0495637_0207938
1860 Ga0495643_0001941
1861 Ga0495663_0134012
1862 Ga0495587_0098139
1863 Ga0495598_0009390
1864 Ga0495598_0015886
1865 Ga0495598_0134260
1866 Ga0495609_0079851
1867 Ga0495621_0094454
1868 Ga0495621_0167157
1869 Ga0495597_0351223
1870 Ga0495633_0193656
1871 Ga0495656_0107445
1872 Ga0495659_0102391
1873 Ga0495647_0003465
1874 Ga0495647_0275437
1875 Ga0495647_0324119
1876 Ga0495669_0114625
1877 Ga0495669_0338223
1878 Ga0495649_0409512
1879 Ga0495604_0347158
1880 Ga0495672_0320193
1881 Ga0495680_0380536
1882 Ga0495675_0755088
1883 Ga0495685_080951
1884 Ga0495614_0230281
1885 Ga0495615_0145672
1886 Ga0496101_0614809
1887 Ga0496104_0003082
1888 Ga0496104_1271719
1889 Ga0496105_0019761
1890 Ga0496105_0343643
1891 Ga0496106_0249197
1892 Ga0496106_0500743
1893 Ga0496107_0318703
1894 Ga0496108_0003036
1895 Ga0496108_1012114
1896 Ga0496109_0004537
1897 Ga0496109_0818684
1898 Ga0496110_0004868
1899 Ga0496110_0215709
1900 Ga0496110_0891015
1901 Ga0496111_0005731
1902 Ga0496111_0127638
1903 Ga0496112_0001468
1904 Ga0496113_0167493
1905 Ga0496113_0994574
1906 Ga0496114_0053394
1907 Ga0496114_0171724
1908 Ga0496114_1337213
1909 Ga0501300_021039
1910 Ga0501311_082027
1911 Ga0501031_0046471
1912 Ga0501031_0511735
1913 Ga0501032_0520296
1914 Ga0501033_0037295
1915 Ga0501034_0115513
1916 Ga0501034_0705034
1917 Ga0501036_0104742
1918 Ga0501036_0273501
1919 Ga0501036_0521110
1920 Ga0501036_0591953
1921 Ga0501036_0652360
1922 Ga0501036_0865534
1923 Ga0501036_1015335
1924 Ga0501037_0098874
1925 Ga0501037_0557127
1926 Ga0501037_0728156
1927 Ga0501038_0135132
1928 Ga0501038_0399459
1929 Ga0501038_0589329
1930 Ga0501038_0834415
1931 Ga0501039_0089734
1932 Ga0501039_0258539
1933 Ga0501039_0368660
1934 Ga0501039_0497179
1935 Ga0501039_0504529
1936 Ga0501040_0068905
1937 Ga0501040_0286680
1938 Ga0501040_0511750
1939 Ga0501040_1230390
1940 Ga0501041_0144688
1941 Ga0501041_0235132
1942 Ga0501041_0427339
1943 Ga0501041_0530679
1944 Ga0501042_0075928
1945 Ga0501042_0085131
1946 Ga0501042_0210948
1947 Ga0501042_0233859
1948 Ga0501042_0874338
1949 Ga0501042_1258217
1950 Ga0501042_1373781
1951 Ga0501043_0106136
1952 Ga0501046_0015798
1953 Ga0501046_0046528
1954 Ga0501046_0285268
1955 Ga0501046_0536254
1956 Ga0501046_0610915
1957 Ga0501046_1168724
1958 Ga0501047_0006623
1959 Ga0501047_0071383
1960 Ga0501047_0988841
1961 Ga0501048_0200008
1962 Ga0501067_0144682
1963 Ga0501067_0544826
1964 Ga0501067_0588831
1965 Ga0501068_0058634
1966 Ga0501068_0075221
1967 Ga0501068_0211500
1968 Ga0501069_0006243
1969 Ga0501070_0343688
1970 Ga0501070_0661706
1971 Ga0501070_1497282
1972 Ga0501071_0149591
1973 Ga0501071_0159629
1974 Ga0501071_0166359
1975 Ga0501071_0189283
1976 Ga0501071_0239367
1977 Ga0501071_0435316
1978 Ga0501071_0484897
1979 Ga0501071_0672350
1980 Ga0501071_1099832
1981 Ga0501072_0075990
1982 Ga0501072_0109368
1983 Ga0501072_0127443
1984 Ga0501072_0210167
1985 Ga0501072_0220493
1986 Ga0501072_0254797
1987 Ga0501073_0347179
1988 Ga0501073_0454940
1989 Ga0501073_0580333
1990 Ga0501073_1058910
1991 Ga0501074_0017869
1992 Ga0501074_0162295
1993 Ga0501074_0194780
1994 Ga0501074_0314169
1995 Ga0501074_0929107
1996 Ga0501075_0121589
1997 Ga0501075_0144066
1998 Ga0501075_0165360
1999 Ga0501075_0423995
2000 Ga0501075_0606554
2001 Ga0501075_1375790
2002 Ga0501075_1442648
2003 Ga0501075_1530664
2004 Ga0501076_0085979
2005 Ga0501076_0159376
2006 Ga0501076_0185119
2007 Ga0501076_0347888
2008 Ga0501076_0404539
2009 Ga0501076_0454774
2010 Ga0501076_0472907
2011 Ga0501076_0517199
2012 Ga0501076_0546117
2013 Ga0501076_0979298
2014 Ga0501076_1557296
2015 Ga0501077_0102406
2016 Ga0501077_0253061
2017 Ga0501077_0384601
2018 Ga0501077_0454925
2019 Ga0501077_0488621
2020 Ga0501077_0747206
2021 Ga0501077_0835607
2022 Ga0501211_043925
2023 Ga0501243_130230
2024 Ga0501079_0027969
2025 Ga0501079_0332455
2026 Ga0501079_0832907
2027 Ga0501080_0019050
2028 Ga0501080_0102787
2029 Ga0501080_0393028
2030 Ga0501080_1833734
2031 Ga0501081_0046801
2032 Ga0501081_0354441
2033 Ga0501081_0398270
2034 Ga0501083_0009096
2035 Ga0501083_0139058
2036 Ga0501083_0180486
2037 Ga0501083_1035306
2038 Ga0501035_0128300
2039 Ga0501035_0250609
2040 Ga0501035_0296453
2041 Ga0501035_0812271
2042 Ga0501044_0116255
2043 Ga0501044_0144191
2044 Ga0501044_0723691
2045 Ga0501045_0013621
2046 Ga0501045_0026599
2047 Ga0501045_0044615
2048 Ga0501045_0091558
2049 Ga0501045_0984409
2050 nmdc:mga03683_152060_c1
2051 nmdc:mga03n38_328724_c1
2052 nmdc:mga00v17_169127_c1
2053 nmdc:mga00v17_373533_c1
2054 nmdc:mga0yw44_16488_c1
2055 nmdc:mga0k408_11298_c1
2056 nmdc:mga0k408_601469_c1
2057 nmdc:mga0k408_842942_c1
2058 nmdc:mga06z11_128855_c1
2059 nmdc:mga06z11_640735_c1
2060 nmdc:mga04h51_80670_c1
2061 nmdc:mga07m45_99236_c1
2062 nmdc:mga05p37_1102340_c1
2063 nmdc:mga05p37_11849_c1
2064 nmdc:mga05p37_1408827_c1
2065 nmdc:mga05p37_1775674_c1
2066 nmdc:mga05p37_2244117_c1
2067 nmdc:mga05p37_288705_c1
2068 nmdc:mga05p37_359328_c1
2069 nmdc:mga05p37_39335_c1
2070 nmdc:mga05p37_54_c2
2071 nmdc:mga05p37_554256_c1
2072 nmdc:mga05p37_59208_c1
2073 nmdc:mga05p37_62626_c1
2074 nmdc:mga05p37_69250_c1
2075 nmdc:mga05p37_979152_c1
2076 nmdc:mga09592_1053806_c1
2077 nmdc:mga09592_1101508_c1
2078 nmdc:mga09592_1258644_c1
2079 nmdc:mga09592_1521423_c1
2080 nmdc:mga09592_1709847_c1
2081 nmdc:mga09592_27877_c1
2082 nmdc:mga09592_475652_c1
2083 nmdc:mga09592_553605_c1
2084 nmdc:mga09592_624290_c1
2085 nmdc:mga09592_686212_c1
2086 nmdc:mga09592_848199_c1
2087 nmdc:mga0qj67_146515_c1
2088 nmdc:mga0qj67_23200_c1
2089 nmdc:mga0qj67_325561_c1
2090 nmdc:mga0qj67_398643_c1
2091 nmdc:mga0qj67_496222_c1
2092 nmdc:mga0qj67_563773_c1
2093 nmdc:mga0qj67_566669_c1
2094 nmdc:mga0qj67_61432_c1
2095 nmdc:mga0qj67_915933_c1
2096 nmdc:mga06r32_128077_c1
2097 nmdc:mga06r32_672116_c1
2098 nmdc:mga06r32_71740_c1
2099 nmdc:mga08y16_1015049_c1
2100 nmdc:mga08y16_1141985_c1
2101 nmdc:mga08y16_1172445_c1
2102 nmdc:mga08y16_1409804_c1
2103 nmdc:mga08y16_1947641_c1
2104 nmdc:mga08y16_19906_c1
2105 nmdc:mga08y16_19984_c1
2106 nmdc:mga08y16_244307_c1
2107 nmdc:mga08y16_2979_c1
2108 nmdc:mga08y16_2_c1
2109 nmdc:mga08y16_46458_c1
2110 nmdc:mga08y16_53015_c1
2111 nmdc:mga08y16_53496_c1
2112 nmdc:mga08y16_634696_c1
2113 nmdc:mga08y16_67967_c1
2114 nmdc:mga08y16_87982_c1
2115 nmdc:mga0n895_1424093_c1
2116 nmdc:mga0n895_1576179_c1
2117 nmdc:mga0n895_2047167_c1
2118 nmdc:mga0n895_220970_c1
2119 nmdc:mga0n895_281_c1
2120 nmdc:mga0n895_285856_c1
2121 nmdc:mga0n895_31613_c1
2122 nmdc:mga0n895_35411_c1
2123 nmdc:mga0n895_627410_c1
2124 nmdc:mga0n895_73517_c1
2125 nmdc:mga0rr50_12769_c1
2126 nmdc:mga0rr50_597653_c1
2127 nmdc:mga0rr50_99442_c1
2128 nmdc:mga08x19_1442_c1
2129 nmdc:mga08x19_15948_c1
2130 nmdc:mga0a205_1430760_c1
2131 nmdc:mga0a205_205039_c1
2132 nmdc:mga0a205_249539_c1
2133 nmdc:mga0a205_34105_c1
2134 nmdc:mga0a205_469_c1
2135 nmdc:mga0a205_495605_c1
2136 nmdc:mga0a205_509325_c1
2137 nmdc:mga0a205_516667_c1
2138 nmdc:mga0a205_56533_c1
2139 nmdc:mga0a205_964118_c1
2140 nmdc:mga0sz30_200081_c1
2141 Ga0495619_0465123
2142 Ga0501084_0028026
2143 Ga0501084_0087693
2144 Ga0501084_0221203
2145 Ga0501084_0516083
2146 Ga0501084_0617930
2147 Ga0501084_1046619
2148 Ga0501084_1642936
2149 Ga0590071_056342
2150 Ga0590074_115496
2151 Ga0590077_000518
2152 Ga0590077_030411
2153 Ga0501082_0037262
2154 Ga0501082_0164047
2155 Ga0501082_0198840
2156 Ga0501082_0258610
2157 Ga0501082_0340092
2158 Ga0501082_0342075
2159 Ga0501082_0449738
2160 Ga0501082_0558647
2161 Ga0501082_1486509
2162 Ga0501082_1712595
2163 Ga0501082_1850452
2164 Ga0530510_0011089
2165 Ga0530510_0247570
2166 Ga0530510_0332525
2167 Ga0530510_0439828
2168 Ga0530510_0564265
2169 Ga0530510_0942225
2170 Ga0530510_0987283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02575

YbaB_DNA_bd

YbaB/EbfC DNA-binding family

14

105

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yrx-assembly1.cif.gz_A-2 crystal structure of a hypothetical protein rv3716c from mycobacterium tuberculosis 0.8784 16 81
1pug-assembly2.cif.gz_D structure of e. coli ybab 0.877 15 88
7bid-assembly1.cif.gz_A crystal structure of v31wrap-t, a 7-bladed designer protein 0.8769 24 51
1pug-assembly2.cif.gz_C structure of e. coli ybab 0.8587 11 88
1pug-assembly1.cif.gz_B structure of e. coli ybab 0.8546 14 84
ID Description Score Start End Superfamily
af_Q5A644_499_658_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9196 34 50 3.20.19.10
5yrxA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8784 16 81 3.30.1310.10
1pugB00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8546 14 84 3.30.1310.10
1pugA00 Alpha Beta;2-Layer Sandwich;Ybab; Chain: A;;Nucleoid-associated protein YbaB-like domain 0.8387 8 97 3.30.1310.10
af_Q4CUP9_587_746_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.8133 25 38 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A383AGM3-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.9584 3 80 GO:0003677
GO:0005829
AF-I4BAU4-F1-model_v4 Nucleoid-associated protein Turpa_3767 0.9304 2 93 GO:0003677
GO:0005829
GO:0043590
AF-A0A2N1W9T3-F1-model_v4 Nucleoid-associated protein 0.9275 8 80 GO:0003677
AF-A0A6B2DJQ5-F1-model_v4 YbaB/EbfC family nucleoid-associated protein 0.9162 2 84 GO:0003677
AF-A0A2V7WSV0-F1-model_v4 Nucleoid-associated protein DMF54_06745 0.9047 4 99 GO:0003677
GO:0005829
GO:0043590

Map