F489743

General Info

Members Datasets Scaffolds Average Seq Length
1084 345 2168 134

Family's Representative Sequence

Representative Sequence 3300027395|Ga0209996_1029159|Ga0209996_10291591
Length 160
Sequence MRTKCAVVVAGIALLVSVVGVSAHHSFSAEFDASKPFKMTGTVTKVEWMNPHTFFYIDVTDEKTGKVTNWAMEMGSPNGLMRAGWTRNTMKIGDKVAVEGSLAKDGSPTGNARSVTMASTGQRLFAASRSMHVTAKPAEPSSTASGSPTYPSPITAGRAV

Samples

Sample ID Description Type Environment
1 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
22 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
26 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
42 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
43 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
44 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
45 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
50 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
51 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
52 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
53 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
54 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
55 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
58 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
59 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
60 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
61 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
62 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
63 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
64 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
65 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
66 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
67 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
68 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
69 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
70 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
71 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
72 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
73 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
74 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
75 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
82 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
91 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
92 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
93 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
94 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
95 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
96 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
97 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
98 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
99 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
100 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
101 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
102 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
103 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
117 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
119 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
120 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
121 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
139 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
140 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
144 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
145 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
146 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
150 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
218 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
219 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
220 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
222 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
223 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
224 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
225 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
226 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
232 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
235 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
236 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
239 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
240 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
241 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
242 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
266 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
267 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
268 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
275 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
276 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
277 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
313 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
314 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
315 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
316 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
317 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
321 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
345 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.87
Metatranscriptomes 9.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.74
Rhizosphere 97.05
Stem 0
Stem Tuber 0
Unclassified 31.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209996_1029159 3300027395 Unclassified 798
2 MRS1b_contig_5777746 2162886011 Bacteria 899
3 JGI24746J21847_1056352 3300001977 Unclassified 558
4 JGI24747J21853_1029968 3300001978 Unclassified 619
5 JGI24743J22301_10066454 3300001991 Bacteria 748
6 JGI24750J21931_1028425 3300002070 Bacteria 812
7 JGI24744J21845_10102481 3300002077 Unclassified 529
8 JGI24034J26672_10033601 3300002239 Unclassified 843
9 JGI24742J22300_10044319 3300002244 Unclassified 797
10 Ga0006765J45826_119689 3300003161 Unclassified 589
11 Ga0006778J45830_1088770 3300003162 Bacteria 595
12 Ga0006759J45824_1028470 3300003163 Unclassified 697
13 Ga0006759J45824_1037243 3300003163 Unclassified 616
14 Ga0006759J45824_1039726 3300003163 Unclassified 646
15 Ga0006759J45824_1059035 3300003163 Bacteria 572
16 Ga0006759J45824_1079571 3300003163 Bacteria 559
17 JGI25406J46586_10006131 3300003203 Bacteria 5552
18 JGI25406J46586_10006252 3300003203 Bacteria 5497
19 JGI25406J46586_10011237 3300003203 Bacteria 3936
20 JGI25406J46586_10025102 3300003203 Bacteria 2320
21 JGI25406J46586_10029195 3300003203 Bacteria 2091
22 Ga0006770J48903_1037006 3300003305 Unclassified 699
23 Ga0006777J48905_1114579 3300003308 Bacteria 611
24 Ga0007417J51691_1022871 3300003544 Bacteria 614
25 Ga0007417J51691_1024922 3300003544 Unclassified 709
26 Ga0007410J51695_1018074 3300003574 Bacteria 706
27 Ga0007410J51695_1039180 3300003574 Unclassified 647
28 Ga0007409J51694_1026771 3300003575 Unclassified 644
29 Ga0007416J51690_1031709 3300003577 Unclassified 914
30 Ga0007416J51690_1038893 3300003577 Bacteria 560
31 Ga0007416J51690_1060112 3300003577 Bacteria 520
32 Ga0032354_1025555 3300003693 Unclassified 803
33 Ga0032354_1029260 3300003693 Unclassified 710
34 Ga0032354_1048698 3300003693 Bacteria 620
35 Ga0058858_1432881 3300004785 Bacteria 686
36 Ga0058859_10026949 3300004798 Unclassified 526
37 Ga0058859_10041449 3300004798 Unclassified 841
38 Ga0058859_10046910 3300004798 Bacteria 673
39 Ga0058859_10078578 3300004798 Bacteria 806
40 Ga0058859_10126710 3300004798 Bacteria 526
41 Ga0058859_10126987 3300004798 Unclassified 526
42 Ga0058859_10137091 3300004798 Unclassified 555
43 Ga0058859_11460156 3300004798 Bacteria 622
44 Ga0058859_11512003 3300004798 Unclassified 533
45 Ga0058859_11605069 3300004798 Unclassified 517
46 Ga0058859_11792330 3300004798 Unclassified 512
47 Ga0058859_11815650 3300004798 Bacteria 570
48 Ga0058863_10083060 3300004799 Unclassified 756
49 Ga0058863_11282215 3300004799 Bacteria 661
50 Ga0058863_11723477 3300004799 Unclassified 1104
51 Ga0058863_11794519 3300004799 Bacteria 842
52 Ga0058863_11840946 3300004799 Unclassified 890
53 Ga0058863_11850213 3300004799 Bacteria 509
54 Ga0058863_11923835 3300004799 Unclassified 665
55 Ga0058861_10034176 3300004800 Unclassified 533
56 Ga0058861_10136379 3300004800 Unclassified 522
57 Ga0058861_11659293 3300004800 Bacteria 816
58 Ga0058861_11815246 3300004800 Bacteria 581
59 Ga0058861_11841430 3300004800 Bacteria 507
60 Ga0058861_11860914 3300004800 Unclassified 1006
61 Ga0058861_11880184 3300004800 Unclassified 654
62 Ga0058861_11920879 3300004800 Unclassified 764
63 Ga0058861_11949659 3300004800 Unclassified 835
64 Ga0058860_10005183 3300004801 Unclassified 778
65 Ga0058860_10051366 3300004801 Bacteria 558
66 Ga0058860_10105618 3300004801 Bacteria 723
67 Ga0058860_10155442 3300004801 Bacteria 535
68 Ga0058860_11084365 3300004801 Bacteria 1229
69 Ga0058860_12004642 3300004801 Unclassified 509
70 Ga0058860_12144544 3300004801 Bacteria 822
71 Ga0058860_12183639 3300004801 Bacteria 630
72 Ga0058860_12244112 3300004801 Unclassified 552
73 Ga0058862_10193550 3300004803 Bacteria 585
74 Ga0058862_11954123 3300004803 Bacteria 720
75 Ga0058862_12483175 3300004803 Unclassified 897
76 Ga0058862_12486888 3300004803 Unclassified 598
77 Ga0058862_12647495 3300004803 Unclassified 820
78 Ga0058862_12856078 3300004803 Unclassified 736
79 Ga0058862_12876065 3300004803 Bacteria 719
80 Ga0065714_10312694 3300005288 Unclassified 679
81 Ga0065714_10415629 3300005288 Unclassified 578
82 Ga0065712_10008521 3300005290 Bacteria 2202
83 Ga0065712_10069898 3300005290 Bacteria 6546
84 Ga0065712_10309503 3300005290 Unclassified 819
85 Ga0065712_10487943 3300005290 Bacteria 629
86 Ga0065712_10796919 3300005290 Unclassified 513
87 Ga0065715_10030244 3300005293 Bacteria 1932
88 Ga0065715_10040528 3300005293 Bacteria 1573
89 Ga0065715_10625707 3300005293 Bacteria 693
90 Ga0065715_10987622 3300005293 Bacteria 534
91 Ga0065707_10273897 3300005295 Bacteria 1064
92 Ga0065707_10468479 3300005295 Bacteria 777
93 Ga0065707_10744246 3300005295 Bacteria 621
94 Ga0070658_10562710 3300005327 Bacteria 987
95 Ga0070676_10004761 3300005328 Bacteria 7174
96 Ga0070676_10015593 3300005328 Bacteria 4194
97 Ga0070676_10190864 3300005328 Bacteria 1337
98 Ga0070676_10255413 3300005328 Bacteria 1171
99 Ga0070676_10375109 3300005328 Unclassified 984
100 Ga0070676_10518990 3300005328 Bacteria 848
101 Ga0070683_100300494 3300005329 Bacteria 1527
102 Ga0070683_101247784 3300005329 Unclassified 714
103 Ga0070690_100001322 3300005330 Bacteria 12891
104 Ga0070690_100008747 3300005330 Bacteria 5844
105 Ga0070690_100050288 3300005330 Bacteria 2659
106 Ga0070690_100388152 3300005330 Unclassified 1022
107 Ga0070690_100437970 3300005330 Bacteria 967
108 Ga0070690_100616077 3300005330 Unclassified 825
109 Ga0070690_100751774 3300005330 Bacteria 753
110 Ga0070690_100880130 3300005330 Unclassified 699
111 Ga0070670_100001926 3300005331 Bacteria 16985
112 Ga0070670_100035613 3300005331 Bacteria 4284
113 Ga0070670_100066566 3300005331 Bacteria 3091
114 Ga0070670_100122996 3300005331 Bacteria 2239
115 Ga0070670_100351062 3300005331 Bacteria 1296
116 Ga0070670_101280247 3300005331 Unclassified 671
117 Ga0070670_102190468 3300005331 Unclassified 509
118 Ga0070677_10002632 3300005333 Bacteria 5743
119 Ga0070677_10056606 3300005333 Bacteria 1604
120 Ga0070677_10058268 3300005333 Unclassified 1586
121 Ga0070677_10914225 3300005333 Unclassified 508
122 Ga0068869_100002137 3300005334 Bacteria 11881
123 Ga0068869_100007360 3300005334 Bacteria 7026
124 Ga0068869_100379895 3300005334 Bacteria 1158
125 Ga0068869_100545120 3300005334 Bacteria 974
126 Ga0070666_10012451 3300005335 Bacteria 5365
127 Ga0070666_10013448 3300005335 Bacteria 5194
128 Ga0070666_10057791 3300005335 Bacteria 2622
129 Ga0070680_101181970 3300005336 Unclassified 661
130 Ga0070682_100389863 3300005337 Bacteria 1050
131 Ga0070682_100807339 3300005337 Unclassified 763
132 Ga0068868_100009452 3300005338 Bacteria 7019
133 Ga0068868_100024652 3300005338 Bacteria 4568
134 Ga0068868_100081795 3300005338 Bacteria 2590
135 Ga0068868_101694428 3300005338 Unclassified 596
136 Ga0070660_101052448 3300005339 Unclassified 688
137 Ga0070689_100088178 3300005340 Bacteria 2442
138 Ga0070689_100099927 3300005340 Bacteria 2295
139 Ga0070689_100106600 3300005340 Bacteria 2224
140 Ga0070689_100606628 3300005340 Bacteria 948
141 Ga0070691_10848017 3300005341 Unclassified 560
142 Ga0070687_100056560 3300005343 Bacteria 2053
143 Ga0070687_100062483 3300005343 Bacteria 1972
144 Ga0070687_100569057 3300005343 Unclassified 774
145 Ga0070661_100009146 3300005344 Bacteria 6847
146 Ga0070661_100015584 3300005344 Bacteria 5365
147 Ga0070661_100110436 3300005344 Bacteria 2053
148 Ga0070661_101472074 3300005344 Bacteria 574
149 Ga0070692_10313636 3300005345 Bacteria 962
150 Ga0070692_10450837 3300005345 Unclassified 823
151 Ga0070692_10503914 3300005345 Unclassified 785
152 Ga0070668_100420722 3300005347 Unclassified 1144
153 Ga0070668_100833366 3300005347 Unclassified 821
154 Ga0070669_100095019 3300005353 Bacteria 2241
155 Ga0070669_100346750 3300005353 Unclassified 1204
156 Ga0070669_100502898 3300005353 Bacteria 1005
157 Ga0070669_100895726 3300005353 Bacteria 758
158 Ga0070675_100002090 3300005354 Bacteria 14787
159 Ga0070675_100002256 3300005354 Bacteria 14292
160 Ga0070675_100120637 3300005354 Bacteria 2227
161 Ga0070675_100196210 3300005354 Bacteria 1751
162 Ga0070675_100217309 3300005354 Bacteria 1663
163 Ga0070675_100327615 3300005354 Bacteria 1354
164 Ga0070675_100477775 3300005354 Bacteria 1121
165 Ga0070675_100861329 3300005354 Bacteria 829
166 Ga0070675_101090551 3300005354 Unclassified 734
167 Ga0070671_100055572 3300005355 Bacteria 3293
168 Ga0070671_100082526 3300005355 Bacteria 2688
169 Ga0070671_100751455 3300005355 Unclassified 848
170 Ga0070674_100000886 3300005356 Bacteria 15612
171 Ga0070674_100143868 3300005356 Bacteria 1793
172 Ga0070674_100157571 3300005356 Bacteria 1719
173 Ga0070674_100433185 3300005356 Unclassified 1082
174 Ga0070674_100774844 3300005356 Unclassified 826
175 Ga0070674_102039985 3300005356 Unclassified 523
176 Ga0070673_100006055 3300005364 Bacteria 7833
177 Ga0070673_100025160 3300005364 Bacteria 4376
178 Ga0070673_100034975 3300005364 Bacteria 3807
179 Ga0070673_100087081 3300005364 Bacteria 2545
180 Ga0070673_100087788 3300005364 Bacteria 2535
181 Ga0070673_100097088 3300005364 Bacteria 2419
182 Ga0070673_100168633 3300005364 Bacteria 1867
183 Ga0070673_100179468 3300005364 Bacteria 1812
184 Ga0070673_101498766 3300005364 Bacteria 636
185 Ga0070673_102291341 3300005364 Unclassified 513
186 Ga0070688_100055823 3300005365 Bacteria 2478
187 Ga0070688_100101625 3300005365 Bacteria 1897
188 Ga0070688_100141065 3300005365 Bacteria 1637
189 Ga0070688_101014252 3300005365 Bacteria 660
190 Ga0070688_101499881 3300005365 Unclassified 548
191 Ga0070659_100275636 3300005366 Bacteria 1398
192 Ga0070659_100856003 3300005366 Bacteria 793
193 Ga0070667_100011039 3300005367 Bacteria 7472
194 Ga0070667_100016345 3300005367 Bacteria 6139
195 Ga0070667_100185177 3300005367 Unclassified 1842
196 Ga0070667_100357246 3300005367 Unclassified 1324
197 Ga0070667_100903809 3300005367 Bacteria 822
198 Ga0070667_101696296 3300005367 Bacteria 594
199 Ga0070703_10038536 3300005406 Unclassified 1478
200 Ga0070709_10293493 3300005434 Bacteria 1185
201 Ga0070713_100008352 3300005436 Bacteria 7342
202 Ga0070713_100016901 3300005436 Bacteria 5498
203 Ga0070710_10126494 3300005437 Bacteria 1553
204 Ga0070701_10028491 3300005438 Unclassified 2745
205 Ga0070701_10346443 3300005438 Bacteria 927
206 Ga0070701_10472688 3300005438 Bacteria 809
207 Ga0070701_10638180 3300005438 Unclassified 710
208 Ga0070711_100082047 3300005439 Bacteria 2300
209 Ga0070705_100247770 3300005440 Bacteria 1249
210 Ga0070700_100658735 3300005441 Unclassified 827
211 Ga0070700_101011706 3300005441 Bacteria 684
212 Ga0070694_100002432 3300005444 Bacteria 10985
213 Ga0070694_100060666 3300005444 Bacteria 2580
214 Ga0070694_100123078 3300005444 Unclassified 1863
215 Ga0070694_101010233 3300005444 Unclassified 691
216 Ga0070694_101354373 3300005444 Unclassified 600
217 Ga0070694_101759469 3300005444 Bacteria 528
218 Ga0070708_100206293 3300005445 Unclassified 1841
219 Ga0070678_100020013 3300005456 Bacteria 4381
220 Ga0070678_100086605 3300005456 Bacteria 2390
221 Ga0070678_100207890 3300005456 Unclassified 1620
222 Ga0070678_100250259 3300005456 Bacteria 1486
223 Ga0070678_100429136 3300005456 Unclassified 1154
224 Ga0070678_100458116 3300005456 Unclassified 1118
225 Ga0070678_100675839 3300005456 Unclassified 928
226 Ga0070678_101222360 3300005456 Bacteria 697
227 Ga0070678_101391975 3300005456 Unclassified 655
228 Ga0070662_100021066 3300005457 Bacteria 4447
229 Ga0070662_100140882 3300005457 Bacteria 1868
230 Ga0070662_101666612 3300005457 Unclassified 551
231 Ga0070681_10563192 3300005458 Bacteria 1053
232 Ga0070681_10895117 3300005458 Bacteria 806
233 Ga0068867_100041600 3300005459 Bacteria 3358
234 Ga0068867_100172683 3300005459 Unclassified 1713
235 Ga0068867_100385134 3300005459 Bacteria 1179
236 Ga0068867_100389261 3300005459 Unclassified 1173
237 Ga0068867_101337525 3300005459 Bacteria 662
238 Ga0070685_10085330 3300005466 Bacteria 1901
239 Ga0070685_10463749 3300005466 Bacteria 890
240 Ga0070685_10606178 3300005466 Bacteria 788
241 Ga0070685_11218565 3300005466 Unclassified 572
242 Ga0070685_11536090 3300005466 Unclassified 514
243 Ga0070706_100944354 3300005467 Bacteria 796
244 Ga0070707_100052627 3300005468 Unclassified 3904
245 Ga0070707_100268217 3300005468 Bacteria 1660
246 Ga0070707_100678873 3300005468 Unclassified 993
247 Ga0070698_100239132 3300005471 Bacteria 1749
248 Ga0070698_100642053 3300005471 Unclassified 1002
249 Ga0070698_101209240 3300005471 Bacteria 705
250 Ga0070699_100328089 3300005518 Bacteria 1376
251 Ga0070699_100350401 3300005518 Unclassified 1330
252 Ga0070679_100410876 3300005530 Bacteria 1299
253 Ga0070679_101643129 3300005530 Unclassified 590
254 Ga0070679_101748045 3300005530 Unclassified 570
255 Ga0070684_100145486 3300005535 Unclassified 2145
256 Ga0070684_100649211 3300005535 Unclassified 982
257 Ga0070697_100412378 3300005536 Bacteria 1173
258 Ga0070697_100580194 3300005536 Unclassified 985
259 Ga0070697_102044297 3300005536 Unclassified 513
260 Ga0070672_100007756 3300005543 Bacteria 7315
261 Ga0070672_100070011 3300005543 Bacteria 2787
262 Ga0070672_100154032 3300005543 Bacteria 1903
263 Ga0070672_100192204 3300005543 Unclassified 1704
264 Ga0070672_100494566 3300005543 Bacteria 1057
265 Ga0070672_100579221 3300005543 Bacteria 976
266 Ga0070672_100775851 3300005543 Unclassified 842
267 Ga0070672_101091232 3300005543 Bacteria 709
268 Ga0070686_100004772 3300005544 Bacteria 7480
269 Ga0070686_100094519 3300005544 Bacteria 2006
270 Ga0070686_100095154 3300005544 Bacteria 2001
271 Ga0070686_100296267 3300005544 Unclassified 1198
272 Ga0070686_100492607 3300005544 Bacteria 950
273 Ga0070695_100002378 3300005545 Bacteria 10808
274 Ga0070695_100355968 3300005545 Bacteria 1098
275 Ga0070695_100625921 3300005545 Bacteria 847
276 Ga0070696_100038105 3300005546 Unclassified 3317
277 Ga0070696_100054711 3300005546 Bacteria 2782
278 Ga0070696_100083707 3300005546 Bacteria 2263
279 Ga0070696_100116180 3300005546 Bacteria 1932
280 Ga0070696_100408015 3300005546 Bacteria 1064
281 Ga0070665_100018571 3300005548 Bacteria 6969
282 Ga0070665_100240777 3300005548 Unclassified 1810
283 Ga0070704_100011387 3300005549 Bacteria 5449
284 Ga0070664_100000508 3300005564 Bacteria 29520
285 Ga0070664_100000777 3300005564 Bacteria 24623
286 Ga0070664_100001566 3300005564 Bacteria 18284
287 Ga0070664_100038915 3300005564 Bacteria 4005
288 Ga0070664_100660119 3300005564 Unclassified 972
289 Ga0070664_100662596 3300005564 Bacteria 970
290 Ga0068857_100185957 3300005577 Bacteria 1891
291 Ga0068857_100955366 3300005577 Bacteria 823
292 Ga0068857_101529128 3300005577 Unclassified 651
293 Ga0068854_100096744 3300005578 Bacteria 2206
294 Ga0070702_100129223 3300005615 Bacteria 1593
295 Ga0070702_100735481 3300005615 Unclassified 756
296 Ga0070702_101863902 3300005615 Unclassified 503
297 Ga0068852_100373732 3300005616 Unclassified 1397
298 Ga0068852_101033724 3300005616 Bacteria 841
299 Ga0068859_100030951 3300005617 Bacteria 5370
300 Ga0068859_100084276 3300005617 Bacteria 3223
301 Ga0068859_100116245 3300005617 Bacteria 2739
302 Ga0068859_100125942 3300005617 Unclassified 2631
303 Ga0068859_100145523 3300005617 Bacteria 2444
304 Ga0068859_100169629 3300005617 Unclassified 2263
305 Ga0068859_100458607 3300005617 Bacteria 1370
306 Ga0068859_100738246 3300005617 Unclassified 1074
307 Ga0068859_101054128 3300005617 Unclassified 894
308 Ga0068859_101647792 3300005617 Bacteria 708
309 Ga0068859_102270481 3300005617 Unclassified 598
310 Ga0068864_100001955 3300005618 Bacteria 16940
311 Ga0068864_100016892 3300005618 Bacteria 6082
312 Ga0068864_100032637 3300005618 Bacteria 4425
313 Ga0068864_100051480 3300005618 Bacteria 3548
314 Ga0068864_100624365 3300005618 Bacteria 1047
315 Ga0068864_101196096 3300005618 Bacteria 758
316 Ga0068864_101336734 3300005618 Unclassified 717
317 Ga0068866_10255411 3300005718 Unclassified 1074
318 Ga0068866_10282716 3300005718 Bacteria 1029
319 Ga0068866_11332021 3300005718 Unclassified 523
320 Ga0068861_100040419 3300005719 Unclassified 3488
321 Ga0068861_100053271 3300005719 Bacteria 3077
322 Ga0068861_100117895 3300005719 Bacteria 2137
323 Ga0068861_100159613 3300005719 Bacteria 1859
324 Ga0068861_100373454 3300005719 Bacteria 1258
325 Ga0068861_100573579 3300005719 Bacteria 1032
326 Ga0068861_100637250 3300005719 Bacteria 983
327 Ga0068861_100900015 3300005719 Unclassified 838
328 Ga0068861_101097138 3300005719 Unclassified 765
329 Ga0068851_10158083 3300005834 Bacteria 1243
330 Ga0068851_10336477 3300005834 Unclassified 875
331 Ga0068870_10003483 3300005840 Bacteria 6673
332 Ga0068870_10048919 3300005840 Bacteria 2228
333 Ga0068870_10101955 3300005840 Bacteria 1624
334 Ga0068870_10138160 3300005840 Bacteria 1423
335 Ga0068870_10309809 3300005840 Bacteria 999
336 Ga0068870_10826298 3300005840 Unclassified 649
337 Ga0068863_100006787 3300005841 Bacteria 11220
338 Ga0068863_100061190 3300005841 Unclassified 3559
339 Ga0068863_100091448 3300005841 Bacteria 2885
340 Ga0068863_100352936 3300005841 Bacteria 1432
341 Ga0068863_100470819 3300005841 Unclassified 1235
342 Ga0068863_100494416 3300005841 Bacteria 1204
343 Ga0068863_100508268 3300005841 Bacteria 1187
344 Ga0068863_100576130 3300005841 Unclassified 1113
345 Ga0068863_100842615 3300005841 Bacteria 915
346 Ga0068863_102136646 3300005841 Unclassified 570
347 Ga0068858_100049801 3300005842 Bacteria 3878
348 Ga0068858_100053429 3300005842 Unclassified 3737
349 Ga0068858_100060443 3300005842 Unclassified 3503
350 Ga0068858_100091515 3300005842 Bacteria 2831
351 Ga0068858_100323799 3300005842 Bacteria 1473
352 Ga0068858_100579328 3300005842 Bacteria 1087
353 Ga0068860_100030936 3300005843 Bacteria 5147
354 Ga0068860_100285530 3300005843 Bacteria 1614
355 Ga0068860_101402766 3300005843 Unclassified 720
356 Ga0068860_102554422 3300005843 Unclassified 530
357 Ga0068862_100042105 3300005844 Unclassified 3889
358 Ga0068862_100321342 3300005844 Bacteria 1429
359 Ga0068862_100512126 3300005844 Bacteria 1141
360 Ga0068862_100743220 3300005844 Unclassified 954
361 Ga0068862_100896566 3300005844 Bacteria 871
362 Ga0068862_100918250 3300005844 Bacteria 861
363 Ga0068862_101239094 3300005844 Unclassified 746
364 Ga0081455_10121568 3300005937 Unclassified 2056
365 Ga0081455_10797153 3300005937 Unclassified 593
366 Ga0081539_10000133 3300005985 Bacteria 173855
367 Ga0081539_10000329 3300005985 Bacteria 105307
368 Ga0081539_10005236 3300005985 Bacteria 13400
369 Ga0075432_10013769 3300006058 Bacteria 2752
370 Ga0070715_10264999 3300006163 Unclassified 904
371 Ga0097621_100004942 3300006237 Bacteria 9347
372 Ga0097621_100083160 3300006237 Bacteria 2667
373 Ga0097621_100106178 3300006237 Bacteria 2369
374 Ga0097621_100220674 3300006237 Unclassified 1652
375 Ga0097621_100278806 3300006237 Unclassified 1471
376 Ga0097621_100599232 3300006237 Bacteria 1007
377 Ga0097621_100620811 3300006237 Unclassified 990
378 Ga0097621_101721143 3300006237 Unclassified 597
379 Ga0097621_102297626 3300006237 Unclassified 516
380 Ga0068871_100000568 3300006358 Bacteria 25277
381 Ga0068871_100063687 3300006358 Unclassified 3016
382 Ga0068871_100141280 3300006358 Bacteria 2047
383 Ga0068871_100145951 3300006358 Bacteria 2014
384 Ga0068871_100235006 3300006358 Bacteria 1592
385 Ga0068871_100335932 3300006358 Bacteria 1333
386 Ga0068871_100354613 3300006358 Bacteria 1298
387 Ga0068871_100670980 3300006358 Bacteria 948
388 Ga0068871_100729491 3300006358 Bacteria 910
389 Ga0068871_100909712 3300006358 Bacteria 816
390 Ga0075428_100008383 3300006844 Bacteria 11458
391 Ga0075428_100016065 3300006844 Bacteria 8277
392 Ga0075428_100016769 3300006844 Bacteria 8089
393 Ga0075428_100029402 3300006844 Bacteria 6080
394 Ga0075428_100841320 3300006844 Unclassified 974
395 Ga0075428_100940955 3300006844 Unclassified 916
396 Ga0075428_101045280 3300006844 Bacteria 864
397 Ga0075430_100009192 3300006846 Bacteria 8352
398 Ga0075430_100015340 3300006846 Bacteria 6525
399 Ga0075430_100045019 3300006846 Bacteria 3730
400 Ga0075430_100127371 3300006846 Bacteria 2123
401 Ga0075430_100132865 3300006846 Unclassified 2074
402 Ga0075430_100155074 3300006846 Bacteria 1907
403 Ga0075430_101013758 3300006846 Unclassified 684
404 Ga0075430_101310817 3300006846 Unclassified 595
405 Ga0075431_100006482 3300006847 Bacteria 11619
406 Ga0075431_100006533 3300006847 Bacteria 11582
407 Ga0075431_100009194 3300006847 Bacteria 9911
408 Ga0075431_100151409 3300006847 Bacteria 2388
409 Ga0075433_10000629 3300006852 Bacteria 23546
410 Ga0075433_10006287 3300006852 Bacteria 9380
411 Ga0075433_10127724 3300006852 Unclassified 2258
412 Ga0075433_10176086 3300006852 Bacteria 1904
413 Ga0075433_10323396 3300006852 Bacteria 1364
414 Ga0075433_10780086 3300006852 Unclassified 835
415 Ga0075434_100050439 3300006871 Bacteria 4134
416 Ga0075434_100119953 3300006871 Bacteria 2645
417 Ga0075434_100172414 3300006871 Bacteria 2183
418 Ga0075434_100508667 3300006871 Unclassified 1225
419 Ga0075429_100012736 3300006880 Bacteria 7296
420 Ga0075429_100012997 3300006880 Bacteria 7223
421 Ga0075429_100017263 3300006880 Bacteria 6242
422 Ga0075429_100039720 3300006880 Unclassified 4095
423 Ga0075429_100432837 3300006880 Unclassified 1152
424 Ga0068865_100031357 3300006881 Bacteria 3544
425 Ga0068865_100208248 3300006881 Bacteria 1522
426 Ga0068865_100483312 3300006881 Bacteria 1030
427 Ga0068865_100660031 3300006881 Unclassified 890
428 Ga0068865_100770477 3300006881 Bacteria 828
429 Ga0075436_100169159 3300006914 Bacteria 1543
430 Ga0075436_101137922 3300006914 Bacteria 588
431 Ga0097620_100030951 3300006931 Bacteria 5370
432 Ga0097620_100084278 3300006931 Bacteria 3223
433 Ga0097620_100116241 3300006931 Bacteria 2739
434 Ga0097620_100125949 3300006931 Unclassified 2631
435 Ga0097620_100145520 3300006931 Bacteria 2444
436 Ga0097620_100169619 3300006931 Unclassified 2263
437 Ga0097620_100458610 3300006931 Bacteria 1370
438 Ga0097620_100738229 3300006931 Unclassified 1074
439 Ga0097620_101054037 3300006931 Unclassified 894
440 Ga0097620_101647776 3300006931 Bacteria 708
441 Ga0097620_102270379 3300006931 Unclassified 598
442 Ga0075435_100000725 3300007076 Bacteria 20435
443 Ga0075435_100009913 3300007076 Bacteria 6938
444 Ga0075435_100126562 3300007076 Bacteria 2136
445 Ga0075435_100222304 3300007076 Bacteria 1603
446 Ga0075435_101552773 3300007076 Bacteria 581
447 Ga0105244_10233077 3300009036 Bacteria 861
448 Ga0111539_10009474 3300009094 Bacteria 12291
449 Ga0111539_10019921 3300009094 Bacteria 8262
450 Ga0111539_10024909 3300009094 Bacteria 7334
451 Ga0111539_10026447 3300009094 Bacteria 7094
452 Ga0111539_10036678 3300009094 Bacteria 5925
453 Ga0111539_10041446 3300009094 Bacteria 5536
454 Ga0111539_10064583 3300009094 Bacteria 4329
455 Ga0111539_10382256 3300009094 Unclassified 1639
456 Ga0111539_10670504 3300009094 Unclassified 1207
457 Ga0105245_10561016 3300009098 Bacteria 1165
458 Ga0105245_10587970 3300009098 Bacteria 1138
459 Ga0105245_10589073 3300009098 Unclassified 1137
460 Ga0105245_11563503 3300009098 Bacteria 711
461 Ga0105245_11955339 3300009098 Unclassified 640
462 Ga0105247_10328988 3300009101 Bacteria 1069
463 Ga0105247_10419111 3300009101 Bacteria 958
464 Ga0114129_10013443 3300009147 Bacteria 11666
465 Ga0114129_10045450 3300009147 Bacteria 6173
466 Ga0114129_10066168 3300009147 Bacteria 5041
467 Ga0114129_10168326 3300009147 Bacteria 2989
468 Ga0114129_10191100 3300009147 Bacteria 2780
469 Ga0114129_10404571 3300009147 Bacteria 1798
470 Ga0114129_10515153 3300009147 Bacteria 1560
471 Ga0105243_10038297 3300009148 Bacteria 3734
472 Ga0105243_10044742 3300009148 Bacteria 3475
473 Ga0105243_12414187 3300009148 Unclassified 564
474 Ga0105243_13084620 3300009148 Unclassified 505
475 Ga0105242_10018370 3300009176 Bacteria 5465
476 Ga0105242_10271885 3300009176 Unclassified 1535
477 Ga0105242_10327650 3300009176 Bacteria 1407
478 Ga0105248_10001517 3300009177 Bacteria 25847
479 Ga0105248_10001944 3300009177 Bacteria 22950
480 Ga0105248_10020509 3300009177 Bacteria 7324
481 Ga0105248_10093632 3300009177 Bacteria 3384
482 Ga0105248_10117287 3300009177 Bacteria 3002
483 Ga0105248_10574557 3300009177 Bacteria 1272
484 Ga0105248_10580338 3300009177 Bacteria 1265
485 Ga0105248_10924951 3300009177 Bacteria 985
486 Ga0105248_11393934 3300009177 Unclassified 793
487 Ga0105248_12083592 3300009177 Unclassified 645
488 Ga0105238_10017272 3300009551 Bacteria 7329
489 Ga0105238_10824068 3300009551 Unclassified 944
490 Ga0105249_10023740 3300009553 Bacteria 5506
491 Ga0105249_10245886 3300009553 Unclassified 1771
492 Ga0105249_10643576 3300009553 Unclassified 1117
493 Ga0105249_11270174 3300009553 Bacteria 808
494 Ga0105246_10124085 3300011119 Bacteria 1918
495 Ga0105246_10338591 3300011119 Unclassified 1229
496 Ga0105246_10403085 3300011119 Bacteria 1136
497 Ga0105246_11011200 3300011119 Bacteria 753
498 Ga0105246_11405420 3300011119 Unclassified 651
499 Ga0157319_1020015 3300012497 Unclassified 641
500 Ga0157371_10309502 3300013102 Bacteria 1145
501 Ga0157374_10279857 3300013296 Unclassified 1647
502 Ga0157374_10310109 3300013296 Unclassified 1562
503 Ga0157374_10623469 3300013296 Bacteria 1089
504 Ga0157374_11130368 3300013296 Unclassified 804
505 Ga0157378_10052770 3300013297 Bacteria 3617
506 Ga0157378_10087855 3300013297 Bacteria 2820
507 Ga0157378_10428634 3300013297 Bacteria 1308
508 Ga0157378_10504196 3300013297 Unclassified 1209
509 Ga0163162_10004920 3300013306 Bacteria 12881
510 Ga0163162_10006636 3300013306 Bacteria 11216
511 Ga0163162_10038924 3300013306 Bacteria 4748
512 Ga0163162_10071757 3300013306 Bacteria 3516
513 Ga0163162_10506394 3300013306 Bacteria 1338
514 Ga0163162_10669783 3300013306 Bacteria 1161
515 Ga0163162_11508193 3300013306 Bacteria 766
516 Ga0163162_11699803 3300013306 Unclassified 721
517 Ga0163162_11794340 3300013306 Bacteria 701
518 Ga0163162_12335039 3300013306 Unclassified 615
519 Ga0157372_12028297 3300013307 Bacteria 661
520 Ga0157375_10063280 3300013308 Bacteria 3680
521 Ga0157375_10146286 3300013308 Bacteria 2494
522 Ga0157375_10428975 3300013308 Bacteria 1488
523 Ga0157375_10830745 3300013308 Bacteria 1071
524 Ga0157375_10871944 3300013308 Bacteria 1045
525 Ga0157375_11002738 3300013308 Bacteria 975
526 Ga0157375_11132466 3300013308 Unclassified 917
527 Ga0157375_11210806 3300013308 Bacteria 886
528 Ga0163163_10001063 3300014325 Bacteria 23324
529 Ga0163163_10006058 3300014325 Bacteria 10519
530 Ga0163163_10020811 3300014325 Bacteria 6184
531 Ga0163163_10026210 3300014325 Bacteria 5569
532 Ga0163163_10183550 3300014325 Bacteria 2139
533 Ga0163163_10392761 3300014325 Bacteria 1445
534 Ga0163163_10730724 3300014325 Bacteria 1053
535 Ga0163163_10849677 3300014325 Bacteria 976
536 Ga0157380_10006441 3300014326 Bacteria 8268
537 Ga0157380_10007437 3300014326 Bacteria 7777
538 Ga0157380_10043947 3300014326 Unclassified 3499
539 Ga0157380_10077491 3300014326 Bacteria 2709
540 Ga0157380_10214769 3300014326 Bacteria 1717
541 Ga0157380_10252381 3300014326 Bacteria 1597
542 Ga0157380_13009978 3300014326 Unclassified 537
543 Ga0157377_10002509 3300014745 Bacteria 8129
544 Ga0157377_10104308 3300014745 Bacteria 1695
545 Ga0157377_10197566 3300014745 Bacteria 1275
546 Ga0157377_10199245 3300014745 Bacteria 1270
547 Ga0157377_10299273 3300014745 Bacteria 1061
548 Ga0157377_10351628 3300014745 Bacteria 989
549 Ga0157379_10187924 3300014968 Bacteria 1867
550 Ga0157379_10439316 3300014968 Bacteria 1203
551 Ga0157376_10009221 3300014969 Bacteria 7160
552 Ga0157376_10069205 3300014969 Bacteria 2991
553 Ga0157376_10083392 3300014969 Bacteria 2749
554 Ga0157376_10133647 3300014969 Unclassified 2217
555 Ga0157376_10460734 3300014969 Bacteria 1242
556 Ga0157376_10540458 3300014969 Bacteria 1152
557 Ga0157376_10692316 3300014969 Bacteria 1023
558 Ga0157376_10712687 3300014969 Bacteria 1010
559 Ga0157376_11057680 3300014969 Bacteria 836
560 Ga0157376_11885820 3300014969 Bacteria 634
561 Ga0163161_10043995 3300017792 Bacteria 3215
562 Ga0163161_10062221 3300017792 Bacteria 2718
563 Ga0163161_10174958 3300017792 Bacteria 1643
564 Ga0163161_10622621 3300017792 Unclassified 892
565 Ga0163161_10675700 3300017792 Bacteria 858
566 Ga0197907_11064887 3300020069 Bacteria 722
567 Ga0206356_10295248 3300020070 Bacteria 729
568 Ga0206356_11338882 3300020070 Unclassified 1080
569 Ga0206349_1579484 3300020075 Unclassified 594
570 Ga0206349_1745606 3300020075 Unclassified 925
571 Ga0206352_10240803 3300020078 Unclassified 645
572 Ga0206352_10435217 3300020078 Bacteria 513
573 Ga0206352_10459886 3300020078 Bacteria 661
574 Ga0206352_10684472 3300020078 Bacteria 691
575 Ga0206352_10789063 3300020078 Unclassified 647
576 Ga0206352_10808230 3300020078 Bacteria 789
577 Ga0206350_10603039 3300020080 Bacteria 2108
578 Ga0206350_11293131 3300020080 Unclassified 832
579 Ga0206350_11655528 3300020080 Unclassified 642
580 Ga0206354_11378251 3300020081 Bacteria 623
581 Ga0206353_11760492 3300020082 Unclassified 617
582 Ga0206353_11983827 3300020082 Bacteria 672
583 Ga0224712_10279338 3300022467 Unclassified 777
584 Ga0224712_10317047 3300022467 Bacteria 732
585 Ga0207666_1016382 3300025271 Bacteria 1062
586 Ga0207673_1046337 3300025290 Bacteria 613
587 Ga0207697_10021544 3300025315 Bacteria 2638
588 Ga0207697_10089813 3300025315 Bacteria 1301
589 Ga0207697_10125669 3300025315 Bacteria 1106
590 Ga0207697_10172905 3300025315 Bacteria 945
591 Ga0207656_10171150 3300025321 Bacteria 1038
592 Ga0207653_10091567 3300025885 Unclassified 1066
593 Ga0207682_10003633 3300025893 Bacteria 6655
594 Ga0207682_10021350 3300025893 Unclassified 2547
595 Ga0207682_10027680 3300025893 Bacteria 2258
596 Ga0207682_10038379 3300025893 Bacteria 1943
597 Ga0207682_10057813 3300025893 Unclassified 1618
598 Ga0207682_10184607 3300025893 Bacteria 954
599 Ga0207692_10771792 3300025898 Unclassified 627
600 Ga0207642_10048207 3300025899 Bacteria 1909
601 Ga0207688_10015436 3300025901 Bacteria 4142
602 Ga0207688_10177251 3300025901 Bacteria 1270
603 Ga0207688_10208009 3300025901 Bacteria 1175
604 Ga0207680_10007945 3300025903 Bacteria 5187
605 Ga0207680_10017707 3300025903 Bacteria 3769
606 Ga0207680_10117060 3300025903 Bacteria 1737
607 Ga0207680_10199483 3300025903 Bacteria 1363
608 Ga0207685_10117996 3300025905 Bacteria 1160
609 Ga0207685_10169964 3300025905 Unclassified 1002
610 Ga0207699_10020357 3300025906 Bacteria 3554
611 Ga0207699_10057371 3300025906 Bacteria 2325
612 Ga0207645_10001298 3300025907 Bacteria 20552
613 Ga0207645_10010593 3300025907 Bacteria 6325
614 Ga0207645_10015451 3300025907 Bacteria 5069
615 Ga0207645_10365288 3300025907 Unclassified 967
616 Ga0207643_10001468 3300025908 Bacteria 13539
617 Ga0207643_10004046 3300025908 Bacteria 7894
618 Ga0207643_10023721 3300025908 Bacteria 3385
619 Ga0207643_10036792 3300025908 Bacteria 2746
620 Ga0207643_10056693 3300025908 Bacteria 2228
621 Ga0207643_10097705 3300025908 Unclassified 1719
622 Ga0207643_10121432 3300025908 Bacteria 1548
623 Ga0207643_10226116 3300025908 Unclassified 1147
624 Ga0207643_10259338 3300025908 Bacteria 1073
625 Ga0207707_10040412 3300025912 Unclassified 4074
626 Ga0207707_10098983 3300025912 Bacteria 2549
627 Ga0207707_10202660 3300025912 Unclassified 1730
628 Ga0207707_10923223 3300025912 Unclassified 720
629 Ga0207707_10957488 3300025912 Bacteria 705
630 Ga0207660_10653666 3300025917 Unclassified 857
631 Ga0207660_10973501 3300025917 Unclassified 692
632 Ga0207662_10034684 3300025918 Bacteria 2945
633 Ga0207662_10042957 3300025918 Bacteria 2666
634 Ga0207662_10833656 3300025918 Bacteria 651
635 Ga0207662_10951754 3300025918 Unclassified 609
636 Ga0207657_10500561 3300025919 Bacteria 952
637 Ga0207657_11013174 3300025919 Unclassified 637
638 Ga0207649_10013669 3300025920 Unclassified 4536
639 Ga0207649_10048687 3300025920 Bacteria 2615
640 Ga0207649_10088917 3300025920 Bacteria 2018
641 Ga0207652_10847973 3300025921 Bacteria 809
642 Ga0207646_10726633 3300025922 Unclassified 887
643 Ga0207646_11566500 3300025922 Unclassified 569
644 Ga0207681_10104603 3300025923 Unclassified 2048
645 Ga0207681_10146942 3300025923 Bacteria 1762
646 Ga0207681_10415836 3300025923 Bacteria 1088
647 Ga0207681_10698962 3300025923 Bacteria 843
648 Ga0207681_11192343 3300025923 Bacteria 640
649 Ga0207681_11300194 3300025923 Bacteria 611
650 Ga0207694_10001914 3300025924 Bacteria 17254
651 Ga0207694_10312082 3300025924 Bacteria 1296
652 Ga0207650_10000444 3300025925 Bacteria 35551
653 Ga0207650_10008206 3300025925 Bacteria 7124
654 Ga0207650_10026771 3300025925 Bacteria 4118
655 Ga0207650_10030746 3300025925 Bacteria 3871
656 Ga0207650_10061140 3300025925 Bacteria 2812
657 Ga0207650_10857860 3300025925 Bacteria 770
658 Ga0207650_11037574 3300025925 Unclassified 698
659 Ga0207650_11623018 3300025925 Unclassified 549
660 Ga0207659_10018306 3300025926 Bacteria 4590
661 Ga0207659_10022541 3300025926 Bacteria 4193
662 Ga0207659_10071465 3300025926 Unclassified 2534
663 Ga0207659_10200545 3300025926 Bacteria 1593
664 Ga0207659_10245784 3300025926 Bacteria 1450
665 Ga0207659_10379614 3300025926 Bacteria 1178
666 Ga0207659_10531082 3300025926 Unclassified 998
667 Ga0207659_10637246 3300025926 Bacteria 910
668 Ga0207659_10658386 3300025926 Bacteria 895
669 Ga0207659_10895009 3300025926 Unclassified 763
670 Ga0207659_11599087 3300025926 Bacteria 556
671 Ga0207687_10239498 3300025927 Bacteria 1437
672 Ga0207700_10001848 3300025928 Bacteria 11991
673 Ga0207700_10154681 3300025928 Unclassified 1899
674 Ga0207644_10151257 3300025931 Bacteria 1796
675 Ga0207644_10405017 3300025931 Bacteria 1116
676 Ga0207644_10423968 3300025931 Unclassified 1090
677 Ga0207690_10096866 3300025932 Bacteria 2098
678 Ga0207690_11123907 3300025932 Bacteria 655
679 Ga0207706_10011838 3300025933 Bacteria 7944
680 Ga0207706_10162045 3300025933 Bacteria 1966
681 Ga0207706_10462887 3300025933 Bacteria 1096
682 Ga0207706_10533525 3300025933 Bacteria 1011
683 Ga0207686_10004639 3300025934 Bacteria 7363
684 Ga0207686_10311369 3300025934 Unclassified 1173
685 Ga0207686_11524530 3300025934 Unclassified 551
686 Ga0207709_10007046 3300025935 Bacteria 6285
687 Ga0207709_10099178 3300025935 Unclassified 1922
688 Ga0207709_10510013 3300025935 Unclassified 940
689 Ga0207670_10050526 3300025936 Bacteria 2787
690 Ga0207670_10093849 3300025936 Bacteria 2127
691 Ga0207670_10143450 3300025936 Bacteria 1763
692 Ga0207670_10211011 3300025936 Bacteria 1481
693 Ga0207670_10387903 3300025936 Bacteria 1114
694 Ga0207670_11348098 3300025936 Unclassified 605
695 Ga0207669_10049870 3300025937 Bacteria 2498
696 Ga0207669_10069194 3300025937 Bacteria 2207
697 Ga0207669_10076983 3300025937 Bacteria 2120
698 Ga0207669_10142835 3300025937 Bacteria 1664
699 Ga0207704_10019639 3300025938 Bacteria 3553
700 Ga0207704_10087191 3300025938 Bacteria 2038
701 Ga0207704_10130706 3300025938 Bacteria 1738
702 Ga0207704_10242141 3300025938 Unclassified 1348
703 Ga0207704_10362442 3300025938 Bacteria 1132
704 Ga0207665_10337223 3300025939 Bacteria 1135
705 Ga0207691_10005742 3300025940 Bacteria 12004
706 Ga0207691_10029518 3300025940 Bacteria 5129
707 Ga0207691_10029580 3300025940 Bacteria 5124
708 Ga0207691_10060228 3300025940 Bacteria 3450
709 Ga0207691_10072536 3300025940 Bacteria 3105
710 Ga0207691_10083937 3300025940 Bacteria 2860
711 Ga0207691_10326382 3300025940 Unclassified 1315
712 Ga0207691_10361489 3300025940 Bacteria 1241
713 Ga0207691_10375308 3300025940 Bacteria 1214
714 Ga0207691_10497650 3300025940 Bacteria 1035
715 Ga0207691_10602285 3300025940 Unclassified 930
716 Ga0207691_10849236 3300025940 Unclassified 766
717 Ga0207691_10924073 3300025940 Bacteria 730
718 Ga0207711_10035868 3300025941 Unclassified 4205
719 Ga0207711_10053293 3300025941 Bacteria 3469
720 Ga0207711_10556610 3300025941 Unclassified 1070
721 Ga0207711_11027311 3300025941 Unclassified 764
722 Ga0207689_10015899 3300025942 Bacteria 6373
723 Ga0207689_10080645 3300025942 Bacteria 2675
724 Ga0207689_10128041 3300025942 Bacteria 2088
725 Ga0207661_10356837 3300025944 Unclassified 1320
726 Ga0207679_10002310 3300025945 Bacteria 11732
727 Ga0207679_10004151 3300025945 Bacteria 8997
728 Ga0207679_10006713 3300025945 Bacteria 7287
729 Ga0207679_10037678 3300025945 Bacteria 3439
730 Ga0207679_10114572 3300025945 Bacteria 2134
731 Ga0207679_10568348 3300025945 Bacteria 1019
732 Ga0207679_10951207 3300025945 Bacteria 787
733 Ga0207667_11857241 3300025949 Bacteria 565
734 Ga0207651_10048365 3300025960 Bacteria 2874
735 Ga0207651_10061313 3300025960 Bacteria 2615
736 Ga0207651_10243056 3300025960 Unclassified 1468
737 Ga0207651_11434873 3300025960 Bacteria 621
738 Ga0207712_10010441 3300025961 Bacteria 5896
739 Ga0207712_10033145 3300025961 Bacteria 3490
740 Ga0207712_10098510 3300025961 Unclassified 2168
741 Ga0207712_10538935 3300025961 Unclassified 1002
742 Ga0207668_10250899 3300025972 Bacteria 1437
743 Ga0207668_10968633 3300025972 Unclassified 759
744 Ga0207668_11050528 3300025972 Unclassified 729
745 Ga0207640_10073692 3300025981 Bacteria 2308
746 Ga0207658_10006375 3300025986 Bacteria 8053
747 Ga0207658_10131117 3300025986 Bacteria 2014
748 Ga0207658_10775736 3300025986 Bacteria 869
749 Ga0207658_11092806 3300025986 Bacteria 728
750 Ga0207658_11260971 3300025986 Unclassified 676
751 Ga0207677_10008838 3300026023 Bacteria 5646
752 Ga0207677_10169361 3300026023 Bacteria 1706
753 Ga0207677_10243815 3300026023 Bacteria 1455
754 Ga0207677_10547265 3300026023 Bacteria 1008
755 Ga0207703_10045243 3300026035 Unclassified 3540
756 Ga0207703_10109644 3300026035 Bacteria 2353
757 Ga0207703_10392473 3300026035 Bacteria 1286
758 Ga0207703_10394550 3300026035 Bacteria 1283
759 Ga0207703_10791929 3300026035 Bacteria 905
760 Ga0207678_10066128 3300026067 Bacteria 3104
761 Ga0207708_10047881 3300026075 Bacteria 3253
762 Ga0207708_10065875 3300026075 Unclassified 2769
763 Ga0207708_10181010 3300026075 Bacteria 1674
764 Ga0207708_10229742 3300026075 Bacteria 1489
765 Ga0207708_10427741 3300026075 Bacteria 1099
766 Ga0207708_10640588 3300026075 Bacteria 904
767 Ga0207708_10699181 3300026075 Unclassified 866
768 Ga0207641_10026440 3300026088 Bacteria 4789
769 Ga0207641_10045780 3300026088 Bacteria 3686
770 Ga0207641_10433139 3300026088 Unclassified 1268
771 Ga0207641_10492034 3300026088 Bacteria 1190
772 Ga0207641_10803812 3300026088 Bacteria 930
773 Ga0207641_10839825 3300026088 Unclassified 910
774 Ga0207641_10842728 3300026088 Bacteria 908
775 Ga0207641_10962386 3300026088 Unclassified 849
776 Ga0207641_12549783 3300026088 Unclassified 509
777 Ga0207648_10002543 3300026089 Bacteria 19560
778 Ga0207648_10045092 3300026089 Bacteria 3868
779 Ga0207648_10046886 3300026089 Bacteria 3788
780 Ga0207648_10155578 3300026089 Bacteria 2018
781 Ga0207648_10222971 3300026089 Unclassified 1676
782 Ga0207648_10458878 3300026089 Bacteria 1161
783 Ga0207648_11155323 3300026089 Unclassified 727
784 Ga0207648_11466597 3300026089 Unclassified 641
785 Ga0207676_10001140 3300026095 Bacteria 20053
786 Ga0207676_10033261 3300026095 Bacteria 3894
787 Ga0207676_10050009 3300026095 Bacteria 3256
788 Ga0207676_10086124 3300026095 Bacteria 2566
789 Ga0207676_10826343 3300026095 Unclassified 905
790 Ga0207676_11515952 3300026095 Bacteria 667
791 Ga0207674_10349087 3300026116 Bacteria 1430
792 Ga0207674_10410015 3300026116 Bacteria 1309
793 Ga0207674_10504647 3300026116 Bacteria 1169
794 Ga0207675_100022758 3300026118 Bacteria 5831
795 Ga0207675_100050204 3300026118 Bacteria 3893
796 Ga0207675_100060016 3300026118 Unclassified 3550
797 Ga0207675_100233173 3300026118 Bacteria 1776
798 Ga0207675_100678973 3300026118 Unclassified 1038
799 Ga0207675_100815849 3300026118 Bacteria 947
800 Ga0207683_10012865 3300026121 Bacteria 7142
801 Ga0207683_10039566 3300026121 Bacteria 4114
802 Ga0207683_10101200 3300026121 Bacteria 2573
803 Ga0207683_10114527 3300026121 Bacteria 2416
804 Ga0207683_10143665 3300026121 Bacteria 2151
805 Ga0207683_10156716 3300026121 Bacteria 2057
806 Ga0207683_10332684 3300026121 Unclassified 1392
807 Ga0207683_10852843 3300026121 Unclassified 846
808 Ga0207683_11240104 3300026121 Bacteria 691
809 Ga0207683_11674409 3300026121 Unclassified 585
810 Ga0207683_11968377 3300026121 Unclassified 533
811 Ga0207698_10633523 3300026142 Unclassified 1057
812 Ga0207698_11154225 3300026142 Bacteria 788
813 Ga0209966_1030286 3300027695 Bacteria 1093
814 Ga0209974_10050858 3300027876 Bacteria 1392
815 Ga0207428_10000737 3300027907 Bacteria 37593
816 Ga0207428_10015072 3300027907 Bacteria 6696
817 Ga0207428_10111516 3300027907 Bacteria 2105
818 Ga0207428_10161695 3300027907 Bacteria 1700
819 Ga0207428_10171107 3300027907 Bacteria 1645
820 Ga0207428_10470100 3300027907 Bacteria 915
821 Ga0207428_10916189 3300027907 Unclassified 619
822 Ga0268266_10203889 3300028379 Unclassified 1811
823 Ga0268266_12212342 3300028379 Bacteria 522
824 Ga0268265_10055983 3300028380 Unclassified 2998
825 Ga0268265_10069478 3300028380 Bacteria 2735
826 Ga0268265_10368439 3300028380 Bacteria 1318
827 Ga0268265_10566780 3300028380 Bacteria 1080
828 Ga0268265_10700890 3300028380 Bacteria 978
829 Ga0268264_10018520 3300028381 Bacteria 5695
830 Ga0268264_11047025 3300028381 Unclassified 823
831 Ga0268264_11095719 3300028381 Unclassified 805
832 Ga0268264_12011903 3300028381 Unclassified 587
833 Ga0268264_12352865 3300028381 Bacteria 539
834 Ga0265766_1012685 3300030863 Bacteria 625
835 Ga0307405_10694688 3300031731 Unclassified 842
836 Ga0307409_102199855 3300031995 Bacteria 581
837 Ga0307416_100126286 3300032002 Bacteria 2292
838 Ga0307416_100583921 3300032002 Bacteria 1195
839 Ga0307416_103431786 3300032002 Unclassified 530
840 Ga0307411_10694448 3300032005 Unclassified 886
841 Ga0373958_0111216 3300034819 Unclassified 653
842 Ga0373934_0192326 3300035086 Unclassified 840
843 Ga0373951_0067567 3300035091 Bacteria 905
844 Ga0373923_0185023 3300035111 Bacteria 958
845 Ga0373953_0013290 3300035117 Bacteria 2938
846 Ga0373953_0058625 3300035117 Bacteria 1570
847 Ga0373954_0164777 3300035118 Bacteria 1085
848 Ga0373956_0214315 3300035119 Unclassified 914
849 Ga0373956_0287846 3300035119 Bacteria 782
850 Ga0373956_0332099 3300035119 Unclassified 724
851 Ga0373956_0351300 3300035119 Bacteria 703
852 Ga0373957_0074125 3300035120 Bacteria 1336
853 Ga0373957_0263769 3300035120 Unclassified 726
854 Ga0373957_0402846 3300035120 Unclassified 589
855 Ga0373955_0093818 3300035172 Bacteria 1714
856 Ga0373955_0225736 3300035172 Bacteria 1120
857 Ga0373955_0251665 3300035172 Bacteria 1059
858 Ga0373955_0605334 3300035172 Unclassified 671
859 Ga0373962_0025225 3300035242 Bacteria 1596
860 Ga0373924_0296791 3300035410 Unclassified 717
861 Ga0373931_0894961 3300035691 Bacteria 596
862 Ga0373935_0504493 3300035692 Bacteria 879
863 Ga0373927_0620039 3300035695 Bacteria 715
864 Ga0373937_0008123 3300036401 Bacteria 9110
865 Ga0373937_0008508 3300036401 Bacteria 8915
866 Ga0373937_0032356 3300036401 Bacteria 4744
867 Ga0373937_0069353 3300036401 Bacteria 3251
868 Ga0373937_0108614 3300036401 Bacteria 2580
869 Ga0373937_0294226 3300036401 Bacteria 1534
870 Ga0373937_0353052 3300036401 Bacteria 1393
871 Ga0373937_0963108 3300036401 Bacteria 802
872 Ga0373925_1425682 3300037068 Unclassified 567
873 Ga0436365_1792320 3300039437 Bacteria 2076
874 Ga0439453_0055457 3300041408 Unclassified 810
875 Ga0451798_0799210 3300041458 Unclassified 670
876 Ga0451802_0925699 3300041460 Unclassified 529
877 Ga0451853_3575839 3300041512 Unclassified 1295
878 Ga0439450_007173 3300042008 Bacteria 2033
879 Ga0439455_0178000 3300042012 Bacteria 612
880 Ga0439444_0031059 3300042437 Bacteria 1003
881 Ga0439460_0114322 3300042461 Bacteria 878
882 Ga0439460_0115636 3300042461 Bacteria 874
883 Ga0450916_000521 3300042530 Bacteria 3381
884 Ga0451576_0191432 3300045051 Bacteria 2136
885 Ga0451576_0684140 3300045051 Bacteria 1078
886 Ga0451576_0694000 3300045051 Unclassified 1069
887 Ga0495592_0027743 3300046454 Bacteria 4290
888 Ga0495592_0051359 3300046454 Bacteria 3062
889 Ga0495592_0135001 3300046454 Bacteria 1722
890 Ga0495603_0100533 3300046455 Bacteria 1688
891 Ga0495629_0026701 3300046459 Bacteria 4101
892 Ga0495629_0327491 3300046459 Bacteria 1047
893 Ga0495629_0642645 3300046459 Bacteria 707
894 Ga0495651_0975918 3300046462 Bacteria 515
895 Ga0495653_0213493 3300046463 Bacteria 1302
896 Ga0495653_0568185 3300046463 Unclassified 700
897 Ga0495580_0027778 3300046472 Bacteria 4116
898 Ga0495580_0153936 3300046472 Bacteria 1593
899 Ga0495580_0154271 3300046472 Bacteria 1591
900 Ga0495580_0760740 3300046472 Bacteria 630
901 Ga0495582_0329047 3300046473 Bacteria 879
902 Ga0495639_0098601 3300046475 Bacteria 1378
903 Ga0495662_0195082 3300046476 Bacteria 998
904 Ga0495662_0208821 3300046476 Bacteria 962
905 Ga0495664_0125107 3300046477 Bacteria 1555
906 Ga0495664_0411506 3300046477 Bacteria 812
907 Ga0495594_0015076 3300046499 Bacteria 4057
908 Ga0495594_0457286 3300046499 Bacteria 726
909 Ga0495608_0010456 3300046511 Bacteria 6476
910 Ga0495608_0019307 3300046511 Bacteria 4692
911 Ga0495618_0134348 3300046514 Bacteria 1583
912 Ga0495618_0859922 3300046514 Unclassified 525
913 Ga0495628_0023317 3300046516 Bacteria 5081
914 Ga0495630_0008571 3300046517 Bacteria 7337
915 Ga0495630_0069380 3300046517 Bacteria 2652
916 Ga0495630_0179334 3300046517 Unclassified 1615
917 Ga0495630_0330300 3300046517 Unclassified 1166
918 Ga0495652_0621223 3300046529 Bacteria 735
919 Ga0495640_0630953 3300046533 Unclassified 646
920 Ga0495586_0039774 3300046535 Bacteria 2529
921 Ga0495586_0784856 3300046535 Unclassified 550
922 Ga0495598_0017022 3300046537 Bacteria 1867
923 Ga0495621_0124459 3300046539 Bacteria 999
924 Ga0495621_0343075 3300046539 Unclassified 625
925 Ga0495621_0396057 3300046539 Unclassified 585
926 Ga0495645_0055392 3300046543 Bacteria 2879
927 Ga0495667_0000776 3300046559 Bacteria 20492
928 Ga0495667_0004456 3300046559 Bacteria 9444
929 Ga0495667_0079754 3300046559 Bacteria 2128
930 Ga0495656_0061613 3300046615 Bacteria 1639
931 Ga0495656_0106196 3300046615 Bacteria 1306
932 Ga0495634_0039953 3300046642 Bacteria 3193
933 Ga0495634_0081494 3300046642 Bacteria 2116
934 Ga0495634_0102217 3300046642 Bacteria 1851
935 Ga0495611_0523728 3300046648 Unclassified 538
936 Ga0495635_0291583 3300046663 Bacteria 1095
937 Ga0495659_0055959 3300046664 Unclassified 1447
938 Ga0495659_0251844 3300046664 Bacteria 736
939 Ga0495661_0259399 3300046665 Unclassified 884
940 Ga0495657_0004256 3300046675 Bacteria 11445
941 Ga0495657_0006819 3300046675 Bacteria 8890
942 Ga0495599_0087243 3300046678 Bacteria 1948
943 Ga0495658_0634609 3300046683 Unclassified 684
944 Ga0495669_0005724 3300046684 Bacteria 5182
945 Ga0495613_0000464 3300046689 Bacteria 34669
946 Ga0495613_0055782 3300046689 Bacteria 2902
947 Ga0495613_0057238 3300046689 Bacteria 2862
948 Ga0495613_0078784 3300046689 Bacteria 2396
949 Ga0495613_0104834 3300046689 Bacteria 2041
950 Ga0495613_0553866 3300046689 Unclassified 769
951 Ga0495670_0143768 3300046691 Bacteria 1249
952 Ga0495670_0206543 3300046691 Bacteria 1041
953 Ga0495600_0219244 3300046809 Bacteria 1217
954 Ga0495600_0844123 3300046809 Unclassified 543
955 Ga0495604_0028365 3300047317 Bacteria 4453
956 Ga0495636_0424026 3300047318 Bacteria 636
957 Ga0495674_0045727 3300047319 Bacteria 3887
958 Ga0495674_0066105 3300047319 Bacteria 3139
959 Ga0495674_0135662 3300047319 Bacteria 2071
960 Ga0495674_0248641 3300047319 Unclassified 1464
961 Ga0495674_1034375 3300047319 Unclassified 628
962 Ga0495672_0301256 3300047320 Unclassified 759
963 Ga0495680_0172039 3300047322 Bacteria 1568
964 Ga0495680_0215605 3300047322 Unclassified 1372
965 Ga0495680_0927646 3300047322 Unclassified 561
966 Ga0495675_0351464 3300047444 Unclassified 867
967 Ga0495681_0265539 3300047470 Unclassified 673
968 Ga0495684_0000213 3300047471 Bacteria 45092
969 Ga0495684_0054033 3300047471 Bacteria 3064
970 Ga0495684_0081986 3300047471 Bacteria 2448
971 Ga0495684_0133546 3300047471 Unclassified 1863
972 Ga0495684_0263556 3300047471 Bacteria 1249
973 Ga0495684_0512294 3300047471 Bacteria 823
974 Ga0495614_0358976 3300048089 Unclassified 680
975 Ga0496107_1020680 3300048910 Unclassified 600
976 Ga0496108_0234197 3300048911 Bacteria 1597
977 Ga0496110_0771200 3300048913 Bacteria 865
978 Ga0496110_1212206 3300048913 Bacteria 664
979 Ga0496112_1671172 3300048915 Unclassified 549
980 Ga0496113_0770356 3300048916 Bacteria 765
981 Ga0501308_039345 3300049128 Bacteria 661
982 Ga0501305_059274 3300049161 Unclassified 656
983 Ga0501315_090741 3300049531 Bacteria 529
984 Ga0501320_063466 3300049536 Unclassified 523
985 Ga0501321_061889 3300049537 Unclassified 567
986 Ga0501031_0722964 3300049568 Unclassified 639
987 Ga0501033_0793391 3300049570 Unclassified 641
988 Ga0501036_0267076 3300049572 Unclassified 1433
989 Ga0501037_1147553 3300049573 Unclassified 502
990 Ga0501038_0290109 3300049574 Unclassified 1286
991 Ga0501039_0061997 3300049575 Bacteria 2897
992 Ga0501039_1334106 3300049575 Unclassified 553
993 Ga0501040_0069743 3300049576 Bacteria 2425
994 Ga0501041_0230769 3300049577 Bacteria 1162
995 Ga0501041_0341556 3300049577 Bacteria 946
996 Ga0501042_0137141 3300049578 Bacteria 1764
997 Ga0501042_0242403 3300049578 Bacteria 1301
998 Ga0501042_0532042 3300049578 Unclassified 854
999 Ga0501042_0766320 3300049578 Bacteria 702
1000 Ga0501048_0475092 3300049582 Unclassified 896
1001 Ga0501068_0346770 3300049584 Bacteria 954
1002 Ga0501070_0538346 3300049586 Bacteria 936
1003 Ga0501071_0081988 3300049587 Unclassified 2361
1004 Ga0501071_0570737 3300049587 Bacteria 869
1005 Ga0501072_1007177 3300049588 Unclassified 649
1006 Ga0501074_0525037 3300049590 Bacteria 838
1007 Ga0501075_0306111 3300049591 Bacteria 1211
1008 Ga0501075_1089682 3300049591 Unclassified 607
1009 Ga0501076_0012265 3300049592 Bacteria 6409
1010 Ga0501076_0351393 3300049592 Bacteria 1210
1011 Ga0501076_1110819 3300049592 Unclassified 651
1012 Ga0501077_0810180 3300049593 Unclassified 602
1013 Ga0501077_0970953 3300049593 Bacteria 547
1014 Ga0501249_016417 3300049679 Bacteria 1590
1015 Ga0501249_072039 3300049679 Unclassified 808
1016 Ga0501245_153355 3300049708 Unclassified 511
1017 Ga0501079_0031577 3300049741 Bacteria 4071
1018 Ga0501081_1040730 3300049743 Unclassified 619
1019 Ga0501271_048692 3300049768 Unclassified 570
1020 Ga0501283_054330 3300049779 Bacteria 714
1021 Ga0501045_0076002 3300049824 Bacteria 2474
1022 Ga0501045_0326437 3300049824 Bacteria 1142
1023 nmdc:mga05p37_101605_c1 3300050507 Bacteria 3540
1024 nmdc:mga05p37_1042632_c1 3300050507 Unclassified 864
1025 nmdc:mga05p37_11531_c1 3300050507 Bacteria 10529
1026 nmdc:mga05p37_132541_c1 3300050507 Bacteria 3057
1027 nmdc:mga05p37_152388_c1 3300050507 Unclassified 2827
1028 nmdc:mga05p37_487067_c1 3300050507 Bacteria 1419
1029 nmdc:mga05p37_624837_c1 3300050507 Bacteria 1211
1030 nmdc:mga09592_1080630_c1 3300050508 Bacteria 668
1031 nmdc:mga09592_43233_c1 3300050508 Bacteria 3792
1032 nmdc:mga09592_9695_c1 3300050508 Bacteria 6284
1033 nmdc:mga09592_9961_c1 3300050508 Bacteria 7732
1034 nmdc:mga0qj67_1010_c1 3300050509 Bacteria 19413
1035 nmdc:mga0qj67_16091_c2 3300050509 Bacteria 2546
1036 nmdc:mga0qj67_196631_c1 3300050509 Unclassified 1639
1037 nmdc:mga0qj67_211719_c1 3300050509 Unclassified 1574
1038 nmdc:mga0qj67_69057_c1 3300050509 Unclassified 2817
1039 nmdc:mga0qj67_990996_c1 3300050509 Bacteria 660
1040 nmdc:mga06r32_52440_c1 3300050510 Bacteria 3907
1041 nmdc:mga06r32_5760_c1 3300050510 Bacteria 11164
1042 nmdc:mga06r32_8623_c1 3300050510 Bacteria 9190
1043 nmdc:mga08y16_103044_c1 3300050511 Bacteria 2971
1044 nmdc:mga08y16_12043_c1 3300050511 Bacteria 9087
1045 nmdc:mga08y16_126031_c1 3300050511 Bacteria 2664
1046 nmdc:mga08y16_14264_c1 3300050511 Bacteria 8363
1047 nmdc:mga08y16_456996_c1 3300050511 Bacteria 1302
1048 nmdc:mga08y16_48777_c1 3300050511 Bacteria 4431
1049 nmdc:mga08y16_569920_c1 3300050511 Unclassified 1144
1050 nmdc:mga0n895_10466_c2 3300050512 Bacteria 3653
1051 nmdc:mga0n895_26617_c1 3300050512 Bacteria 5481
1052 nmdc:mga0n895_340283_c1 3300050512 Bacteria 1520
1053 nmdc:mga0n895_673657_c1 3300050512 Unclassified 1032
1054 nmdc:mga0rr50_1040000_c1 3300050513 Unclassified 697
1055 nmdc:mga0rr50_3269_c1 3300050513 Bacteria 9296
1056 nmdc:mga0rr50_379608_c1 3300050513 Bacteria 1192
1057 nmdc:mga0rr50_51384_c1 3300050513 Bacteria 3058
1058 nmdc:mga08x19_1057907_c1 3300050514 Bacteria 576
1059 nmdc:mga0a205_1562_c1 3300050515 Bacteria 19604
1060 nmdc:mga0a205_176753_c1 3300050515 Unclassified 2030
1061 nmdc:mga0a205_283890_c1 3300050515 Bacteria 1531
1062 nmdc:mga0a205_447_c1 3300050515 Bacteria 31860
1063 nmdc:mga0a205_5420_c1 3300050515 Bacteria 11503
1064 Ga0495601_0033313 3300053077 Bacteria 3210
1065 Ga0495612_0180982 3300053078 Bacteria 926
1066 Ga0495595_0076412 3300053084 Bacteria 1590
1067 Ga0495619_0002779 3300053085 Bacteria 11420
1068 Ga0495619_0161349 3300053085 Bacteria 1548
1069 Ga0501084_0097083 3300054114 Bacteria 2474
1070 Ga0501084_1326807 3300054114 Unclassified 603
1071 Ga0501084_1359834 3300054114 Unclassified 595
1072 Ga0587084_102479 3300059477 Unclassified 582
1073 Ga0587073_0085149 3300059492 Unclassified 793
1074 Ga0587073_0117497 3300059492 Archaea 713
1075 Ga0587083_0086995 3300059505 Unclassified 755
1076 Ga0587092_130068 3300059512 Unclassified 546
1077 Ga0587115_104972 3300059626 Bacteria 528
1078 Ga0587117_061676 3300059627 Bacteria 646
1079 Ga0587079_127218 3300059647 Unclassified 636
1080 Ga0587079_183514 3300059647 Unclassified 561
1081 Ga0501082_0236930 3300060353 Unclassified 1588
1082 Ga0501082_0595509 3300060353 Bacteria 967
1083 Ga0530510_0068212 3300061734 Bacteria 2580
1084 Ga0530510_0150363 3300061734 Bacteria 1719
1085 Ga0209996_1029159
1086 MRS1b_contig_5777746
1087 JGI24746J21847_1056352
1088 JGI24747J21853_1029968
1089 JGI24743J22301_10066454
1090 JGI24750J21931_1028425
1091 JGI24744J21845_10102481
1092 JGI24034J26672_10033601
1093 JGI24742J22300_10044319
1094 Ga0006765J45826_119689
1095 Ga0006778J45830_1088770
1096 Ga0006759J45824_1028470
1097 Ga0006759J45824_1037243
1098 Ga0006759J45824_1039726
1099 Ga0006759J45824_1059035
1100 Ga0006759J45824_1079571
1101 JGI25406J46586_10006131
1102 JGI25406J46586_10006252
1103 JGI25406J46586_10011237
1104 JGI25406J46586_10025102
1105 JGI25406J46586_10029195
1106 Ga0006770J48903_1037006
1107 Ga0006777J48905_1114579
1108 Ga0007417J51691_1022871
1109 Ga0007417J51691_1024922
1110 Ga0007410J51695_1018074
1111 Ga0007410J51695_1039180
1112 Ga0007409J51694_1026771
1113 Ga0007416J51690_1031709
1114 Ga0007416J51690_1038893
1115 Ga0007416J51690_1060112
1116 Ga0032354_1025555
1117 Ga0032354_1029260
1118 Ga0032354_1048698
1119 Ga0058858_1432881
1120 Ga0058859_10026949
1121 Ga0058859_10041449
1122 Ga0058859_10046910
1123 Ga0058859_10078578
1124 Ga0058859_10126710
1125 Ga0058859_10126987
1126 Ga0058859_10137091
1127 Ga0058859_11460156
1128 Ga0058859_11512003
1129 Ga0058859_11605069
1130 Ga0058859_11792330
1131 Ga0058859_11815650
1132 Ga0058863_10083060
1133 Ga0058863_11282215
1134 Ga0058863_11723477
1135 Ga0058863_11794519
1136 Ga0058863_11840946
1137 Ga0058863_11850213
1138 Ga0058863_11923835
1139 Ga0058861_10034176
1140 Ga0058861_10136379
1141 Ga0058861_11659293
1142 Ga0058861_11815246
1143 Ga0058861_11841430
1144 Ga0058861_11860914
1145 Ga0058861_11880184
1146 Ga0058861_11920879
1147 Ga0058861_11949659
1148 Ga0058860_10005183
1149 Ga0058860_10051366
1150 Ga0058860_10105618
1151 Ga0058860_10155442
1152 Ga0058860_11084365
1153 Ga0058860_12004642
1154 Ga0058860_12144544
1155 Ga0058860_12183639
1156 Ga0058860_12244112
1157 Ga0058862_10193550
1158 Ga0058862_11954123
1159 Ga0058862_12483175
1160 Ga0058862_12486888
1161 Ga0058862_12647495
1162 Ga0058862_12856078
1163 Ga0058862_12876065
1164 Ga0065714_10312694
1165 Ga0065714_10415629
1166 Ga0065712_10008521
1167 Ga0065712_10069898
1168 Ga0065712_10309503
1169 Ga0065712_10487943
1170 Ga0065712_10796919
1171 Ga0065715_10030244
1172 Ga0065715_10040528
1173 Ga0065715_10625707
1174 Ga0065715_10987622
1175 Ga0065707_10273897
1176 Ga0065707_10468479
1177 Ga0065707_10744246
1178 Ga0070658_10562710
1179 Ga0070676_10004761
1180 Ga0070676_10015593
1181 Ga0070676_10190864
1182 Ga0070676_10255413
1183 Ga0070676_10375109
1184 Ga0070676_10518990
1185 Ga0070683_100300494
1186 Ga0070683_101247784
1187 Ga0070690_100001322
1188 Ga0070690_100008747
1189 Ga0070690_100050288
1190 Ga0070690_100388152
1191 Ga0070690_100437970
1192 Ga0070690_100616077
1193 Ga0070690_100751774
1194 Ga0070690_100880130
1195 Ga0070670_100001926
1196 Ga0070670_100035613
1197 Ga0070670_100066566
1198 Ga0070670_100122996
1199 Ga0070670_100351062
1200 Ga0070670_101280247
1201 Ga0070670_102190468
1202 Ga0070677_10002632
1203 Ga0070677_10056606
1204 Ga0070677_10058268
1205 Ga0070677_10914225
1206 Ga0068869_100002137
1207 Ga0068869_100007360
1208 Ga0068869_100379895
1209 Ga0068869_100545120
1210 Ga0070666_10012451
1211 Ga0070666_10013448
1212 Ga0070666_10057791
1213 Ga0070680_101181970
1214 Ga0070682_100389863
1215 Ga0070682_100807339
1216 Ga0068868_100009452
1217 Ga0068868_100024652
1218 Ga0068868_100081795
1219 Ga0068868_101694428
1220 Ga0070660_101052448
1221 Ga0070689_100088178
1222 Ga0070689_100099927
1223 Ga0070689_100106600
1224 Ga0070689_100606628
1225 Ga0070691_10848017
1226 Ga0070687_100056560
1227 Ga0070687_100062483
1228 Ga0070687_100569057
1229 Ga0070661_100009146
1230 Ga0070661_100015584
1231 Ga0070661_100110436
1232 Ga0070661_101472074
1233 Ga0070692_10313636
1234 Ga0070692_10450837
1235 Ga0070692_10503914
1236 Ga0070668_100420722
1237 Ga0070668_100833366
1238 Ga0070669_100095019
1239 Ga0070669_100346750
1240 Ga0070669_100502898
1241 Ga0070669_100895726
1242 Ga0070675_100002090
1243 Ga0070675_100002256
1244 Ga0070675_100120637
1245 Ga0070675_100196210
1246 Ga0070675_100217309
1247 Ga0070675_100327615
1248 Ga0070675_100477775
1249 Ga0070675_100861329
1250 Ga0070675_101090551
1251 Ga0070671_100055572
1252 Ga0070671_100082526
1253 Ga0070671_100751455
1254 Ga0070674_100000886
1255 Ga0070674_100143868
1256 Ga0070674_100157571
1257 Ga0070674_100433185
1258 Ga0070674_100774844
1259 Ga0070674_102039985
1260 Ga0070673_100006055
1261 Ga0070673_100025160
1262 Ga0070673_100034975
1263 Ga0070673_100087081
1264 Ga0070673_100087788
1265 Ga0070673_100097088
1266 Ga0070673_100168633
1267 Ga0070673_100179468
1268 Ga0070673_101498766
1269 Ga0070673_102291341
1270 Ga0070688_100055823
1271 Ga0070688_100101625
1272 Ga0070688_100141065
1273 Ga0070688_101014252
1274 Ga0070688_101499881
1275 Ga0070659_100275636
1276 Ga0070659_100856003
1277 Ga0070667_100011039
1278 Ga0070667_100016345
1279 Ga0070667_100185177
1280 Ga0070667_100357246
1281 Ga0070667_100903809
1282 Ga0070667_101696296
1283 Ga0070703_10038536
1284 Ga0070709_10293493
1285 Ga0070713_100008352
1286 Ga0070713_100016901
1287 Ga0070710_10126494
1288 Ga0070701_10028491
1289 Ga0070701_10346443
1290 Ga0070701_10472688
1291 Ga0070701_10638180
1292 Ga0070711_100082047
1293 Ga0070705_100247770
1294 Ga0070700_100658735
1295 Ga0070700_101011706
1296 Ga0070694_100002432
1297 Ga0070694_100060666
1298 Ga0070694_100123078
1299 Ga0070694_101010233
1300 Ga0070694_101354373
1301 Ga0070694_101759469
1302 Ga0070708_100206293
1303 Ga0070678_100020013
1304 Ga0070678_100086605
1305 Ga0070678_100207890
1306 Ga0070678_100250259
1307 Ga0070678_100429136
1308 Ga0070678_100458116
1309 Ga0070678_100675839
1310 Ga0070678_101222360
1311 Ga0070678_101391975
1312 Ga0070662_100021066
1313 Ga0070662_100140882
1314 Ga0070662_101666612
1315 Ga0070681_10563192
1316 Ga0070681_10895117
1317 Ga0068867_100041600
1318 Ga0068867_100172683
1319 Ga0068867_100385134
1320 Ga0068867_100389261
1321 Ga0068867_101337525
1322 Ga0070685_10085330
1323 Ga0070685_10463749
1324 Ga0070685_10606178
1325 Ga0070685_11218565
1326 Ga0070685_11536090
1327 Ga0070706_100944354
1328 Ga0070707_100052627
1329 Ga0070707_100268217
1330 Ga0070707_100678873
1331 Ga0070698_100239132
1332 Ga0070698_100642053
1333 Ga0070698_101209240
1334 Ga0070699_100328089
1335 Ga0070699_100350401
1336 Ga0070679_100410876
1337 Ga0070679_101643129
1338 Ga0070679_101748045
1339 Ga0070684_100145486
1340 Ga0070684_100649211
1341 Ga0070697_100412378
1342 Ga0070697_100580194
1343 Ga0070697_102044297
1344 Ga0070672_100007756
1345 Ga0070672_100070011
1346 Ga0070672_100154032
1347 Ga0070672_100192204
1348 Ga0070672_100494566
1349 Ga0070672_100579221
1350 Ga0070672_100775851
1351 Ga0070672_101091232
1352 Ga0070686_100004772
1353 Ga0070686_100094519
1354 Ga0070686_100095154
1355 Ga0070686_100296267
1356 Ga0070686_100492607
1357 Ga0070695_100002378
1358 Ga0070695_100355968
1359 Ga0070695_100625921
1360 Ga0070696_100038105
1361 Ga0070696_100054711
1362 Ga0070696_100083707
1363 Ga0070696_100116180
1364 Ga0070696_100408015
1365 Ga0070665_100018571
1366 Ga0070665_100240777
1367 Ga0070704_100011387
1368 Ga0070664_100000508
1369 Ga0070664_100000777
1370 Ga0070664_100001566
1371 Ga0070664_100038915
1372 Ga0070664_100660119
1373 Ga0070664_100662596
1374 Ga0068857_100185957
1375 Ga0068857_100955366
1376 Ga0068857_101529128
1377 Ga0068854_100096744
1378 Ga0070702_100129223
1379 Ga0070702_100735481
1380 Ga0070702_101863902
1381 Ga0068852_100373732
1382 Ga0068852_101033724
1383 Ga0068859_100030951
1384 Ga0068859_100084276
1385 Ga0068859_100116245
1386 Ga0068859_100125942
1387 Ga0068859_100145523
1388 Ga0068859_100169629
1389 Ga0068859_100458607
1390 Ga0068859_100738246
1391 Ga0068859_101054128
1392 Ga0068859_101647792
1393 Ga0068859_102270481
1394 Ga0068864_100001955
1395 Ga0068864_100016892
1396 Ga0068864_100032637
1397 Ga0068864_100051480
1398 Ga0068864_100624365
1399 Ga0068864_101196096
1400 Ga0068864_101336734
1401 Ga0068866_10255411
1402 Ga0068866_10282716
1403 Ga0068866_11332021
1404 Ga0068861_100040419
1405 Ga0068861_100053271
1406 Ga0068861_100117895
1407 Ga0068861_100159613
1408 Ga0068861_100373454
1409 Ga0068861_100573579
1410 Ga0068861_100637250
1411 Ga0068861_100900015
1412 Ga0068861_101097138
1413 Ga0068851_10158083
1414 Ga0068851_10336477
1415 Ga0068870_10003483
1416 Ga0068870_10048919
1417 Ga0068870_10101955
1418 Ga0068870_10138160
1419 Ga0068870_10309809
1420 Ga0068870_10826298
1421 Ga0068863_100006787
1422 Ga0068863_100061190
1423 Ga0068863_100091448
1424 Ga0068863_100352936
1425 Ga0068863_100470819
1426 Ga0068863_100494416
1427 Ga0068863_100508268
1428 Ga0068863_100576130
1429 Ga0068863_100842615
1430 Ga0068863_102136646
1431 Ga0068858_100049801
1432 Ga0068858_100053429
1433 Ga0068858_100060443
1434 Ga0068858_100091515
1435 Ga0068858_100323799
1436 Ga0068858_100579328
1437 Ga0068860_100030936
1438 Ga0068860_100285530
1439 Ga0068860_101402766
1440 Ga0068860_102554422
1441 Ga0068862_100042105
1442 Ga0068862_100321342
1443 Ga0068862_100512126
1444 Ga0068862_100743220
1445 Ga0068862_100896566
1446 Ga0068862_100918250
1447 Ga0068862_101239094
1448 Ga0081455_10121568
1449 Ga0081455_10797153
1450 Ga0081539_10000133
1451 Ga0081539_10000329
1452 Ga0081539_10005236
1453 Ga0075432_10013769
1454 Ga0070715_10264999
1455 Ga0097621_100004942
1456 Ga0097621_100083160
1457 Ga0097621_100106178
1458 Ga0097621_100220674
1459 Ga0097621_100278806
1460 Ga0097621_100599232
1461 Ga0097621_100620811
1462 Ga0097621_101721143
1463 Ga0097621_102297626
1464 Ga0068871_100000568
1465 Ga0068871_100063687
1466 Ga0068871_100141280
1467 Ga0068871_100145951
1468 Ga0068871_100235006
1469 Ga0068871_100335932
1470 Ga0068871_100354613
1471 Ga0068871_100670980
1472 Ga0068871_100729491
1473 Ga0068871_100909712
1474 Ga0075428_100008383
1475 Ga0075428_100016065
1476 Ga0075428_100016769
1477 Ga0075428_100029402
1478 Ga0075428_100841320
1479 Ga0075428_100940955
1480 Ga0075428_101045280
1481 Ga0075430_100009192
1482 Ga0075430_100015340
1483 Ga0075430_100045019
1484 Ga0075430_100127371
1485 Ga0075430_100132865
1486 Ga0075430_100155074
1487 Ga0075430_101013758
1488 Ga0075430_101310817
1489 Ga0075431_100006482
1490 Ga0075431_100006533
1491 Ga0075431_100009194
1492 Ga0075431_100151409
1493 Ga0075433_10000629
1494 Ga0075433_10006287
1495 Ga0075433_10127724
1496 Ga0075433_10176086
1497 Ga0075433_10323396
1498 Ga0075433_10780086
1499 Ga0075434_100050439
1500 Ga0075434_100119953
1501 Ga0075434_100172414
1502 Ga0075434_100508667
1503 Ga0075429_100012736
1504 Ga0075429_100012997
1505 Ga0075429_100017263
1506 Ga0075429_100039720
1507 Ga0075429_100432837
1508 Ga0068865_100031357
1509 Ga0068865_100208248
1510 Ga0068865_100483312
1511 Ga0068865_100660031
1512 Ga0068865_100770477
1513 Ga0075436_100169159
1514 Ga0075436_101137922
1515 Ga0097620_100030951
1516 Ga0097620_100084278
1517 Ga0097620_100116241
1518 Ga0097620_100125949
1519 Ga0097620_100145520
1520 Ga0097620_100169619
1521 Ga0097620_100458610
1522 Ga0097620_100738229
1523 Ga0097620_101054037
1524 Ga0097620_101647776
1525 Ga0097620_102270379
1526 Ga0075435_100000725
1527 Ga0075435_100009913
1528 Ga0075435_100126562
1529 Ga0075435_100222304
1530 Ga0075435_101552773
1531 Ga0105244_10233077
1532 Ga0111539_10009474
1533 Ga0111539_10019921
1534 Ga0111539_10024909
1535 Ga0111539_10026447
1536 Ga0111539_10036678
1537 Ga0111539_10041446
1538 Ga0111539_10064583
1539 Ga0111539_10382256
1540 Ga0111539_10670504
1541 Ga0105245_10561016
1542 Ga0105245_10587970
1543 Ga0105245_10589073
1544 Ga0105245_11563503
1545 Ga0105245_11955339
1546 Ga0105247_10328988
1547 Ga0105247_10419111
1548 Ga0114129_10013443
1549 Ga0114129_10045450
1550 Ga0114129_10066168
1551 Ga0114129_10168326
1552 Ga0114129_10191100
1553 Ga0114129_10404571
1554 Ga0114129_10515153
1555 Ga0105243_10038297
1556 Ga0105243_10044742
1557 Ga0105243_12414187
1558 Ga0105243_13084620
1559 Ga0105242_10018370
1560 Ga0105242_10271885
1561 Ga0105242_10327650
1562 Ga0105248_10001517
1563 Ga0105248_10001944
1564 Ga0105248_10020509
1565 Ga0105248_10093632
1566 Ga0105248_10117287
1567 Ga0105248_10574557
1568 Ga0105248_10580338
1569 Ga0105248_10924951
1570 Ga0105248_11393934
1571 Ga0105248_12083592
1572 Ga0105238_10017272
1573 Ga0105238_10824068
1574 Ga0105249_10023740
1575 Ga0105249_10245886
1576 Ga0105249_10643576
1577 Ga0105249_11270174
1578 Ga0105246_10124085
1579 Ga0105246_10338591
1580 Ga0105246_10403085
1581 Ga0105246_11011200
1582 Ga0105246_11405420
1583 Ga0157319_1020015
1584 Ga0157371_10309502
1585 Ga0157374_10279857
1586 Ga0157374_10310109
1587 Ga0157374_10623469
1588 Ga0157374_11130368
1589 Ga0157378_10052770
1590 Ga0157378_10087855
1591 Ga0157378_10428634
1592 Ga0157378_10504196
1593 Ga0163162_10004920
1594 Ga0163162_10006636
1595 Ga0163162_10038924
1596 Ga0163162_10071757
1597 Ga0163162_10506394
1598 Ga0163162_10669783
1599 Ga0163162_11508193
1600 Ga0163162_11699803
1601 Ga0163162_11794340
1602 Ga0163162_12335039
1603 Ga0157372_12028297
1604 Ga0157375_10063280
1605 Ga0157375_10146286
1606 Ga0157375_10428975
1607 Ga0157375_10830745
1608 Ga0157375_10871944
1609 Ga0157375_11002738
1610 Ga0157375_11132466
1611 Ga0157375_11210806
1612 Ga0163163_10001063
1613 Ga0163163_10006058
1614 Ga0163163_10020811
1615 Ga0163163_10026210
1616 Ga0163163_10183550
1617 Ga0163163_10392761
1618 Ga0163163_10730724
1619 Ga0163163_10849677
1620 Ga0157380_10006441
1621 Ga0157380_10007437
1622 Ga0157380_10043947
1623 Ga0157380_10077491
1624 Ga0157380_10214769
1625 Ga0157380_10252381
1626 Ga0157380_13009978
1627 Ga0157377_10002509
1628 Ga0157377_10104308
1629 Ga0157377_10197566
1630 Ga0157377_10199245
1631 Ga0157377_10299273
1632 Ga0157377_10351628
1633 Ga0157379_10187924
1634 Ga0157379_10439316
1635 Ga0157376_10009221
1636 Ga0157376_10069205
1637 Ga0157376_10083392
1638 Ga0157376_10133647
1639 Ga0157376_10460734
1640 Ga0157376_10540458
1641 Ga0157376_10692316
1642 Ga0157376_10712687
1643 Ga0157376_11057680
1644 Ga0157376_11885820
1645 Ga0163161_10043995
1646 Ga0163161_10062221
1647 Ga0163161_10174958
1648 Ga0163161_10622621
1649 Ga0163161_10675700
1650 Ga0197907_11064887
1651 Ga0206356_10295248
1652 Ga0206356_11338882
1653 Ga0206349_1579484
1654 Ga0206349_1745606
1655 Ga0206352_10240803
1656 Ga0206352_10435217
1657 Ga0206352_10459886
1658 Ga0206352_10684472
1659 Ga0206352_10789063
1660 Ga0206352_10808230
1661 Ga0206350_10603039
1662 Ga0206350_11293131
1663 Ga0206350_11655528
1664 Ga0206354_11378251
1665 Ga0206353_11760492
1666 Ga0206353_11983827
1667 Ga0224712_10279338
1668 Ga0224712_10317047
1669 Ga0207666_1016382
1670 Ga0207673_1046337
1671 Ga0207697_10021544
1672 Ga0207697_10089813
1673 Ga0207697_10125669
1674 Ga0207697_10172905
1675 Ga0207656_10171150
1676 Ga0207653_10091567
1677 Ga0207682_10003633
1678 Ga0207682_10021350
1679 Ga0207682_10027680
1680 Ga0207682_10038379
1681 Ga0207682_10057813
1682 Ga0207682_10184607
1683 Ga0207692_10771792
1684 Ga0207642_10048207
1685 Ga0207688_10015436
1686 Ga0207688_10177251
1687 Ga0207688_10208009
1688 Ga0207680_10007945
1689 Ga0207680_10017707
1690 Ga0207680_10117060
1691 Ga0207680_10199483
1692 Ga0207685_10117996
1693 Ga0207685_10169964
1694 Ga0207699_10020357
1695 Ga0207699_10057371
1696 Ga0207645_10001298
1697 Ga0207645_10010593
1698 Ga0207645_10015451
1699 Ga0207645_10365288
1700 Ga0207643_10001468
1701 Ga0207643_10004046
1702 Ga0207643_10023721
1703 Ga0207643_10036792
1704 Ga0207643_10056693
1705 Ga0207643_10097705
1706 Ga0207643_10121432
1707 Ga0207643_10226116
1708 Ga0207643_10259338
1709 Ga0207707_10040412
1710 Ga0207707_10098983
1711 Ga0207707_10202660
1712 Ga0207707_10923223
1713 Ga0207707_10957488
1714 Ga0207660_10653666
1715 Ga0207660_10973501
1716 Ga0207662_10034684
1717 Ga0207662_10042957
1718 Ga0207662_10833656
1719 Ga0207662_10951754
1720 Ga0207657_10500561
1721 Ga0207657_11013174
1722 Ga0207649_10013669
1723 Ga0207649_10048687
1724 Ga0207649_10088917
1725 Ga0207652_10847973
1726 Ga0207646_10726633
1727 Ga0207646_11566500
1728 Ga0207681_10104603
1729 Ga0207681_10146942
1730 Ga0207681_10415836
1731 Ga0207681_10698962
1732 Ga0207681_11192343
1733 Ga0207681_11300194
1734 Ga0207694_10001914
1735 Ga0207694_10312082
1736 Ga0207650_10000444
1737 Ga0207650_10008206
1738 Ga0207650_10026771
1739 Ga0207650_10030746
1740 Ga0207650_10061140
1741 Ga0207650_10857860
1742 Ga0207650_11037574
1743 Ga0207650_11623018
1744 Ga0207659_10018306
1745 Ga0207659_10022541
1746 Ga0207659_10071465
1747 Ga0207659_10200545
1748 Ga0207659_10245784
1749 Ga0207659_10379614
1750 Ga0207659_10531082
1751 Ga0207659_10637246
1752 Ga0207659_10658386
1753 Ga0207659_10895009
1754 Ga0207659_11599087
1755 Ga0207687_10239498
1756 Ga0207700_10001848
1757 Ga0207700_10154681
1758 Ga0207644_10151257
1759 Ga0207644_10405017
1760 Ga0207644_10423968
1761 Ga0207690_10096866
1762 Ga0207690_11123907
1763 Ga0207706_10011838
1764 Ga0207706_10162045
1765 Ga0207706_10462887
1766 Ga0207706_10533525
1767 Ga0207686_10004639
1768 Ga0207686_10311369
1769 Ga0207686_11524530
1770 Ga0207709_10007046
1771 Ga0207709_10099178
1772 Ga0207709_10510013
1773 Ga0207670_10050526
1774 Ga0207670_10093849
1775 Ga0207670_10143450
1776 Ga0207670_10211011
1777 Ga0207670_10387903
1778 Ga0207670_11348098
1779 Ga0207669_10049870
1780 Ga0207669_10069194
1781 Ga0207669_10076983
1782 Ga0207669_10142835
1783 Ga0207704_10019639
1784 Ga0207704_10087191
1785 Ga0207704_10130706
1786 Ga0207704_10242141
1787 Ga0207704_10362442
1788 Ga0207665_10337223
1789 Ga0207691_10005742
1790 Ga0207691_10029518
1791 Ga0207691_10029580
1792 Ga0207691_10060228
1793 Ga0207691_10072536
1794 Ga0207691_10083937
1795 Ga0207691_10326382
1796 Ga0207691_10361489
1797 Ga0207691_10375308
1798 Ga0207691_10497650
1799 Ga0207691_10602285
1800 Ga0207691_10849236
1801 Ga0207691_10924073
1802 Ga0207711_10035868
1803 Ga0207711_10053293
1804 Ga0207711_10556610
1805 Ga0207711_11027311
1806 Ga0207689_10015899
1807 Ga0207689_10080645
1808 Ga0207689_10128041
1809 Ga0207661_10356837
1810 Ga0207679_10002310
1811 Ga0207679_10004151
1812 Ga0207679_10006713
1813 Ga0207679_10037678
1814 Ga0207679_10114572
1815 Ga0207679_10568348
1816 Ga0207679_10951207
1817 Ga0207667_11857241
1818 Ga0207651_10048365
1819 Ga0207651_10061313
1820 Ga0207651_10243056
1821 Ga0207651_11434873
1822 Ga0207712_10010441
1823 Ga0207712_10033145
1824 Ga0207712_10098510
1825 Ga0207712_10538935
1826 Ga0207668_10250899
1827 Ga0207668_10968633
1828 Ga0207668_11050528
1829 Ga0207640_10073692
1830 Ga0207658_10006375
1831 Ga0207658_10131117
1832 Ga0207658_10775736
1833 Ga0207658_11092806
1834 Ga0207658_11260971
1835 Ga0207677_10008838
1836 Ga0207677_10169361
1837 Ga0207677_10243815
1838 Ga0207677_10547265
1839 Ga0207703_10045243
1840 Ga0207703_10109644
1841 Ga0207703_10392473
1842 Ga0207703_10394550
1843 Ga0207703_10791929
1844 Ga0207678_10066128
1845 Ga0207708_10047881
1846 Ga0207708_10065875
1847 Ga0207708_10181010
1848 Ga0207708_10229742
1849 Ga0207708_10427741
1850 Ga0207708_10640588
1851 Ga0207708_10699181
1852 Ga0207641_10026440
1853 Ga0207641_10045780
1854 Ga0207641_10433139
1855 Ga0207641_10492034
1856 Ga0207641_10803812
1857 Ga0207641_10839825
1858 Ga0207641_10842728
1859 Ga0207641_10962386
1860 Ga0207641_12549783
1861 Ga0207648_10002543
1862 Ga0207648_10045092
1863 Ga0207648_10046886
1864 Ga0207648_10155578
1865 Ga0207648_10222971
1866 Ga0207648_10458878
1867 Ga0207648_11155323
1868 Ga0207648_11466597
1869 Ga0207676_10001140
1870 Ga0207676_10033261
1871 Ga0207676_10050009
1872 Ga0207676_10086124
1873 Ga0207676_10826343
1874 Ga0207676_11515952
1875 Ga0207674_10349087
1876 Ga0207674_10410015
1877 Ga0207674_10504647
1878 Ga0207675_100022758
1879 Ga0207675_100050204
1880 Ga0207675_100060016
1881 Ga0207675_100233173
1882 Ga0207675_100678973
1883 Ga0207675_100815849
1884 Ga0207683_10012865
1885 Ga0207683_10039566
1886 Ga0207683_10101200
1887 Ga0207683_10114527
1888 Ga0207683_10143665
1889 Ga0207683_10156716
1890 Ga0207683_10332684
1891 Ga0207683_10852843
1892 Ga0207683_11240104
1893 Ga0207683_11674409
1894 Ga0207683_11968377
1895 Ga0207698_10633523
1896 Ga0207698_11154225
1897 Ga0209966_1030286
1898 Ga0209974_10050858
1899 Ga0207428_10000737
1900 Ga0207428_10015072
1901 Ga0207428_10111516
1902 Ga0207428_10161695
1903 Ga0207428_10171107
1904 Ga0207428_10470100
1905 Ga0207428_10916189
1906 Ga0268266_10203889
1907 Ga0268266_12212342
1908 Ga0268265_10055983
1909 Ga0268265_10069478
1910 Ga0268265_10368439
1911 Ga0268265_10566780
1912 Ga0268265_10700890
1913 Ga0268264_10018520
1914 Ga0268264_11047025
1915 Ga0268264_11095719
1916 Ga0268264_12011903
1917 Ga0268264_12352865
1918 Ga0265766_1012685
1919 Ga0307405_10694688
1920 Ga0307409_102199855
1921 Ga0307416_100126286
1922 Ga0307416_100583921
1923 Ga0307416_103431786
1924 Ga0307411_10694448
1925 Ga0373958_0111216
1926 Ga0373934_0192326
1927 Ga0373951_0067567
1928 Ga0373923_0185023
1929 Ga0373953_0013290
1930 Ga0373953_0058625
1931 Ga0373954_0164777
1932 Ga0373956_0214315
1933 Ga0373956_0287846
1934 Ga0373956_0332099
1935 Ga0373956_0351300
1936 Ga0373957_0074125
1937 Ga0373957_0263769
1938 Ga0373957_0402846
1939 Ga0373955_0093818
1940 Ga0373955_0225736
1941 Ga0373955_0251665
1942 Ga0373955_0605334
1943 Ga0373962_0025225
1944 Ga0373924_0296791
1945 Ga0373931_0894961
1946 Ga0373935_0504493
1947 Ga0373927_0620039
1948 Ga0373937_0008123
1949 Ga0373937_0008508
1950 Ga0373937_0032356
1951 Ga0373937_0069353
1952 Ga0373937_0108614
1953 Ga0373937_0294226
1954 Ga0373937_0353052
1955 Ga0373937_0963108
1956 Ga0373925_1425682
1957 Ga0436365_1792320
1958 Ga0439453_0055457
1959 Ga0451798_0799210
1960 Ga0451802_0925699
1961 Ga0451853_3575839
1962 Ga0439450_007173
1963 Ga0439455_0178000
1964 Ga0439444_0031059
1965 Ga0439460_0114322
1966 Ga0439460_0115636
1967 Ga0450916_000521
1968 Ga0451576_0191432
1969 Ga0451576_0684140
1970 Ga0451576_0694000
1971 Ga0495592_0027743
1972 Ga0495592_0051359
1973 Ga0495592_0135001
1974 Ga0495603_0100533
1975 Ga0495629_0026701
1976 Ga0495629_0327491
1977 Ga0495629_0642645
1978 Ga0495651_0975918
1979 Ga0495653_0213493
1980 Ga0495653_0568185
1981 Ga0495580_0027778
1982 Ga0495580_0153936
1983 Ga0495580_0154271
1984 Ga0495580_0760740
1985 Ga0495582_0329047
1986 Ga0495639_0098601
1987 Ga0495662_0195082
1988 Ga0495662_0208821
1989 Ga0495664_0125107
1990 Ga0495664_0411506
1991 Ga0495594_0015076
1992 Ga0495594_0457286
1993 Ga0495608_0010456
1994 Ga0495608_0019307
1995 Ga0495618_0134348
1996 Ga0495618_0859922
1997 Ga0495628_0023317
1998 Ga0495630_0008571
1999 Ga0495630_0069380
2000 Ga0495630_0179334
2001 Ga0495630_0330300
2002 Ga0495652_0621223
2003 Ga0495640_0630953
2004 Ga0495586_0039774
2005 Ga0495586_0784856
2006 Ga0495598_0017022
2007 Ga0495621_0124459
2008 Ga0495621_0343075
2009 Ga0495621_0396057
2010 Ga0495645_0055392
2011 Ga0495667_0000776
2012 Ga0495667_0004456
2013 Ga0495667_0079754
2014 Ga0495656_0061613
2015 Ga0495656_0106196
2016 Ga0495634_0039953
2017 Ga0495634_0081494
2018 Ga0495634_0102217
2019 Ga0495611_0523728
2020 Ga0495635_0291583
2021 Ga0495659_0055959
2022 Ga0495659_0251844
2023 Ga0495661_0259399
2024 Ga0495657_0004256
2025 Ga0495657_0006819
2026 Ga0495599_0087243
2027 Ga0495658_0634609
2028 Ga0495669_0005724
2029 Ga0495613_0000464
2030 Ga0495613_0055782
2031 Ga0495613_0057238
2032 Ga0495613_0078784
2033 Ga0495613_0104834
2034 Ga0495613_0553866
2035 Ga0495670_0143768
2036 Ga0495670_0206543
2037 Ga0495600_0219244
2038 Ga0495600_0844123
2039 Ga0495604_0028365
2040 Ga0495636_0424026
2041 Ga0495674_0045727
2042 Ga0495674_0066105
2043 Ga0495674_0135662
2044 Ga0495674_0248641
2045 Ga0495674_1034375
2046 Ga0495672_0301256
2047 Ga0495680_0172039
2048 Ga0495680_0215605
2049 Ga0495680_0927646
2050 Ga0495675_0351464
2051 Ga0495681_0265539
2052 Ga0495684_0000213
2053 Ga0495684_0054033
2054 Ga0495684_0081986
2055 Ga0495684_0133546
2056 Ga0495684_0263556
2057 Ga0495684_0512294
2058 Ga0495614_0358976
2059 Ga0496107_1020680
2060 Ga0496108_0234197
2061 Ga0496110_0771200
2062 Ga0496110_1212206
2063 Ga0496112_1671172
2064 Ga0496113_0770356
2065 Ga0501308_039345
2066 Ga0501305_059274
2067 Ga0501315_090741
2068 Ga0501320_063466
2069 Ga0501321_061889
2070 Ga0501031_0722964
2071 Ga0501033_0793391
2072 Ga0501036_0267076
2073 Ga0501037_1147553
2074 Ga0501038_0290109
2075 Ga0501039_0061997
2076 Ga0501039_1334106
2077 Ga0501040_0069743
2078 Ga0501041_0230769
2079 Ga0501041_0341556
2080 Ga0501042_0137141
2081 Ga0501042_0242403
2082 Ga0501042_0532042
2083 Ga0501042_0766320
2084 Ga0501048_0475092
2085 Ga0501068_0346770
2086 Ga0501070_0538346
2087 Ga0501071_0081988
2088 Ga0501071_0570737
2089 Ga0501072_1007177
2090 Ga0501074_0525037
2091 Ga0501075_0306111
2092 Ga0501075_1089682
2093 Ga0501076_0012265
2094 Ga0501076_0351393
2095 Ga0501076_1110819
2096 Ga0501077_0810180
2097 Ga0501077_0970953
2098 Ga0501249_016417
2099 Ga0501249_072039
2100 Ga0501245_153355
2101 Ga0501079_0031577
2102 Ga0501081_1040730
2103 Ga0501271_048692
2104 Ga0501283_054330
2105 Ga0501045_0076002
2106 Ga0501045_0326437
2107 nmdc:mga05p37_101605_c1
2108 nmdc:mga05p37_1042632_c1
2109 nmdc:mga05p37_11531_c1
2110 nmdc:mga05p37_132541_c1
2111 nmdc:mga05p37_152388_c1
2112 nmdc:mga05p37_487067_c1
2113 nmdc:mga05p37_624837_c1
2114 nmdc:mga09592_1080630_c1
2115 nmdc:mga09592_43233_c1
2116 nmdc:mga09592_9695_c1
2117 nmdc:mga09592_9961_c1
2118 nmdc:mga0qj67_1010_c1
2119 nmdc:mga0qj67_16091_c2
2120 nmdc:mga0qj67_196631_c1
2121 nmdc:mga0qj67_211719_c1
2122 nmdc:mga0qj67_69057_c1
2123 nmdc:mga0qj67_990996_c1
2124 nmdc:mga06r32_52440_c1
2125 nmdc:mga06r32_5760_c1
2126 nmdc:mga06r32_8623_c1
2127 nmdc:mga08y16_103044_c1
2128 nmdc:mga08y16_12043_c1
2129 nmdc:mga08y16_126031_c1
2130 nmdc:mga08y16_14264_c1
2131 nmdc:mga08y16_456996_c1
2132 nmdc:mga08y16_48777_c1
2133 nmdc:mga08y16_569920_c1
2134 nmdc:mga0n895_10466_c2
2135 nmdc:mga0n895_26617_c1
2136 nmdc:mga0n895_340283_c1
2137 nmdc:mga0n895_673657_c1
2138 nmdc:mga0rr50_1040000_c1
2139 nmdc:mga0rr50_3269_c1
2140 nmdc:mga0rr50_379608_c1
2141 nmdc:mga0rr50_51384_c1
2142 nmdc:mga08x19_1057907_c1
2143 nmdc:mga0a205_1562_c1
2144 nmdc:mga0a205_176753_c1
2145 nmdc:mga0a205_283890_c1
2146 nmdc:mga0a205_447_c1
2147 nmdc:mga0a205_5420_c1
2148 Ga0495601_0033313
2149 Ga0495612_0180982
2150 Ga0495595_0076412
2151 Ga0495619_0002779
2152 Ga0495619_0161349
2153 Ga0501084_0097083
2154 Ga0501084_1326807
2155 Ga0501084_1359834
2156 Ga0587084_102479
2157 Ga0587073_0085149
2158 Ga0587073_0117497
2159 Ga0587083_0086995
2160 Ga0587092_130068
2161 Ga0587115_104972
2162 Ga0587117_061676
2163 Ga0587079_127218
2164 Ga0587079_183514
2165 Ga0501082_0236930
2166 Ga0501082_0595509
2167 Ga0530510_0068212
2168 Ga0530510_0150363

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

13

113

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uzt-assembly1.cif.gz_A crystal structure of rptp alpha 0.8643 43 73
6kr4-assembly4.cif.gz_D crystal structure of the liprin-alpha3_sam123/lar_d1d2 complex 0.8397 43 77
6kr4-assembly3.cif.gz_C crystal structure of the liprin-alpha3_sam123/lar_d1d2 complex 0.8244 43 77
7f5o-assembly2.cif.gz_B crystal structure of ptpn2 catalytic domain 0.8225 43 76
2pa5-assembly2.cif.gz_B crystal structure of human protein tyrosine phosphatase ptpn9 0.8215 39 76
ID Description Score Start End Superfamily
af_A0A143ZXZ0_952_1068_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8811 42 71 2.30.29.30
af_Q64512_2131_2444_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8455 43 76 3.90.190.10
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8361 38 97 2.40.50.140
af_O44180_216_527_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8293 43 77 3.90.190.10
4ge6A00 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8197 39 77 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9744 31 124
AF-A0A2T5GGJ4-F1-model_v4 Uncharacterized protein 0.9705 35 126
AF-A0A1M3P5H5-F1-model_v4 DUF5666 domain-containing protein 0.9659 39 126
AF-A0A521RFX0-F1-model_v4 Uncharacterized protein 0.9643 31 131
AF-A0A2V8DL04-F1-model_v4 DUF5666 domain-containing protein 0.9642 37 134

Map