F489743
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1084 | 345 | 2168 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300027395|Ga0209996_1029159|Ga0209996_10291591 |
| Length | 160 |
| Sequence | MRTKCAVVVAGIALLVSVVGVSAHHSFSAEFDASKPFKMTGTVTKVEWMNPHTFFYIDVTDEKTGKVTNWAMEMGSPNGLMRAGWTRNTMKIGDKVAVEGSLAKDGSPTGNARSVTMASTGQRLFAASRSMHVTAKPAEPSSTASGSPTYPSPITAGRAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300003161 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 12 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 15 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 20 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 21 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 22 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 23 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 24 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 25 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 26 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 29 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 42 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 44 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 71 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 91 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 92 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 93 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 94 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 95 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 96 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 97 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 98 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 99 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 100 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 101 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 102 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 103 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 104 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 108 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 109 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 116 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 128 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 144 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 145 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 146 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 214 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 215 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 218 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 220 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 234 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 235 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 239 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 240 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 241 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 242 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 289 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 293 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 317 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 321 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 344 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.87 |
| Metatranscriptomes | 9.13 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.74 |
| Rhizosphere | 97.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 31.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209996_1029159 | 3300027395 | Unclassified | 798 |
| 2 | MRS1b_contig_5777746 | 2162886011 | Bacteria | 899 |
| 3 | JGI24746J21847_1056352 | 3300001977 | Unclassified | 558 |
| 4 | JGI24747J21853_1029968 | 3300001978 | Unclassified | 619 |
| 5 | JGI24743J22301_10066454 | 3300001991 | Bacteria | 748 |
| 6 | JGI24750J21931_1028425 | 3300002070 | Bacteria | 812 |
| 7 | JGI24744J21845_10102481 | 3300002077 | Unclassified | 529 |
| 8 | JGI24034J26672_10033601 | 3300002239 | Unclassified | 843 |
| 9 | JGI24742J22300_10044319 | 3300002244 | Unclassified | 797 |
| 10 | Ga0006765J45826_119689 | 3300003161 | Unclassified | 589 |
| 11 | Ga0006778J45830_1088770 | 3300003162 | Bacteria | 595 |
| 12 | Ga0006759J45824_1028470 | 3300003163 | Unclassified | 697 |
| 13 | Ga0006759J45824_1037243 | 3300003163 | Unclassified | 616 |
| 14 | Ga0006759J45824_1039726 | 3300003163 | Unclassified | 646 |
| 15 | Ga0006759J45824_1059035 | 3300003163 | Bacteria | 572 |
| 16 | Ga0006759J45824_1079571 | 3300003163 | Bacteria | 559 |
| 17 | JGI25406J46586_10006131 | 3300003203 | Bacteria | 5552 |
| 18 | JGI25406J46586_10006252 | 3300003203 | Bacteria | 5497 |
| 19 | JGI25406J46586_10011237 | 3300003203 | Bacteria | 3936 |
| 20 | JGI25406J46586_10025102 | 3300003203 | Bacteria | 2320 |
| 21 | JGI25406J46586_10029195 | 3300003203 | Bacteria | 2091 |
| 22 | Ga0006770J48903_1037006 | 3300003305 | Unclassified | 699 |
| 23 | Ga0006777J48905_1114579 | 3300003308 | Bacteria | 611 |
| 24 | Ga0007417J51691_1022871 | 3300003544 | Bacteria | 614 |
| 25 | Ga0007417J51691_1024922 | 3300003544 | Unclassified | 709 |
| 26 | Ga0007410J51695_1018074 | 3300003574 | Bacteria | 706 |
| 27 | Ga0007410J51695_1039180 | 3300003574 | Unclassified | 647 |
| 28 | Ga0007409J51694_1026771 | 3300003575 | Unclassified | 644 |
| 29 | Ga0007416J51690_1031709 | 3300003577 | Unclassified | 914 |
| 30 | Ga0007416J51690_1038893 | 3300003577 | Bacteria | 560 |
| 31 | Ga0007416J51690_1060112 | 3300003577 | Bacteria | 520 |
| 32 | Ga0032354_1025555 | 3300003693 | Unclassified | 803 |
| 33 | Ga0032354_1029260 | 3300003693 | Unclassified | 710 |
| 34 | Ga0032354_1048698 | 3300003693 | Bacteria | 620 |
| 35 | Ga0058858_1432881 | 3300004785 | Bacteria | 686 |
| 36 | Ga0058859_10026949 | 3300004798 | Unclassified | 526 |
| 37 | Ga0058859_10041449 | 3300004798 | Unclassified | 841 |
| 38 | Ga0058859_10046910 | 3300004798 | Bacteria | 673 |
| 39 | Ga0058859_10078578 | 3300004798 | Bacteria | 806 |
| 40 | Ga0058859_10126710 | 3300004798 | Bacteria | 526 |
| 41 | Ga0058859_10126987 | 3300004798 | Unclassified | 526 |
| 42 | Ga0058859_10137091 | 3300004798 | Unclassified | 555 |
| 43 | Ga0058859_11460156 | 3300004798 | Bacteria | 622 |
| 44 | Ga0058859_11512003 | 3300004798 | Unclassified | 533 |
| 45 | Ga0058859_11605069 | 3300004798 | Unclassified | 517 |
| 46 | Ga0058859_11792330 | 3300004798 | Unclassified | 512 |
| 47 | Ga0058859_11815650 | 3300004798 | Bacteria | 570 |
| 48 | Ga0058863_10083060 | 3300004799 | Unclassified | 756 |
| 49 | Ga0058863_11282215 | 3300004799 | Bacteria | 661 |
| 50 | Ga0058863_11723477 | 3300004799 | Unclassified | 1104 |
| 51 | Ga0058863_11794519 | 3300004799 | Bacteria | 842 |
| 52 | Ga0058863_11840946 | 3300004799 | Unclassified | 890 |
| 53 | Ga0058863_11850213 | 3300004799 | Bacteria | 509 |
| 54 | Ga0058863_11923835 | 3300004799 | Unclassified | 665 |
| 55 | Ga0058861_10034176 | 3300004800 | Unclassified | 533 |
| 56 | Ga0058861_10136379 | 3300004800 | Unclassified | 522 |
| 57 | Ga0058861_11659293 | 3300004800 | Bacteria | 816 |
| 58 | Ga0058861_11815246 | 3300004800 | Bacteria | 581 |
| 59 | Ga0058861_11841430 | 3300004800 | Bacteria | 507 |
| 60 | Ga0058861_11860914 | 3300004800 | Unclassified | 1006 |
| 61 | Ga0058861_11880184 | 3300004800 | Unclassified | 654 |
| 62 | Ga0058861_11920879 | 3300004800 | Unclassified | 764 |
| 63 | Ga0058861_11949659 | 3300004800 | Unclassified | 835 |
| 64 | Ga0058860_10005183 | 3300004801 | Unclassified | 778 |
| 65 | Ga0058860_10051366 | 3300004801 | Bacteria | 558 |
| 66 | Ga0058860_10105618 | 3300004801 | Bacteria | 723 |
| 67 | Ga0058860_10155442 | 3300004801 | Bacteria | 535 |
| 68 | Ga0058860_11084365 | 3300004801 | Bacteria | 1229 |
| 69 | Ga0058860_12004642 | 3300004801 | Unclassified | 509 |
| 70 | Ga0058860_12144544 | 3300004801 | Bacteria | 822 |
| 71 | Ga0058860_12183639 | 3300004801 | Bacteria | 630 |
| 72 | Ga0058860_12244112 | 3300004801 | Unclassified | 552 |
| 73 | Ga0058862_10193550 | 3300004803 | Bacteria | 585 |
| 74 | Ga0058862_11954123 | 3300004803 | Bacteria | 720 |
| 75 | Ga0058862_12483175 | 3300004803 | Unclassified | 897 |
| 76 | Ga0058862_12486888 | 3300004803 | Unclassified | 598 |
| 77 | Ga0058862_12647495 | 3300004803 | Unclassified | 820 |
| 78 | Ga0058862_12856078 | 3300004803 | Unclassified | 736 |
| 79 | Ga0058862_12876065 | 3300004803 | Bacteria | 719 |
| 80 | Ga0065714_10312694 | 3300005288 | Unclassified | 679 |
| 81 | Ga0065714_10415629 | 3300005288 | Unclassified | 578 |
| 82 | Ga0065712_10008521 | 3300005290 | Bacteria | 2202 |
| 83 | Ga0065712_10069898 | 3300005290 | Bacteria | 6546 |
| 84 | Ga0065712_10309503 | 3300005290 | Unclassified | 819 |
| 85 | Ga0065712_10487943 | 3300005290 | Bacteria | 629 |
| 86 | Ga0065712_10796919 | 3300005290 | Unclassified | 513 |
| 87 | Ga0065715_10030244 | 3300005293 | Bacteria | 1932 |
| 88 | Ga0065715_10040528 | 3300005293 | Bacteria | 1573 |
| 89 | Ga0065715_10625707 | 3300005293 | Bacteria | 693 |
| 90 | Ga0065715_10987622 | 3300005293 | Bacteria | 534 |
| 91 | Ga0065707_10273897 | 3300005295 | Bacteria | 1064 |
| 92 | Ga0065707_10468479 | 3300005295 | Bacteria | 777 |
| 93 | Ga0065707_10744246 | 3300005295 | Bacteria | 621 |
| 94 | Ga0070658_10562710 | 3300005327 | Bacteria | 987 |
| 95 | Ga0070676_10004761 | 3300005328 | Bacteria | 7174 |
| 96 | Ga0070676_10015593 | 3300005328 | Bacteria | 4194 |
| 97 | Ga0070676_10190864 | 3300005328 | Bacteria | 1337 |
| 98 | Ga0070676_10255413 | 3300005328 | Bacteria | 1171 |
| 99 | Ga0070676_10375109 | 3300005328 | Unclassified | 984 |
| 100 | Ga0070676_10518990 | 3300005328 | Bacteria | 848 |
| 101 | Ga0070683_100300494 | 3300005329 | Bacteria | 1527 |
| 102 | Ga0070683_101247784 | 3300005329 | Unclassified | 714 |
| 103 | Ga0070690_100001322 | 3300005330 | Bacteria | 12891 |
| 104 | Ga0070690_100008747 | 3300005330 | Bacteria | 5844 |
| 105 | Ga0070690_100050288 | 3300005330 | Bacteria | 2659 |
| 106 | Ga0070690_100388152 | 3300005330 | Unclassified | 1022 |
| 107 | Ga0070690_100437970 | 3300005330 | Bacteria | 967 |
| 108 | Ga0070690_100616077 | 3300005330 | Unclassified | 825 |
| 109 | Ga0070690_100751774 | 3300005330 | Bacteria | 753 |
| 110 | Ga0070690_100880130 | 3300005330 | Unclassified | 699 |
| 111 | Ga0070670_100001926 | 3300005331 | Bacteria | 16985 |
| 112 | Ga0070670_100035613 | 3300005331 | Bacteria | 4284 |
| 113 | Ga0070670_100066566 | 3300005331 | Bacteria | 3091 |
| 114 | Ga0070670_100122996 | 3300005331 | Bacteria | 2239 |
| 115 | Ga0070670_100351062 | 3300005331 | Bacteria | 1296 |
| 116 | Ga0070670_101280247 | 3300005331 | Unclassified | 671 |
| 117 | Ga0070670_102190468 | 3300005331 | Unclassified | 509 |
| 118 | Ga0070677_10002632 | 3300005333 | Bacteria | 5743 |
| 119 | Ga0070677_10056606 | 3300005333 | Bacteria | 1604 |
| 120 | Ga0070677_10058268 | 3300005333 | Unclassified | 1586 |
| 121 | Ga0070677_10914225 | 3300005333 | Unclassified | 508 |
| 122 | Ga0068869_100002137 | 3300005334 | Bacteria | 11881 |
| 123 | Ga0068869_100007360 | 3300005334 | Bacteria | 7026 |
| 124 | Ga0068869_100379895 | 3300005334 | Bacteria | 1158 |
| 125 | Ga0068869_100545120 | 3300005334 | Bacteria | 974 |
| 126 | Ga0070666_10012451 | 3300005335 | Bacteria | 5365 |
| 127 | Ga0070666_10013448 | 3300005335 | Bacteria | 5194 |
| 128 | Ga0070666_10057791 | 3300005335 | Bacteria | 2622 |
| 129 | Ga0070680_101181970 | 3300005336 | Unclassified | 661 |
| 130 | Ga0070682_100389863 | 3300005337 | Bacteria | 1050 |
| 131 | Ga0070682_100807339 | 3300005337 | Unclassified | 763 |
| 132 | Ga0068868_100009452 | 3300005338 | Bacteria | 7019 |
| 133 | Ga0068868_100024652 | 3300005338 | Bacteria | 4568 |
| 134 | Ga0068868_100081795 | 3300005338 | Bacteria | 2590 |
| 135 | Ga0068868_101694428 | 3300005338 | Unclassified | 596 |
| 136 | Ga0070660_101052448 | 3300005339 | Unclassified | 688 |
| 137 | Ga0070689_100088178 | 3300005340 | Bacteria | 2442 |
| 138 | Ga0070689_100099927 | 3300005340 | Bacteria | 2295 |
| 139 | Ga0070689_100106600 | 3300005340 | Bacteria | 2224 |
| 140 | Ga0070689_100606628 | 3300005340 | Bacteria | 948 |
| 141 | Ga0070691_10848017 | 3300005341 | Unclassified | 560 |
| 142 | Ga0070687_100056560 | 3300005343 | Bacteria | 2053 |
| 143 | Ga0070687_100062483 | 3300005343 | Bacteria | 1972 |
| 144 | Ga0070687_100569057 | 3300005343 | Unclassified | 774 |
| 145 | Ga0070661_100009146 | 3300005344 | Bacteria | 6847 |
| 146 | Ga0070661_100015584 | 3300005344 | Bacteria | 5365 |
| 147 | Ga0070661_100110436 | 3300005344 | Bacteria | 2053 |
| 148 | Ga0070661_101472074 | 3300005344 | Bacteria | 574 |
| 149 | Ga0070692_10313636 | 3300005345 | Bacteria | 962 |
| 150 | Ga0070692_10450837 | 3300005345 | Unclassified | 823 |
| 151 | Ga0070692_10503914 | 3300005345 | Unclassified | 785 |
| 152 | Ga0070668_100420722 | 3300005347 | Unclassified | 1144 |
| 153 | Ga0070668_100833366 | 3300005347 | Unclassified | 821 |
| 154 | Ga0070669_100095019 | 3300005353 | Bacteria | 2241 |
| 155 | Ga0070669_100346750 | 3300005353 | Unclassified | 1204 |
| 156 | Ga0070669_100502898 | 3300005353 | Bacteria | 1005 |
| 157 | Ga0070669_100895726 | 3300005353 | Bacteria | 758 |
| 158 | Ga0070675_100002090 | 3300005354 | Bacteria | 14787 |
| 159 | Ga0070675_100002256 | 3300005354 | Bacteria | 14292 |
| 160 | Ga0070675_100120637 | 3300005354 | Bacteria | 2227 |
| 161 | Ga0070675_100196210 | 3300005354 | Bacteria | 1751 |
| 162 | Ga0070675_100217309 | 3300005354 | Bacteria | 1663 |
| 163 | Ga0070675_100327615 | 3300005354 | Bacteria | 1354 |
| 164 | Ga0070675_100477775 | 3300005354 | Bacteria | 1121 |
| 165 | Ga0070675_100861329 | 3300005354 | Bacteria | 829 |
| 166 | Ga0070675_101090551 | 3300005354 | Unclassified | 734 |
| 167 | Ga0070671_100055572 | 3300005355 | Bacteria | 3293 |
| 168 | Ga0070671_100082526 | 3300005355 | Bacteria | 2688 |
| 169 | Ga0070671_100751455 | 3300005355 | Unclassified | 848 |
| 170 | Ga0070674_100000886 | 3300005356 | Bacteria | 15612 |
| 171 | Ga0070674_100143868 | 3300005356 | Bacteria | 1793 |
| 172 | Ga0070674_100157571 | 3300005356 | Bacteria | 1719 |
| 173 | Ga0070674_100433185 | 3300005356 | Unclassified | 1082 |
| 174 | Ga0070674_100774844 | 3300005356 | Unclassified | 826 |
| 175 | Ga0070674_102039985 | 3300005356 | Unclassified | 523 |
| 176 | Ga0070673_100006055 | 3300005364 | Bacteria | 7833 |
| 177 | Ga0070673_100025160 | 3300005364 | Bacteria | 4376 |
| 178 | Ga0070673_100034975 | 3300005364 | Bacteria | 3807 |
| 179 | Ga0070673_100087081 | 3300005364 | Bacteria | 2545 |
| 180 | Ga0070673_100087788 | 3300005364 | Bacteria | 2535 |
| 181 | Ga0070673_100097088 | 3300005364 | Bacteria | 2419 |
| 182 | Ga0070673_100168633 | 3300005364 | Bacteria | 1867 |
| 183 | Ga0070673_100179468 | 3300005364 | Bacteria | 1812 |
| 184 | Ga0070673_101498766 | 3300005364 | Bacteria | 636 |
| 185 | Ga0070673_102291341 | 3300005364 | Unclassified | 513 |
| 186 | Ga0070688_100055823 | 3300005365 | Bacteria | 2478 |
| 187 | Ga0070688_100101625 | 3300005365 | Bacteria | 1897 |
| 188 | Ga0070688_100141065 | 3300005365 | Bacteria | 1637 |
| 189 | Ga0070688_101014252 | 3300005365 | Bacteria | 660 |
| 190 | Ga0070688_101499881 | 3300005365 | Unclassified | 548 |
| 191 | Ga0070659_100275636 | 3300005366 | Bacteria | 1398 |
| 192 | Ga0070659_100856003 | 3300005366 | Bacteria | 793 |
| 193 | Ga0070667_100011039 | 3300005367 | Bacteria | 7472 |
| 194 | Ga0070667_100016345 | 3300005367 | Bacteria | 6139 |
| 195 | Ga0070667_100185177 | 3300005367 | Unclassified | 1842 |
| 196 | Ga0070667_100357246 | 3300005367 | Unclassified | 1324 |
| 197 | Ga0070667_100903809 | 3300005367 | Bacteria | 822 |
| 198 | Ga0070667_101696296 | 3300005367 | Bacteria | 594 |
| 199 | Ga0070703_10038536 | 3300005406 | Unclassified | 1478 |
| 200 | Ga0070709_10293493 | 3300005434 | Bacteria | 1185 |
| 201 | Ga0070713_100008352 | 3300005436 | Bacteria | 7342 |
| 202 | Ga0070713_100016901 | 3300005436 | Bacteria | 5498 |
| 203 | Ga0070710_10126494 | 3300005437 | Bacteria | 1553 |
| 204 | Ga0070701_10028491 | 3300005438 | Unclassified | 2745 |
| 205 | Ga0070701_10346443 | 3300005438 | Bacteria | 927 |
| 206 | Ga0070701_10472688 | 3300005438 | Bacteria | 809 |
| 207 | Ga0070701_10638180 | 3300005438 | Unclassified | 710 |
| 208 | Ga0070711_100082047 | 3300005439 | Bacteria | 2300 |
| 209 | Ga0070705_100247770 | 3300005440 | Bacteria | 1249 |
| 210 | Ga0070700_100658735 | 3300005441 | Unclassified | 827 |
| 211 | Ga0070700_101011706 | 3300005441 | Bacteria | 684 |
| 212 | Ga0070694_100002432 | 3300005444 | Bacteria | 10985 |
| 213 | Ga0070694_100060666 | 3300005444 | Bacteria | 2580 |
| 214 | Ga0070694_100123078 | 3300005444 | Unclassified | 1863 |
| 215 | Ga0070694_101010233 | 3300005444 | Unclassified | 691 |
| 216 | Ga0070694_101354373 | 3300005444 | Unclassified | 600 |
| 217 | Ga0070694_101759469 | 3300005444 | Bacteria | 528 |
| 218 | Ga0070708_100206293 | 3300005445 | Unclassified | 1841 |
| 219 | Ga0070678_100020013 | 3300005456 | Bacteria | 4381 |
| 220 | Ga0070678_100086605 | 3300005456 | Bacteria | 2390 |
| 221 | Ga0070678_100207890 | 3300005456 | Unclassified | 1620 |
| 222 | Ga0070678_100250259 | 3300005456 | Bacteria | 1486 |
| 223 | Ga0070678_100429136 | 3300005456 | Unclassified | 1154 |
| 224 | Ga0070678_100458116 | 3300005456 | Unclassified | 1118 |
| 225 | Ga0070678_100675839 | 3300005456 | Unclassified | 928 |
| 226 | Ga0070678_101222360 | 3300005456 | Bacteria | 697 |
| 227 | Ga0070678_101391975 | 3300005456 | Unclassified | 655 |
| 228 | Ga0070662_100021066 | 3300005457 | Bacteria | 4447 |
| 229 | Ga0070662_100140882 | 3300005457 | Bacteria | 1868 |
| 230 | Ga0070662_101666612 | 3300005457 | Unclassified | 551 |
| 231 | Ga0070681_10563192 | 3300005458 | Bacteria | 1053 |
| 232 | Ga0070681_10895117 | 3300005458 | Bacteria | 806 |
| 233 | Ga0068867_100041600 | 3300005459 | Bacteria | 3358 |
| 234 | Ga0068867_100172683 | 3300005459 | Unclassified | 1713 |
| 235 | Ga0068867_100385134 | 3300005459 | Bacteria | 1179 |
| 236 | Ga0068867_100389261 | 3300005459 | Unclassified | 1173 |
| 237 | Ga0068867_101337525 | 3300005459 | Bacteria | 662 |
| 238 | Ga0070685_10085330 | 3300005466 | Bacteria | 1901 |
| 239 | Ga0070685_10463749 | 3300005466 | Bacteria | 890 |
| 240 | Ga0070685_10606178 | 3300005466 | Bacteria | 788 |
| 241 | Ga0070685_11218565 | 3300005466 | Unclassified | 572 |
| 242 | Ga0070685_11536090 | 3300005466 | Unclassified | 514 |
| 243 | Ga0070706_100944354 | 3300005467 | Bacteria | 796 |
| 244 | Ga0070707_100052627 | 3300005468 | Unclassified | 3904 |
| 245 | Ga0070707_100268217 | 3300005468 | Bacteria | 1660 |
| 246 | Ga0070707_100678873 | 3300005468 | Unclassified | 993 |
| 247 | Ga0070698_100239132 | 3300005471 | Bacteria | 1749 |
| 248 | Ga0070698_100642053 | 3300005471 | Unclassified | 1002 |
| 249 | Ga0070698_101209240 | 3300005471 | Bacteria | 705 |
| 250 | Ga0070699_100328089 | 3300005518 | Bacteria | 1376 |
| 251 | Ga0070699_100350401 | 3300005518 | Unclassified | 1330 |
| 252 | Ga0070679_100410876 | 3300005530 | Bacteria | 1299 |
| 253 | Ga0070679_101643129 | 3300005530 | Unclassified | 590 |
| 254 | Ga0070679_101748045 | 3300005530 | Unclassified | 570 |
| 255 | Ga0070684_100145486 | 3300005535 | Unclassified | 2145 |
| 256 | Ga0070684_100649211 | 3300005535 | Unclassified | 982 |
| 257 | Ga0070697_100412378 | 3300005536 | Bacteria | 1173 |
| 258 | Ga0070697_100580194 | 3300005536 | Unclassified | 985 |
| 259 | Ga0070697_102044297 | 3300005536 | Unclassified | 513 |
| 260 | Ga0070672_100007756 | 3300005543 | Bacteria | 7315 |
| 261 | Ga0070672_100070011 | 3300005543 | Bacteria | 2787 |
| 262 | Ga0070672_100154032 | 3300005543 | Bacteria | 1903 |
| 263 | Ga0070672_100192204 | 3300005543 | Unclassified | 1704 |
| 264 | Ga0070672_100494566 | 3300005543 | Bacteria | 1057 |
| 265 | Ga0070672_100579221 | 3300005543 | Bacteria | 976 |
| 266 | Ga0070672_100775851 | 3300005543 | Unclassified | 842 |
| 267 | Ga0070672_101091232 | 3300005543 | Bacteria | 709 |
| 268 | Ga0070686_100004772 | 3300005544 | Bacteria | 7480 |
| 269 | Ga0070686_100094519 | 3300005544 | Bacteria | 2006 |
| 270 | Ga0070686_100095154 | 3300005544 | Bacteria | 2001 |
| 271 | Ga0070686_100296267 | 3300005544 | Unclassified | 1198 |
| 272 | Ga0070686_100492607 | 3300005544 | Bacteria | 950 |
| 273 | Ga0070695_100002378 | 3300005545 | Bacteria | 10808 |
| 274 | Ga0070695_100355968 | 3300005545 | Bacteria | 1098 |
| 275 | Ga0070695_100625921 | 3300005545 | Bacteria | 847 |
| 276 | Ga0070696_100038105 | 3300005546 | Unclassified | 3317 |
| 277 | Ga0070696_100054711 | 3300005546 | Bacteria | 2782 |
| 278 | Ga0070696_100083707 | 3300005546 | Bacteria | 2263 |
| 279 | Ga0070696_100116180 | 3300005546 | Bacteria | 1932 |
| 280 | Ga0070696_100408015 | 3300005546 | Bacteria | 1064 |
| 281 | Ga0070665_100018571 | 3300005548 | Bacteria | 6969 |
| 282 | Ga0070665_100240777 | 3300005548 | Unclassified | 1810 |
| 283 | Ga0070704_100011387 | 3300005549 | Bacteria | 5449 |
| 284 | Ga0070664_100000508 | 3300005564 | Bacteria | 29520 |
| 285 | Ga0070664_100000777 | 3300005564 | Bacteria | 24623 |
| 286 | Ga0070664_100001566 | 3300005564 | Bacteria | 18284 |
| 287 | Ga0070664_100038915 | 3300005564 | Bacteria | 4005 |
| 288 | Ga0070664_100660119 | 3300005564 | Unclassified | 972 |
| 289 | Ga0070664_100662596 | 3300005564 | Bacteria | 970 |
| 290 | Ga0068857_100185957 | 3300005577 | Bacteria | 1891 |
| 291 | Ga0068857_100955366 | 3300005577 | Bacteria | 823 |
| 292 | Ga0068857_101529128 | 3300005577 | Unclassified | 651 |
| 293 | Ga0068854_100096744 | 3300005578 | Bacteria | 2206 |
| 294 | Ga0070702_100129223 | 3300005615 | Bacteria | 1593 |
| 295 | Ga0070702_100735481 | 3300005615 | Unclassified | 756 |
| 296 | Ga0070702_101863902 | 3300005615 | Unclassified | 503 |
| 297 | Ga0068852_100373732 | 3300005616 | Unclassified | 1397 |
| 298 | Ga0068852_101033724 | 3300005616 | Bacteria | 841 |
| 299 | Ga0068859_100030951 | 3300005617 | Bacteria | 5370 |
| 300 | Ga0068859_100084276 | 3300005617 | Bacteria | 3223 |
| 301 | Ga0068859_100116245 | 3300005617 | Bacteria | 2739 |
| 302 | Ga0068859_100125942 | 3300005617 | Unclassified | 2631 |
| 303 | Ga0068859_100145523 | 3300005617 | Bacteria | 2444 |
| 304 | Ga0068859_100169629 | 3300005617 | Unclassified | 2263 |
| 305 | Ga0068859_100458607 | 3300005617 | Bacteria | 1370 |
| 306 | Ga0068859_100738246 | 3300005617 | Unclassified | 1074 |
| 307 | Ga0068859_101054128 | 3300005617 | Unclassified | 894 |
| 308 | Ga0068859_101647792 | 3300005617 | Bacteria | 708 |
| 309 | Ga0068859_102270481 | 3300005617 | Unclassified | 598 |
| 310 | Ga0068864_100001955 | 3300005618 | Bacteria | 16940 |
| 311 | Ga0068864_100016892 | 3300005618 | Bacteria | 6082 |
| 312 | Ga0068864_100032637 | 3300005618 | Bacteria | 4425 |
| 313 | Ga0068864_100051480 | 3300005618 | Bacteria | 3548 |
| 314 | Ga0068864_100624365 | 3300005618 | Bacteria | 1047 |
| 315 | Ga0068864_101196096 | 3300005618 | Bacteria | 758 |
| 316 | Ga0068864_101336734 | 3300005618 | Unclassified | 717 |
| 317 | Ga0068866_10255411 | 3300005718 | Unclassified | 1074 |
| 318 | Ga0068866_10282716 | 3300005718 | Bacteria | 1029 |
| 319 | Ga0068866_11332021 | 3300005718 | Unclassified | 523 |
| 320 | Ga0068861_100040419 | 3300005719 | Unclassified | 3488 |
| 321 | Ga0068861_100053271 | 3300005719 | Bacteria | 3077 |
| 322 | Ga0068861_100117895 | 3300005719 | Bacteria | 2137 |
| 323 | Ga0068861_100159613 | 3300005719 | Bacteria | 1859 |
| 324 | Ga0068861_100373454 | 3300005719 | Bacteria | 1258 |
| 325 | Ga0068861_100573579 | 3300005719 | Bacteria | 1032 |
| 326 | Ga0068861_100637250 | 3300005719 | Bacteria | 983 |
| 327 | Ga0068861_100900015 | 3300005719 | Unclassified | 838 |
| 328 | Ga0068861_101097138 | 3300005719 | Unclassified | 765 |
| 329 | Ga0068851_10158083 | 3300005834 | Bacteria | 1243 |
| 330 | Ga0068851_10336477 | 3300005834 | Unclassified | 875 |
| 331 | Ga0068870_10003483 | 3300005840 | Bacteria | 6673 |
| 332 | Ga0068870_10048919 | 3300005840 | Bacteria | 2228 |
| 333 | Ga0068870_10101955 | 3300005840 | Bacteria | 1624 |
| 334 | Ga0068870_10138160 | 3300005840 | Bacteria | 1423 |
| 335 | Ga0068870_10309809 | 3300005840 | Bacteria | 999 |
| 336 | Ga0068870_10826298 | 3300005840 | Unclassified | 649 |
| 337 | Ga0068863_100006787 | 3300005841 | Bacteria | 11220 |
| 338 | Ga0068863_100061190 | 3300005841 | Unclassified | 3559 |
| 339 | Ga0068863_100091448 | 3300005841 | Bacteria | 2885 |
| 340 | Ga0068863_100352936 | 3300005841 | Bacteria | 1432 |
| 341 | Ga0068863_100470819 | 3300005841 | Unclassified | 1235 |
| 342 | Ga0068863_100494416 | 3300005841 | Bacteria | 1204 |
| 343 | Ga0068863_100508268 | 3300005841 | Bacteria | 1187 |
| 344 | Ga0068863_100576130 | 3300005841 | Unclassified | 1113 |
| 345 | Ga0068863_100842615 | 3300005841 | Bacteria | 915 |
| 346 | Ga0068863_102136646 | 3300005841 | Unclassified | 570 |
| 347 | Ga0068858_100049801 | 3300005842 | Bacteria | 3878 |
| 348 | Ga0068858_100053429 | 3300005842 | Unclassified | 3737 |
| 349 | Ga0068858_100060443 | 3300005842 | Unclassified | 3503 |
| 350 | Ga0068858_100091515 | 3300005842 | Bacteria | 2831 |
| 351 | Ga0068858_100323799 | 3300005842 | Bacteria | 1473 |
| 352 | Ga0068858_100579328 | 3300005842 | Bacteria | 1087 |
| 353 | Ga0068860_100030936 | 3300005843 | Bacteria | 5147 |
| 354 | Ga0068860_100285530 | 3300005843 | Bacteria | 1614 |
| 355 | Ga0068860_101402766 | 3300005843 | Unclassified | 720 |
| 356 | Ga0068860_102554422 | 3300005843 | Unclassified | 530 |
| 357 | Ga0068862_100042105 | 3300005844 | Unclassified | 3889 |
| 358 | Ga0068862_100321342 | 3300005844 | Bacteria | 1429 |
| 359 | Ga0068862_100512126 | 3300005844 | Bacteria | 1141 |
| 360 | Ga0068862_100743220 | 3300005844 | Unclassified | 954 |
| 361 | Ga0068862_100896566 | 3300005844 | Bacteria | 871 |
| 362 | Ga0068862_100918250 | 3300005844 | Bacteria | 861 |
| 363 | Ga0068862_101239094 | 3300005844 | Unclassified | 746 |
| 364 | Ga0081455_10121568 | 3300005937 | Unclassified | 2056 |
| 365 | Ga0081455_10797153 | 3300005937 | Unclassified | 593 |
| 366 | Ga0081539_10000133 | 3300005985 | Bacteria | 173855 |
| 367 | Ga0081539_10000329 | 3300005985 | Bacteria | 105307 |
| 368 | Ga0081539_10005236 | 3300005985 | Bacteria | 13400 |
| 369 | Ga0075432_10013769 | 3300006058 | Bacteria | 2752 |
| 370 | Ga0070715_10264999 | 3300006163 | Unclassified | 904 |
| 371 | Ga0097621_100004942 | 3300006237 | Bacteria | 9347 |
| 372 | Ga0097621_100083160 | 3300006237 | Bacteria | 2667 |
| 373 | Ga0097621_100106178 | 3300006237 | Bacteria | 2369 |
| 374 | Ga0097621_100220674 | 3300006237 | Unclassified | 1652 |
| 375 | Ga0097621_100278806 | 3300006237 | Unclassified | 1471 |
| 376 | Ga0097621_100599232 | 3300006237 | Bacteria | 1007 |
| 377 | Ga0097621_100620811 | 3300006237 | Unclassified | 990 |
| 378 | Ga0097621_101721143 | 3300006237 | Unclassified | 597 |
| 379 | Ga0097621_102297626 | 3300006237 | Unclassified | 516 |
| 380 | Ga0068871_100000568 | 3300006358 | Bacteria | 25277 |
| 381 | Ga0068871_100063687 | 3300006358 | Unclassified | 3016 |
| 382 | Ga0068871_100141280 | 3300006358 | Bacteria | 2047 |
| 383 | Ga0068871_100145951 | 3300006358 | Bacteria | 2014 |
| 384 | Ga0068871_100235006 | 3300006358 | Bacteria | 1592 |
| 385 | Ga0068871_100335932 | 3300006358 | Bacteria | 1333 |
| 386 | Ga0068871_100354613 | 3300006358 | Bacteria | 1298 |
| 387 | Ga0068871_100670980 | 3300006358 | Bacteria | 948 |
| 388 | Ga0068871_100729491 | 3300006358 | Bacteria | 910 |
| 389 | Ga0068871_100909712 | 3300006358 | Bacteria | 816 |
| 390 | Ga0075428_100008383 | 3300006844 | Bacteria | 11458 |
| 391 | Ga0075428_100016065 | 3300006844 | Bacteria | 8277 |
| 392 | Ga0075428_100016769 | 3300006844 | Bacteria | 8089 |
| 393 | Ga0075428_100029402 | 3300006844 | Bacteria | 6080 |
| 394 | Ga0075428_100841320 | 3300006844 | Unclassified | 974 |
| 395 | Ga0075428_100940955 | 3300006844 | Unclassified | 916 |
| 396 | Ga0075428_101045280 | 3300006844 | Bacteria | 864 |
| 397 | Ga0075430_100009192 | 3300006846 | Bacteria | 8352 |
| 398 | Ga0075430_100015340 | 3300006846 | Bacteria | 6525 |
| 399 | Ga0075430_100045019 | 3300006846 | Bacteria | 3730 |
| 400 | Ga0075430_100127371 | 3300006846 | Bacteria | 2123 |
| 401 | Ga0075430_100132865 | 3300006846 | Unclassified | 2074 |
| 402 | Ga0075430_100155074 | 3300006846 | Bacteria | 1907 |
| 403 | Ga0075430_101013758 | 3300006846 | Unclassified | 684 |
| 404 | Ga0075430_101310817 | 3300006846 | Unclassified | 595 |
| 405 | Ga0075431_100006482 | 3300006847 | Bacteria | 11619 |
| 406 | Ga0075431_100006533 | 3300006847 | Bacteria | 11582 |
| 407 | Ga0075431_100009194 | 3300006847 | Bacteria | 9911 |
| 408 | Ga0075431_100151409 | 3300006847 | Bacteria | 2388 |
| 409 | Ga0075433_10000629 | 3300006852 | Bacteria | 23546 |
| 410 | Ga0075433_10006287 | 3300006852 | Bacteria | 9380 |
| 411 | Ga0075433_10127724 | 3300006852 | Unclassified | 2258 |
| 412 | Ga0075433_10176086 | 3300006852 | Bacteria | 1904 |
| 413 | Ga0075433_10323396 | 3300006852 | Bacteria | 1364 |
| 414 | Ga0075433_10780086 | 3300006852 | Unclassified | 835 |
| 415 | Ga0075434_100050439 | 3300006871 | Bacteria | 4134 |
| 416 | Ga0075434_100119953 | 3300006871 | Bacteria | 2645 |
| 417 | Ga0075434_100172414 | 3300006871 | Bacteria | 2183 |
| 418 | Ga0075434_100508667 | 3300006871 | Unclassified | 1225 |
| 419 | Ga0075429_100012736 | 3300006880 | Bacteria | 7296 |
| 420 | Ga0075429_100012997 | 3300006880 | Bacteria | 7223 |
| 421 | Ga0075429_100017263 | 3300006880 | Bacteria | 6242 |
| 422 | Ga0075429_100039720 | 3300006880 | Unclassified | 4095 |
| 423 | Ga0075429_100432837 | 3300006880 | Unclassified | 1152 |
| 424 | Ga0068865_100031357 | 3300006881 | Bacteria | 3544 |
| 425 | Ga0068865_100208248 | 3300006881 | Bacteria | 1522 |
| 426 | Ga0068865_100483312 | 3300006881 | Bacteria | 1030 |
| 427 | Ga0068865_100660031 | 3300006881 | Unclassified | 890 |
| 428 | Ga0068865_100770477 | 3300006881 | Bacteria | 828 |
| 429 | Ga0075436_100169159 | 3300006914 | Bacteria | 1543 |
| 430 | Ga0075436_101137922 | 3300006914 | Bacteria | 588 |
| 431 | Ga0097620_100030951 | 3300006931 | Bacteria | 5370 |
| 432 | Ga0097620_100084278 | 3300006931 | Bacteria | 3223 |
| 433 | Ga0097620_100116241 | 3300006931 | Bacteria | 2739 |
| 434 | Ga0097620_100125949 | 3300006931 | Unclassified | 2631 |
| 435 | Ga0097620_100145520 | 3300006931 | Bacteria | 2444 |
| 436 | Ga0097620_100169619 | 3300006931 | Unclassified | 2263 |
| 437 | Ga0097620_100458610 | 3300006931 | Bacteria | 1370 |
| 438 | Ga0097620_100738229 | 3300006931 | Unclassified | 1074 |
| 439 | Ga0097620_101054037 | 3300006931 | Unclassified | 894 |
| 440 | Ga0097620_101647776 | 3300006931 | Bacteria | 708 |
| 441 | Ga0097620_102270379 | 3300006931 | Unclassified | 598 |
| 442 | Ga0075435_100000725 | 3300007076 | Bacteria | 20435 |
| 443 | Ga0075435_100009913 | 3300007076 | Bacteria | 6938 |
| 444 | Ga0075435_100126562 | 3300007076 | Bacteria | 2136 |
| 445 | Ga0075435_100222304 | 3300007076 | Bacteria | 1603 |
| 446 | Ga0075435_101552773 | 3300007076 | Bacteria | 581 |
| 447 | Ga0105244_10233077 | 3300009036 | Bacteria | 861 |
| 448 | Ga0111539_10009474 | 3300009094 | Bacteria | 12291 |
| 449 | Ga0111539_10019921 | 3300009094 | Bacteria | 8262 |
| 450 | Ga0111539_10024909 | 3300009094 | Bacteria | 7334 |
| 451 | Ga0111539_10026447 | 3300009094 | Bacteria | 7094 |
| 452 | Ga0111539_10036678 | 3300009094 | Bacteria | 5925 |
| 453 | Ga0111539_10041446 | 3300009094 | Bacteria | 5536 |
| 454 | Ga0111539_10064583 | 3300009094 | Bacteria | 4329 |
| 455 | Ga0111539_10382256 | 3300009094 | Unclassified | 1639 |
| 456 | Ga0111539_10670504 | 3300009094 | Unclassified | 1207 |
| 457 | Ga0105245_10561016 | 3300009098 | Bacteria | 1165 |
| 458 | Ga0105245_10587970 | 3300009098 | Bacteria | 1138 |
| 459 | Ga0105245_10589073 | 3300009098 | Unclassified | 1137 |
| 460 | Ga0105245_11563503 | 3300009098 | Bacteria | 711 |
| 461 | Ga0105245_11955339 | 3300009098 | Unclassified | 640 |
| 462 | Ga0105247_10328988 | 3300009101 | Bacteria | 1069 |
| 463 | Ga0105247_10419111 | 3300009101 | Bacteria | 958 |
| 464 | Ga0114129_10013443 | 3300009147 | Bacteria | 11666 |
| 465 | Ga0114129_10045450 | 3300009147 | Bacteria | 6173 |
| 466 | Ga0114129_10066168 | 3300009147 | Bacteria | 5041 |
| 467 | Ga0114129_10168326 | 3300009147 | Bacteria | 2989 |
| 468 | Ga0114129_10191100 | 3300009147 | Bacteria | 2780 |
| 469 | Ga0114129_10404571 | 3300009147 | Bacteria | 1798 |
| 470 | Ga0114129_10515153 | 3300009147 | Bacteria | 1560 |
| 471 | Ga0105243_10038297 | 3300009148 | Bacteria | 3734 |
| 472 | Ga0105243_10044742 | 3300009148 | Bacteria | 3475 |
| 473 | Ga0105243_12414187 | 3300009148 | Unclassified | 564 |
| 474 | Ga0105243_13084620 | 3300009148 | Unclassified | 505 |
| 475 | Ga0105242_10018370 | 3300009176 | Bacteria | 5465 |
| 476 | Ga0105242_10271885 | 3300009176 | Unclassified | 1535 |
| 477 | Ga0105242_10327650 | 3300009176 | Bacteria | 1407 |
| 478 | Ga0105248_10001517 | 3300009177 | Bacteria | 25847 |
| 479 | Ga0105248_10001944 | 3300009177 | Bacteria | 22950 |
| 480 | Ga0105248_10020509 | 3300009177 | Bacteria | 7324 |
| 481 | Ga0105248_10093632 | 3300009177 | Bacteria | 3384 |
| 482 | Ga0105248_10117287 | 3300009177 | Bacteria | 3002 |
| 483 | Ga0105248_10574557 | 3300009177 | Bacteria | 1272 |
| 484 | Ga0105248_10580338 | 3300009177 | Bacteria | 1265 |
| 485 | Ga0105248_10924951 | 3300009177 | Bacteria | 985 |
| 486 | Ga0105248_11393934 | 3300009177 | Unclassified | 793 |
| 487 | Ga0105248_12083592 | 3300009177 | Unclassified | 645 |
| 488 | Ga0105238_10017272 | 3300009551 | Bacteria | 7329 |
| 489 | Ga0105238_10824068 | 3300009551 | Unclassified | 944 |
| 490 | Ga0105249_10023740 | 3300009553 | Bacteria | 5506 |
| 491 | Ga0105249_10245886 | 3300009553 | Unclassified | 1771 |
| 492 | Ga0105249_10643576 | 3300009553 | Unclassified | 1117 |
| 493 | Ga0105249_11270174 | 3300009553 | Bacteria | 808 |
| 494 | Ga0105246_10124085 | 3300011119 | Bacteria | 1918 |
| 495 | Ga0105246_10338591 | 3300011119 | Unclassified | 1229 |
| 496 | Ga0105246_10403085 | 3300011119 | Bacteria | 1136 |
| 497 | Ga0105246_11011200 | 3300011119 | Bacteria | 753 |
| 498 | Ga0105246_11405420 | 3300011119 | Unclassified | 651 |
| 499 | Ga0157319_1020015 | 3300012497 | Unclassified | 641 |
| 500 | Ga0157371_10309502 | 3300013102 | Bacteria | 1145 |
| 501 | Ga0157374_10279857 | 3300013296 | Unclassified | 1647 |
| 502 | Ga0157374_10310109 | 3300013296 | Unclassified | 1562 |
| 503 | Ga0157374_10623469 | 3300013296 | Bacteria | 1089 |
| 504 | Ga0157374_11130368 | 3300013296 | Unclassified | 804 |
| 505 | Ga0157378_10052770 | 3300013297 | Bacteria | 3617 |
| 506 | Ga0157378_10087855 | 3300013297 | Bacteria | 2820 |
| 507 | Ga0157378_10428634 | 3300013297 | Bacteria | 1308 |
| 508 | Ga0157378_10504196 | 3300013297 | Unclassified | 1209 |
| 509 | Ga0163162_10004920 | 3300013306 | Bacteria | 12881 |
| 510 | Ga0163162_10006636 | 3300013306 | Bacteria | 11216 |
| 511 | Ga0163162_10038924 | 3300013306 | Bacteria | 4748 |
| 512 | Ga0163162_10071757 | 3300013306 | Bacteria | 3516 |
| 513 | Ga0163162_10506394 | 3300013306 | Bacteria | 1338 |
| 514 | Ga0163162_10669783 | 3300013306 | Bacteria | 1161 |
| 515 | Ga0163162_11508193 | 3300013306 | Bacteria | 766 |
| 516 | Ga0163162_11699803 | 3300013306 | Unclassified | 721 |
| 517 | Ga0163162_11794340 | 3300013306 | Bacteria | 701 |
| 518 | Ga0163162_12335039 | 3300013306 | Unclassified | 615 |
| 519 | Ga0157372_12028297 | 3300013307 | Bacteria | 661 |
| 520 | Ga0157375_10063280 | 3300013308 | Bacteria | 3680 |
| 521 | Ga0157375_10146286 | 3300013308 | Bacteria | 2494 |
| 522 | Ga0157375_10428975 | 3300013308 | Bacteria | 1488 |
| 523 | Ga0157375_10830745 | 3300013308 | Bacteria | 1071 |
| 524 | Ga0157375_10871944 | 3300013308 | Bacteria | 1045 |
| 525 | Ga0157375_11002738 | 3300013308 | Bacteria | 975 |
| 526 | Ga0157375_11132466 | 3300013308 | Unclassified | 917 |
| 527 | Ga0157375_11210806 | 3300013308 | Bacteria | 886 |
| 528 | Ga0163163_10001063 | 3300014325 | Bacteria | 23324 |
| 529 | Ga0163163_10006058 | 3300014325 | Bacteria | 10519 |
| 530 | Ga0163163_10020811 | 3300014325 | Bacteria | 6184 |
| 531 | Ga0163163_10026210 | 3300014325 | Bacteria | 5569 |
| 532 | Ga0163163_10183550 | 3300014325 | Bacteria | 2139 |
| 533 | Ga0163163_10392761 | 3300014325 | Bacteria | 1445 |
| 534 | Ga0163163_10730724 | 3300014325 | Bacteria | 1053 |
| 535 | Ga0163163_10849677 | 3300014325 | Bacteria | 976 |
| 536 | Ga0157380_10006441 | 3300014326 | Bacteria | 8268 |
| 537 | Ga0157380_10007437 | 3300014326 | Bacteria | 7777 |
| 538 | Ga0157380_10043947 | 3300014326 | Unclassified | 3499 |
| 539 | Ga0157380_10077491 | 3300014326 | Bacteria | 2709 |
| 540 | Ga0157380_10214769 | 3300014326 | Bacteria | 1717 |
| 541 | Ga0157380_10252381 | 3300014326 | Bacteria | 1597 |
| 542 | Ga0157380_13009978 | 3300014326 | Unclassified | 537 |
| 543 | Ga0157377_10002509 | 3300014745 | Bacteria | 8129 |
| 544 | Ga0157377_10104308 | 3300014745 | Bacteria | 1695 |
| 545 | Ga0157377_10197566 | 3300014745 | Bacteria | 1275 |
| 546 | Ga0157377_10199245 | 3300014745 | Bacteria | 1270 |
| 547 | Ga0157377_10299273 | 3300014745 | Bacteria | 1061 |
| 548 | Ga0157377_10351628 | 3300014745 | Bacteria | 989 |
| 549 | Ga0157379_10187924 | 3300014968 | Bacteria | 1867 |
| 550 | Ga0157379_10439316 | 3300014968 | Bacteria | 1203 |
| 551 | Ga0157376_10009221 | 3300014969 | Bacteria | 7160 |
| 552 | Ga0157376_10069205 | 3300014969 | Bacteria | 2991 |
| 553 | Ga0157376_10083392 | 3300014969 | Bacteria | 2749 |
| 554 | Ga0157376_10133647 | 3300014969 | Unclassified | 2217 |
| 555 | Ga0157376_10460734 | 3300014969 | Bacteria | 1242 |
| 556 | Ga0157376_10540458 | 3300014969 | Bacteria | 1152 |
| 557 | Ga0157376_10692316 | 3300014969 | Bacteria | 1023 |
| 558 | Ga0157376_10712687 | 3300014969 | Bacteria | 1010 |
| 559 | Ga0157376_11057680 | 3300014969 | Bacteria | 836 |
| 560 | Ga0157376_11885820 | 3300014969 | Bacteria | 634 |
| 561 | Ga0163161_10043995 | 3300017792 | Bacteria | 3215 |
| 562 | Ga0163161_10062221 | 3300017792 | Bacteria | 2718 |
| 563 | Ga0163161_10174958 | 3300017792 | Bacteria | 1643 |
| 564 | Ga0163161_10622621 | 3300017792 | Unclassified | 892 |
| 565 | Ga0163161_10675700 | 3300017792 | Bacteria | 858 |
| 566 | Ga0197907_11064887 | 3300020069 | Bacteria | 722 |
| 567 | Ga0206356_10295248 | 3300020070 | Bacteria | 729 |
| 568 | Ga0206356_11338882 | 3300020070 | Unclassified | 1080 |
| 569 | Ga0206349_1579484 | 3300020075 | Unclassified | 594 |
| 570 | Ga0206349_1745606 | 3300020075 | Unclassified | 925 |
| 571 | Ga0206352_10240803 | 3300020078 | Unclassified | 645 |
| 572 | Ga0206352_10435217 | 3300020078 | Bacteria | 513 |
| 573 | Ga0206352_10459886 | 3300020078 | Bacteria | 661 |
| 574 | Ga0206352_10684472 | 3300020078 | Bacteria | 691 |
| 575 | Ga0206352_10789063 | 3300020078 | Unclassified | 647 |
| 576 | Ga0206352_10808230 | 3300020078 | Bacteria | 789 |
| 577 | Ga0206350_10603039 | 3300020080 | Bacteria | 2108 |
| 578 | Ga0206350_11293131 | 3300020080 | Unclassified | 832 |
| 579 | Ga0206350_11655528 | 3300020080 | Unclassified | 642 |
| 580 | Ga0206354_11378251 | 3300020081 | Bacteria | 623 |
| 581 | Ga0206353_11760492 | 3300020082 | Unclassified | 617 |
| 582 | Ga0206353_11983827 | 3300020082 | Bacteria | 672 |
| 583 | Ga0224712_10279338 | 3300022467 | Unclassified | 777 |
| 584 | Ga0224712_10317047 | 3300022467 | Bacteria | 732 |
| 585 | Ga0207666_1016382 | 3300025271 | Bacteria | 1062 |
| 586 | Ga0207673_1046337 | 3300025290 | Bacteria | 613 |
| 587 | Ga0207697_10021544 | 3300025315 | Bacteria | 2638 |
| 588 | Ga0207697_10089813 | 3300025315 | Bacteria | 1301 |
| 589 | Ga0207697_10125669 | 3300025315 | Bacteria | 1106 |
| 590 | Ga0207697_10172905 | 3300025315 | Bacteria | 945 |
| 591 | Ga0207656_10171150 | 3300025321 | Bacteria | 1038 |
| 592 | Ga0207653_10091567 | 3300025885 | Unclassified | 1066 |
| 593 | Ga0207682_10003633 | 3300025893 | Bacteria | 6655 |
| 594 | Ga0207682_10021350 | 3300025893 | Unclassified | 2547 |
| 595 | Ga0207682_10027680 | 3300025893 | Bacteria | 2258 |
| 596 | Ga0207682_10038379 | 3300025893 | Bacteria | 1943 |
| 597 | Ga0207682_10057813 | 3300025893 | Unclassified | 1618 |
| 598 | Ga0207682_10184607 | 3300025893 | Bacteria | 954 |
| 599 | Ga0207692_10771792 | 3300025898 | Unclassified | 627 |
| 600 | Ga0207642_10048207 | 3300025899 | Bacteria | 1909 |
| 601 | Ga0207688_10015436 | 3300025901 | Bacteria | 4142 |
| 602 | Ga0207688_10177251 | 3300025901 | Bacteria | 1270 |
| 603 | Ga0207688_10208009 | 3300025901 | Bacteria | 1175 |
| 604 | Ga0207680_10007945 | 3300025903 | Bacteria | 5187 |
| 605 | Ga0207680_10017707 | 3300025903 | Bacteria | 3769 |
| 606 | Ga0207680_10117060 | 3300025903 | Bacteria | 1737 |
| 607 | Ga0207680_10199483 | 3300025903 | Bacteria | 1363 |
| 608 | Ga0207685_10117996 | 3300025905 | Bacteria | 1160 |
| 609 | Ga0207685_10169964 | 3300025905 | Unclassified | 1002 |
| 610 | Ga0207699_10020357 | 3300025906 | Bacteria | 3554 |
| 611 | Ga0207699_10057371 | 3300025906 | Bacteria | 2325 |
| 612 | Ga0207645_10001298 | 3300025907 | Bacteria | 20552 |
| 613 | Ga0207645_10010593 | 3300025907 | Bacteria | 6325 |
| 614 | Ga0207645_10015451 | 3300025907 | Bacteria | 5069 |
| 615 | Ga0207645_10365288 | 3300025907 | Unclassified | 967 |
| 616 | Ga0207643_10001468 | 3300025908 | Bacteria | 13539 |
| 617 | Ga0207643_10004046 | 3300025908 | Bacteria | 7894 |
| 618 | Ga0207643_10023721 | 3300025908 | Bacteria | 3385 |
| 619 | Ga0207643_10036792 | 3300025908 | Bacteria | 2746 |
| 620 | Ga0207643_10056693 | 3300025908 | Bacteria | 2228 |
| 621 | Ga0207643_10097705 | 3300025908 | Unclassified | 1719 |
| 622 | Ga0207643_10121432 | 3300025908 | Bacteria | 1548 |
| 623 | Ga0207643_10226116 | 3300025908 | Unclassified | 1147 |
| 624 | Ga0207643_10259338 | 3300025908 | Bacteria | 1073 |
| 625 | Ga0207707_10040412 | 3300025912 | Unclassified | 4074 |
| 626 | Ga0207707_10098983 | 3300025912 | Bacteria | 2549 |
| 627 | Ga0207707_10202660 | 3300025912 | Unclassified | 1730 |
| 628 | Ga0207707_10923223 | 3300025912 | Unclassified | 720 |
| 629 | Ga0207707_10957488 | 3300025912 | Bacteria | 705 |
| 630 | Ga0207660_10653666 | 3300025917 | Unclassified | 857 |
| 631 | Ga0207660_10973501 | 3300025917 | Unclassified | 692 |
| 632 | Ga0207662_10034684 | 3300025918 | Bacteria | 2945 |
| 633 | Ga0207662_10042957 | 3300025918 | Bacteria | 2666 |
| 634 | Ga0207662_10833656 | 3300025918 | Bacteria | 651 |
| 635 | Ga0207662_10951754 | 3300025918 | Unclassified | 609 |
| 636 | Ga0207657_10500561 | 3300025919 | Bacteria | 952 |
| 637 | Ga0207657_11013174 | 3300025919 | Unclassified | 637 |
| 638 | Ga0207649_10013669 | 3300025920 | Unclassified | 4536 |
| 639 | Ga0207649_10048687 | 3300025920 | Bacteria | 2615 |
| 640 | Ga0207649_10088917 | 3300025920 | Bacteria | 2018 |
| 641 | Ga0207652_10847973 | 3300025921 | Bacteria | 809 |
| 642 | Ga0207646_10726633 | 3300025922 | Unclassified | 887 |
| 643 | Ga0207646_11566500 | 3300025922 | Unclassified | 569 |
| 644 | Ga0207681_10104603 | 3300025923 | Unclassified | 2048 |
| 645 | Ga0207681_10146942 | 3300025923 | Bacteria | 1762 |
| 646 | Ga0207681_10415836 | 3300025923 | Bacteria | 1088 |
| 647 | Ga0207681_10698962 | 3300025923 | Bacteria | 843 |
| 648 | Ga0207681_11192343 | 3300025923 | Bacteria | 640 |
| 649 | Ga0207681_11300194 | 3300025923 | Bacteria | 611 |
| 650 | Ga0207694_10001914 | 3300025924 | Bacteria | 17254 |
| 651 | Ga0207694_10312082 | 3300025924 | Bacteria | 1296 |
| 652 | Ga0207650_10000444 | 3300025925 | Bacteria | 35551 |
| 653 | Ga0207650_10008206 | 3300025925 | Bacteria | 7124 |
| 654 | Ga0207650_10026771 | 3300025925 | Bacteria | 4118 |
| 655 | Ga0207650_10030746 | 3300025925 | Bacteria | 3871 |
| 656 | Ga0207650_10061140 | 3300025925 | Bacteria | 2812 |
| 657 | Ga0207650_10857860 | 3300025925 | Bacteria | 770 |
| 658 | Ga0207650_11037574 | 3300025925 | Unclassified | 698 |
| 659 | Ga0207650_11623018 | 3300025925 | Unclassified | 549 |
| 660 | Ga0207659_10018306 | 3300025926 | Bacteria | 4590 |
| 661 | Ga0207659_10022541 | 3300025926 | Bacteria | 4193 |
| 662 | Ga0207659_10071465 | 3300025926 | Unclassified | 2534 |
| 663 | Ga0207659_10200545 | 3300025926 | Bacteria | 1593 |
| 664 | Ga0207659_10245784 | 3300025926 | Bacteria | 1450 |
| 665 | Ga0207659_10379614 | 3300025926 | Bacteria | 1178 |
| 666 | Ga0207659_10531082 | 3300025926 | Unclassified | 998 |
| 667 | Ga0207659_10637246 | 3300025926 | Bacteria | 910 |
| 668 | Ga0207659_10658386 | 3300025926 | Bacteria | 895 |
| 669 | Ga0207659_10895009 | 3300025926 | Unclassified | 763 |
| 670 | Ga0207659_11599087 | 3300025926 | Bacteria | 556 |
| 671 | Ga0207687_10239498 | 3300025927 | Bacteria | 1437 |
| 672 | Ga0207700_10001848 | 3300025928 | Bacteria | 11991 |
| 673 | Ga0207700_10154681 | 3300025928 | Unclassified | 1899 |
| 674 | Ga0207644_10151257 | 3300025931 | Bacteria | 1796 |
| 675 | Ga0207644_10405017 | 3300025931 | Bacteria | 1116 |
| 676 | Ga0207644_10423968 | 3300025931 | Unclassified | 1090 |
| 677 | Ga0207690_10096866 | 3300025932 | Bacteria | 2098 |
| 678 | Ga0207690_11123907 | 3300025932 | Bacteria | 655 |
| 679 | Ga0207706_10011838 | 3300025933 | Bacteria | 7944 |
| 680 | Ga0207706_10162045 | 3300025933 | Bacteria | 1966 |
| 681 | Ga0207706_10462887 | 3300025933 | Bacteria | 1096 |
| 682 | Ga0207706_10533525 | 3300025933 | Bacteria | 1011 |
| 683 | Ga0207686_10004639 | 3300025934 | Bacteria | 7363 |
| 684 | Ga0207686_10311369 | 3300025934 | Unclassified | 1173 |
| 685 | Ga0207686_11524530 | 3300025934 | Unclassified | 551 |
| 686 | Ga0207709_10007046 | 3300025935 | Bacteria | 6285 |
| 687 | Ga0207709_10099178 | 3300025935 | Unclassified | 1922 |
| 688 | Ga0207709_10510013 | 3300025935 | Unclassified | 940 |
| 689 | Ga0207670_10050526 | 3300025936 | Bacteria | 2787 |
| 690 | Ga0207670_10093849 | 3300025936 | Bacteria | 2127 |
| 691 | Ga0207670_10143450 | 3300025936 | Bacteria | 1763 |
| 692 | Ga0207670_10211011 | 3300025936 | Bacteria | 1481 |
| 693 | Ga0207670_10387903 | 3300025936 | Bacteria | 1114 |
| 694 | Ga0207670_11348098 | 3300025936 | Unclassified | 605 |
| 695 | Ga0207669_10049870 | 3300025937 | Bacteria | 2498 |
| 696 | Ga0207669_10069194 | 3300025937 | Bacteria | 2207 |
| 697 | Ga0207669_10076983 | 3300025937 | Bacteria | 2120 |
| 698 | Ga0207669_10142835 | 3300025937 | Bacteria | 1664 |
| 699 | Ga0207704_10019639 | 3300025938 | Bacteria | 3553 |
| 700 | Ga0207704_10087191 | 3300025938 | Bacteria | 2038 |
| 701 | Ga0207704_10130706 | 3300025938 | Bacteria | 1738 |
| 702 | Ga0207704_10242141 | 3300025938 | Unclassified | 1348 |
| 703 | Ga0207704_10362442 | 3300025938 | Bacteria | 1132 |
| 704 | Ga0207665_10337223 | 3300025939 | Bacteria | 1135 |
| 705 | Ga0207691_10005742 | 3300025940 | Bacteria | 12004 |
| 706 | Ga0207691_10029518 | 3300025940 | Bacteria | 5129 |
| 707 | Ga0207691_10029580 | 3300025940 | Bacteria | 5124 |
| 708 | Ga0207691_10060228 | 3300025940 | Bacteria | 3450 |
| 709 | Ga0207691_10072536 | 3300025940 | Bacteria | 3105 |
| 710 | Ga0207691_10083937 | 3300025940 | Bacteria | 2860 |
| 711 | Ga0207691_10326382 | 3300025940 | Unclassified | 1315 |
| 712 | Ga0207691_10361489 | 3300025940 | Bacteria | 1241 |
| 713 | Ga0207691_10375308 | 3300025940 | Bacteria | 1214 |
| 714 | Ga0207691_10497650 | 3300025940 | Bacteria | 1035 |
| 715 | Ga0207691_10602285 | 3300025940 | Unclassified | 930 |
| 716 | Ga0207691_10849236 | 3300025940 | Unclassified | 766 |
| 717 | Ga0207691_10924073 | 3300025940 | Bacteria | 730 |
| 718 | Ga0207711_10035868 | 3300025941 | Unclassified | 4205 |
| 719 | Ga0207711_10053293 | 3300025941 | Bacteria | 3469 |
| 720 | Ga0207711_10556610 | 3300025941 | Unclassified | 1070 |
| 721 | Ga0207711_11027311 | 3300025941 | Unclassified | 764 |
| 722 | Ga0207689_10015899 | 3300025942 | Bacteria | 6373 |
| 723 | Ga0207689_10080645 | 3300025942 | Bacteria | 2675 |
| 724 | Ga0207689_10128041 | 3300025942 | Bacteria | 2088 |
| 725 | Ga0207661_10356837 | 3300025944 | Unclassified | 1320 |
| 726 | Ga0207679_10002310 | 3300025945 | Bacteria | 11732 |
| 727 | Ga0207679_10004151 | 3300025945 | Bacteria | 8997 |
| 728 | Ga0207679_10006713 | 3300025945 | Bacteria | 7287 |
| 729 | Ga0207679_10037678 | 3300025945 | Bacteria | 3439 |
| 730 | Ga0207679_10114572 | 3300025945 | Bacteria | 2134 |
| 731 | Ga0207679_10568348 | 3300025945 | Bacteria | 1019 |
| 732 | Ga0207679_10951207 | 3300025945 | Bacteria | 787 |
| 733 | Ga0207667_11857241 | 3300025949 | Bacteria | 565 |
| 734 | Ga0207651_10048365 | 3300025960 | Bacteria | 2874 |
| 735 | Ga0207651_10061313 | 3300025960 | Bacteria | 2615 |
| 736 | Ga0207651_10243056 | 3300025960 | Unclassified | 1468 |
| 737 | Ga0207651_11434873 | 3300025960 | Bacteria | 621 |
| 738 | Ga0207712_10010441 | 3300025961 | Bacteria | 5896 |
| 739 | Ga0207712_10033145 | 3300025961 | Bacteria | 3490 |
| 740 | Ga0207712_10098510 | 3300025961 | Unclassified | 2168 |
| 741 | Ga0207712_10538935 | 3300025961 | Unclassified | 1002 |
| 742 | Ga0207668_10250899 | 3300025972 | Bacteria | 1437 |
| 743 | Ga0207668_10968633 | 3300025972 | Unclassified | 759 |
| 744 | Ga0207668_11050528 | 3300025972 | Unclassified | 729 |
| 745 | Ga0207640_10073692 | 3300025981 | Bacteria | 2308 |
| 746 | Ga0207658_10006375 | 3300025986 | Bacteria | 8053 |
| 747 | Ga0207658_10131117 | 3300025986 | Bacteria | 2014 |
| 748 | Ga0207658_10775736 | 3300025986 | Bacteria | 869 |
| 749 | Ga0207658_11092806 | 3300025986 | Bacteria | 728 |
| 750 | Ga0207658_11260971 | 3300025986 | Unclassified | 676 |
| 751 | Ga0207677_10008838 | 3300026023 | Bacteria | 5646 |
| 752 | Ga0207677_10169361 | 3300026023 | Bacteria | 1706 |
| 753 | Ga0207677_10243815 | 3300026023 | Bacteria | 1455 |
| 754 | Ga0207677_10547265 | 3300026023 | Bacteria | 1008 |
| 755 | Ga0207703_10045243 | 3300026035 | Unclassified | 3540 |
| 756 | Ga0207703_10109644 | 3300026035 | Bacteria | 2353 |
| 757 | Ga0207703_10392473 | 3300026035 | Bacteria | 1286 |
| 758 | Ga0207703_10394550 | 3300026035 | Bacteria | 1283 |
| 759 | Ga0207703_10791929 | 3300026035 | Bacteria | 905 |
| 760 | Ga0207678_10066128 | 3300026067 | Bacteria | 3104 |
| 761 | Ga0207708_10047881 | 3300026075 | Bacteria | 3253 |
| 762 | Ga0207708_10065875 | 3300026075 | Unclassified | 2769 |
| 763 | Ga0207708_10181010 | 3300026075 | Bacteria | 1674 |
| 764 | Ga0207708_10229742 | 3300026075 | Bacteria | 1489 |
| 765 | Ga0207708_10427741 | 3300026075 | Bacteria | 1099 |
| 766 | Ga0207708_10640588 | 3300026075 | Bacteria | 904 |
| 767 | Ga0207708_10699181 | 3300026075 | Unclassified | 866 |
| 768 | Ga0207641_10026440 | 3300026088 | Bacteria | 4789 |
| 769 | Ga0207641_10045780 | 3300026088 | Bacteria | 3686 |
| 770 | Ga0207641_10433139 | 3300026088 | Unclassified | 1268 |
| 771 | Ga0207641_10492034 | 3300026088 | Bacteria | 1190 |
| 772 | Ga0207641_10803812 | 3300026088 | Bacteria | 930 |
| 773 | Ga0207641_10839825 | 3300026088 | Unclassified | 910 |
| 774 | Ga0207641_10842728 | 3300026088 | Bacteria | 908 |
| 775 | Ga0207641_10962386 | 3300026088 | Unclassified | 849 |
| 776 | Ga0207641_12549783 | 3300026088 | Unclassified | 509 |
| 777 | Ga0207648_10002543 | 3300026089 | Bacteria | 19560 |
| 778 | Ga0207648_10045092 | 3300026089 | Bacteria | 3868 |
| 779 | Ga0207648_10046886 | 3300026089 | Bacteria | 3788 |
| 780 | Ga0207648_10155578 | 3300026089 | Bacteria | 2018 |
| 781 | Ga0207648_10222971 | 3300026089 | Unclassified | 1676 |
| 782 | Ga0207648_10458878 | 3300026089 | Bacteria | 1161 |
| 783 | Ga0207648_11155323 | 3300026089 | Unclassified | 727 |
| 784 | Ga0207648_11466597 | 3300026089 | Unclassified | 641 |
| 785 | Ga0207676_10001140 | 3300026095 | Bacteria | 20053 |
| 786 | Ga0207676_10033261 | 3300026095 | Bacteria | 3894 |
| 787 | Ga0207676_10050009 | 3300026095 | Bacteria | 3256 |
| 788 | Ga0207676_10086124 | 3300026095 | Bacteria | 2566 |
| 789 | Ga0207676_10826343 | 3300026095 | Unclassified | 905 |
| 790 | Ga0207676_11515952 | 3300026095 | Bacteria | 667 |
| 791 | Ga0207674_10349087 | 3300026116 | Bacteria | 1430 |
| 792 | Ga0207674_10410015 | 3300026116 | Bacteria | 1309 |
| 793 | Ga0207674_10504647 | 3300026116 | Bacteria | 1169 |
| 794 | Ga0207675_100022758 | 3300026118 | Bacteria | 5831 |
| 795 | Ga0207675_100050204 | 3300026118 | Bacteria | 3893 |
| 796 | Ga0207675_100060016 | 3300026118 | Unclassified | 3550 |
| 797 | Ga0207675_100233173 | 3300026118 | Bacteria | 1776 |
| 798 | Ga0207675_100678973 | 3300026118 | Unclassified | 1038 |
| 799 | Ga0207675_100815849 | 3300026118 | Bacteria | 947 |
| 800 | Ga0207683_10012865 | 3300026121 | Bacteria | 7142 |
| 801 | Ga0207683_10039566 | 3300026121 | Bacteria | 4114 |
| 802 | Ga0207683_10101200 | 3300026121 | Bacteria | 2573 |
| 803 | Ga0207683_10114527 | 3300026121 | Bacteria | 2416 |
| 804 | Ga0207683_10143665 | 3300026121 | Bacteria | 2151 |
| 805 | Ga0207683_10156716 | 3300026121 | Bacteria | 2057 |
| 806 | Ga0207683_10332684 | 3300026121 | Unclassified | 1392 |
| 807 | Ga0207683_10852843 | 3300026121 | Unclassified | 846 |
| 808 | Ga0207683_11240104 | 3300026121 | Bacteria | 691 |
| 809 | Ga0207683_11674409 | 3300026121 | Unclassified | 585 |
| 810 | Ga0207683_11968377 | 3300026121 | Unclassified | 533 |
| 811 | Ga0207698_10633523 | 3300026142 | Unclassified | 1057 |
| 812 | Ga0207698_11154225 | 3300026142 | Bacteria | 788 |
| 813 | Ga0209966_1030286 | 3300027695 | Bacteria | 1093 |
| 814 | Ga0209974_10050858 | 3300027876 | Bacteria | 1392 |
| 815 | Ga0207428_10000737 | 3300027907 | Bacteria | 37593 |
| 816 | Ga0207428_10015072 | 3300027907 | Bacteria | 6696 |
| 817 | Ga0207428_10111516 | 3300027907 | Bacteria | 2105 |
| 818 | Ga0207428_10161695 | 3300027907 | Bacteria | 1700 |
| 819 | Ga0207428_10171107 | 3300027907 | Bacteria | 1645 |
| 820 | Ga0207428_10470100 | 3300027907 | Bacteria | 915 |
| 821 | Ga0207428_10916189 | 3300027907 | Unclassified | 619 |
| 822 | Ga0268266_10203889 | 3300028379 | Unclassified | 1811 |
| 823 | Ga0268266_12212342 | 3300028379 | Bacteria | 522 |
| 824 | Ga0268265_10055983 | 3300028380 | Unclassified | 2998 |
| 825 | Ga0268265_10069478 | 3300028380 | Bacteria | 2735 |
| 826 | Ga0268265_10368439 | 3300028380 | Bacteria | 1318 |
| 827 | Ga0268265_10566780 | 3300028380 | Bacteria | 1080 |
| 828 | Ga0268265_10700890 | 3300028380 | Bacteria | 978 |
| 829 | Ga0268264_10018520 | 3300028381 | Bacteria | 5695 |
| 830 | Ga0268264_11047025 | 3300028381 | Unclassified | 823 |
| 831 | Ga0268264_11095719 | 3300028381 | Unclassified | 805 |
| 832 | Ga0268264_12011903 | 3300028381 | Unclassified | 587 |
| 833 | Ga0268264_12352865 | 3300028381 | Bacteria | 539 |
| 834 | Ga0265766_1012685 | 3300030863 | Bacteria | 625 |
| 835 | Ga0307405_10694688 | 3300031731 | Unclassified | 842 |
| 836 | Ga0307409_102199855 | 3300031995 | Bacteria | 581 |
| 837 | Ga0307416_100126286 | 3300032002 | Bacteria | 2292 |
| 838 | Ga0307416_100583921 | 3300032002 | Bacteria | 1195 |
| 839 | Ga0307416_103431786 | 3300032002 | Unclassified | 530 |
| 840 | Ga0307411_10694448 | 3300032005 | Unclassified | 886 |
| 841 | Ga0373958_0111216 | 3300034819 | Unclassified | 653 |
| 842 | Ga0373934_0192326 | 3300035086 | Unclassified | 840 |
| 843 | Ga0373951_0067567 | 3300035091 | Bacteria | 905 |
| 844 | Ga0373923_0185023 | 3300035111 | Bacteria | 958 |
| 845 | Ga0373953_0013290 | 3300035117 | Bacteria | 2938 |
| 846 | Ga0373953_0058625 | 3300035117 | Bacteria | 1570 |
| 847 | Ga0373954_0164777 | 3300035118 | Bacteria | 1085 |
| 848 | Ga0373956_0214315 | 3300035119 | Unclassified | 914 |
| 849 | Ga0373956_0287846 | 3300035119 | Bacteria | 782 |
| 850 | Ga0373956_0332099 | 3300035119 | Unclassified | 724 |
| 851 | Ga0373956_0351300 | 3300035119 | Bacteria | 703 |
| 852 | Ga0373957_0074125 | 3300035120 | Bacteria | 1336 |
| 853 | Ga0373957_0263769 | 3300035120 | Unclassified | 726 |
| 854 | Ga0373957_0402846 | 3300035120 | Unclassified | 589 |
| 855 | Ga0373955_0093818 | 3300035172 | Bacteria | 1714 |
| 856 | Ga0373955_0225736 | 3300035172 | Bacteria | 1120 |
| 857 | Ga0373955_0251665 | 3300035172 | Bacteria | 1059 |
| 858 | Ga0373955_0605334 | 3300035172 | Unclassified | 671 |
| 859 | Ga0373962_0025225 | 3300035242 | Bacteria | 1596 |
| 860 | Ga0373924_0296791 | 3300035410 | Unclassified | 717 |
| 861 | Ga0373931_0894961 | 3300035691 | Bacteria | 596 |
| 862 | Ga0373935_0504493 | 3300035692 | Bacteria | 879 |
| 863 | Ga0373927_0620039 | 3300035695 | Bacteria | 715 |
| 864 | Ga0373937_0008123 | 3300036401 | Bacteria | 9110 |
| 865 | Ga0373937_0008508 | 3300036401 | Bacteria | 8915 |
| 866 | Ga0373937_0032356 | 3300036401 | Bacteria | 4744 |
| 867 | Ga0373937_0069353 | 3300036401 | Bacteria | 3251 |
| 868 | Ga0373937_0108614 | 3300036401 | Bacteria | 2580 |
| 869 | Ga0373937_0294226 | 3300036401 | Bacteria | 1534 |
| 870 | Ga0373937_0353052 | 3300036401 | Bacteria | 1393 |
| 871 | Ga0373937_0963108 | 3300036401 | Bacteria | 802 |
| 872 | Ga0373925_1425682 | 3300037068 | Unclassified | 567 |
| 873 | Ga0436365_1792320 | 3300039437 | Bacteria | 2076 |
| 874 | Ga0439453_0055457 | 3300041408 | Unclassified | 810 |
| 875 | Ga0451798_0799210 | 3300041458 | Unclassified | 670 |
| 876 | Ga0451802_0925699 | 3300041460 | Unclassified | 529 |
| 877 | Ga0451853_3575839 | 3300041512 | Unclassified | 1295 |
| 878 | Ga0439450_007173 | 3300042008 | Bacteria | 2033 |
| 879 | Ga0439455_0178000 | 3300042012 | Bacteria | 612 |
| 880 | Ga0439444_0031059 | 3300042437 | Bacteria | 1003 |
| 881 | Ga0439460_0114322 | 3300042461 | Bacteria | 878 |
| 882 | Ga0439460_0115636 | 3300042461 | Bacteria | 874 |
| 883 | Ga0450916_000521 | 3300042530 | Bacteria | 3381 |
| 884 | Ga0451576_0191432 | 3300045051 | Bacteria | 2136 |
| 885 | Ga0451576_0684140 | 3300045051 | Bacteria | 1078 |
| 886 | Ga0451576_0694000 | 3300045051 | Unclassified | 1069 |
| 887 | Ga0495592_0027743 | 3300046454 | Bacteria | 4290 |
| 888 | Ga0495592_0051359 | 3300046454 | Bacteria | 3062 |
| 889 | Ga0495592_0135001 | 3300046454 | Bacteria | 1722 |
| 890 | Ga0495603_0100533 | 3300046455 | Bacteria | 1688 |
| 891 | Ga0495629_0026701 | 3300046459 | Bacteria | 4101 |
| 892 | Ga0495629_0327491 | 3300046459 | Bacteria | 1047 |
| 893 | Ga0495629_0642645 | 3300046459 | Bacteria | 707 |
| 894 | Ga0495651_0975918 | 3300046462 | Bacteria | 515 |
| 895 | Ga0495653_0213493 | 3300046463 | Bacteria | 1302 |
| 896 | Ga0495653_0568185 | 3300046463 | Unclassified | 700 |
| 897 | Ga0495580_0027778 | 3300046472 | Bacteria | 4116 |
| 898 | Ga0495580_0153936 | 3300046472 | Bacteria | 1593 |
| 899 | Ga0495580_0154271 | 3300046472 | Bacteria | 1591 |
| 900 | Ga0495580_0760740 | 3300046472 | Bacteria | 630 |
| 901 | Ga0495582_0329047 | 3300046473 | Bacteria | 879 |
| 902 | Ga0495639_0098601 | 3300046475 | Bacteria | 1378 |
| 903 | Ga0495662_0195082 | 3300046476 | Bacteria | 998 |
| 904 | Ga0495662_0208821 | 3300046476 | Bacteria | 962 |
| 905 | Ga0495664_0125107 | 3300046477 | Bacteria | 1555 |
| 906 | Ga0495664_0411506 | 3300046477 | Bacteria | 812 |
| 907 | Ga0495594_0015076 | 3300046499 | Bacteria | 4057 |
| 908 | Ga0495594_0457286 | 3300046499 | Bacteria | 726 |
| 909 | Ga0495608_0010456 | 3300046511 | Bacteria | 6476 |
| 910 | Ga0495608_0019307 | 3300046511 | Bacteria | 4692 |
| 911 | Ga0495618_0134348 | 3300046514 | Bacteria | 1583 |
| 912 | Ga0495618_0859922 | 3300046514 | Unclassified | 525 |
| 913 | Ga0495628_0023317 | 3300046516 | Bacteria | 5081 |
| 914 | Ga0495630_0008571 | 3300046517 | Bacteria | 7337 |
| 915 | Ga0495630_0069380 | 3300046517 | Bacteria | 2652 |
| 916 | Ga0495630_0179334 | 3300046517 | Unclassified | 1615 |
| 917 | Ga0495630_0330300 | 3300046517 | Unclassified | 1166 |
| 918 | Ga0495652_0621223 | 3300046529 | Bacteria | 735 |
| 919 | Ga0495640_0630953 | 3300046533 | Unclassified | 646 |
| 920 | Ga0495586_0039774 | 3300046535 | Bacteria | 2529 |
| 921 | Ga0495586_0784856 | 3300046535 | Unclassified | 550 |
| 922 | Ga0495598_0017022 | 3300046537 | Bacteria | 1867 |
| 923 | Ga0495621_0124459 | 3300046539 | Bacteria | 999 |
| 924 | Ga0495621_0343075 | 3300046539 | Unclassified | 625 |
| 925 | Ga0495621_0396057 | 3300046539 | Unclassified | 585 |
| 926 | Ga0495645_0055392 | 3300046543 | Bacteria | 2879 |
| 927 | Ga0495667_0000776 | 3300046559 | Bacteria | 20492 |
| 928 | Ga0495667_0004456 | 3300046559 | Bacteria | 9444 |
| 929 | Ga0495667_0079754 | 3300046559 | Bacteria | 2128 |
| 930 | Ga0495656_0061613 | 3300046615 | Bacteria | 1639 |
| 931 | Ga0495656_0106196 | 3300046615 | Bacteria | 1306 |
| 932 | Ga0495634_0039953 | 3300046642 | Bacteria | 3193 |
| 933 | Ga0495634_0081494 | 3300046642 | Bacteria | 2116 |
| 934 | Ga0495634_0102217 | 3300046642 | Bacteria | 1851 |
| 935 | Ga0495611_0523728 | 3300046648 | Unclassified | 538 |
| 936 | Ga0495635_0291583 | 3300046663 | Bacteria | 1095 |
| 937 | Ga0495659_0055959 | 3300046664 | Unclassified | 1447 |
| 938 | Ga0495659_0251844 | 3300046664 | Bacteria | 736 |
| 939 | Ga0495661_0259399 | 3300046665 | Unclassified | 884 |
| 940 | Ga0495657_0004256 | 3300046675 | Bacteria | 11445 |
| 941 | Ga0495657_0006819 | 3300046675 | Bacteria | 8890 |
| 942 | Ga0495599_0087243 | 3300046678 | Bacteria | 1948 |
| 943 | Ga0495658_0634609 | 3300046683 | Unclassified | 684 |
| 944 | Ga0495669_0005724 | 3300046684 | Bacteria | 5182 |
| 945 | Ga0495613_0000464 | 3300046689 | Bacteria | 34669 |
| 946 | Ga0495613_0055782 | 3300046689 | Bacteria | 2902 |
| 947 | Ga0495613_0057238 | 3300046689 | Bacteria | 2862 |
| 948 | Ga0495613_0078784 | 3300046689 | Bacteria | 2396 |
| 949 | Ga0495613_0104834 | 3300046689 | Bacteria | 2041 |
| 950 | Ga0495613_0553866 | 3300046689 | Unclassified | 769 |
| 951 | Ga0495670_0143768 | 3300046691 | Bacteria | 1249 |
| 952 | Ga0495670_0206543 | 3300046691 | Bacteria | 1041 |
| 953 | Ga0495600_0219244 | 3300046809 | Bacteria | 1217 |
| 954 | Ga0495600_0844123 | 3300046809 | Unclassified | 543 |
| 955 | Ga0495604_0028365 | 3300047317 | Bacteria | 4453 |
| 956 | Ga0495636_0424026 | 3300047318 | Bacteria | 636 |
| 957 | Ga0495674_0045727 | 3300047319 | Bacteria | 3887 |
| 958 | Ga0495674_0066105 | 3300047319 | Bacteria | 3139 |
| 959 | Ga0495674_0135662 | 3300047319 | Bacteria | 2071 |
| 960 | Ga0495674_0248641 | 3300047319 | Unclassified | 1464 |
| 961 | Ga0495674_1034375 | 3300047319 | Unclassified | 628 |
| 962 | Ga0495672_0301256 | 3300047320 | Unclassified | 759 |
| 963 | Ga0495680_0172039 | 3300047322 | Bacteria | 1568 |
| 964 | Ga0495680_0215605 | 3300047322 | Unclassified | 1372 |
| 965 | Ga0495680_0927646 | 3300047322 | Unclassified | 561 |
| 966 | Ga0495675_0351464 | 3300047444 | Unclassified | 867 |
| 967 | Ga0495681_0265539 | 3300047470 | Unclassified | 673 |
| 968 | Ga0495684_0000213 | 3300047471 | Bacteria | 45092 |
| 969 | Ga0495684_0054033 | 3300047471 | Bacteria | 3064 |
| 970 | Ga0495684_0081986 | 3300047471 | Bacteria | 2448 |
| 971 | Ga0495684_0133546 | 3300047471 | Unclassified | 1863 |
| 972 | Ga0495684_0263556 | 3300047471 | Bacteria | 1249 |
| 973 | Ga0495684_0512294 | 3300047471 | Bacteria | 823 |
| 974 | Ga0495614_0358976 | 3300048089 | Unclassified | 680 |
| 975 | Ga0496107_1020680 | 3300048910 | Unclassified | 600 |
| 976 | Ga0496108_0234197 | 3300048911 | Bacteria | 1597 |
| 977 | Ga0496110_0771200 | 3300048913 | Bacteria | 865 |
| 978 | Ga0496110_1212206 | 3300048913 | Bacteria | 664 |
| 979 | Ga0496112_1671172 | 3300048915 | Unclassified | 549 |
| 980 | Ga0496113_0770356 | 3300048916 | Bacteria | 765 |
| 981 | Ga0501308_039345 | 3300049128 | Bacteria | 661 |
| 982 | Ga0501305_059274 | 3300049161 | Unclassified | 656 |
| 983 | Ga0501315_090741 | 3300049531 | Bacteria | 529 |
| 984 | Ga0501320_063466 | 3300049536 | Unclassified | 523 |
| 985 | Ga0501321_061889 | 3300049537 | Unclassified | 567 |
| 986 | Ga0501031_0722964 | 3300049568 | Unclassified | 639 |
| 987 | Ga0501033_0793391 | 3300049570 | Unclassified | 641 |
| 988 | Ga0501036_0267076 | 3300049572 | Unclassified | 1433 |
| 989 | Ga0501037_1147553 | 3300049573 | Unclassified | 502 |
| 990 | Ga0501038_0290109 | 3300049574 | Unclassified | 1286 |
| 991 | Ga0501039_0061997 | 3300049575 | Bacteria | 2897 |
| 992 | Ga0501039_1334106 | 3300049575 | Unclassified | 553 |
| 993 | Ga0501040_0069743 | 3300049576 | Bacteria | 2425 |
| 994 | Ga0501041_0230769 | 3300049577 | Bacteria | 1162 |
| 995 | Ga0501041_0341556 | 3300049577 | Bacteria | 946 |
| 996 | Ga0501042_0137141 | 3300049578 | Bacteria | 1764 |
| 997 | Ga0501042_0242403 | 3300049578 | Bacteria | 1301 |
| 998 | Ga0501042_0532042 | 3300049578 | Unclassified | 854 |
| 999 | Ga0501042_0766320 | 3300049578 | Bacteria | 702 |
| 1000 | Ga0501048_0475092 | 3300049582 | Unclassified | 896 |
| 1001 | Ga0501068_0346770 | 3300049584 | Bacteria | 954 |
| 1002 | Ga0501070_0538346 | 3300049586 | Bacteria | 936 |
| 1003 | Ga0501071_0081988 | 3300049587 | Unclassified | 2361 |
| 1004 | Ga0501071_0570737 | 3300049587 | Bacteria | 869 |
| 1005 | Ga0501072_1007177 | 3300049588 | Unclassified | 649 |
| 1006 | Ga0501074_0525037 | 3300049590 | Bacteria | 838 |
| 1007 | Ga0501075_0306111 | 3300049591 | Bacteria | 1211 |
| 1008 | Ga0501075_1089682 | 3300049591 | Unclassified | 607 |
| 1009 | Ga0501076_0012265 | 3300049592 | Bacteria | 6409 |
| 1010 | Ga0501076_0351393 | 3300049592 | Bacteria | 1210 |
| 1011 | Ga0501076_1110819 | 3300049592 | Unclassified | 651 |
| 1012 | Ga0501077_0810180 | 3300049593 | Unclassified | 602 |
| 1013 | Ga0501077_0970953 | 3300049593 | Bacteria | 547 |
| 1014 | Ga0501249_016417 | 3300049679 | Bacteria | 1590 |
| 1015 | Ga0501249_072039 | 3300049679 | Unclassified | 808 |
| 1016 | Ga0501245_153355 | 3300049708 | Unclassified | 511 |
| 1017 | Ga0501079_0031577 | 3300049741 | Bacteria | 4071 |
| 1018 | Ga0501081_1040730 | 3300049743 | Unclassified | 619 |
| 1019 | Ga0501271_048692 | 3300049768 | Unclassified | 570 |
| 1020 | Ga0501283_054330 | 3300049779 | Bacteria | 714 |
| 1021 | Ga0501045_0076002 | 3300049824 | Bacteria | 2474 |
| 1022 | Ga0501045_0326437 | 3300049824 | Bacteria | 1142 |
| 1023 | nmdc:mga05p37_101605_c1 | 3300050507 | Bacteria | 3540 |
| 1024 | nmdc:mga05p37_1042632_c1 | 3300050507 | Unclassified | 864 |
| 1025 | nmdc:mga05p37_11531_c1 | 3300050507 | Bacteria | 10529 |
| 1026 | nmdc:mga05p37_132541_c1 | 3300050507 | Bacteria | 3057 |
| 1027 | nmdc:mga05p37_152388_c1 | 3300050507 | Unclassified | 2827 |
| 1028 | nmdc:mga05p37_487067_c1 | 3300050507 | Bacteria | 1419 |
| 1029 | nmdc:mga05p37_624837_c1 | 3300050507 | Bacteria | 1211 |
| 1030 | nmdc:mga09592_1080630_c1 | 3300050508 | Bacteria | 668 |
| 1031 | nmdc:mga09592_43233_c1 | 3300050508 | Bacteria | 3792 |
| 1032 | nmdc:mga09592_9695_c1 | 3300050508 | Bacteria | 6284 |
| 1033 | nmdc:mga09592_9961_c1 | 3300050508 | Bacteria | 7732 |
| 1034 | nmdc:mga0qj67_1010_c1 | 3300050509 | Bacteria | 19413 |
| 1035 | nmdc:mga0qj67_16091_c2 | 3300050509 | Bacteria | 2546 |
| 1036 | nmdc:mga0qj67_196631_c1 | 3300050509 | Unclassified | 1639 |
| 1037 | nmdc:mga0qj67_211719_c1 | 3300050509 | Unclassified | 1574 |
| 1038 | nmdc:mga0qj67_69057_c1 | 3300050509 | Unclassified | 2817 |
| 1039 | nmdc:mga0qj67_990996_c1 | 3300050509 | Bacteria | 660 |
| 1040 | nmdc:mga06r32_52440_c1 | 3300050510 | Bacteria | 3907 |
| 1041 | nmdc:mga06r32_5760_c1 | 3300050510 | Bacteria | 11164 |
| 1042 | nmdc:mga06r32_8623_c1 | 3300050510 | Bacteria | 9190 |
| 1043 | nmdc:mga08y16_103044_c1 | 3300050511 | Bacteria | 2971 |
| 1044 | nmdc:mga08y16_12043_c1 | 3300050511 | Bacteria | 9087 |
| 1045 | nmdc:mga08y16_126031_c1 | 3300050511 | Bacteria | 2664 |
| 1046 | nmdc:mga08y16_14264_c1 | 3300050511 | Bacteria | 8363 |
| 1047 | nmdc:mga08y16_456996_c1 | 3300050511 | Bacteria | 1302 |
| 1048 | nmdc:mga08y16_48777_c1 | 3300050511 | Bacteria | 4431 |
| 1049 | nmdc:mga08y16_569920_c1 | 3300050511 | Unclassified | 1144 |
| 1050 | nmdc:mga0n895_10466_c2 | 3300050512 | Bacteria | 3653 |
| 1051 | nmdc:mga0n895_26617_c1 | 3300050512 | Bacteria | 5481 |
| 1052 | nmdc:mga0n895_340283_c1 | 3300050512 | Bacteria | 1520 |
| 1053 | nmdc:mga0n895_673657_c1 | 3300050512 | Unclassified | 1032 |
| 1054 | nmdc:mga0rr50_1040000_c1 | 3300050513 | Unclassified | 697 |
| 1055 | nmdc:mga0rr50_3269_c1 | 3300050513 | Bacteria | 9296 |
| 1056 | nmdc:mga0rr50_379608_c1 | 3300050513 | Bacteria | 1192 |
| 1057 | nmdc:mga0rr50_51384_c1 | 3300050513 | Bacteria | 3058 |
| 1058 | nmdc:mga08x19_1057907_c1 | 3300050514 | Bacteria | 576 |
| 1059 | nmdc:mga0a205_1562_c1 | 3300050515 | Bacteria | 19604 |
| 1060 | nmdc:mga0a205_176753_c1 | 3300050515 | Unclassified | 2030 |
| 1061 | nmdc:mga0a205_283890_c1 | 3300050515 | Bacteria | 1531 |
| 1062 | nmdc:mga0a205_447_c1 | 3300050515 | Bacteria | 31860 |
| 1063 | nmdc:mga0a205_5420_c1 | 3300050515 | Bacteria | 11503 |
| 1064 | Ga0495601_0033313 | 3300053077 | Bacteria | 3210 |
| 1065 | Ga0495612_0180982 | 3300053078 | Bacteria | 926 |
| 1066 | Ga0495595_0076412 | 3300053084 | Bacteria | 1590 |
| 1067 | Ga0495619_0002779 | 3300053085 | Bacteria | 11420 |
| 1068 | Ga0495619_0161349 | 3300053085 | Bacteria | 1548 |
| 1069 | Ga0501084_0097083 | 3300054114 | Bacteria | 2474 |
| 1070 | Ga0501084_1326807 | 3300054114 | Unclassified | 603 |
| 1071 | Ga0501084_1359834 | 3300054114 | Unclassified | 595 |
| 1072 | Ga0587084_102479 | 3300059477 | Unclassified | 582 |
| 1073 | Ga0587073_0085149 | 3300059492 | Unclassified | 793 |
| 1074 | Ga0587073_0117497 | 3300059492 | Archaea | 713 |
| 1075 | Ga0587083_0086995 | 3300059505 | Unclassified | 755 |
| 1076 | Ga0587092_130068 | 3300059512 | Unclassified | 546 |
| 1077 | Ga0587115_104972 | 3300059626 | Bacteria | 528 |
| 1078 | Ga0587117_061676 | 3300059627 | Bacteria | 646 |
| 1079 | Ga0587079_127218 | 3300059647 | Unclassified | 636 |
| 1080 | Ga0587079_183514 | 3300059647 | Unclassified | 561 |
| 1081 | Ga0501082_0236930 | 3300060353 | Unclassified | 1588 |
| 1082 | Ga0501082_0595509 | 3300060353 | Bacteria | 967 |
| 1083 | Ga0530510_0068212 | 3300061734 | Bacteria | 2580 |
| 1084 | Ga0530510_0150363 | 3300061734 | Bacteria | 1719 |
| 1085 | Ga0209996_1029159 | |||
| 1086 | MRS1b_contig_5777746 | |||
| 1087 | JGI24746J21847_1056352 | |||
| 1088 | JGI24747J21853_1029968 | |||
| 1089 | JGI24743J22301_10066454 | |||
| 1090 | JGI24750J21931_1028425 | |||
| 1091 | JGI24744J21845_10102481 | |||
| 1092 | JGI24034J26672_10033601 | |||
| 1093 | JGI24742J22300_10044319 | |||
| 1094 | Ga0006765J45826_119689 | |||
| 1095 | Ga0006778J45830_1088770 | |||
| 1096 | Ga0006759J45824_1028470 | |||
| 1097 | Ga0006759J45824_1037243 | |||
| 1098 | Ga0006759J45824_1039726 | |||
| 1099 | Ga0006759J45824_1059035 | |||
| 1100 | Ga0006759J45824_1079571 | |||
| 1101 | JGI25406J46586_10006131 | |||
| 1102 | JGI25406J46586_10006252 | |||
| 1103 | JGI25406J46586_10011237 | |||
| 1104 | JGI25406J46586_10025102 | |||
| 1105 | JGI25406J46586_10029195 | |||
| 1106 | Ga0006770J48903_1037006 | |||
| 1107 | Ga0006777J48905_1114579 | |||
| 1108 | Ga0007417J51691_1022871 | |||
| 1109 | Ga0007417J51691_1024922 | |||
| 1110 | Ga0007410J51695_1018074 | |||
| 1111 | Ga0007410J51695_1039180 | |||
| 1112 | Ga0007409J51694_1026771 | |||
| 1113 | Ga0007416J51690_1031709 | |||
| 1114 | Ga0007416J51690_1038893 | |||
| 1115 | Ga0007416J51690_1060112 | |||
| 1116 | Ga0032354_1025555 | |||
| 1117 | Ga0032354_1029260 | |||
| 1118 | Ga0032354_1048698 | |||
| 1119 | Ga0058858_1432881 | |||
| 1120 | Ga0058859_10026949 | |||
| 1121 | Ga0058859_10041449 | |||
| 1122 | Ga0058859_10046910 | |||
| 1123 | Ga0058859_10078578 | |||
| 1124 | Ga0058859_10126710 | |||
| 1125 | Ga0058859_10126987 | |||
| 1126 | Ga0058859_10137091 | |||
| 1127 | Ga0058859_11460156 | |||
| 1128 | Ga0058859_11512003 | |||
| 1129 | Ga0058859_11605069 | |||
| 1130 | Ga0058859_11792330 | |||
| 1131 | Ga0058859_11815650 | |||
| 1132 | Ga0058863_10083060 | |||
| 1133 | Ga0058863_11282215 | |||
| 1134 | Ga0058863_11723477 | |||
| 1135 | Ga0058863_11794519 | |||
| 1136 | Ga0058863_11840946 | |||
| 1137 | Ga0058863_11850213 | |||
| 1138 | Ga0058863_11923835 | |||
| 1139 | Ga0058861_10034176 | |||
| 1140 | Ga0058861_10136379 | |||
| 1141 | Ga0058861_11659293 | |||
| 1142 | Ga0058861_11815246 | |||
| 1143 | Ga0058861_11841430 | |||
| 1144 | Ga0058861_11860914 | |||
| 1145 | Ga0058861_11880184 | |||
| 1146 | Ga0058861_11920879 | |||
| 1147 | Ga0058861_11949659 | |||
| 1148 | Ga0058860_10005183 | |||
| 1149 | Ga0058860_10051366 | |||
| 1150 | Ga0058860_10105618 | |||
| 1151 | Ga0058860_10155442 | |||
| 1152 | Ga0058860_11084365 | |||
| 1153 | Ga0058860_12004642 | |||
| 1154 | Ga0058860_12144544 | |||
| 1155 | Ga0058860_12183639 | |||
| 1156 | Ga0058860_12244112 | |||
| 1157 | Ga0058862_10193550 | |||
| 1158 | Ga0058862_11954123 | |||
| 1159 | Ga0058862_12483175 | |||
| 1160 | Ga0058862_12486888 | |||
| 1161 | Ga0058862_12647495 | |||
| 1162 | Ga0058862_12856078 | |||
| 1163 | Ga0058862_12876065 | |||
| 1164 | Ga0065714_10312694 | |||
| 1165 | Ga0065714_10415629 | |||
| 1166 | Ga0065712_10008521 | |||
| 1167 | Ga0065712_10069898 | |||
| 1168 | Ga0065712_10309503 | |||
| 1169 | Ga0065712_10487943 | |||
| 1170 | Ga0065712_10796919 | |||
| 1171 | Ga0065715_10030244 | |||
| 1172 | Ga0065715_10040528 | |||
| 1173 | Ga0065715_10625707 | |||
| 1174 | Ga0065715_10987622 | |||
| 1175 | Ga0065707_10273897 | |||
| 1176 | Ga0065707_10468479 | |||
| 1177 | Ga0065707_10744246 | |||
| 1178 | Ga0070658_10562710 | |||
| 1179 | Ga0070676_10004761 | |||
| 1180 | Ga0070676_10015593 | |||
| 1181 | Ga0070676_10190864 | |||
| 1182 | Ga0070676_10255413 | |||
| 1183 | Ga0070676_10375109 | |||
| 1184 | Ga0070676_10518990 | |||
| 1185 | Ga0070683_100300494 | |||
| 1186 | Ga0070683_101247784 | |||
| 1187 | Ga0070690_100001322 | |||
| 1188 | Ga0070690_100008747 | |||
| 1189 | Ga0070690_100050288 | |||
| 1190 | Ga0070690_100388152 | |||
| 1191 | Ga0070690_100437970 | |||
| 1192 | Ga0070690_100616077 | |||
| 1193 | Ga0070690_100751774 | |||
| 1194 | Ga0070690_100880130 | |||
| 1195 | Ga0070670_100001926 | |||
| 1196 | Ga0070670_100035613 | |||
| 1197 | Ga0070670_100066566 | |||
| 1198 | Ga0070670_100122996 | |||
| 1199 | Ga0070670_100351062 | |||
| 1200 | Ga0070670_101280247 | |||
| 1201 | Ga0070670_102190468 | |||
| 1202 | Ga0070677_10002632 | |||
| 1203 | Ga0070677_10056606 | |||
| 1204 | Ga0070677_10058268 | |||
| 1205 | Ga0070677_10914225 | |||
| 1206 | Ga0068869_100002137 | |||
| 1207 | Ga0068869_100007360 | |||
| 1208 | Ga0068869_100379895 | |||
| 1209 | Ga0068869_100545120 | |||
| 1210 | Ga0070666_10012451 | |||
| 1211 | Ga0070666_10013448 | |||
| 1212 | Ga0070666_10057791 | |||
| 1213 | Ga0070680_101181970 | |||
| 1214 | Ga0070682_100389863 | |||
| 1215 | Ga0070682_100807339 | |||
| 1216 | Ga0068868_100009452 | |||
| 1217 | Ga0068868_100024652 | |||
| 1218 | Ga0068868_100081795 | |||
| 1219 | Ga0068868_101694428 | |||
| 1220 | Ga0070660_101052448 | |||
| 1221 | Ga0070689_100088178 | |||
| 1222 | Ga0070689_100099927 | |||
| 1223 | Ga0070689_100106600 | |||
| 1224 | Ga0070689_100606628 | |||
| 1225 | Ga0070691_10848017 | |||
| 1226 | Ga0070687_100056560 | |||
| 1227 | Ga0070687_100062483 | |||
| 1228 | Ga0070687_100569057 | |||
| 1229 | Ga0070661_100009146 | |||
| 1230 | Ga0070661_100015584 | |||
| 1231 | Ga0070661_100110436 | |||
| 1232 | Ga0070661_101472074 | |||
| 1233 | Ga0070692_10313636 | |||
| 1234 | Ga0070692_10450837 | |||
| 1235 | Ga0070692_10503914 | |||
| 1236 | Ga0070668_100420722 | |||
| 1237 | Ga0070668_100833366 | |||
| 1238 | Ga0070669_100095019 | |||
| 1239 | Ga0070669_100346750 | |||
| 1240 | Ga0070669_100502898 | |||
| 1241 | Ga0070669_100895726 | |||
| 1242 | Ga0070675_100002090 | |||
| 1243 | Ga0070675_100002256 | |||
| 1244 | Ga0070675_100120637 | |||
| 1245 | Ga0070675_100196210 | |||
| 1246 | Ga0070675_100217309 | |||
| 1247 | Ga0070675_100327615 | |||
| 1248 | Ga0070675_100477775 | |||
| 1249 | Ga0070675_100861329 | |||
| 1250 | Ga0070675_101090551 | |||
| 1251 | Ga0070671_100055572 | |||
| 1252 | Ga0070671_100082526 | |||
| 1253 | Ga0070671_100751455 | |||
| 1254 | Ga0070674_100000886 | |||
| 1255 | Ga0070674_100143868 | |||
| 1256 | Ga0070674_100157571 | |||
| 1257 | Ga0070674_100433185 | |||
| 1258 | Ga0070674_100774844 | |||
| 1259 | Ga0070674_102039985 | |||
| 1260 | Ga0070673_100006055 | |||
| 1261 | Ga0070673_100025160 | |||
| 1262 | Ga0070673_100034975 | |||
| 1263 | Ga0070673_100087081 | |||
| 1264 | Ga0070673_100087788 | |||
| 1265 | Ga0070673_100097088 | |||
| 1266 | Ga0070673_100168633 | |||
| 1267 | Ga0070673_100179468 | |||
| 1268 | Ga0070673_101498766 | |||
| 1269 | Ga0070673_102291341 | |||
| 1270 | Ga0070688_100055823 | |||
| 1271 | Ga0070688_100101625 | |||
| 1272 | Ga0070688_100141065 | |||
| 1273 | Ga0070688_101014252 | |||
| 1274 | Ga0070688_101499881 | |||
| 1275 | Ga0070659_100275636 | |||
| 1276 | Ga0070659_100856003 | |||
| 1277 | Ga0070667_100011039 | |||
| 1278 | Ga0070667_100016345 | |||
| 1279 | Ga0070667_100185177 | |||
| 1280 | Ga0070667_100357246 | |||
| 1281 | Ga0070667_100903809 | |||
| 1282 | Ga0070667_101696296 | |||
| 1283 | Ga0070703_10038536 | |||
| 1284 | Ga0070709_10293493 | |||
| 1285 | Ga0070713_100008352 | |||
| 1286 | Ga0070713_100016901 | |||
| 1287 | Ga0070710_10126494 | |||
| 1288 | Ga0070701_10028491 | |||
| 1289 | Ga0070701_10346443 | |||
| 1290 | Ga0070701_10472688 | |||
| 1291 | Ga0070701_10638180 | |||
| 1292 | Ga0070711_100082047 | |||
| 1293 | Ga0070705_100247770 | |||
| 1294 | Ga0070700_100658735 | |||
| 1295 | Ga0070700_101011706 | |||
| 1296 | Ga0070694_100002432 | |||
| 1297 | Ga0070694_100060666 | |||
| 1298 | Ga0070694_100123078 | |||
| 1299 | Ga0070694_101010233 | |||
| 1300 | Ga0070694_101354373 | |||
| 1301 | Ga0070694_101759469 | |||
| 1302 | Ga0070708_100206293 | |||
| 1303 | Ga0070678_100020013 | |||
| 1304 | Ga0070678_100086605 | |||
| 1305 | Ga0070678_100207890 | |||
| 1306 | Ga0070678_100250259 | |||
| 1307 | Ga0070678_100429136 | |||
| 1308 | Ga0070678_100458116 | |||
| 1309 | Ga0070678_100675839 | |||
| 1310 | Ga0070678_101222360 | |||
| 1311 | Ga0070678_101391975 | |||
| 1312 | Ga0070662_100021066 | |||
| 1313 | Ga0070662_100140882 | |||
| 1314 | Ga0070662_101666612 | |||
| 1315 | Ga0070681_10563192 | |||
| 1316 | Ga0070681_10895117 | |||
| 1317 | Ga0068867_100041600 | |||
| 1318 | Ga0068867_100172683 | |||
| 1319 | Ga0068867_100385134 | |||
| 1320 | Ga0068867_100389261 | |||
| 1321 | Ga0068867_101337525 | |||
| 1322 | Ga0070685_10085330 | |||
| 1323 | Ga0070685_10463749 | |||
| 1324 | Ga0070685_10606178 | |||
| 1325 | Ga0070685_11218565 | |||
| 1326 | Ga0070685_11536090 | |||
| 1327 | Ga0070706_100944354 | |||
| 1328 | Ga0070707_100052627 | |||
| 1329 | Ga0070707_100268217 | |||
| 1330 | Ga0070707_100678873 | |||
| 1331 | Ga0070698_100239132 | |||
| 1332 | Ga0070698_100642053 | |||
| 1333 | Ga0070698_101209240 | |||
| 1334 | Ga0070699_100328089 | |||
| 1335 | Ga0070699_100350401 | |||
| 1336 | Ga0070679_100410876 | |||
| 1337 | Ga0070679_101643129 | |||
| 1338 | Ga0070679_101748045 | |||
| 1339 | Ga0070684_100145486 | |||
| 1340 | Ga0070684_100649211 | |||
| 1341 | Ga0070697_100412378 | |||
| 1342 | Ga0070697_100580194 | |||
| 1343 | Ga0070697_102044297 | |||
| 1344 | Ga0070672_100007756 | |||
| 1345 | Ga0070672_100070011 | |||
| 1346 | Ga0070672_100154032 | |||
| 1347 | Ga0070672_100192204 | |||
| 1348 | Ga0070672_100494566 | |||
| 1349 | Ga0070672_100579221 | |||
| 1350 | Ga0070672_100775851 | |||
| 1351 | Ga0070672_101091232 | |||
| 1352 | Ga0070686_100004772 | |||
| 1353 | Ga0070686_100094519 | |||
| 1354 | Ga0070686_100095154 | |||
| 1355 | Ga0070686_100296267 | |||
| 1356 | Ga0070686_100492607 | |||
| 1357 | Ga0070695_100002378 | |||
| 1358 | Ga0070695_100355968 | |||
| 1359 | Ga0070695_100625921 | |||
| 1360 | Ga0070696_100038105 | |||
| 1361 | Ga0070696_100054711 | |||
| 1362 | Ga0070696_100083707 | |||
| 1363 | Ga0070696_100116180 | |||
| 1364 | Ga0070696_100408015 | |||
| 1365 | Ga0070665_100018571 | |||
| 1366 | Ga0070665_100240777 | |||
| 1367 | Ga0070704_100011387 | |||
| 1368 | Ga0070664_100000508 | |||
| 1369 | Ga0070664_100000777 | |||
| 1370 | Ga0070664_100001566 | |||
| 1371 | Ga0070664_100038915 | |||
| 1372 | Ga0070664_100660119 | |||
| 1373 | Ga0070664_100662596 | |||
| 1374 | Ga0068857_100185957 | |||
| 1375 | Ga0068857_100955366 | |||
| 1376 | Ga0068857_101529128 | |||
| 1377 | Ga0068854_100096744 | |||
| 1378 | Ga0070702_100129223 | |||
| 1379 | Ga0070702_100735481 | |||
| 1380 | Ga0070702_101863902 | |||
| 1381 | Ga0068852_100373732 | |||
| 1382 | Ga0068852_101033724 | |||
| 1383 | Ga0068859_100030951 | |||
| 1384 | Ga0068859_100084276 | |||
| 1385 | Ga0068859_100116245 | |||
| 1386 | Ga0068859_100125942 | |||
| 1387 | Ga0068859_100145523 | |||
| 1388 | Ga0068859_100169629 | |||
| 1389 | Ga0068859_100458607 | |||
| 1390 | Ga0068859_100738246 | |||
| 1391 | Ga0068859_101054128 | |||
| 1392 | Ga0068859_101647792 | |||
| 1393 | Ga0068859_102270481 | |||
| 1394 | Ga0068864_100001955 | |||
| 1395 | Ga0068864_100016892 | |||
| 1396 | Ga0068864_100032637 | |||
| 1397 | Ga0068864_100051480 | |||
| 1398 | Ga0068864_100624365 | |||
| 1399 | Ga0068864_101196096 | |||
| 1400 | Ga0068864_101336734 | |||
| 1401 | Ga0068866_10255411 | |||
| 1402 | Ga0068866_10282716 | |||
| 1403 | Ga0068866_11332021 | |||
| 1404 | Ga0068861_100040419 | |||
| 1405 | Ga0068861_100053271 | |||
| 1406 | Ga0068861_100117895 | |||
| 1407 | Ga0068861_100159613 | |||
| 1408 | Ga0068861_100373454 | |||
| 1409 | Ga0068861_100573579 | |||
| 1410 | Ga0068861_100637250 | |||
| 1411 | Ga0068861_100900015 | |||
| 1412 | Ga0068861_101097138 | |||
| 1413 | Ga0068851_10158083 | |||
| 1414 | Ga0068851_10336477 | |||
| 1415 | Ga0068870_10003483 | |||
| 1416 | Ga0068870_10048919 | |||
| 1417 | Ga0068870_10101955 | |||
| 1418 | Ga0068870_10138160 | |||
| 1419 | Ga0068870_10309809 | |||
| 1420 | Ga0068870_10826298 | |||
| 1421 | Ga0068863_100006787 | |||
| 1422 | Ga0068863_100061190 | |||
| 1423 | Ga0068863_100091448 | |||
| 1424 | Ga0068863_100352936 | |||
| 1425 | Ga0068863_100470819 | |||
| 1426 | Ga0068863_100494416 | |||
| 1427 | Ga0068863_100508268 | |||
| 1428 | Ga0068863_100576130 | |||
| 1429 | Ga0068863_100842615 | |||
| 1430 | Ga0068863_102136646 | |||
| 1431 | Ga0068858_100049801 | |||
| 1432 | Ga0068858_100053429 | |||
| 1433 | Ga0068858_100060443 | |||
| 1434 | Ga0068858_100091515 | |||
| 1435 | Ga0068858_100323799 | |||
| 1436 | Ga0068858_100579328 | |||
| 1437 | Ga0068860_100030936 | |||
| 1438 | Ga0068860_100285530 | |||
| 1439 | Ga0068860_101402766 | |||
| 1440 | Ga0068860_102554422 | |||
| 1441 | Ga0068862_100042105 | |||
| 1442 | Ga0068862_100321342 | |||
| 1443 | Ga0068862_100512126 | |||
| 1444 | Ga0068862_100743220 | |||
| 1445 | Ga0068862_100896566 | |||
| 1446 | Ga0068862_100918250 | |||
| 1447 | Ga0068862_101239094 | |||
| 1448 | Ga0081455_10121568 | |||
| 1449 | Ga0081455_10797153 | |||
| 1450 | Ga0081539_10000133 | |||
| 1451 | Ga0081539_10000329 | |||
| 1452 | Ga0081539_10005236 | |||
| 1453 | Ga0075432_10013769 | |||
| 1454 | Ga0070715_10264999 | |||
| 1455 | Ga0097621_100004942 | |||
| 1456 | Ga0097621_100083160 | |||
| 1457 | Ga0097621_100106178 | |||
| 1458 | Ga0097621_100220674 | |||
| 1459 | Ga0097621_100278806 | |||
| 1460 | Ga0097621_100599232 | |||
| 1461 | Ga0097621_100620811 | |||
| 1462 | Ga0097621_101721143 | |||
| 1463 | Ga0097621_102297626 | |||
| 1464 | Ga0068871_100000568 | |||
| 1465 | Ga0068871_100063687 | |||
| 1466 | Ga0068871_100141280 | |||
| 1467 | Ga0068871_100145951 | |||
| 1468 | Ga0068871_100235006 | |||
| 1469 | Ga0068871_100335932 | |||
| 1470 | Ga0068871_100354613 | |||
| 1471 | Ga0068871_100670980 | |||
| 1472 | Ga0068871_100729491 | |||
| 1473 | Ga0068871_100909712 | |||
| 1474 | Ga0075428_100008383 | |||
| 1475 | Ga0075428_100016065 | |||
| 1476 | Ga0075428_100016769 | |||
| 1477 | Ga0075428_100029402 | |||
| 1478 | Ga0075428_100841320 | |||
| 1479 | Ga0075428_100940955 | |||
| 1480 | Ga0075428_101045280 | |||
| 1481 | Ga0075430_100009192 | |||
| 1482 | Ga0075430_100015340 | |||
| 1483 | Ga0075430_100045019 | |||
| 1484 | Ga0075430_100127371 | |||
| 1485 | Ga0075430_100132865 | |||
| 1486 | Ga0075430_100155074 | |||
| 1487 | Ga0075430_101013758 | |||
| 1488 | Ga0075430_101310817 | |||
| 1489 | Ga0075431_100006482 | |||
| 1490 | Ga0075431_100006533 | |||
| 1491 | Ga0075431_100009194 | |||
| 1492 | Ga0075431_100151409 | |||
| 1493 | Ga0075433_10000629 | |||
| 1494 | Ga0075433_10006287 | |||
| 1495 | Ga0075433_10127724 | |||
| 1496 | Ga0075433_10176086 | |||
| 1497 | Ga0075433_10323396 | |||
| 1498 | Ga0075433_10780086 | |||
| 1499 | Ga0075434_100050439 | |||
| 1500 | Ga0075434_100119953 | |||
| 1501 | Ga0075434_100172414 | |||
| 1502 | Ga0075434_100508667 | |||
| 1503 | Ga0075429_100012736 | |||
| 1504 | Ga0075429_100012997 | |||
| 1505 | Ga0075429_100017263 | |||
| 1506 | Ga0075429_100039720 | |||
| 1507 | Ga0075429_100432837 | |||
| 1508 | Ga0068865_100031357 | |||
| 1509 | Ga0068865_100208248 | |||
| 1510 | Ga0068865_100483312 | |||
| 1511 | Ga0068865_100660031 | |||
| 1512 | Ga0068865_100770477 | |||
| 1513 | Ga0075436_100169159 | |||
| 1514 | Ga0075436_101137922 | |||
| 1515 | Ga0097620_100030951 | |||
| 1516 | Ga0097620_100084278 | |||
| 1517 | Ga0097620_100116241 | |||
| 1518 | Ga0097620_100125949 | |||
| 1519 | Ga0097620_100145520 | |||
| 1520 | Ga0097620_100169619 | |||
| 1521 | Ga0097620_100458610 | |||
| 1522 | Ga0097620_100738229 | |||
| 1523 | Ga0097620_101054037 | |||
| 1524 | Ga0097620_101647776 | |||
| 1525 | Ga0097620_102270379 | |||
| 1526 | Ga0075435_100000725 | |||
| 1527 | Ga0075435_100009913 | |||
| 1528 | Ga0075435_100126562 | |||
| 1529 | Ga0075435_100222304 | |||
| 1530 | Ga0075435_101552773 | |||
| 1531 | Ga0105244_10233077 | |||
| 1532 | Ga0111539_10009474 | |||
| 1533 | Ga0111539_10019921 | |||
| 1534 | Ga0111539_10024909 | |||
| 1535 | Ga0111539_10026447 | |||
| 1536 | Ga0111539_10036678 | |||
| 1537 | Ga0111539_10041446 | |||
| 1538 | Ga0111539_10064583 | |||
| 1539 | Ga0111539_10382256 | |||
| 1540 | Ga0111539_10670504 | |||
| 1541 | Ga0105245_10561016 | |||
| 1542 | Ga0105245_10587970 | |||
| 1543 | Ga0105245_10589073 | |||
| 1544 | Ga0105245_11563503 | |||
| 1545 | Ga0105245_11955339 | |||
| 1546 | Ga0105247_10328988 | |||
| 1547 | Ga0105247_10419111 | |||
| 1548 | Ga0114129_10013443 | |||
| 1549 | Ga0114129_10045450 | |||
| 1550 | Ga0114129_10066168 | |||
| 1551 | Ga0114129_10168326 | |||
| 1552 | Ga0114129_10191100 | |||
| 1553 | Ga0114129_10404571 | |||
| 1554 | Ga0114129_10515153 | |||
| 1555 | Ga0105243_10038297 | |||
| 1556 | Ga0105243_10044742 | |||
| 1557 | Ga0105243_12414187 | |||
| 1558 | Ga0105243_13084620 | |||
| 1559 | Ga0105242_10018370 | |||
| 1560 | Ga0105242_10271885 | |||
| 1561 | Ga0105242_10327650 | |||
| 1562 | Ga0105248_10001517 | |||
| 1563 | Ga0105248_10001944 | |||
| 1564 | Ga0105248_10020509 | |||
| 1565 | Ga0105248_10093632 | |||
| 1566 | Ga0105248_10117287 | |||
| 1567 | Ga0105248_10574557 | |||
| 1568 | Ga0105248_10580338 | |||
| 1569 | Ga0105248_10924951 | |||
| 1570 | Ga0105248_11393934 | |||
| 1571 | Ga0105248_12083592 | |||
| 1572 | Ga0105238_10017272 | |||
| 1573 | Ga0105238_10824068 | |||
| 1574 | Ga0105249_10023740 | |||
| 1575 | Ga0105249_10245886 | |||
| 1576 | Ga0105249_10643576 | |||
| 1577 | Ga0105249_11270174 | |||
| 1578 | Ga0105246_10124085 | |||
| 1579 | Ga0105246_10338591 | |||
| 1580 | Ga0105246_10403085 | |||
| 1581 | Ga0105246_11011200 | |||
| 1582 | Ga0105246_11405420 | |||
| 1583 | Ga0157319_1020015 | |||
| 1584 | Ga0157371_10309502 | |||
| 1585 | Ga0157374_10279857 | |||
| 1586 | Ga0157374_10310109 | |||
| 1587 | Ga0157374_10623469 | |||
| 1588 | Ga0157374_11130368 | |||
| 1589 | Ga0157378_10052770 | |||
| 1590 | Ga0157378_10087855 | |||
| 1591 | Ga0157378_10428634 | |||
| 1592 | Ga0157378_10504196 | |||
| 1593 | Ga0163162_10004920 | |||
| 1594 | Ga0163162_10006636 | |||
| 1595 | Ga0163162_10038924 | |||
| 1596 | Ga0163162_10071757 | |||
| 1597 | Ga0163162_10506394 | |||
| 1598 | Ga0163162_10669783 | |||
| 1599 | Ga0163162_11508193 | |||
| 1600 | Ga0163162_11699803 | |||
| 1601 | Ga0163162_11794340 | |||
| 1602 | Ga0163162_12335039 | |||
| 1603 | Ga0157372_12028297 | |||
| 1604 | Ga0157375_10063280 | |||
| 1605 | Ga0157375_10146286 | |||
| 1606 | Ga0157375_10428975 | |||
| 1607 | Ga0157375_10830745 | |||
| 1608 | Ga0157375_10871944 | |||
| 1609 | Ga0157375_11002738 | |||
| 1610 | Ga0157375_11132466 | |||
| 1611 | Ga0157375_11210806 | |||
| 1612 | Ga0163163_10001063 | |||
| 1613 | Ga0163163_10006058 | |||
| 1614 | Ga0163163_10020811 | |||
| 1615 | Ga0163163_10026210 | |||
| 1616 | Ga0163163_10183550 | |||
| 1617 | Ga0163163_10392761 | |||
| 1618 | Ga0163163_10730724 | |||
| 1619 | Ga0163163_10849677 | |||
| 1620 | Ga0157380_10006441 | |||
| 1621 | Ga0157380_10007437 | |||
| 1622 | Ga0157380_10043947 | |||
| 1623 | Ga0157380_10077491 | |||
| 1624 | Ga0157380_10214769 | |||
| 1625 | Ga0157380_10252381 | |||
| 1626 | Ga0157380_13009978 | |||
| 1627 | Ga0157377_10002509 | |||
| 1628 | Ga0157377_10104308 | |||
| 1629 | Ga0157377_10197566 | |||
| 1630 | Ga0157377_10199245 | |||
| 1631 | Ga0157377_10299273 | |||
| 1632 | Ga0157377_10351628 | |||
| 1633 | Ga0157379_10187924 | |||
| 1634 | Ga0157379_10439316 | |||
| 1635 | Ga0157376_10009221 | |||
| 1636 | Ga0157376_10069205 | |||
| 1637 | Ga0157376_10083392 | |||
| 1638 | Ga0157376_10133647 | |||
| 1639 | Ga0157376_10460734 | |||
| 1640 | Ga0157376_10540458 | |||
| 1641 | Ga0157376_10692316 | |||
| 1642 | Ga0157376_10712687 | |||
| 1643 | Ga0157376_11057680 | |||
| 1644 | Ga0157376_11885820 | |||
| 1645 | Ga0163161_10043995 | |||
| 1646 | Ga0163161_10062221 | |||
| 1647 | Ga0163161_10174958 | |||
| 1648 | Ga0163161_10622621 | |||
| 1649 | Ga0163161_10675700 | |||
| 1650 | Ga0197907_11064887 | |||
| 1651 | Ga0206356_10295248 | |||
| 1652 | Ga0206356_11338882 | |||
| 1653 | Ga0206349_1579484 | |||
| 1654 | Ga0206349_1745606 | |||
| 1655 | Ga0206352_10240803 | |||
| 1656 | Ga0206352_10435217 | |||
| 1657 | Ga0206352_10459886 | |||
| 1658 | Ga0206352_10684472 | |||
| 1659 | Ga0206352_10789063 | |||
| 1660 | Ga0206352_10808230 | |||
| 1661 | Ga0206350_10603039 | |||
| 1662 | Ga0206350_11293131 | |||
| 1663 | Ga0206350_11655528 | |||
| 1664 | Ga0206354_11378251 | |||
| 1665 | Ga0206353_11760492 | |||
| 1666 | Ga0206353_11983827 | |||
| 1667 | Ga0224712_10279338 | |||
| 1668 | Ga0224712_10317047 | |||
| 1669 | Ga0207666_1016382 | |||
| 1670 | Ga0207673_1046337 | |||
| 1671 | Ga0207697_10021544 | |||
| 1672 | Ga0207697_10089813 | |||
| 1673 | Ga0207697_10125669 | |||
| 1674 | Ga0207697_10172905 | |||
| 1675 | Ga0207656_10171150 | |||
| 1676 | Ga0207653_10091567 | |||
| 1677 | Ga0207682_10003633 | |||
| 1678 | Ga0207682_10021350 | |||
| 1679 | Ga0207682_10027680 | |||
| 1680 | Ga0207682_10038379 | |||
| 1681 | Ga0207682_10057813 | |||
| 1682 | Ga0207682_10184607 | |||
| 1683 | Ga0207692_10771792 | |||
| 1684 | Ga0207642_10048207 | |||
| 1685 | Ga0207688_10015436 | |||
| 1686 | Ga0207688_10177251 | |||
| 1687 | Ga0207688_10208009 | |||
| 1688 | Ga0207680_10007945 | |||
| 1689 | Ga0207680_10017707 | |||
| 1690 | Ga0207680_10117060 | |||
| 1691 | Ga0207680_10199483 | |||
| 1692 | Ga0207685_10117996 | |||
| 1693 | Ga0207685_10169964 | |||
| 1694 | Ga0207699_10020357 | |||
| 1695 | Ga0207699_10057371 | |||
| 1696 | Ga0207645_10001298 | |||
| 1697 | Ga0207645_10010593 | |||
| 1698 | Ga0207645_10015451 | |||
| 1699 | Ga0207645_10365288 | |||
| 1700 | Ga0207643_10001468 | |||
| 1701 | Ga0207643_10004046 | |||
| 1702 | Ga0207643_10023721 | |||
| 1703 | Ga0207643_10036792 | |||
| 1704 | Ga0207643_10056693 | |||
| 1705 | Ga0207643_10097705 | |||
| 1706 | Ga0207643_10121432 | |||
| 1707 | Ga0207643_10226116 | |||
| 1708 | Ga0207643_10259338 | |||
| 1709 | Ga0207707_10040412 | |||
| 1710 | Ga0207707_10098983 | |||
| 1711 | Ga0207707_10202660 | |||
| 1712 | Ga0207707_10923223 | |||
| 1713 | Ga0207707_10957488 | |||
| 1714 | Ga0207660_10653666 | |||
| 1715 | Ga0207660_10973501 | |||
| 1716 | Ga0207662_10034684 | |||
| 1717 | Ga0207662_10042957 | |||
| 1718 | Ga0207662_10833656 | |||
| 1719 | Ga0207662_10951754 | |||
| 1720 | Ga0207657_10500561 | |||
| 1721 | Ga0207657_11013174 | |||
| 1722 | Ga0207649_10013669 | |||
| 1723 | Ga0207649_10048687 | |||
| 1724 | Ga0207649_10088917 | |||
| 1725 | Ga0207652_10847973 | |||
| 1726 | Ga0207646_10726633 | |||
| 1727 | Ga0207646_11566500 | |||
| 1728 | Ga0207681_10104603 | |||
| 1729 | Ga0207681_10146942 | |||
| 1730 | Ga0207681_10415836 | |||
| 1731 | Ga0207681_10698962 | |||
| 1732 | Ga0207681_11192343 | |||
| 1733 | Ga0207681_11300194 | |||
| 1734 | Ga0207694_10001914 | |||
| 1735 | Ga0207694_10312082 | |||
| 1736 | Ga0207650_10000444 | |||
| 1737 | Ga0207650_10008206 | |||
| 1738 | Ga0207650_10026771 | |||
| 1739 | Ga0207650_10030746 | |||
| 1740 | Ga0207650_10061140 | |||
| 1741 | Ga0207650_10857860 | |||
| 1742 | Ga0207650_11037574 | |||
| 1743 | Ga0207650_11623018 | |||
| 1744 | Ga0207659_10018306 | |||
| 1745 | Ga0207659_10022541 | |||
| 1746 | Ga0207659_10071465 | |||
| 1747 | Ga0207659_10200545 | |||
| 1748 | Ga0207659_10245784 | |||
| 1749 | Ga0207659_10379614 | |||
| 1750 | Ga0207659_10531082 | |||
| 1751 | Ga0207659_10637246 | |||
| 1752 | Ga0207659_10658386 | |||
| 1753 | Ga0207659_10895009 | |||
| 1754 | Ga0207659_11599087 | |||
| 1755 | Ga0207687_10239498 | |||
| 1756 | Ga0207700_10001848 | |||
| 1757 | Ga0207700_10154681 | |||
| 1758 | Ga0207644_10151257 | |||
| 1759 | Ga0207644_10405017 | |||
| 1760 | Ga0207644_10423968 | |||
| 1761 | Ga0207690_10096866 | |||
| 1762 | Ga0207690_11123907 | |||
| 1763 | Ga0207706_10011838 | |||
| 1764 | Ga0207706_10162045 | |||
| 1765 | Ga0207706_10462887 | |||
| 1766 | Ga0207706_10533525 | |||
| 1767 | Ga0207686_10004639 | |||
| 1768 | Ga0207686_10311369 | |||
| 1769 | Ga0207686_11524530 | |||
| 1770 | Ga0207709_10007046 | |||
| 1771 | Ga0207709_10099178 | |||
| 1772 | Ga0207709_10510013 | |||
| 1773 | Ga0207670_10050526 | |||
| 1774 | Ga0207670_10093849 | |||
| 1775 | Ga0207670_10143450 | |||
| 1776 | Ga0207670_10211011 | |||
| 1777 | Ga0207670_10387903 | |||
| 1778 | Ga0207670_11348098 | |||
| 1779 | Ga0207669_10049870 | |||
| 1780 | Ga0207669_10069194 | |||
| 1781 | Ga0207669_10076983 | |||
| 1782 | Ga0207669_10142835 | |||
| 1783 | Ga0207704_10019639 | |||
| 1784 | Ga0207704_10087191 | |||
| 1785 | Ga0207704_10130706 | |||
| 1786 | Ga0207704_10242141 | |||
| 1787 | Ga0207704_10362442 | |||
| 1788 | Ga0207665_10337223 | |||
| 1789 | Ga0207691_10005742 | |||
| 1790 | Ga0207691_10029518 | |||
| 1791 | Ga0207691_10029580 | |||
| 1792 | Ga0207691_10060228 | |||
| 1793 | Ga0207691_10072536 | |||
| 1794 | Ga0207691_10083937 | |||
| 1795 | Ga0207691_10326382 | |||
| 1796 | Ga0207691_10361489 | |||
| 1797 | Ga0207691_10375308 | |||
| 1798 | Ga0207691_10497650 | |||
| 1799 | Ga0207691_10602285 | |||
| 1800 | Ga0207691_10849236 | |||
| 1801 | Ga0207691_10924073 | |||
| 1802 | Ga0207711_10035868 | |||
| 1803 | Ga0207711_10053293 | |||
| 1804 | Ga0207711_10556610 | |||
| 1805 | Ga0207711_11027311 | |||
| 1806 | Ga0207689_10015899 | |||
| 1807 | Ga0207689_10080645 | |||
| 1808 | Ga0207689_10128041 | |||
| 1809 | Ga0207661_10356837 | |||
| 1810 | Ga0207679_10002310 | |||
| 1811 | Ga0207679_10004151 | |||
| 1812 | Ga0207679_10006713 | |||
| 1813 | Ga0207679_10037678 | |||
| 1814 | Ga0207679_10114572 | |||
| 1815 | Ga0207679_10568348 | |||
| 1816 | Ga0207679_10951207 | |||
| 1817 | Ga0207667_11857241 | |||
| 1818 | Ga0207651_10048365 | |||
| 1819 | Ga0207651_10061313 | |||
| 1820 | Ga0207651_10243056 | |||
| 1821 | Ga0207651_11434873 | |||
| 1822 | Ga0207712_10010441 | |||
| 1823 | Ga0207712_10033145 | |||
| 1824 | Ga0207712_10098510 | |||
| 1825 | Ga0207712_10538935 | |||
| 1826 | Ga0207668_10250899 | |||
| 1827 | Ga0207668_10968633 | |||
| 1828 | Ga0207668_11050528 | |||
| 1829 | Ga0207640_10073692 | |||
| 1830 | Ga0207658_10006375 | |||
| 1831 | Ga0207658_10131117 | |||
| 1832 | Ga0207658_10775736 | |||
| 1833 | Ga0207658_11092806 | |||
| 1834 | Ga0207658_11260971 | |||
| 1835 | Ga0207677_10008838 | |||
| 1836 | Ga0207677_10169361 | |||
| 1837 | Ga0207677_10243815 | |||
| 1838 | Ga0207677_10547265 | |||
| 1839 | Ga0207703_10045243 | |||
| 1840 | Ga0207703_10109644 | |||
| 1841 | Ga0207703_10392473 | |||
| 1842 | Ga0207703_10394550 | |||
| 1843 | Ga0207703_10791929 | |||
| 1844 | Ga0207678_10066128 | |||
| 1845 | Ga0207708_10047881 | |||
| 1846 | Ga0207708_10065875 | |||
| 1847 | Ga0207708_10181010 | |||
| 1848 | Ga0207708_10229742 | |||
| 1849 | Ga0207708_10427741 | |||
| 1850 | Ga0207708_10640588 | |||
| 1851 | Ga0207708_10699181 | |||
| 1852 | Ga0207641_10026440 | |||
| 1853 | Ga0207641_10045780 | |||
| 1854 | Ga0207641_10433139 | |||
| 1855 | Ga0207641_10492034 | |||
| 1856 | Ga0207641_10803812 | |||
| 1857 | Ga0207641_10839825 | |||
| 1858 | Ga0207641_10842728 | |||
| 1859 | Ga0207641_10962386 | |||
| 1860 | Ga0207641_12549783 | |||
| 1861 | Ga0207648_10002543 | |||
| 1862 | Ga0207648_10045092 | |||
| 1863 | Ga0207648_10046886 | |||
| 1864 | Ga0207648_10155578 | |||
| 1865 | Ga0207648_10222971 | |||
| 1866 | Ga0207648_10458878 | |||
| 1867 | Ga0207648_11155323 | |||
| 1868 | Ga0207648_11466597 | |||
| 1869 | Ga0207676_10001140 | |||
| 1870 | Ga0207676_10033261 | |||
| 1871 | Ga0207676_10050009 | |||
| 1872 | Ga0207676_10086124 | |||
| 1873 | Ga0207676_10826343 | |||
| 1874 | Ga0207676_11515952 | |||
| 1875 | Ga0207674_10349087 | |||
| 1876 | Ga0207674_10410015 | |||
| 1877 | Ga0207674_10504647 | |||
| 1878 | Ga0207675_100022758 | |||
| 1879 | Ga0207675_100050204 | |||
| 1880 | Ga0207675_100060016 | |||
| 1881 | Ga0207675_100233173 | |||
| 1882 | Ga0207675_100678973 | |||
| 1883 | Ga0207675_100815849 | |||
| 1884 | Ga0207683_10012865 | |||
| 1885 | Ga0207683_10039566 | |||
| 1886 | Ga0207683_10101200 | |||
| 1887 | Ga0207683_10114527 | |||
| 1888 | Ga0207683_10143665 | |||
| 1889 | Ga0207683_10156716 | |||
| 1890 | Ga0207683_10332684 | |||
| 1891 | Ga0207683_10852843 | |||
| 1892 | Ga0207683_11240104 | |||
| 1893 | Ga0207683_11674409 | |||
| 1894 | Ga0207683_11968377 | |||
| 1895 | Ga0207698_10633523 | |||
| 1896 | Ga0207698_11154225 | |||
| 1897 | Ga0209966_1030286 | |||
| 1898 | Ga0209974_10050858 | |||
| 1899 | Ga0207428_10000737 | |||
| 1900 | Ga0207428_10015072 | |||
| 1901 | Ga0207428_10111516 | |||
| 1902 | Ga0207428_10161695 | |||
| 1903 | Ga0207428_10171107 | |||
| 1904 | Ga0207428_10470100 | |||
| 1905 | Ga0207428_10916189 | |||
| 1906 | Ga0268266_10203889 | |||
| 1907 | Ga0268266_12212342 | |||
| 1908 | Ga0268265_10055983 | |||
| 1909 | Ga0268265_10069478 | |||
| 1910 | Ga0268265_10368439 | |||
| 1911 | Ga0268265_10566780 | |||
| 1912 | Ga0268265_10700890 | |||
| 1913 | Ga0268264_10018520 | |||
| 1914 | Ga0268264_11047025 | |||
| 1915 | Ga0268264_11095719 | |||
| 1916 | Ga0268264_12011903 | |||
| 1917 | Ga0268264_12352865 | |||
| 1918 | Ga0265766_1012685 | |||
| 1919 | Ga0307405_10694688 | |||
| 1920 | Ga0307409_102199855 | |||
| 1921 | Ga0307416_100126286 | |||
| 1922 | Ga0307416_100583921 | |||
| 1923 | Ga0307416_103431786 | |||
| 1924 | Ga0307411_10694448 | |||
| 1925 | Ga0373958_0111216 | |||
| 1926 | Ga0373934_0192326 | |||
| 1927 | Ga0373951_0067567 | |||
| 1928 | Ga0373923_0185023 | |||
| 1929 | Ga0373953_0013290 | |||
| 1930 | Ga0373953_0058625 | |||
| 1931 | Ga0373954_0164777 | |||
| 1932 | Ga0373956_0214315 | |||
| 1933 | Ga0373956_0287846 | |||
| 1934 | Ga0373956_0332099 | |||
| 1935 | Ga0373956_0351300 | |||
| 1936 | Ga0373957_0074125 | |||
| 1937 | Ga0373957_0263769 | |||
| 1938 | Ga0373957_0402846 | |||
| 1939 | Ga0373955_0093818 | |||
| 1940 | Ga0373955_0225736 | |||
| 1941 | Ga0373955_0251665 | |||
| 1942 | Ga0373955_0605334 | |||
| 1943 | Ga0373962_0025225 | |||
| 1944 | Ga0373924_0296791 | |||
| 1945 | Ga0373931_0894961 | |||
| 1946 | Ga0373935_0504493 | |||
| 1947 | Ga0373927_0620039 | |||
| 1948 | Ga0373937_0008123 | |||
| 1949 | Ga0373937_0008508 | |||
| 1950 | Ga0373937_0032356 | |||
| 1951 | Ga0373937_0069353 | |||
| 1952 | Ga0373937_0108614 | |||
| 1953 | Ga0373937_0294226 | |||
| 1954 | Ga0373937_0353052 | |||
| 1955 | Ga0373937_0963108 | |||
| 1956 | Ga0373925_1425682 | |||
| 1957 | Ga0436365_1792320 | |||
| 1958 | Ga0439453_0055457 | |||
| 1959 | Ga0451798_0799210 | |||
| 1960 | Ga0451802_0925699 | |||
| 1961 | Ga0451853_3575839 | |||
| 1962 | Ga0439450_007173 | |||
| 1963 | Ga0439455_0178000 | |||
| 1964 | Ga0439444_0031059 | |||
| 1965 | Ga0439460_0114322 | |||
| 1966 | Ga0439460_0115636 | |||
| 1967 | Ga0450916_000521 | |||
| 1968 | Ga0451576_0191432 | |||
| 1969 | Ga0451576_0684140 | |||
| 1970 | Ga0451576_0694000 | |||
| 1971 | Ga0495592_0027743 | |||
| 1972 | Ga0495592_0051359 | |||
| 1973 | Ga0495592_0135001 | |||
| 1974 | Ga0495603_0100533 | |||
| 1975 | Ga0495629_0026701 | |||
| 1976 | Ga0495629_0327491 | |||
| 1977 | Ga0495629_0642645 | |||
| 1978 | Ga0495651_0975918 | |||
| 1979 | Ga0495653_0213493 | |||
| 1980 | Ga0495653_0568185 | |||
| 1981 | Ga0495580_0027778 | |||
| 1982 | Ga0495580_0153936 | |||
| 1983 | Ga0495580_0154271 | |||
| 1984 | Ga0495580_0760740 | |||
| 1985 | Ga0495582_0329047 | |||
| 1986 | Ga0495639_0098601 | |||
| 1987 | Ga0495662_0195082 | |||
| 1988 | Ga0495662_0208821 | |||
| 1989 | Ga0495664_0125107 | |||
| 1990 | Ga0495664_0411506 | |||
| 1991 | Ga0495594_0015076 | |||
| 1992 | Ga0495594_0457286 | |||
| 1993 | Ga0495608_0010456 | |||
| 1994 | Ga0495608_0019307 | |||
| 1995 | Ga0495618_0134348 | |||
| 1996 | Ga0495618_0859922 | |||
| 1997 | Ga0495628_0023317 | |||
| 1998 | Ga0495630_0008571 | |||
| 1999 | Ga0495630_0069380 | |||
| 2000 | Ga0495630_0179334 | |||
| 2001 | Ga0495630_0330300 | |||
| 2002 | Ga0495652_0621223 | |||
| 2003 | Ga0495640_0630953 | |||
| 2004 | Ga0495586_0039774 | |||
| 2005 | Ga0495586_0784856 | |||
| 2006 | Ga0495598_0017022 | |||
| 2007 | Ga0495621_0124459 | |||
| 2008 | Ga0495621_0343075 | |||
| 2009 | Ga0495621_0396057 | |||
| 2010 | Ga0495645_0055392 | |||
| 2011 | Ga0495667_0000776 | |||
| 2012 | Ga0495667_0004456 | |||
| 2013 | Ga0495667_0079754 | |||
| 2014 | Ga0495656_0061613 | |||
| 2015 | Ga0495656_0106196 | |||
| 2016 | Ga0495634_0039953 | |||
| 2017 | Ga0495634_0081494 | |||
| 2018 | Ga0495634_0102217 | |||
| 2019 | Ga0495611_0523728 | |||
| 2020 | Ga0495635_0291583 | |||
| 2021 | Ga0495659_0055959 | |||
| 2022 | Ga0495659_0251844 | |||
| 2023 | Ga0495661_0259399 | |||
| 2024 | Ga0495657_0004256 | |||
| 2025 | Ga0495657_0006819 | |||
| 2026 | Ga0495599_0087243 | |||
| 2027 | Ga0495658_0634609 | |||
| 2028 | Ga0495669_0005724 | |||
| 2029 | Ga0495613_0000464 | |||
| 2030 | Ga0495613_0055782 | |||
| 2031 | Ga0495613_0057238 | |||
| 2032 | Ga0495613_0078784 | |||
| 2033 | Ga0495613_0104834 | |||
| 2034 | Ga0495613_0553866 | |||
| 2035 | Ga0495670_0143768 | |||
| 2036 | Ga0495670_0206543 | |||
| 2037 | Ga0495600_0219244 | |||
| 2038 | Ga0495600_0844123 | |||
| 2039 | Ga0495604_0028365 | |||
| 2040 | Ga0495636_0424026 | |||
| 2041 | Ga0495674_0045727 | |||
| 2042 | Ga0495674_0066105 | |||
| 2043 | Ga0495674_0135662 | |||
| 2044 | Ga0495674_0248641 | |||
| 2045 | Ga0495674_1034375 | |||
| 2046 | Ga0495672_0301256 | |||
| 2047 | Ga0495680_0172039 | |||
| 2048 | Ga0495680_0215605 | |||
| 2049 | Ga0495680_0927646 | |||
| 2050 | Ga0495675_0351464 | |||
| 2051 | Ga0495681_0265539 | |||
| 2052 | Ga0495684_0000213 | |||
| 2053 | Ga0495684_0054033 | |||
| 2054 | Ga0495684_0081986 | |||
| 2055 | Ga0495684_0133546 | |||
| 2056 | Ga0495684_0263556 | |||
| 2057 | Ga0495684_0512294 | |||
| 2058 | Ga0495614_0358976 | |||
| 2059 | Ga0496107_1020680 | |||
| 2060 | Ga0496108_0234197 | |||
| 2061 | Ga0496110_0771200 | |||
| 2062 | Ga0496110_1212206 | |||
| 2063 | Ga0496112_1671172 | |||
| 2064 | Ga0496113_0770356 | |||
| 2065 | Ga0501308_039345 | |||
| 2066 | Ga0501305_059274 | |||
| 2067 | Ga0501315_090741 | |||
| 2068 | Ga0501320_063466 | |||
| 2069 | Ga0501321_061889 | |||
| 2070 | Ga0501031_0722964 | |||
| 2071 | Ga0501033_0793391 | |||
| 2072 | Ga0501036_0267076 | |||
| 2073 | Ga0501037_1147553 | |||
| 2074 | Ga0501038_0290109 | |||
| 2075 | Ga0501039_0061997 | |||
| 2076 | Ga0501039_1334106 | |||
| 2077 | Ga0501040_0069743 | |||
| 2078 | Ga0501041_0230769 | |||
| 2079 | Ga0501041_0341556 | |||
| 2080 | Ga0501042_0137141 | |||
| 2081 | Ga0501042_0242403 | |||
| 2082 | Ga0501042_0532042 | |||
| 2083 | Ga0501042_0766320 | |||
| 2084 | Ga0501048_0475092 | |||
| 2085 | Ga0501068_0346770 | |||
| 2086 | Ga0501070_0538346 | |||
| 2087 | Ga0501071_0081988 | |||
| 2088 | Ga0501071_0570737 | |||
| 2089 | Ga0501072_1007177 | |||
| 2090 | Ga0501074_0525037 | |||
| 2091 | Ga0501075_0306111 | |||
| 2092 | Ga0501075_1089682 | |||
| 2093 | Ga0501076_0012265 | |||
| 2094 | Ga0501076_0351393 | |||
| 2095 | Ga0501076_1110819 | |||
| 2096 | Ga0501077_0810180 | |||
| 2097 | Ga0501077_0970953 | |||
| 2098 | Ga0501249_016417 | |||
| 2099 | Ga0501249_072039 | |||
| 2100 | Ga0501245_153355 | |||
| 2101 | Ga0501079_0031577 | |||
| 2102 | Ga0501081_1040730 | |||
| 2103 | Ga0501271_048692 | |||
| 2104 | Ga0501283_054330 | |||
| 2105 | Ga0501045_0076002 | |||
| 2106 | Ga0501045_0326437 | |||
| 2107 | nmdc:mga05p37_101605_c1 | |||
| 2108 | nmdc:mga05p37_1042632_c1 | |||
| 2109 | nmdc:mga05p37_11531_c1 | |||
| 2110 | nmdc:mga05p37_132541_c1 | |||
| 2111 | nmdc:mga05p37_152388_c1 | |||
| 2112 | nmdc:mga05p37_487067_c1 | |||
| 2113 | nmdc:mga05p37_624837_c1 | |||
| 2114 | nmdc:mga09592_1080630_c1 | |||
| 2115 | nmdc:mga09592_43233_c1 | |||
| 2116 | nmdc:mga09592_9695_c1 | |||
| 2117 | nmdc:mga09592_9961_c1 | |||
| 2118 | nmdc:mga0qj67_1010_c1 | |||
| 2119 | nmdc:mga0qj67_16091_c2 | |||
| 2120 | nmdc:mga0qj67_196631_c1 | |||
| 2121 | nmdc:mga0qj67_211719_c1 | |||
| 2122 | nmdc:mga0qj67_69057_c1 | |||
| 2123 | nmdc:mga0qj67_990996_c1 | |||
| 2124 | nmdc:mga06r32_52440_c1 | |||
| 2125 | nmdc:mga06r32_5760_c1 | |||
| 2126 | nmdc:mga06r32_8623_c1 | |||
| 2127 | nmdc:mga08y16_103044_c1 | |||
| 2128 | nmdc:mga08y16_12043_c1 | |||
| 2129 | nmdc:mga08y16_126031_c1 | |||
| 2130 | nmdc:mga08y16_14264_c1 | |||
| 2131 | nmdc:mga08y16_456996_c1 | |||
| 2132 | nmdc:mga08y16_48777_c1 | |||
| 2133 | nmdc:mga08y16_569920_c1 | |||
| 2134 | nmdc:mga0n895_10466_c2 | |||
| 2135 | nmdc:mga0n895_26617_c1 | |||
| 2136 | nmdc:mga0n895_340283_c1 | |||
| 2137 | nmdc:mga0n895_673657_c1 | |||
| 2138 | nmdc:mga0rr50_1040000_c1 | |||
| 2139 | nmdc:mga0rr50_3269_c1 | |||
| 2140 | nmdc:mga0rr50_379608_c1 | |||
| 2141 | nmdc:mga0rr50_51384_c1 | |||
| 2142 | nmdc:mga08x19_1057907_c1 | |||
| 2143 | nmdc:mga0a205_1562_c1 | |||
| 2144 | nmdc:mga0a205_176753_c1 | |||
| 2145 | nmdc:mga0a205_283890_c1 | |||
| 2146 | nmdc:mga0a205_447_c1 | |||
| 2147 | nmdc:mga0a205_5420_c1 | |||
| 2148 | Ga0495601_0033313 | |||
| 2149 | Ga0495612_0180982 | |||
| 2150 | Ga0495595_0076412 | |||
| 2151 | Ga0495619_0002779 | |||
| 2152 | Ga0495619_0161349 | |||
| 2153 | Ga0501084_0097083 | |||
| 2154 | Ga0501084_1326807 | |||
| 2155 | Ga0501084_1359834 | |||
| 2156 | Ga0587084_102479 | |||
| 2157 | Ga0587073_0085149 | |||
| 2158 | Ga0587073_0117497 | |||
| 2159 | Ga0587083_0086995 | |||
| 2160 | Ga0587092_130068 | |||
| 2161 | Ga0587115_104972 | |||
| 2162 | Ga0587117_061676 | |||
| 2163 | Ga0587079_127218 | |||
| 2164 | Ga0587079_183514 | |||
| 2165 | Ga0501082_0236930 | |||
| 2166 | Ga0501082_0595509 | |||
| 2167 | Ga0530510_0068212 | |||
| 2168 | Ga0530510_0150363 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6uzt-assembly1.cif.gz_A | crystal structure of rptp alpha | 0.8643 | 43 | 73 |
| 6kr4-assembly4.cif.gz_D | crystal structure of the liprin-alpha3_sam123/lar_d1d2 complex | 0.8397 | 43 | 77 |
| 6kr4-assembly3.cif.gz_C | crystal structure of the liprin-alpha3_sam123/lar_d1d2 complex | 0.8244 | 43 | 77 |
| 7f5o-assembly2.cif.gz_B | crystal structure of ptpn2 catalytic domain | 0.8225 | 43 | 76 |
| 2pa5-assembly2.cif.gz_B | crystal structure of human protein tyrosine phosphatase ptpn9 | 0.8215 | 39 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A143ZXZ0_952_1068_2.30.29.30 | Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) | 0.8811 | 42 | 71 | 2.30.29.30 |
| af_Q64512_2131_2444_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8455 | 43 | 76 | 3.90.190.10 |
| 2awoD03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8361 | 38 | 97 | 2.40.50.140 |
| af_O44180_216_527_3.90.190.10 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8293 | 43 | 77 | 3.90.190.10 |
| 4ge6A00 | Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily | 0.8197 | 39 | 77 | 3.90.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4Q999-F1-model_v4 | DUF5666 domain-containing protein | 0.9744 | 31 | 124 |
|
| AF-A0A2T5GGJ4-F1-model_v4 | Uncharacterized protein | 0.9705 | 35 | 126 |
|
| AF-A0A1M3P5H5-F1-model_v4 | DUF5666 domain-containing protein | 0.9659 | 39 | 126 |
|
| AF-A0A521RFX0-F1-model_v4 | Uncharacterized protein | 0.9643 | 31 | 131 |
|
| AF-A0A2V8DL04-F1-model_v4 | DUF5666 domain-containing protein | 0.9642 | 37 | 134 |
|