F489728
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1083 | 432 | 2166 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300041456|Ga0451795_0117465|Ga0451795_0117465_60_455 |
| Length | 131 |
| Sequence | MWWRSLPYCCRGGLQSRKSDLWEPKVKLREIAHSRTGDKGNISNISVIAYDAKHYPLLLEQVTAARVKSHFAGVVQGEVVRYELPNLSALNFVMDQALGGGVTRSLALDAHGKSLSSALLDLDIVPALDGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 80 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 81 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 82 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 84 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 194 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 195 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 196 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 202 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 210 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 211 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 212 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 213 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 214 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 215 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 218 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 222 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 223 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 224 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 226 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 227 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 229 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 230 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 232 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 240 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 241 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 242 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 243 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 244 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 245 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 246 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 251 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 252 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 253 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 254 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 255 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 256 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 257 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 258 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 259 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 260 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 261 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 262 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 263 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 264 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 348 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 349 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 350 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 351 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 354 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 355 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 360 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 361 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 362 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 363 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 364 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 365 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 366 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 376 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 380 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 381 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 382 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 384 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 385 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 386 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 392 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 395 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 396 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 397 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 398 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 399 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 400 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 401 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 402 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 403 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 404 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 406 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 407 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 408 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 409 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 410 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 411 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 412 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 413 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 414 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 415 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 416 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 417 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 418 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 419 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 421 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 422 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 423 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 424 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 425 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 426 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 427 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 428 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 429 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 430 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 431 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 432 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.26 |
| Metatranscriptomes | 0.74 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.39 |
| Nodule | 0 |
| Rhizoplane | 7.66 |
| Rhizosphere | 79.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0451795_0117465 | 3300041456 | Bacteria | 755 |
| 2 | LJQas_1007039 | 3300000549 | Bacteria | 1389 |
| 3 | JGI24741J21665_1057105 | 3300001915 | Bacteria | 575 |
| 4 | JGI25406J46586_10001570 | 3300003203 | Bacteria | 10780 |
| 5 | rootL2_10241999 | 3300003322 | Bacteria | 1835 |
| 6 | JGI25404J52841_10073789 | 3300003659 | Bacteria | 713 |
| 7 | Ga0070658_10013317 | 3300005327 | Bacteria | 6600 |
| 8 | Ga0070658_10389682 | 3300005327 | Bacteria | 1196 |
| 9 | Ga0070658_10826685 | 3300005327 | Bacteria | 805 |
| 10 | Ga0070676_10308885 | 3300005328 | Bacteria | 1074 |
| 11 | Ga0070683_100006884 | 3300005329 | Bacteria | 9552 |
| 12 | Ga0070683_100013050 | 3300005329 | Bacteria | 7235 |
| 13 | Ga0070683_100021998 | 3300005329 | Bacteria | 5693 |
| 14 | Ga0070683_100349331 | 3300005329 | Bacteria | 1408 |
| 15 | Ga0070683_100732010 | 3300005329 | Bacteria | 947 |
| 16 | Ga0070690_100014248 | 3300005330 | Bacteria | 4715 |
| 17 | Ga0070670_100353204 | 3300005331 | Bacteria | 1292 |
| 18 | Ga0068869_101957109 | 3300005334 | Bacteria | 526 |
| 19 | Ga0070666_11285021 | 3300005335 | Bacteria | 546 |
| 20 | Ga0070680_100012621 | 3300005336 | Bacteria | 6567 |
| 21 | Ga0070680_100111581 | 3300005336 | Bacteria | 2276 |
| 22 | Ga0070682_100355415 | 3300005337 | Bacteria | 1094 |
| 23 | Ga0068868_100059075 | 3300005338 | Bacteria | 3032 |
| 24 | Ga0070660_100003001 | 3300005339 | Bacteria | 11625 |
| 25 | Ga0070660_100577742 | 3300005339 | Bacteria | 939 |
| 26 | Ga0070660_100583116 | 3300005339 | Bacteria | 934 |
| 27 | Ga0070689_100645008 | 3300005340 | Bacteria | 921 |
| 28 | Ga0070691_10463483 | 3300005341 | Bacteria | 726 |
| 29 | Ga0070661_100052574 | 3300005344 | Bacteria | 2981 |
| 30 | Ga0070661_100192762 | 3300005344 | Bacteria | 1555 |
| 31 | Ga0070661_100283892 | 3300005344 | Bacteria | 1285 |
| 32 | Ga0070661_100304134 | 3300005344 | Bacteria | 1242 |
| 33 | Ga0070661_100795775 | 3300005344 | Bacteria | 776 |
| 34 | Ga0070692_10389002 | 3300005345 | Bacteria | 877 |
| 35 | Ga0070668_100488291 | 3300005347 | Bacteria | 1064 |
| 36 | Ga0070668_100514746 | 3300005347 | Bacteria | 1037 |
| 37 | Ga0070668_101488451 | 3300005347 | Bacteria | 619 |
| 38 | Ga0070675_100079712 | 3300005354 | Bacteria | 2729 |
| 39 | Ga0070675_100875563 | 3300005354 | Bacteria | 823 |
| 40 | Ga0070671_100210121 | 3300005355 | Bacteria | 1651 |
| 41 | Ga0070673_100587184 | 3300005364 | Bacteria | 1015 |
| 42 | Ga0070673_102114395 | 3300005364 | Bacteria | 535 |
| 43 | Ga0070688_100386582 | 3300005365 | Bacteria | 1033 |
| 44 | Ga0070659_100053855 | 3300005366 | Bacteria | 3168 |
| 45 | Ga0070659_100351818 | 3300005366 | Bacteria | 1236 |
| 46 | Ga0070659_100391450 | 3300005366 | Bacteria | 1172 |
| 47 | Ga0070667_101376804 | 3300005367 | Bacteria | 662 |
| 48 | Ga0070709_10059529 | 3300005434 | Bacteria | 2425 |
| 49 | Ga0070709_10184406 | 3300005434 | Bacteria | 1468 |
| 50 | Ga0070709_10193050 | 3300005434 | Bacteria | 1438 |
| 51 | Ga0070709_10277958 | 3300005434 | Bacteria | 1216 |
| 52 | Ga0070709_10650576 | 3300005434 | Bacteria | 816 |
| 53 | Ga0070714_100049987 | 3300005435 | Bacteria | 3560 |
| 54 | Ga0070714_100776514 | 3300005435 | Bacteria | 927 |
| 55 | Ga0070714_100934592 | 3300005435 | Bacteria | 842 |
| 56 | Ga0070714_102337496 | 3300005435 | Bacteria | 520 |
| 57 | Ga0070713_100013461 | 3300005436 | Bacteria | 6042 |
| 58 | Ga0070713_100037147 | 3300005436 | Bacteria | 3937 |
| 59 | Ga0070713_100317122 | 3300005436 | Bacteria | 1439 |
| 60 | Ga0070713_100788139 | 3300005436 | Bacteria | 911 |
| 61 | Ga0070710_10029445 | 3300005437 | Bacteria | 2947 |
| 62 | Ga0070710_10235534 | 3300005437 | Bacteria | 1171 |
| 63 | Ga0070711_100004780 | 3300005439 | Bacteria | 8026 |
| 64 | Ga0070711_100019277 | 3300005439 | Bacteria | 4375 |
| 65 | Ga0070711_100180914 | 3300005439 | Bacteria | 1614 |
| 66 | Ga0070711_100549747 | 3300005439 | Bacteria | 958 |
| 67 | Ga0070711_101370859 | 3300005439 | Bacteria | 615 |
| 68 | Ga0070711_101485296 | 3300005439 | Bacteria | 591 |
| 69 | Ga0070711_102031907 | 3300005439 | Bacteria | 506 |
| 70 | Ga0070700_100344406 | 3300005441 | Bacteria | 1103 |
| 71 | Ga0070694_101338872 | 3300005444 | Bacteria | 603 |
| 72 | Ga0070694_101519134 | 3300005444 | Bacteria | 567 |
| 73 | Ga0070663_100011972 | 3300005455 | Bacteria | 5471 |
| 74 | Ga0070663_100039599 | 3300005455 | Bacteria | 3294 |
| 75 | Ga0070663_100040778 | 3300005455 | Bacteria | 3252 |
| 76 | Ga0070663_100066779 | 3300005455 | Bacteria | 2607 |
| 77 | Ga0070663_100095880 | 3300005455 | Bacteria | 2206 |
| 78 | Ga0070663_100269724 | 3300005455 | Bacteria | 1352 |
| 79 | Ga0070663_100964733 | 3300005455 | Bacteria | 740 |
| 80 | Ga0070678_100040699 | 3300005456 | Bacteria | 3289 |
| 81 | Ga0070678_100535509 | 3300005456 | Bacteria | 1038 |
| 82 | Ga0070678_100606293 | 3300005456 | Bacteria | 978 |
| 83 | Ga0070662_100110702 | 3300005457 | Bacteria | 2092 |
| 84 | Ga0070662_100519159 | 3300005457 | Bacteria | 995 |
| 85 | Ga0070662_100739241 | 3300005457 | Bacteria | 834 |
| 86 | Ga0070662_101201486 | 3300005457 | Bacteria | 652 |
| 87 | Ga0070681_10162608 | 3300005458 | Bacteria | 2156 |
| 88 | Ga0070681_10283388 | 3300005458 | Bacteria | 1568 |
| 89 | Ga0070681_11791715 | 3300005458 | Bacteria | 541 |
| 90 | Ga0070681_11898178 | 3300005458 | Bacteria | 523 |
| 91 | Ga0070699_101423785 | 3300005518 | Bacteria | 636 |
| 92 | Ga0070679_100114331 | 3300005530 | Bacteria | 2684 |
| 93 | Ga0070679_100295738 | 3300005530 | Bacteria | 1570 |
| 94 | Ga0070679_100341310 | 3300005530 | Bacteria | 1446 |
| 95 | Ga0070679_101125354 | 3300005530 | Bacteria | 730 |
| 96 | Ga0070684_100005044 | 3300005535 | Bacteria | 10086 |
| 97 | Ga0070684_100009975 | 3300005535 | Bacteria | 7508 |
| 98 | Ga0070684_100045272 | 3300005535 | Bacteria | 3810 |
| 99 | Ga0070684_100068678 | 3300005535 | Bacteria | 3115 |
| 100 | Ga0070684_100302077 | 3300005535 | Bacteria | 1469 |
| 101 | Ga0070684_100443923 | 3300005535 | Bacteria | 1199 |
| 102 | Ga0070684_101030200 | 3300005535 | Bacteria | 773 |
| 103 | Ga0070684_101161614 | 3300005535 | Bacteria | 726 |
| 104 | Ga0070684_101231612 | 3300005535 | Bacteria | 704 |
| 105 | Ga0070697_101208693 | 3300005536 | Bacteria | 674 |
| 106 | Ga0068853_100004408 | 3300005539 | Bacteria | 10900 |
| 107 | Ga0068853_100086640 | 3300005539 | Bacteria | 2747 |
| 108 | Ga0068853_100361598 | 3300005539 | Bacteria | 1352 |
| 109 | Ga0068853_100580555 | 3300005539 | Bacteria | 1064 |
| 110 | Ga0068853_100580559 | 3300005539 | Bacteria | 1064 |
| 111 | Ga0068853_100601920 | 3300005539 | Bacteria | 1044 |
| 112 | Ga0068853_100854725 | 3300005539 | Bacteria | 873 |
| 113 | Ga0068853_101012872 | 3300005539 | Bacteria | 800 |
| 114 | Ga0070672_100249449 | 3300005543 | Bacteria | 1495 |
| 115 | Ga0070672_100995651 | 3300005543 | Bacteria | 743 |
| 116 | Ga0070686_100291808 | 3300005544 | Bacteria | 1207 |
| 117 | Ga0070695_100115075 | 3300005545 | Bacteria | 1832 |
| 118 | Ga0070696_100217754 | 3300005546 | Bacteria | 1431 |
| 119 | Ga0070693_100157191 | 3300005547 | Bacteria | 1445 |
| 120 | Ga0070693_100312179 | 3300005547 | Bacteria | 1064 |
| 121 | Ga0070693_100693293 | 3300005547 | Bacteria | 745 |
| 122 | Ga0070665_100018614 | 3300005548 | Bacteria | 6961 |
| 123 | Ga0070665_100131058 | 3300005548 | Bacteria | 2509 |
| 124 | Ga0070665_100504238 | 3300005548 | Bacteria | 1221 |
| 125 | Ga0070665_100776803 | 3300005548 | Bacteria | 971 |
| 126 | Ga0070704_101075533 | 3300005549 | Bacteria | 730 |
| 127 | Ga0070704_101098455 | 3300005549 | Bacteria | 722 |
| 128 | Ga0068855_100050152 | 3300005563 | Bacteria | 4920 |
| 129 | Ga0068855_100171291 | 3300005563 | Bacteria | 2459 |
| 130 | Ga0068855_100307111 | 3300005563 | Bacteria | 1756 |
| 131 | Ga0068855_100359014 | 3300005563 | Bacteria | 1604 |
| 132 | Ga0068855_100887410 | 3300005563 | Bacteria | 943 |
| 133 | Ga0068855_101107198 | 3300005563 | Bacteria | 828 |
| 134 | Ga0068855_101360645 | 3300005563 | Bacteria | 733 |
| 135 | Ga0070664_100027907 | 3300005564 | Bacteria | 4694 |
| 136 | Ga0070664_100053668 | 3300005564 | Bacteria | 3417 |
| 137 | Ga0070664_100488130 | 3300005564 | Bacteria | 1134 |
| 138 | Ga0070664_101125819 | 3300005564 | Bacteria | 740 |
| 139 | Ga0070664_101690591 | 3300005564 | Bacteria | 600 |
| 140 | Ga0068857_100013385 | 3300005577 | Bacteria | 7144 |
| 141 | Ga0068857_100058466 | 3300005577 | Bacteria | 3423 |
| 142 | Ga0068857_100207786 | 3300005577 | Bacteria | 1786 |
| 143 | Ga0068857_100390798 | 3300005577 | Bacteria | 1293 |
| 144 | Ga0068854_100048949 | 3300005578 | Bacteria | 3018 |
| 145 | Ga0068854_100242493 | 3300005578 | Bacteria | 1436 |
| 146 | Ga0068854_100444340 | 3300005578 | Bacteria | 1082 |
| 147 | Ga0068854_100885052 | 3300005578 | Bacteria | 784 |
| 148 | Ga0068856_100001827 | 3300005614 | Bacteria | 22255 |
| 149 | Ga0068856_102718613 | 3300005614 | Bacteria | 500 |
| 150 | Ga0070702_100156002 | 3300005615 | Bacteria | 1470 |
| 151 | Ga0070702_100871138 | 3300005615 | Bacteria | 702 |
| 152 | Ga0068852_100004020 | 3300005616 | Bacteria | 10341 |
| 153 | Ga0068852_100108729 | 3300005616 | Bacteria | 2517 |
| 154 | Ga0068852_100166147 | 3300005616 | Bacteria | 2065 |
| 155 | Ga0068852_100289432 | 3300005616 | Bacteria | 1582 |
| 156 | Ga0068852_100591767 | 3300005616 | Bacteria | 1113 |
| 157 | Ga0068852_100696180 | 3300005616 | Bacteria | 1026 |
| 158 | Ga0068859_101145460 | 3300005617 | Bacteria | 856 |
| 159 | Ga0068864_100041284 | 3300005618 | Bacteria | 3946 |
| 160 | Ga0068864_100297936 | 3300005618 | Bacteria | 1509 |
| 161 | Ga0068864_100592035 | 3300005618 | Bacteria | 1075 |
| 162 | Ga0068864_100888355 | 3300005618 | Bacteria | 879 |
| 163 | Ga0068861_101105632 | 3300005719 | Bacteria | 762 |
| 164 | Ga0068851_10017775 | 3300005834 | Bacteria | 3421 |
| 165 | Ga0068851_10312626 | 3300005834 | Bacteria | 906 |
| 166 | Ga0068851_10414376 | 3300005834 | Bacteria | 795 |
| 167 | Ga0068870_10995021 | 3300005840 | Bacteria | 598 |
| 168 | Ga0068870_11207383 | 3300005840 | Bacteria | 548 |
| 169 | Ga0068863_100277064 | 3300005841 | Bacteria | 1624 |
| 170 | Ga0068863_102298561 | 3300005841 | Bacteria | 549 |
| 171 | Ga0068858_100057389 | 3300005842 | Bacteria | 3598 |
| 172 | Ga0068858_100326322 | 3300005842 | Bacteria | 1468 |
| 173 | Ga0068858_100397487 | 3300005842 | Bacteria | 1324 |
| 174 | Ga0068858_101048822 | 3300005842 | Bacteria | 800 |
| 175 | Ga0068860_100042819 | 3300005843 | Bacteria | 4321 |
| 176 | Ga0068862_100122818 | 3300005844 | Bacteria | 2290 |
| 177 | Ga0068862_100425031 | 3300005844 | Bacteria | 1248 |
| 178 | Ga0081455_10084362 | 3300005937 | Bacteria | 2593 |
| 179 | Ga0081455_10132931 | 3300005937 | Bacteria | 1943 |
| 180 | Ga0081455_10415908 | 3300005937 | Bacteria | 929 |
| 181 | Ga0081540_1003965 | 3300005983 | Bacteria | 11501 |
| 182 | Ga0081540_1011917 | 3300005983 | Bacteria | 5769 |
| 183 | Ga0081540_1074698 | 3300005983 | Bacteria | 1552 |
| 184 | Ga0081539_10000768 | 3300005985 | Bacteria | 63055 |
| 185 | Ga0070717_10005371 | 3300006028 | Bacteria | 9344 |
| 186 | Ga0070717_10069469 | 3300006028 | Bacteria | 2934 |
| 187 | Ga0070717_10154553 | 3300006028 | Bacteria | 1987 |
| 188 | Ga0070717_10561571 | 3300006028 | Bacteria | 1034 |
| 189 | Ga0070717_10815878 | 3300006028 | Bacteria | 849 |
| 190 | Ga0075365_10113065 | 3300006038 | Bacteria | 1867 |
| 191 | Ga0075365_10350492 | 3300006038 | Bacteria | 1041 |
| 192 | Ga0075365_10562563 | 3300006038 | Bacteria | 806 |
| 193 | Ga0075368_10035368 | 3300006042 | Bacteria | 1948 |
| 194 | Ga0075368_10042937 | 3300006042 | Bacteria | 1780 |
| 195 | Ga0075363_100006965 | 3300006048 | Bacteria | 5170 |
| 196 | Ga0075364_10380618 | 3300006051 | Bacteria | 963 |
| 197 | Ga0070715_10455847 | 3300006163 | Bacteria | 723 |
| 198 | Ga0070715_10536610 | 3300006163 | Bacteria | 676 |
| 199 | Ga0070716_100233210 | 3300006173 | Bacteria | 1244 |
| 200 | Ga0070712_100015666 | 3300006175 | Bacteria | 4887 |
| 201 | Ga0070712_100044059 | 3300006175 | Bacteria | 3075 |
| 202 | Ga0075362_10163874 | 3300006177 | Bacteria | 1071 |
| 203 | Ga0075362_10524691 | 3300006177 | Bacteria | 607 |
| 204 | Ga0075362_10616432 | 3300006177 | Bacteria | 562 |
| 205 | Ga0075367_10189439 | 3300006178 | Bacteria | 1283 |
| 206 | Ga0075367_10277080 | 3300006178 | Bacteria | 1054 |
| 207 | Ga0075366_10733558 | 3300006195 | Bacteria | 614 |
| 208 | Ga0097621_100145191 | 3300006237 | Bacteria | 2031 |
| 209 | Ga0097621_101154246 | 3300006237 | Bacteria | 729 |
| 210 | Ga0068871_100678306 | 3300006358 | Bacteria | 943 |
| 211 | Ga0068871_101397924 | 3300006358 | Bacteria | 660 |
| 212 | Ga0075428_100217647 | 3300006844 | Bacteria | 2063 |
| 213 | Ga0068865_100040328 | 3300006881 | Bacteria | 3172 |
| 214 | Ga0068865_100874852 | 3300006881 | Bacteria | 780 |
| 215 | Ga0097620_101145447 | 3300006931 | Bacteria | 856 |
| 216 | Ga0075435_100614950 | 3300007076 | Bacteria | 942 |
| 217 | Ga0099794_10018637 | 3300007265 | Bacteria | 3115 |
| 218 | Ga0099794_10019320 | 3300007265 | Bacteria | 3067 |
| 219 | Ga0099795_10040570 | 3300007788 | Bacteria | 1654 |
| 220 | Ga0099795_10141039 | 3300007788 | Bacteria | 980 |
| 221 | Ga0099795_10361362 | 3300007788 | Bacteria | 652 |
| 222 | Ga0099795_10628902 | 3300007788 | Bacteria | 512 |
| 223 | Ga0105250_10186821 | 3300009092 | Bacteria | 871 |
| 224 | Ga0105250_10411882 | 3300009092 | Bacteria | 601 |
| 225 | Ga0105240_10026622 | 3300009093 | Bacteria | 7589 |
| 226 | Ga0105240_10086468 | 3300009093 | Bacteria | 3840 |
| 227 | Ga0105240_10537480 | 3300009093 | Bacteria | 1295 |
| 228 | Ga0105240_10925157 | 3300009093 | Bacteria | 937 |
| 229 | Ga0111539_10186854 | 3300009094 | Bacteria | 2420 |
| 230 | Ga0111539_11026242 | 3300009094 | Bacteria | 959 |
| 231 | Ga0111539_11874921 | 3300009094 | Bacteria | 695 |
| 232 | Ga0105245_10116668 | 3300009098 | Bacteria | 2489 |
| 233 | Ga0105245_11752594 | 3300009098 | Bacteria | 674 |
| 234 | Ga0105245_12060721 | 3300009098 | Bacteria | 624 |
| 235 | Ga0105247_10008197 | 3300009101 | Bacteria | 6379 |
| 236 | Ga0105247_10150019 | 3300009101 | Bacteria | 1535 |
| 237 | Ga0105247_10391425 | 3300009101 | Bacteria | 988 |
| 238 | Ga0105247_10403496 | 3300009101 | Bacteria | 975 |
| 239 | Ga0105247_10945342 | 3300009101 | Bacteria | 669 |
| 240 | Ga0105243_10704136 | 3300009148 | Bacteria | 985 |
| 241 | Ga0105243_11324995 | 3300009148 | Bacteria | 738 |
| 242 | Ga0105241_10030969 | 3300009174 | Bacteria | 4001 |
| 243 | Ga0105241_10212572 | 3300009174 | Bacteria | 1621 |
| 244 | Ga0105241_10474026 | 3300009174 | Bacteria | 1111 |
| 245 | Ga0105241_11379898 | 3300009174 | Bacteria | 674 |
| 246 | Ga0105241_11577923 | 3300009174 | Bacteria | 634 |
| 247 | Ga0105242_11133330 | 3300009176 | Bacteria | 798 |
| 248 | Ga0105242_11523098 | 3300009176 | Bacteria | 700 |
| 249 | Ga0105248_10500250 | 3300009177 | Bacteria | 1370 |
| 250 | Ga0105248_10807178 | 3300009177 | Bacteria | 1059 |
| 251 | Ga0105248_10807534 | 3300009177 | Bacteria | 1059 |
| 252 | Ga0105248_11691992 | 3300009177 | Bacteria | 717 |
| 253 | Ga0105248_12896797 | 3300009177 | Bacteria | 547 |
| 254 | Ga0105237_10012336 | 3300009545 | Bacteria | 9004 |
| 255 | Ga0105237_10024997 | 3300009545 | Bacteria | 6110 |
| 256 | Ga0105237_10092495 | 3300009545 | Bacteria | 3014 |
| 257 | Ga0105237_10131109 | 3300009545 | Bacteria | 2501 |
| 258 | Ga0105237_10144523 | 3300009545 | Bacteria | 2373 |
| 259 | Ga0105237_10200817 | 3300009545 | Bacteria | 1994 |
| 260 | Ga0105237_10993859 | 3300009545 | Bacteria | 846 |
| 261 | Ga0105237_11120665 | 3300009545 | Bacteria | 794 |
| 262 | Ga0105237_11614514 | 3300009545 | Bacteria | 655 |
| 263 | Ga0105238_10015861 | 3300009551 | Bacteria | 7625 |
| 264 | Ga0105238_10083037 | 3300009551 | Bacteria | 3193 |
| 265 | Ga0105238_10127951 | 3300009551 | Bacteria | 2518 |
| 266 | Ga0105238_10370193 | 3300009551 | Bacteria | 1423 |
| 267 | Ga0105238_10395243 | 3300009551 | Bacteria | 1375 |
| 268 | Ga0105238_10466447 | 3300009551 | Bacteria | 1261 |
| 269 | Ga0105238_11288960 | 3300009551 | Bacteria | 756 |
| 270 | Ga0105249_10957201 | 3300009553 | Bacteria | 924 |
| 271 | Ga0105249_11582850 | 3300009553 | Bacteria | 728 |
| 272 | Ga0099796_10026459 | 3300010159 | Bacteria | 1843 |
| 273 | Ga0099796_10043461 | 3300010159 | Bacteria | 1530 |
| 274 | Ga0099796_10070564 | 3300010159 | Bacteria | 1260 |
| 275 | Ga0099796_10084914 | 3300010159 | Bacteria | 1167 |
| 276 | Ga0099796_10459921 | 3300010159 | Bacteria | 567 |
| 277 | Ga0105239_10017391 | 3300010375 | Bacteria | 7952 |
| 278 | Ga0105239_10245943 | 3300010375 | Bacteria | 2008 |
| 279 | Ga0105239_10612226 | 3300010375 | Bacteria | 1243 |
| 280 | Ga0105239_10817327 | 3300010375 | Bacteria | 1068 |
| 281 | Ga0105239_10880928 | 3300010375 | Bacteria | 1027 |
| 282 | Ga0105239_11181005 | 3300010375 | Bacteria | 882 |
| 283 | Ga0105239_11450910 | 3300010375 | Bacteria | 792 |
| 284 | Ga0105239_11838203 | 3300010375 | Bacteria | 702 |
| 285 | Ga0105239_12166407 | 3300010375 | Bacteria | 646 |
| 286 | Ga0105239_12984047 | 3300010375 | Bacteria | 552 |
| 287 | Ga0105246_10031772 | 3300011119 | Bacteria | 3496 |
| 288 | Ga0105246_10863549 | 3300011119 | Bacteria | 808 |
| 289 | Ga0157373_10187825 | 3300013100 | Bacteria | 1456 |
| 290 | Ga0157373_10948929 | 3300013100 | Bacteria | 640 |
| 291 | Ga0157370_10027113 | 3300013104 | Bacteria | 5649 |
| 292 | Ga0157370_10519389 | 3300013104 | Bacteria | 1093 |
| 293 | Ga0157369_10012270 | 3300013105 | Bacteria | 9731 |
| 294 | Ga0157369_10015050 | 3300013105 | Bacteria | 8730 |
| 295 | Ga0157369_10021463 | 3300013105 | Bacteria | 7224 |
| 296 | Ga0157369_10112059 | 3300013105 | Bacteria | 2899 |
| 297 | Ga0157369_10720460 | 3300013105 | Bacteria | 1027 |
| 298 | Ga0157374_10147112 | 3300013296 | Bacteria | 2289 |
| 299 | Ga0157374_10183023 | 3300013296 | Bacteria | 2048 |
| 300 | Ga0157374_10886989 | 3300013296 | Bacteria | 909 |
| 301 | Ga0157374_11457659 | 3300013296 | Bacteria | 708 |
| 302 | Ga0157374_11854686 | 3300013296 | Bacteria | 628 |
| 303 | Ga0157378_10199759 | 3300013297 | Bacteria | 1891 |
| 304 | Ga0157378_10602544 | 3300013297 | Bacteria | 1110 |
| 305 | Ga0163162_10171087 | 3300013306 | Bacteria | 2297 |
| 306 | Ga0163162_10230559 | 3300013306 | Bacteria | 1982 |
| 307 | Ga0163162_10576398 | 3300013306 | Bacteria | 1252 |
| 308 | Ga0163162_10745514 | 3300013306 | Bacteria | 1099 |
| 309 | Ga0163162_10861808 | 3300013306 | Bacteria | 1021 |
| 310 | Ga0163162_11536763 | 3300013306 | Bacteria | 759 |
| 311 | Ga0157372_10031114 | 3300013307 | Bacteria | 5843 |
| 312 | Ga0157372_10095637 | 3300013307 | Bacteria | 3385 |
| 313 | Ga0157372_11751498 | 3300013307 | Bacteria | 715 |
| 314 | Ga0157372_12979891 | 3300013307 | Bacteria | 541 |
| 315 | Ga0157375_10045421 | 3300013308 | Bacteria | 4275 |
| 316 | Ga0157375_10916659 | 3300013308 | Bacteria | 1020 |
| 317 | Ga0163163_10027218 | 3300014325 | Bacteria | 5475 |
| 318 | Ga0163163_10265592 | 3300014325 | Bacteria | 1767 |
| 319 | Ga0157380_10481792 | 3300014326 | Bacteria | 1200 |
| 320 | Ga0157377_10272694 | 3300014745 | Bacteria | 1105 |
| 321 | Ga0157379_10201824 | 3300014968 | Bacteria | 1798 |
| 322 | Ga0157379_11135447 | 3300014968 | Bacteria | 749 |
| 323 | Ga0157376_10040939 | 3300014969 | Bacteria | 3790 |
| 324 | Ga0157376_11372840 | 3300014969 | Bacteria | 738 |
| 325 | Ga0157376_12506392 | 3300014969 | Bacteria | 555 |
| 326 | Ga0182007_10261175 | 3300015262 | Bacteria | 624 |
| 327 | Ga0163161_11033667 | 3300017792 | Bacteria | 703 |
| 328 | Ga0197907_10712594 | 3300020069 | Bacteria | 1243 |
| 329 | Ga0206356_11290348 | 3300020070 | Bacteria | 1263 |
| 330 | Ga0206350_11263414 | 3300020080 | Bacteria | 848 |
| 331 | Ga0206354_10653258 | 3300020081 | Bacteria | 1070 |
| 332 | Ga0206353_10545694 | 3300020082 | Bacteria | 608 |
| 333 | Ga0213874_10038814 | 3300021377 | Bacteria | 1415 |
| 334 | Ga0213874_10270554 | 3300021377 | Bacteria | 632 |
| 335 | Ga0213876_10029487 | 3300021384 | Bacteria | 2891 |
| 336 | Ga0224712_10016094 | 3300022467 | Bacteria | 2448 |
| 337 | Ga0209758_1002115 | 3300025297 | Bacteria | 21002 |
| 338 | Ga0209758_1019290 | 3300025297 | Bacteria | 3294 |
| 339 | Ga0209758_1115351 | 3300025297 | Bacteria | 735 |
| 340 | Ga0207697_10034140 | 3300025315 | Bacteria | 2083 |
| 341 | Ga0207656_10032000 | 3300025321 | Bacteria | 2182 |
| 342 | Ga0207656_10273268 | 3300025321 | Bacteria | 832 |
| 343 | Ga0207692_10011728 | 3300025898 | Bacteria | 3742 |
| 344 | Ga0207692_10012280 | 3300025898 | Bacteria | 3674 |
| 345 | Ga0207692_10429904 | 3300025898 | Bacteria | 828 |
| 346 | Ga0207692_11070041 | 3300025898 | Bacteria | 534 |
| 347 | Ga0207642_10568559 | 3300025899 | Bacteria | 702 |
| 348 | Ga0207710_10037351 | 3300025900 | Bacteria | 2145 |
| 349 | Ga0207710_10194816 | 3300025900 | Bacteria | 999 |
| 350 | Ga0207688_10115386 | 3300025901 | Bacteria | 1563 |
| 351 | Ga0207688_10951157 | 3300025901 | Bacteria | 543 |
| 352 | Ga0207680_10259313 | 3300025903 | Bacteria | 1203 |
| 353 | Ga0207680_10428471 | 3300025903 | Bacteria | 937 |
| 354 | Ga0207647_10102686 | 3300025904 | Bacteria | 1695 |
| 355 | Ga0207685_10139022 | 3300025905 | Bacteria | 1087 |
| 356 | Ga0207685_10173484 | 3300025905 | Bacteria | 994 |
| 357 | Ga0207699_10141546 | 3300025906 | Bacteria | 1581 |
| 358 | Ga0207645_10241383 | 3300025907 | Bacteria | 1194 |
| 359 | Ga0207645_10658039 | 3300025907 | Bacteria | 712 |
| 360 | Ga0207643_10273399 | 3300025908 | Bacteria | 1046 |
| 361 | Ga0207643_10283143 | 3300025908 | Bacteria | 1028 |
| 362 | Ga0207705_10035276 | 3300025909 | Bacteria | 3578 |
| 363 | Ga0207705_10045560 | 3300025909 | Bacteria | 3152 |
| 364 | Ga0207705_10532020 | 3300025909 | Bacteria | 913 |
| 365 | Ga0207705_11146464 | 3300025909 | Bacteria | 598 |
| 366 | Ga0207705_11223551 | 3300025909 | Bacteria | 575 |
| 367 | Ga0207684_10102347 | 3300025910 | Bacteria | 2449 |
| 368 | Ga0207654_10193490 | 3300025911 | Bacteria | 1335 |
| 369 | Ga0207654_11445791 | 3300025911 | Bacteria | 501 |
| 370 | Ga0207707_10002705 | 3300025912 | Bacteria | 15850 |
| 371 | Ga0207707_10042184 | 3300025912 | Bacteria | 3984 |
| 372 | Ga0207707_10100018 | 3300025912 | Bacteria | 2534 |
| 373 | Ga0207707_10531375 | 3300025912 | Bacteria | 1001 |
| 374 | Ga0207707_10843833 | 3300025912 | Bacteria | 761 |
| 375 | Ga0207695_10033862 | 3300025913 | Bacteria | 5564 |
| 376 | Ga0207695_10083368 | 3300025913 | Bacteria | 3229 |
| 377 | Ga0207695_10151312 | 3300025913 | Bacteria | 2259 |
| 378 | Ga0207671_10009638 | 3300025914 | Bacteria | 8050 |
| 379 | Ga0207671_10171502 | 3300025914 | Bacteria | 1685 |
| 380 | Ga0207671_10214178 | 3300025914 | Bacteria | 1508 |
| 381 | Ga0207671_10223013 | 3300025914 | Bacteria | 1477 |
| 382 | Ga0207671_10418239 | 3300025914 | Bacteria | 1066 |
| 383 | Ga0207671_10422485 | 3300025914 | Bacteria | 1060 |
| 384 | Ga0207671_10541477 | 3300025914 | Bacteria | 928 |
| 385 | Ga0207693_10006974 | 3300025915 | Bacteria | 9332 |
| 386 | Ga0207693_10015344 | 3300025915 | Bacteria | 6148 |
| 387 | Ga0207693_10053164 | 3300025915 | Bacteria | 3178 |
| 388 | Ga0207693_10089056 | 3300025915 | Bacteria | 2419 |
| 389 | Ga0207693_10516823 | 3300025915 | Bacteria | 932 |
| 390 | Ga0207693_11413654 | 3300025915 | Bacteria | 516 |
| 391 | Ga0207663_10010915 | 3300025916 | Bacteria | 4854 |
| 392 | Ga0207663_10234599 | 3300025916 | Bacteria | 1342 |
| 393 | Ga0207663_10471098 | 3300025916 | Bacteria | 971 |
| 394 | Ga0207660_10006961 | 3300025917 | Bacteria | 7324 |
| 395 | Ga0207660_10088845 | 3300025917 | Bacteria | 2286 |
| 396 | Ga0207660_10164737 | 3300025917 | Bacteria | 1713 |
| 397 | Ga0207660_10275300 | 3300025917 | Bacteria | 1334 |
| 398 | Ga0207660_10815243 | 3300025917 | Bacteria | 762 |
| 399 | Ga0207660_11376051 | 3300025917 | Bacteria | 572 |
| 400 | Ga0207657_10006890 | 3300025919 | Bacteria | 11724 |
| 401 | Ga0207657_10076308 | 3300025919 | Bacteria | 2827 |
| 402 | Ga0207657_10594835 | 3300025919 | Bacteria | 863 |
| 403 | Ga0207649_10057477 | 3300025920 | Bacteria | 2433 |
| 404 | Ga0207649_10076980 | 3300025920 | Bacteria | 2148 |
| 405 | Ga0207649_10324150 | 3300025920 | Bacteria | 1133 |
| 406 | Ga0207649_10504592 | 3300025920 | Bacteria | 920 |
| 407 | Ga0207652_10001690 | 3300025921 | Bacteria | 19300 |
| 408 | Ga0207652_10093203 | 3300025921 | Bacteria | 2650 |
| 409 | Ga0207652_10335996 | 3300025921 | Bacteria | 1364 |
| 410 | Ga0207652_10936261 | 3300025921 | Bacteria | 764 |
| 411 | Ga0207652_11174910 | 3300025921 | Bacteria | 669 |
| 412 | Ga0207652_11541564 | 3300025921 | Bacteria | 569 |
| 413 | Ga0207694_10005031 | 3300025924 | Bacteria | 10225 |
| 414 | Ga0207694_10145272 | 3300025924 | Bacteria | 1909 |
| 415 | Ga0207694_10192192 | 3300025924 | Bacteria | 1658 |
| 416 | Ga0207694_10364382 | 3300025924 | Bacteria | 1198 |
| 417 | Ga0207694_11629557 | 3300025924 | Bacteria | 544 |
| 418 | Ga0207659_10228888 | 3300025926 | Bacteria | 1498 |
| 419 | Ga0207687_10029083 | 3300025927 | Bacteria | 3715 |
| 420 | Ga0207687_11329433 | 3300025927 | Bacteria | 618 |
| 421 | Ga0207700_10028440 | 3300025928 | Bacteria | 3930 |
| 422 | Ga0207700_10054396 | 3300025928 | Bacteria | 3004 |
| 423 | Ga0207700_10109223 | 3300025928 | Bacteria | 2222 |
| 424 | Ga0207700_11959361 | 3300025928 | Bacteria | 512 |
| 425 | Ga0207664_10214537 | 3300025929 | Bacteria | 1667 |
| 426 | Ga0207664_10851240 | 3300025929 | Bacteria | 820 |
| 427 | Ga0207664_11368807 | 3300025929 | Bacteria | 628 |
| 428 | Ga0207664_11673240 | 3300025929 | Bacteria | 559 |
| 429 | Ga0207644_10506649 | 3300025931 | Bacteria | 996 |
| 430 | Ga0207644_10518186 | 3300025931 | Bacteria | 985 |
| 431 | Ga0207644_10600031 | 3300025931 | Bacteria | 914 |
| 432 | Ga0207644_11046256 | 3300025931 | Bacteria | 686 |
| 433 | Ga0207690_10260732 | 3300025932 | Bacteria | 1343 |
| 434 | Ga0207690_10744697 | 3300025932 | Bacteria | 807 |
| 435 | Ga0207690_10770258 | 3300025932 | Bacteria | 794 |
| 436 | Ga0207706_10076843 | 3300025933 | Bacteria | 2937 |
| 437 | Ga0207706_10586039 | 3300025933 | Bacteria | 959 |
| 438 | Ga0207706_11053629 | 3300025933 | Bacteria | 681 |
| 439 | Ga0207709_10581042 | 3300025935 | Bacteria | 885 |
| 440 | Ga0207670_10726134 | 3300025936 | Bacteria | 824 |
| 441 | Ga0207704_10475643 | 3300025938 | Bacteria | 1002 |
| 442 | Ga0207704_11383962 | 3300025938 | Bacteria | 603 |
| 443 | Ga0207665_10088683 | 3300025939 | Bacteria | 2141 |
| 444 | Ga0207665_10440126 | 3300025939 | Bacteria | 999 |
| 445 | Ga0207665_11447884 | 3300025939 | Bacteria | 546 |
| 446 | Ga0207691_10183269 | 3300025940 | Bacteria | 1829 |
| 447 | Ga0207711_10214403 | 3300025941 | Bacteria | 1759 |
| 448 | Ga0207711_10654839 | 3300025941 | Bacteria | 980 |
| 449 | Ga0207689_10030366 | 3300025942 | Bacteria | 4504 |
| 450 | Ga0207661_10001270 | 3300025944 | Bacteria | 16867 |
| 451 | Ga0207661_10008424 | 3300025944 | Bacteria | 7371 |
| 452 | Ga0207661_10011867 | 3300025944 | Bacteria | 6328 |
| 453 | Ga0207661_10073538 | 3300025944 | Bacteria | 2799 |
| 454 | Ga0207679_10376144 | 3300025945 | Bacteria | 1244 |
| 455 | Ga0207679_11052775 | 3300025945 | Bacteria | 746 |
| 456 | Ga0207667_10002017 | 3300025949 | Bacteria | 25487 |
| 457 | Ga0207667_10102212 | 3300025949 | Bacteria | 2957 |
| 458 | Ga0207667_10387555 | 3300025949 | Bacteria | 1423 |
| 459 | Ga0207667_10403121 | 3300025949 | Bacteria | 1392 |
| 460 | Ga0207667_10440183 | 3300025949 | Bacteria | 1325 |
| 461 | Ga0207667_10482275 | 3300025949 | Bacteria | 1259 |
| 462 | Ga0207667_11332969 | 3300025949 | Bacteria | 693 |
| 463 | Ga0207712_11227509 | 3300025961 | Bacteria | 669 |
| 464 | Ga0207668_10563465 | 3300025972 | Bacteria | 988 |
| 465 | Ga0207640_10039851 | 3300025981 | Bacteria | 2977 |
| 466 | Ga0207640_10794257 | 3300025981 | Bacteria | 819 |
| 467 | Ga0207640_10975755 | 3300025981 | Bacteria | 744 |
| 468 | Ga0207640_11030283 | 3300025981 | Bacteria | 725 |
| 469 | Ga0207677_10014286 | 3300026023 | Bacteria | 4632 |
| 470 | Ga0207677_11168970 | 3300026023 | Bacteria | 703 |
| 471 | Ga0207703_10197880 | 3300026035 | Bacteria | 1784 |
| 472 | Ga0207703_11155289 | 3300026035 | Bacteria | 744 |
| 473 | Ga0207703_11275229 | 3300026035 | Bacteria | 706 |
| 474 | Ga0207703_11695396 | 3300026035 | Bacteria | 608 |
| 475 | Ga0207703_11740849 | 3300026035 | Bacteria | 599 |
| 476 | Ga0207639_10014358 | 3300026041 | Bacteria | 5569 |
| 477 | Ga0207639_10328105 | 3300026041 | Bacteria | 1361 |
| 478 | Ga0207639_10390942 | 3300026041 | Bacteria | 1251 |
| 479 | Ga0207639_10519060 | 3300026041 | Bacteria | 1091 |
| 480 | Ga0207639_10578631 | 3300026041 | Bacteria | 1034 |
| 481 | Ga0207639_10747080 | 3300026041 | Bacteria | 909 |
| 482 | Ga0207678_10124779 | 3300026067 | Bacteria | 2197 |
| 483 | Ga0207678_10137792 | 3300026067 | Bacteria | 2082 |
| 484 | Ga0207678_10150582 | 3300026067 | Bacteria | 1986 |
| 485 | Ga0207678_10202505 | 3300026067 | Bacteria | 1697 |
| 486 | Ga0207678_10538758 | 3300026067 | Bacteria | 1020 |
| 487 | Ga0207678_10737853 | 3300026067 | Bacteria | 868 |
| 488 | Ga0207708_10442900 | 3300026075 | Bacteria | 1081 |
| 489 | Ga0207708_11236311 | 3300026075 | Bacteria | 653 |
| 490 | Ga0207702_10002952 | 3300026078 | Bacteria | 15870 |
| 491 | Ga0207702_10605469 | 3300026078 | Bacteria | 1075 |
| 492 | Ga0207641_10217974 | 3300026088 | Bacteria | 1768 |
| 493 | Ga0207648_10338010 | 3300026089 | Bacteria | 1356 |
| 494 | Ga0207676_10035357 | 3300026095 | Bacteria | 3791 |
| 495 | Ga0207676_10199636 | 3300026095 | Bacteria | 1766 |
| 496 | Ga0207676_10387048 | 3300026095 | Bacteria | 1303 |
| 497 | Ga0207676_10487769 | 3300026095 | Bacteria | 1168 |
| 498 | Ga0207674_10004033 | 3300026116 | Bacteria | 17818 |
| 499 | Ga0207674_10071396 | 3300026116 | Bacteria | 3488 |
| 500 | Ga0207674_10077740 | 3300026116 | Bacteria | 3324 |
| 501 | Ga0207674_10246534 | 3300026116 | Bacteria | 1733 |
| 502 | Ga0207674_10358894 | 3300026116 | Bacteria | 1409 |
| 503 | Ga0207674_12084368 | 3300026116 | Bacteria | 531 |
| 504 | Ga0207675_100812006 | 3300026118 | Bacteria | 949 |
| 505 | Ga0207675_101317696 | 3300026118 | Bacteria | 743 |
| 506 | Ga0207683_10088795 | 3300026121 | Bacteria | 2751 |
| 507 | Ga0207683_10090100 | 3300026121 | Bacteria | 2731 |
| 508 | Ga0207683_10389035 | 3300026121 | Bacteria | 1282 |
| 509 | Ga0207683_10651391 | 3300026121 | Bacteria | 976 |
| 510 | Ga0207698_10044765 | 3300026142 | Bacteria | 3329 |
| 511 | Ga0207698_10259247 | 3300026142 | Bacteria | 1596 |
| 512 | Ga0207698_10386117 | 3300026142 | Bacteria | 1334 |
| 513 | Ga0207698_11052973 | 3300026142 | Bacteria | 825 |
| 514 | Ga0207698_11712806 | 3300026142 | Bacteria | 644 |
| 515 | Ga0207698_12444367 | 3300026142 | Bacteria | 533 |
| 516 | Ga0209179_1042023 | 3300027512 | Bacteria | 964 |
| 517 | Ga0209179_1129216 | 3300027512 | Bacteria | 565 |
| 518 | Ga0209588_1006547 | 3300027671 | Bacteria | 3391 |
| 519 | Ga0209588_1040603 | 3300027671 | Bacteria | 1501 |
| 520 | Ga0209813_10243410 | 3300027866 | Bacteria | 681 |
| 521 | Ga0268266_10008590 | 3300028379 | Bacteria | 9072 |
| 522 | Ga0268266_10128940 | 3300028379 | Bacteria | 2260 |
| 523 | Ga0268266_10349992 | 3300028379 | Bacteria | 1388 |
| 524 | Ga0268266_10915679 | 3300028379 | Bacteria | 848 |
| 525 | Ga0268265_10027526 | 3300028380 | Bacteria | 4059 |
| 526 | Ga0268265_10335258 | 3300028380 | Bacteria | 1375 |
| 527 | Ga0268264_10452981 | 3300028381 | Bacteria | 1243 |
| 528 | Ga0268264_10971755 | 3300028381 | Bacteria | 855 |
| 529 | Ga0268264_11529703 | 3300028381 | Bacteria | 678 |
| 530 | Ga0307515_10241059 | 3300028794 | Bacteria | 1579 |
| 531 | Ga0307511_10047546 | 3300030521 | Bacteria | 3508 |
| 532 | Ga0307512_10192333 | 3300030522 | Bacteria | 1123 |
| 533 | Ga0265760_10149300 | 3300031090 | Bacteria | 765 |
| 534 | Ga0265330_10023492 | 3300031235 | Bacteria | 2800 |
| 535 | Ga0265328_10132365 | 3300031239 | Bacteria | 934 |
| 536 | Ga0265339_10005842 | 3300031249 | Bacteria | 8159 |
| 537 | Ga0265339_10008162 | 3300031249 | Bacteria | 6683 |
| 538 | Ga0265339_10150589 | 3300031249 | Bacteria | 1177 |
| 539 | Ga0265339_10176586 | 3300031249 | Bacteria | 1066 |
| 540 | Ga0265339_10412572 | 3300031249 | Bacteria | 630 |
| 541 | Ga0307513_10305659 | 3300031456 | Bacteria | 1355 |
| 542 | Ga0307509_10005537 | 3300031507 | Bacteria | 17522 |
| 543 | Ga0307509_10132925 | 3300031507 | Bacteria | 2440 |
| 544 | Ga0307509_10304889 | 3300031507 | Bacteria | 1338 |
| 545 | Ga0307509_10357405 | 3300031507 | Bacteria | 1181 |
| 546 | Ga0307509_10738798 | 3300031507 | Bacteria | 650 |
| 547 | Ga0265314_10002560 | 3300031711 | Bacteria | 18464 |
| 548 | Ga0265314_10002580 | 3300031711 | Bacteria | 18334 |
| 549 | Ga0265314_10199945 | 3300031711 | Bacteria | 1182 |
| 550 | Ga0265342_10012472 | 3300031712 | Bacteria | 5754 |
| 551 | Ga0265342_10587954 | 3300031712 | Bacteria | 562 |
| 552 | Ga0307516_10005934 | 3300031730 | Bacteria | 14450 |
| 553 | Ga0307405_10578236 | 3300031731 | Bacteria | 913 |
| 554 | Ga0307518_10493758 | 3300031838 | Bacteria | 634 |
| 555 | Ga0307409_100887182 | 3300031995 | Bacteria | 905 |
| 556 | Ga0307411_11882123 | 3300032005 | Bacteria | 557 |
| 557 | Ga0307507_10270480 | 3300033179 | Bacteria | 1074 |
| 558 | Ga0307510_10030948 | 3300033180 | Bacteria | 6057 |
| 559 | Ga0307510_10031256 | 3300033180 | Bacteria | 6020 |
| 560 | Ga0373926_0032900 | 3300035083 | Bacteria | 1831 |
| 561 | Ga0373926_0154829 | 3300035083 | Bacteria | 873 |
| 562 | Ga0373934_0058878 | 3300035086 | Bacteria | 1529 |
| 563 | Ga0373934_0163243 | 3300035086 | Bacteria | 914 |
| 564 | Ga0373944_0041167 | 3300035089 | Bacteria | 1429 |
| 565 | Ga0373952_0291527 | 3300035092 | Bacteria | 506 |
| 566 | Ga0373923_0115809 | 3300035111 | Bacteria | 1194 |
| 567 | Ga0373923_0128885 | 3300035111 | Bacteria | 1135 |
| 568 | Ga0373923_0269878 | 3300035111 | Bacteria | 800 |
| 569 | Ga0373936_0019111 | 3300035113 | Bacteria | 2653 |
| 570 | Ga0373936_0030777 | 3300035113 | Bacteria | 2117 |
| 571 | Ga0373936_0053539 | 3300035113 | Bacteria | 1637 |
| 572 | Ga0373936_0388387 | 3300035113 | Bacteria | 639 |
| 573 | Ga0373936_0405655 | 3300035113 | Bacteria | 626 |
| 574 | Ga0373939_0022265 | 3300035114 | Bacteria | 1745 |
| 575 | Ga0373945_0003772 | 3300035116 | Bacteria | 4785 |
| 576 | Ga0373953_0011105 | 3300035117 | Bacteria | 3150 |
| 577 | Ga0373953_0141308 | 3300035117 | Bacteria | 1030 |
| 578 | Ga0373953_0227725 | 3300035117 | Bacteria | 808 |
| 579 | Ga0373954_0047752 | 3300035118 | Bacteria | 2004 |
| 580 | Ga0373954_0066378 | 3300035118 | Bacteria | 1708 |
| 581 | Ga0373954_0090304 | 3300035118 | Bacteria | 1471 |
| 582 | Ga0373954_0358460 | 3300035118 | Bacteria | 720 |
| 583 | Ga0373956_0060324 | 3300035119 | Bacteria | 1717 |
| 584 | Ga0373956_0187648 | 3300035119 | Bacteria | 978 |
| 585 | Ga0373956_0432386 | 3300035119 | Bacteria | 628 |
| 586 | Ga0373957_0002349 | 3300035120 | Bacteria | 5377 |
| 587 | Ga0373957_0040122 | 3300035120 | Bacteria | 1759 |
| 588 | Ga0373957_0159100 | 3300035120 | Bacteria | 930 |
| 589 | Ga0373943_0013488 | 3300035170 | Bacteria | 3691 |
| 590 | Ga0373943_0024845 | 3300035170 | Bacteria | 2797 |
| 591 | Ga0373943_0950217 | 3300035170 | Bacteria | 514 |
| 592 | Ga0373943_0979944 | 3300035170 | Bacteria | 507 |
| 593 | Ga0373946_0009587 | 3300035171 | Bacteria | 3570 |
| 594 | Ga0373946_0075340 | 3300035171 | Bacteria | 1466 |
| 595 | Ga0373946_0170766 | 3300035171 | Bacteria | 1026 |
| 596 | Ga0373955_0010472 | 3300035172 | Bacteria | 4382 |
| 597 | Ga0373955_0012443 | 3300035172 | Bacteria | 4087 |
| 598 | Ga0373955_0026973 | 3300035172 | Bacteria | 2965 |
| 599 | Ga0373955_0827524 | 3300035172 | Bacteria | 569 |
| 600 | Ga0373924_0015854 | 3300035410 | Bacteria | 2870 |
| 601 | Ga0373924_0079381 | 3300035410 | Bacteria | 1394 |
| 602 | Ga0373924_0095586 | 3300035410 | Bacteria | 1274 |
| 603 | Ga0373931_0055410 | 3300035691 | Bacteria | 2122 |
| 604 | Ga0373931_0424639 | 3300035691 | Bacteria | 846 |
| 605 | Ga0373931_0476533 | 3300035691 | Bacteria | 802 |
| 606 | Ga0373935_0003875 | 3300035692 | Bacteria | 8728 |
| 607 | Ga0373935_0409769 | 3300035692 | Bacteria | 974 |
| 608 | Ga0373935_0521569 | 3300035692 | Bacteria | 864 |
| 609 | Ga0373935_0537128 | 3300035692 | Bacteria | 851 |
| 610 | Ga0373927_0002882 | 3300035695 | Bacteria | 12525 |
| 611 | Ga0373927_0008495 | 3300035695 | Bacteria | 6908 |
| 612 | Ga0373927_0018156 | 3300035695 | Bacteria | 4626 |
| 613 | Ga0373927_0043935 | 3300035695 | Bacteria | 2892 |
| 614 | Ga0373933_0010030 | 3300035724 | Bacteria | 5185 |
| 615 | Ga0373933_0054994 | 3300035724 | Bacteria | 2386 |
| 616 | Ga0373933_0223527 | 3300035724 | Bacteria | 1208 |
| 617 | Ga0373933_0429271 | 3300035724 | Bacteria | 863 |
| 618 | Ga0373947_0009316 | 3300035725 | Bacteria | 5640 |
| 619 | Ga0373947_0014881 | 3300035725 | Bacteria | 4465 |
| 620 | Ga0373947_0142854 | 3300035725 | Bacteria | 1536 |
| 621 | Ga0373947_0404391 | 3300035725 | Bacteria | 921 |
| 622 | Ga0373937_0056024 | 3300036401 | Bacteria | 3619 |
| 623 | Ga0373937_0135731 | 3300036401 | Bacteria | 2300 |
| 624 | Ga0373937_0148861 | 3300036401 | Bacteria | 2192 |
| 625 | Ga0373937_1838811 | 3300036401 | Bacteria | 552 |
| 626 | Ga0372808_029125 | 3300036459 | Bacteria | 793 |
| 627 | Ga0373925_0058113 | 3300037068 | Bacteria | 2899 |
| 628 | Ga0373925_0071053 | 3300037068 | Bacteria | 2632 |
| 629 | Ga0373925_0323486 | 3300037068 | Bacteria | 1248 |
| 630 | Ga0373925_0348749 | 3300037068 | Bacteria | 1202 |
| 631 | Ga0373925_0582639 | 3300037068 | Bacteria | 921 |
| 632 | Ga0373925_1269077 | 3300037068 | Bacteria | 605 |
| 633 | Ga0395899_0245006 | 3300037312 | Bacteria | 1232 |
| 634 | Ga0395899_0317672 | 3300037312 | Bacteria | 1050 |
| 635 | Ga0395900_0345701 | 3300037418 | Bacteria | 1462 |
| 636 | Ga0395898_0015307 | 3300037466 | Bacteria | 7872 |
| 637 | Ga0395898_0031629 | 3300037466 | Bacteria | 5286 |
| 638 | Ga0395898_0056746 | 3300037466 | Bacteria | 3817 |
| 639 | Ga0395898_0513499 | 3300037466 | Bacteria | 1139 |
| 640 | Ga0395898_0596788 | 3300037466 | Bacteria | 1047 |
| 641 | Ga0395905_0975062 | 3300037471 | Bacteria | 751 |
| 642 | Ga0395905_1390659 | 3300037471 | Bacteria | 606 |
| 643 | Ga0436364_0842784 | 3300037853 | Bacteria | 835 |
| 644 | Ga0395901_0099375 | 3300038443 | Bacteria | 3051 |
| 645 | Ga0395901_0922324 | 3300038443 | Bacteria | 854 |
| 646 | Ga0436365_0485246 | 3300039437 | Bacteria | 548 |
| 647 | Ga0436365_0815616 | 3300039437 | Bacteria | 532 |
| 648 | Ga0436365_1381894 | 3300039437 | Bacteria | 2754 |
| 649 | Ga0436365_1719439 | 3300039437 | Bacteria | 551 |
| 650 | Ga0436360_0000691 | 3300039438 | Bacteria | 502 |
| 651 | Ga0436360_0491169 | 3300039438 | Bacteria | 1347 |
| 652 | Ga0436361_0000349 | 3300039447 | Bacteria | 1078 |
| 653 | Ga0436363_0091919 | 3300039450 | Bacteria | 660 |
| 654 | Ga0436363_1385019 | 3300039450 | Bacteria | 1015 |
| 655 | Ga0436363_1695624 | 3300039450 | Bacteria | 3988 |
| 656 | Ga0439465_0012995 | 3300041413 | Bacteria | 2602 |
| 657 | Ga0451791_1084933 | 3300041451 | Bacteria | 618 |
| 658 | Ga0451793_0178294 | 3300041452 | Bacteria | 515 |
| 659 | Ga0451797_0381516 | 3300041453 | Bacteria | 561 |
| 660 | Ga0451802_1946777 | 3300041460 | Bacteria | 624 |
| 661 | Ga0451839_1301463 | 3300041496 | Bacteria | 667 |
| 662 | Ga0451847_0886397 | 3300041503 | Bacteria | 580 |
| 663 | Ga0451849_0839640 | 3300041505 | Bacteria | 562 |
| 664 | Ga0451849_1239105 | 3300041505 | Bacteria | 605 |
| 665 | Ga0451853_0198280 | 3300041512 | Bacteria | 1453 |
| 666 | Ga0451853_1211587 | 3300041512 | Bacteria | 766 |
| 667 | Ga0451853_1882543 | 3300041512 | Bacteria | 546 |
| 668 | Ga0439458_0198048 | 3300042157 | Bacteria | 549 |
| 669 | Ga0439459_0222924 | 3300042438 | Bacteria | 523 |
| 670 | Ga0466961_0391135 | 3300044693 | Bacteria | 844 |
| 671 | Ga0466963_0586472 | 3300044694 | Bacteria | 787 |
| 672 | Ga0466964_0323770 | 3300044706 | Bacteria | 784 |
| 673 | Ga0466968_0225552 | 3300044735 | Bacteria | 884 |
| 674 | Ga0466968_0285790 | 3300044735 | Bacteria | 790 |
| 675 | Ga0466970_0076381 | 3300044765 | Bacteria | 1805 |
| 676 | Ga0466957_0139776 | 3300044842 | Bacteria | 1559 |
| 677 | Ga0466957_0209559 | 3300044842 | Bacteria | 1283 |
| 678 | Ga0466957_0741460 | 3300044842 | Bacteria | 695 |
| 679 | Ga0466959_0163644 | 3300045049 | Bacteria | 1563 |
| 680 | Ga0466967_0738236 | 3300045976 | Bacteria | 976 |
| 681 | Ga0466967_1136904 | 3300045976 | Bacteria | 778 |
| 682 | Ga0466967_2529064 | 3300045976 | Bacteria | 508 |
| 683 | Ga0495592_0004098 | 3300046454 | Bacteria | 10596 |
| 684 | Ga0495592_0132648 | 3300046454 | Bacteria | 1741 |
| 685 | Ga0495603_0000217 | 3300046455 | Bacteria | 29788 |
| 686 | Ga0495603_0009199 | 3300046455 | Bacteria | 5971 |
| 687 | Ga0495603_0087530 | 3300046455 | Bacteria | 1823 |
| 688 | Ga0495603_0103380 | 3300046455 | Bacteria | 1663 |
| 689 | Ga0495603_0358235 | 3300046455 | Bacteria | 837 |
| 690 | Ga0495603_0494681 | 3300046455 | Bacteria | 700 |
| 691 | Ga0495590_0129903 | 3300046457 | Bacteria | 905 |
| 692 | Ga0495590_0327074 | 3300046457 | Bacteria | 580 |
| 693 | Ga0495591_107288 | 3300046458 | Bacteria | 688 |
| 694 | Ga0495629_0000862 | 3300046459 | Bacteria | 24478 |
| 695 | Ga0495629_0021708 | 3300046459 | Bacteria | 4580 |
| 696 | Ga0495629_0030060 | 3300046459 | Bacteria | 3852 |
| 697 | Ga0495629_0065650 | 3300046459 | Bacteria | 2533 |
| 698 | Ga0495629_0099483 | 3300046459 | Bacteria | 2029 |
| 699 | Ga0495629_0229147 | 3300046459 | Bacteria | 1281 |
| 700 | Ga0495629_0383333 | 3300046459 | Bacteria | 956 |
| 701 | Ga0495629_0555661 | 3300046459 | Bacteria | 770 |
| 702 | Ga0495638_0580026 | 3300046460 | Bacteria | 553 |
| 703 | Ga0495641_0003672 | 3300046461 | Bacteria | 11330 |
| 704 | Ga0495641_0032216 | 3300046461 | Bacteria | 2496 |
| 705 | Ga0495641_0192158 | 3300046461 | Bacteria | 915 |
| 706 | Ga0495651_0100456 | 3300046462 | Bacteria | 2155 |
| 707 | Ga0495651_0296304 | 3300046462 | Bacteria | 1086 |
| 708 | Ga0495651_0308322 | 3300046462 | Bacteria | 1059 |
| 709 | Ga0495651_0779218 | 3300046462 | Bacteria | 591 |
| 710 | Ga0495653_0033474 | 3300046463 | Bacteria | 4072 |
| 711 | Ga0495653_0229476 | 3300046463 | Bacteria | 1243 |
| 712 | Ga0495650_0160075 | 3300046471 | Bacteria | 803 |
| 713 | Ga0495580_0005364 | 3300046472 | Bacteria | 10616 |
| 714 | Ga0495580_0006588 | 3300046472 | Bacteria | 9437 |
| 715 | Ga0495580_0397632 | 3300046472 | Bacteria | 929 |
| 716 | Ga0495582_0000990 | 3300046473 | Bacteria | 15910 |
| 717 | Ga0495582_0023883 | 3300046473 | Bacteria | 3343 |
| 718 | Ga0495582_0144056 | 3300046473 | Bacteria | 1351 |
| 719 | Ga0495582_0266219 | 3300046473 | Bacteria | 983 |
| 720 | Ga0495639_0000544 | 3300046475 | Bacteria | 17562 |
| 721 | Ga0495639_0017690 | 3300046475 | Bacteria | 3097 |
| 722 | Ga0495639_0283025 | 3300046475 | Bacteria | 824 |
| 723 | Ga0495662_0001589 | 3300046476 | Bacteria | 11287 |
| 724 | Ga0495662_0057004 | 3300046476 | Bacteria | 1886 |
| 725 | Ga0495664_0001505 | 3300046477 | Bacteria | 12344 |
| 726 | Ga0495664_0047310 | 3300046477 | Bacteria | 2552 |
| 727 | Ga0495664_0122382 | 3300046477 | Bacteria | 1573 |
| 728 | Ga0495664_0136551 | 3300046477 | Bacteria | 1486 |
| 729 | Ga0495584_0156167 | 3300046491 | Bacteria | 1159 |
| 730 | Ga0495585_0048859 | 3300046492 | Bacteria | 2351 |
| 731 | Ga0495594_0000128 | 3300046499 | Bacteria | 35750 |
| 732 | Ga0495594_0067579 | 3300046499 | Bacteria | 1984 |
| 733 | Ga0495594_0240001 | 3300046499 | Bacteria | 1033 |
| 734 | Ga0495607_0228292 | 3300046501 | Bacteria | 907 |
| 735 | Ga0495607_0377907 | 3300046501 | Bacteria | 649 |
| 736 | Ga0495583_0112024 | 3300046506 | Bacteria | 1155 |
| 737 | Ga0495606_0001136 | 3300046507 | Bacteria | 37910 |
| 738 | Ga0495606_0125530 | 3300046507 | Bacteria | 1531 |
| 739 | Ga0495608_0026451 | 3300046511 | Bacteria | 3955 |
| 740 | Ga0495608_0048299 | 3300046511 | Bacteria | 2828 |
| 741 | Ga0495608_0249635 | 3300046511 | Bacteria | 1107 |
| 742 | Ga0495610_0236140 | 3300046512 | Bacteria | 731 |
| 743 | Ga0495616_0041706 | 3300046513 | Bacteria | 2340 |
| 744 | Ga0495616_0109549 | 3300046513 | Bacteria | 1284 |
| 745 | Ga0495618_0028500 | 3300046514 | Bacteria | 3480 |
| 746 | Ga0495618_0035913 | 3300046514 | Bacteria | 3110 |
| 747 | Ga0495618_0148252 | 3300046514 | Bacteria | 1499 |
| 748 | Ga0495618_0219935 | 3300046514 | Bacteria | 1198 |
| 749 | Ga0495620_0019752 | 3300046515 | Bacteria | 3306 |
| 750 | Ga0495628_0017576 | 3300046516 | Bacteria | 5949 |
| 751 | Ga0495628_0024999 | 3300046516 | Bacteria | 4883 |
| 752 | Ga0495628_0633738 | 3300046516 | Bacteria | 760 |
| 753 | Ga0495630_0022061 | 3300046517 | Bacteria | 4704 |
| 754 | Ga0495630_0036462 | 3300046517 | Bacteria | 3676 |
| 755 | Ga0495630_0375847 | 3300046517 | Bacteria | 1088 |
| 756 | Ga0495632_0240984 | 3300046519 | Bacteria | 813 |
| 757 | Ga0495632_0338211 | 3300046519 | Bacteria | 663 |
| 758 | Ga0495643_0125140 | 3300046522 | Bacteria | 1295 |
| 759 | Ga0495644_0062010 | 3300046523 | Bacteria | 1405 |
| 760 | Ga0495642_0152020 | 3300046528 | Bacteria | 1001 |
| 761 | Ga0495652_0016896 | 3300046529 | Bacteria | 6521 |
| 762 | Ga0495652_0052716 | 3300046529 | Bacteria | 3468 |
| 763 | Ga0495652_0111869 | 3300046529 | Bacteria | 2195 |
| 764 | Ga0495652_0118695 | 3300046529 | Bacteria | 2113 |
| 765 | Ga0495652_0259563 | 3300046529 | Bacteria | 1283 |
| 766 | Ga0495652_0311456 | 3300046529 | Bacteria | 1140 |
| 767 | Ga0495665_0001468 | 3300046531 | Bacteria | 12651 |
| 768 | Ga0495665_0055108 | 3300046531 | Bacteria | 2100 |
| 769 | Ga0495640_0002595 | 3300046533 | Bacteria | 14526 |
| 770 | Ga0495640_0012990 | 3300046533 | Bacteria | 6345 |
| 771 | Ga0495640_0022149 | 3300046533 | Bacteria | 4651 |
| 772 | Ga0495640_0027356 | 3300046533 | Bacteria | 4113 |
| 773 | Ga0495586_0016197 | 3300046535 | Bacteria | 3966 |
| 774 | Ga0495587_0046121 | 3300046536 | Bacteria | 2587 |
| 775 | Ga0495587_0064108 | 3300046536 | Bacteria | 2147 |
| 776 | Ga0495609_0132842 | 3300046538 | Bacteria | 1065 |
| 777 | Ga0495597_0393321 | 3300046542 | Bacteria | 528 |
| 778 | Ga0495645_0067766 | 3300046543 | Bacteria | 2577 |
| 779 | Ga0495645_0265959 | 3300046543 | Bacteria | 1133 |
| 780 | Ga0495645_0557931 | 3300046543 | Bacteria | 709 |
| 781 | Ga0495645_0736725 | 3300046543 | Bacteria | 596 |
| 782 | Ga0495622_0038006 | 3300046557 | Bacteria | 2241 |
| 783 | Ga0495622_0081756 | 3300046557 | Bacteria | 1486 |
| 784 | Ga0495622_0150336 | 3300046557 | Bacteria | 1054 |
| 785 | Ga0495622_0245599 | 3300046557 | Bacteria | 788 |
| 786 | Ga0495667_0029236 | 3300046559 | Bacteria | 3709 |
| 787 | Ga0495667_0116310 | 3300046559 | Bacteria | 1727 |
| 788 | Ga0495667_0142621 | 3300046559 | Bacteria | 1543 |
| 789 | Ga0495667_0346940 | 3300046559 | Bacteria | 938 |
| 790 | Ga0495667_0376648 | 3300046559 | Bacteria | 895 |
| 791 | Ga0495656_0110860 | 3300046615 | Bacteria | 1283 |
| 792 | Ga0495656_0256351 | 3300046615 | Bacteria | 885 |
| 793 | Ga0495668_0077203 | 3300046616 | Bacteria | 1828 |
| 794 | Ga0495668_0119718 | 3300046616 | Bacteria | 1440 |
| 795 | Ga0495634_0001583 | 3300046642 | Bacteria | 19998 |
| 796 | Ga0495634_0211708 | 3300046642 | Bacteria | 1199 |
| 797 | Ga0495611_0118059 | 3300046648 | Bacteria | 1236 |
| 798 | Ga0495625_0114234 | 3300046660 | Bacteria | 1843 |
| 799 | Ga0495625_0817519 | 3300046660 | Bacteria | 541 |
| 800 | Ga0495635_0000436 | 3300046663 | Bacteria | 26341 |
| 801 | Ga0495635_0069118 | 3300046663 | Bacteria | 2421 |
| 802 | Ga0495635_0633453 | 3300046663 | Bacteria | 696 |
| 803 | Ga0495635_1012453 | 3300046663 | Bacteria | 528 |
| 804 | Ga0495659_0263884 | 3300046664 | Bacteria | 720 |
| 805 | Ga0495588_0023745 | 3300046674 | Bacteria | 3038 |
| 806 | Ga0495588_0472957 | 3300046674 | Bacteria | 657 |
| 807 | Ga0495657_0027114 | 3300046675 | Bacteria | 4047 |
| 808 | Ga0495657_0083501 | 3300046675 | Bacteria | 2062 |
| 809 | Ga0495657_0204306 | 3300046675 | Bacteria | 1203 |
| 810 | Ga0495657_0498528 | 3300046675 | Bacteria | 710 |
| 811 | Ga0495599_0050869 | 3300046678 | Bacteria | 2596 |
| 812 | Ga0495599_0079908 | 3300046678 | Bacteria | 2042 |
| 813 | Ga0495599_0091761 | 3300046678 | Bacteria | 1895 |
| 814 | Ga0495599_0112584 | 3300046678 | Bacteria | 1694 |
| 815 | Ga0495623_0026222 | 3300046679 | Bacteria | 3752 |
| 816 | Ga0495623_0030664 | 3300046679 | Bacteria | 3459 |
| 817 | Ga0495623_0053435 | 3300046679 | Bacteria | 2550 |
| 818 | Ga0495623_0273707 | 3300046679 | Bacteria | 942 |
| 819 | Ga0495646_0014377 | 3300046680 | Bacteria | 5035 |
| 820 | Ga0495646_0016885 | 3300046680 | Bacteria | 4635 |
| 821 | Ga0495646_0201883 | 3300046680 | Bacteria | 1082 |
| 822 | Ga0495646_0306763 | 3300046680 | Bacteria | 838 |
| 823 | Ga0495647_0000394 | 3300046681 | Bacteria | 12460 |
| 824 | Ga0495647_0088297 | 3300046681 | Bacteria | 1267 |
| 825 | Ga0495658_0005609 | 3300046683 | Bacteria | 6167 |
| 826 | Ga0495658_0018051 | 3300046683 | Bacteria | 3660 |
| 827 | Ga0495658_0143713 | 3300046683 | Bacteria | 1461 |
| 828 | Ga0495669_0162091 | 3300046684 | Bacteria | 1061 |
| 829 | Ga0495613_0021731 | 3300046689 | Bacteria | 4781 |
| 830 | Ga0495613_0112154 | 3300046689 | Bacteria | 1964 |
| 831 | Ga0495613_0150274 | 3300046689 | Bacteria | 1661 |
| 832 | Ga0495613_0497969 | 3300046689 | Bacteria | 821 |
| 833 | Ga0495624_0006861 | 3300046690 | Bacteria | 8038 |
| 834 | Ga0495670_0259728 | 3300046691 | Bacteria | 927 |
| 835 | Ga0495670_0634054 | 3300046691 | Bacteria | 582 |
| 836 | Ga0495671_0042266 | 3300046692 | Bacteria | 2291 |
| 837 | Ga0495589_0048523 | 3300046794 | Bacteria | 2102 |
| 838 | Ga0495589_0110118 | 3300046794 | Bacteria | 1329 |
| 839 | Ga0495600_0051952 | 3300046809 | Bacteria | 2675 |
| 840 | Ga0495600_0102374 | 3300046809 | Bacteria | 1866 |
| 841 | Ga0495600_0272024 | 3300046809 | Bacteria | 1074 |
| 842 | Ga0495600_0343852 | 3300046809 | Bacteria | 935 |
| 843 | Ga0495660_0213219 | 3300046810 | Bacteria | 915 |
| 844 | Ga0495581_0000293 | 3300047315 | Bacteria | 24244 |
| 845 | Ga0495581_0053239 | 3300047315 | Bacteria | 2338 |
| 846 | Ga0495581_0182137 | 3300047315 | Bacteria | 1229 |
| 847 | Ga0495604_0090372 | 3300047317 | Bacteria | 2274 |
| 848 | Ga0495604_0158741 | 3300047317 | Bacteria | 1599 |
| 849 | Ga0495604_0197566 | 3300047317 | Bacteria | 1397 |
| 850 | Ga0495674_0008903 | 3300047319 | Bacteria | 9546 |
| 851 | Ga0495674_0053630 | 3300047319 | Bacteria | 3543 |
| 852 | Ga0495674_0460682 | 3300047319 | Bacteria | 1020 |
| 853 | Ga0495674_0635997 | 3300047319 | Bacteria | 842 |
| 854 | Ga0495674_0804026 | 3300047319 | Bacteria | 731 |
| 855 | Ga0495672_0323547 | 3300047320 | Bacteria | 724 |
| 856 | Ga0495676_0074450 | 3300047321 | Bacteria | 2600 |
| 857 | Ga0495676_0080429 | 3300047321 | Bacteria | 2475 |
| 858 | Ga0495676_0137243 | 3300047321 | Bacteria | 1757 |
| 859 | Ga0495680_0114034 | 3300047322 | Bacteria | 2000 |
| 860 | Ga0495680_0754907 | 3300047322 | Bacteria | 638 |
| 861 | Ga0495675_0081725 | 3300047444 | Bacteria | 2034 |
| 862 | Ga0495675_0165007 | 3300047444 | Bacteria | 1362 |
| 863 | Ga0495675_0328892 | 3300047444 | Bacteria | 903 |
| 864 | Ga0495677_0048763 | 3300047445 | Bacteria | 1556 |
| 865 | Ga0495679_182861 | 3300047446 | Bacteria | 555 |
| 866 | Ga0495673_0035307 | 3300047469 | Bacteria | 2305 |
| 867 | Ga0495673_0179438 | 3300047469 | Bacteria | 803 |
| 868 | Ga0495684_0008182 | 3300047471 | Bacteria | 8092 |
| 869 | Ga0495684_0028314 | 3300047471 | Bacteria | 4302 |
| 870 | Ga0495684_0064202 | 3300047471 | Bacteria | 2790 |
| 871 | Ga0495686_0052996 | 3300047472 | Bacteria | 2543 |
| 872 | Ga0495686_0713943 | 3300047472 | Bacteria | 510 |
| 873 | Ga0495593_0000439 | 3300047673 | Bacteria | 23237 |
| 874 | Ga0495593_0008595 | 3300047673 | Bacteria | 5938 |
| 875 | Ga0495593_0142244 | 3300047673 | Bacteria | 1215 |
| 876 | Ga0495593_0219960 | 3300047673 | Bacteria | 953 |
| 877 | Ga0495593_0347207 | 3300047673 | Bacteria | 741 |
| 878 | Ga0495602_0097255 | 3300048088 | Bacteria | 2425 |
| 879 | Ga0495602_0460589 | 3300048088 | Bacteria | 896 |
| 880 | Ga0495602_1056124 | 3300048088 | Bacteria | 534 |
| 881 | Ga0495614_0035192 | 3300048089 | Bacteria | 2152 |
| 882 | Ga0495614_0298588 | 3300048089 | Bacteria | 744 |
| 883 | Ga0496100_0035084 | 3300048903 | Bacteria | 3153 |
| 884 | Ga0496100_0183513 | 3300048903 | Bacteria | 1514 |
| 885 | Ga0496101_0020624 | 3300048904 | Bacteria | 4516 |
| 886 | Ga0496102_0004471 | 3300048905 | Bacteria | 11798 |
| 887 | Ga0496102_0189619 | 3300048905 | Bacteria | 1937 |
| 888 | Ga0496102_0231736 | 3300048905 | Bacteria | 1741 |
| 889 | Ga0496102_0915975 | 3300048905 | Bacteria | 798 |
| 890 | Ga0496102_1129293 | 3300048905 | Bacteria | 703 |
| 891 | Ga0496103_0144277 | 3300048906 | Bacteria | 1523 |
| 892 | Ga0496104_0225722 | 3300048907 | Bacteria | 1785 |
| 893 | Ga0496104_0316621 | 3300048907 | Bacteria | 1473 |
| 894 | Ga0496104_1150317 | 3300048907 | Bacteria | 679 |
| 895 | Ga0496104_1485662 | 3300048907 | Bacteria | 580 |
| 896 | Ga0496104_1685676 | 3300048907 | Bacteria | 536 |
| 897 | Ga0496105_0100819 | 3300048908 | Bacteria | 2384 |
| 898 | Ga0496105_0163181 | 3300048908 | Bacteria | 1829 |
| 899 | Ga0496105_0527719 | 3300048908 | Bacteria | 924 |
| 900 | Ga0496105_0716914 | 3300048908 | Bacteria | 767 |
| 901 | Ga0496105_1212805 | 3300048908 | Bacteria | 555 |
| 902 | Ga0496105_1365695 | 3300048908 | Bacteria | 515 |
| 903 | Ga0496106_0001552 | 3300048909 | Bacteria | 17305 |
| 904 | Ga0496106_0016919 | 3300048909 | Bacteria | 5396 |
| 905 | Ga0496106_0276000 | 3300048909 | Bacteria | 1346 |
| 906 | Ga0496106_0531267 | 3300048909 | Bacteria | 944 |
| 907 | Ga0496106_0687556 | 3300048909 | Bacteria | 816 |
| 908 | Ga0496107_0001619 | 3300048910 | Bacteria | 14019 |
| 909 | Ga0496107_0005793 | 3300048910 | Bacteria | 8456 |
| 910 | Ga0496107_0167791 | 3300048910 | Bacteria | 1628 |
| 911 | Ga0496107_0727704 | 3300048910 | Bacteria | 729 |
| 912 | Ga0496107_0963957 | 3300048910 | Bacteria | 620 |
| 913 | Ga0496108_0000259 | 3300048911 | Bacteria | 45599 |
| 914 | Ga0496108_0038300 | 3300048911 | Bacteria | 3994 |
| 915 | Ga0496108_0109529 | 3300048911 | Bacteria | 2360 |
| 916 | Ga0496108_0121252 | 3300048911 | Bacteria | 2243 |
| 917 | Ga0496108_0153595 | 3300048911 | Bacteria | 1987 |
| 918 | Ga0496108_0180984 | 3300048911 | Bacteria | 1825 |
| 919 | Ga0496109_0000250 | 3300048912 | Bacteria | 51687 |
| 920 | Ga0496109_0094905 | 3300048912 | Bacteria | 2761 |
| 921 | Ga0496109_0128890 | 3300048912 | Bacteria | 2360 |
| 922 | Ga0496109_0203702 | 3300048912 | Bacteria | 1860 |
| 923 | Ga0496109_0312368 | 3300048912 | Bacteria | 1483 |
| 924 | Ga0496109_1268232 | 3300048912 | Bacteria | 673 |
| 925 | Ga0496110_0002671 | 3300048913 | Bacteria | 13465 |
| 926 | Ga0496110_0049885 | 3300048913 | Bacteria | 3674 |
| 927 | Ga0496110_0134307 | 3300048913 | Bacteria | 2235 |
| 928 | Ga0496110_0303612 | 3300048913 | Bacteria | 1454 |
| 929 | Ga0496110_0352092 | 3300048913 | Bacteria | 1341 |
| 930 | Ga0496110_0448870 | 3300048913 | Bacteria | 1175 |
| 931 | Ga0496111_0055154 | 3300048914 | Bacteria | 2874 |
| 932 | Ga0496111_0079541 | 3300048914 | Bacteria | 2392 |
| 933 | Ga0496111_0314329 | 3300048914 | Bacteria | 1160 |
| 934 | Ga0496111_0489571 | 3300048914 | Bacteria | 906 |
| 935 | Ga0496111_1317489 | 3300048914 | Bacteria | 508 |
| 936 | Ga0496112_0000017 | 3300048915 | Bacteria | 191284 |
| 937 | Ga0496112_0003374 | 3300048915 | Bacteria | 13188 |
| 938 | Ga0496112_0024688 | 3300048915 | Bacteria | 5762 |
| 939 | Ga0496112_0147638 | 3300048915 | Bacteria | 2319 |
| 940 | Ga0496112_0406741 | 3300048915 | Bacteria | 1300 |
| 941 | Ga0496112_0519003 | 3300048915 | Bacteria | 1126 |
| 942 | Ga0496112_1313819 | 3300048915 | Bacteria | 639 |
| 943 | Ga0496113_0013101 | 3300048916 | Bacteria | 5601 |
| 944 | Ga0496113_0073296 | 3300048916 | Bacteria | 2608 |
| 945 | Ga0496113_0155877 | 3300048916 | Bacteria | 1803 |
| 946 | Ga0496113_0460114 | 3300048916 | Bacteria | 1022 |
| 947 | Ga0496113_0901253 | 3300048916 | Bacteria | 699 |
| 948 | Ga0496114_0183980 | 3300048917 | Bacteria | 1825 |
| 949 | Ga0496114_0691438 | 3300048917 | Bacteria | 895 |
| 950 | Ga0496114_1678233 | 3300048917 | Bacteria | 523 |
| 951 | Ga0496115_0002446 | 3300048918 | Bacteria | 13344 |
| 952 | Ga0496115_0045535 | 3300048918 | Bacteria | 3503 |
| 953 | Ga0496115_0050187 | 3300048918 | Bacteria | 3342 |
| 954 | Ga0496115_0173768 | 3300048918 | Bacteria | 1781 |
| 955 | Ga0496115_0413051 | 3300048918 | Bacteria | 1094 |
| 956 | Ga0496115_0548439 | 3300048918 | Bacteria | 924 |
| 957 | Ga0496115_0611629 | 3300048918 | Bacteria | 865 |
| 958 | Ga0496115_0639175 | 3300048918 | Bacteria | 842 |
| 959 | Ga0496115_1147358 | 3300048918 | Bacteria | 587 |
| 960 | Ga0496115_1321037 | 3300048918 | Bacteria | 536 |
| 961 | Ga0496118_0019989 | 3300048921 | Bacteria | 5959 |
| 962 | Ga0496119_0361239 | 3300048922 | Bacteria | 701 |
| 963 | Ga0496120_0503856 | 3300048923 | Bacteria | 520 |
| 964 | Ga0496121_0104428 | 3300048924 | Bacteria | 2177 |
| 965 | Ga0496121_0138854 | 3300048924 | Bacteria | 1806 |
| 966 | Ga0496121_0280774 | 3300048924 | Bacteria | 1139 |
| 967 | Ga0496124_0084045 | 3300048927 | Bacteria | 2611 |
| 968 | Ga0496124_0496763 | 3300048927 | Bacteria | 819 |
| 969 | Ga0496125_0004755 | 3300048928 | Bacteria | 15477 |
| 970 | Ga0496125_0009329 | 3300048928 | Bacteria | 10115 |
| 971 | Ga0496125_0052858 | 3300048928 | Bacteria | 3337 |
| 972 | Ga0496126_0013993 | 3300048929 | Bacteria | 8130 |
| 973 | Ga0496126_0020497 | 3300048929 | Bacteria | 6477 |
| 974 | Ga0496126_0029864 | 3300048929 | Bacteria | 5174 |
| 975 | Ga0496126_0038137 | 3300048929 | Bacteria | 4473 |
| 976 | Ga0496126_0042182 | 3300048929 | Bacteria | 4215 |
| 977 | Ga0496126_0069964 | 3300048929 | Bacteria | 3128 |
| 978 | Ga0496126_0076665 | 3300048929 | Bacteria | 2965 |
| 979 | Ga0496126_0077425 | 3300048929 | Bacteria | 2948 |
| 980 | Ga0496126_0084546 | 3300048929 | Bacteria | 2798 |
| 981 | Ga0496126_0126068 | 3300048929 | Bacteria | 2216 |
| 982 | Ga0496126_0126899 | 3300048929 | Bacteria | 2207 |
| 983 | Ga0496126_0215064 | 3300048929 | Bacteria | 1617 |
| 984 | Ga0496126_0233628 | 3300048929 | Bacteria | 1539 |
| 985 | Ga0496126_0241914 | 3300048929 | Bacteria | 1507 |
| 986 | Ga0496126_0260447 | 3300048929 | Bacteria | 1442 |
| 987 | Ga0496126_0303283 | 3300048929 | Bacteria | 1317 |
| 988 | Ga0496126_0545688 | 3300048929 | Bacteria | 921 |
| 989 | Ga0495678_050445 | 3300049459 | Bacteria | 1613 |
| 990 | Ga0501033_0119555 | 3300049570 | Bacteria | 1913 |
| 991 | Ga0501039_1486278 | 3300049575 | Bacteria | 521 |
| 992 | Ga0501046_0065753 | 3300049580 | Bacteria | 2828 |
| 993 | Ga0501047_0012334 | 3300049581 | Bacteria | 8090 |
| 994 | Ga0501047_0329822 | 3300049581 | Bacteria | 1365 |
| 995 | Ga0501070_0040882 | 3300049586 | Bacteria | 3864 |
| 996 | Ga0501071_0782091 | 3300049587 | Bacteria | 736 |
| 997 | Ga0501073_0037500 | 3300049589 | Bacteria | 3441 |
| 998 | Ga0501074_0051766 | 3300049590 | Bacteria | 2963 |
| 999 | Ga0501076_0264395 | 3300049592 | Bacteria | 1409 |
| 1000 | Ga0501080_0013729 | 3300049742 | Bacteria | 7457 |
| 1001 | Ga0501083_0219372 | 3300049744 | Bacteria | 1239 |
| 1002 | Ga0501044_0016521 | 3300049823 | Bacteria | 7921 |
| 1003 | nmdc:mga03683_213316_c1 | 3300050489 | Bacteria | 889 |
| 1004 | nmdc:mga03683_289903_c1 | 3300050489 | Bacteria | 766 |
| 1005 | nmdc:mga03n38_213812_c1 | 3300050490 | Bacteria | 1003 |
| 1006 | nmdc:mga03n38_7252_c1 | 3300050490 | Bacteria | 3913 |
| 1007 | nmdc:mga00v17_30161_c1 | 3300050491 | Bacteria | 3189 |
| 1008 | nmdc:mga00v17_46759_c1 | 3300050491 | Bacteria | 2619 |
| 1009 | nmdc:mga0yw44_193481_c1 | 3300050492 | Bacteria | 1342 |
| 1010 | nmdc:mga0yw44_63288_c1 | 3300050492 | Bacteria | 2274 |
| 1011 | nmdc:mga0k408_582052_c1 | 3300050493 | Bacteria | 661 |
| 1012 | nmdc:mga06z11_144481_c1 | 3300050494 | Bacteria | 1347 |
| 1013 | nmdc:mga06z11_271052_c1 | 3300050494 | Bacteria | 1004 |
| 1014 | nmdc:mga06z11_71464_c1 | 3300050494 | Bacteria | 1837 |
| 1015 | nmdc:mga04h51_85307_c1 | 3300050495 | Bacteria | 1128 |
| 1016 | nmdc:mga08y16_1337271_c1 | 3300050511 | Bacteria | 682 |
| 1017 | nmdc:mga08y16_785497_c1 | 3300050511 | Bacteria | 946 |
| 1018 | nmdc:mga0n895_59607_c1 | 3300050512 | Bacteria | 3765 |
| 1019 | nmdc:mga08x19_113777_c1 | 3300050514 | Bacteria | 1807 |
| 1020 | Ga0495601_0020870 | 3300053077 | Bacteria | 4005 |
| 1021 | Ga0495601_0143986 | 3300053077 | Bacteria | 1555 |
| 1022 | Ga0495601_0167556 | 3300053077 | Bacteria | 1435 |
| 1023 | Ga0495601_0389158 | 3300053077 | Bacteria | 904 |
| 1024 | Ga0495612_0014078 | 3300053078 | Bacteria | 3220 |
| 1025 | Ga0500635_0010159 | 3300053080 | Bacteria | 2635 |
| 1026 | Ga0500635_0043153 | 3300053080 | Bacteria | 1515 |
| 1027 | Ga0495595_0002193 | 3300053084 | Bacteria | 7588 |
| 1028 | Ga0495595_0028192 | 3300053084 | Bacteria | 2507 |
| 1029 | Ga0495619_0009059 | 3300053085 | Bacteria | 6279 |
| 1030 | Ga0495619_0034958 | 3300053085 | Bacteria | 3267 |
| 1031 | Ga0495619_0137381 | 3300053085 | Bacteria | 1682 |
| 1032 | Ga0495619_0313038 | 3300053085 | Bacteria | 1087 |
| 1033 | Ga0495619_0374487 | 3300053085 | Bacteria | 984 |
| 1034 | Ga0495619_0840695 | 3300053085 | Bacteria | 619 |
| 1035 | Ga0500578_0372424 | 3300053086 | Bacteria | 830 |
| 1036 | Ga0500644_0318543 | 3300053088 | Bacteria | 668 |
| 1037 | Ga0500647_0024609 | 3300053091 | Bacteria | 2832 |
| 1038 | Ga0500651_0213443 | 3300053093 | Bacteria | 1134 |
| 1039 | Ga0500566_0000043 | 3300053094 | Bacteria | 62755 |
| 1040 | Ga0500640_000244 | 3300053095 | Bacteria | 12061 |
| 1041 | Ga0500641_0118338 | 3300053096 | Bacteria | 1141 |
| 1042 | Ga0500648_358673 | 3300053097 | Bacteria | 588 |
| 1043 | Ga0500654_233273 | 3300053099 | Bacteria | 511 |
| 1044 | Ga0500554_032392 | 3300053102 | Bacteria | 1551 |
| 1045 | Ga0500555_047596 | 3300053103 | Bacteria | 1180 |
| 1046 | Ga0500562_048659 | 3300053108 | Bacteria | 1132 |
| 1047 | Ga0500572_000024 | 3300053111 | Bacteria | 47391 |
| 1048 | Ga0500591_019154 | 3300053115 | Bacteria | 3317 |
| 1049 | Ga0500594_0146610 | 3300053118 | Bacteria | 756 |
| 1050 | Ga0500595_012441 | 3300053119 | Bacteria | 3292 |
| 1051 | Ga0500595_205830 | 3300053119 | Bacteria | 542 |
| 1052 | Ga0500608_017517 | 3300053122 | Bacteria | 3254 |
| 1053 | Ga0500614_008732 | 3300053123 | Bacteria | 2152 |
| 1054 | Ga0500655_032961 | 3300053133 | Bacteria | 1001 |
| 1055 | Ga0500559_0003204 | 3300053136 | Bacteria | 8136 |
| 1056 | Ga0500559_0010494 | 3300053136 | Bacteria | 3975 |
| 1057 | Ga0500568_0106171 | 3300053139 | Bacteria | 1052 |
| 1058 | Ga0500573_0062148 | 3300053140 | Bacteria | 2138 |
| 1059 | Ga0500588_0167372 | 3300053146 | Bacteria | 803 |
| 1060 | Ga0500589_136942 | 3300053147 | Bacteria | 1015 |
| 1061 | Ga0500590_043526 | 3300053148 | Bacteria | 2303 |
| 1062 | Ga0500590_225558 | 3300053148 | Bacteria | 768 |
| 1063 | Ga0500603_000121 | 3300053150 | Bacteria | 18383 |
| 1064 | Ga0500603_000391 | 3300053150 | Bacteria | 11472 |
| 1065 | Ga0500603_228445 | 3300053150 | Bacteria | 595 |
| 1066 | Ga0500604_0008548 | 3300053151 | Bacteria | 2719 |
| 1067 | Ga0500619_153016 | 3300053154 | Bacteria | 784 |
| 1068 | Ga0500622_0060591 | 3300053156 | Bacteria | 1931 |
| 1069 | Ga0500630_000112 | 3300053159 | Bacteria | 26672 |
| 1070 | Ga0500633_0140406 | 3300053160 | Bacteria | 904 |
| 1071 | Ga0500634_0084743 | 3300053161 | Bacteria | 1623 |
| 1072 | Ga0500638_120973 | 3300053162 | Bacteria | 1198 |
| 1073 | Ga0500638_182290 | 3300053162 | Bacteria | 905 |
| 1074 | Ga0500639_000040 | 3300053163 | Bacteria | 63516 |
| 1075 | Ga0500639_179054 | 3300053163 | Bacteria | 940 |
| 1076 | Ga0500636_0030525 | 3300053177 | Bacteria | 3187 |
| 1077 | Ga0500636_0329649 | 3300053177 | Bacteria | 738 |
| 1078 | Ga0500637_0002167 | 3300053178 | Bacteria | 8637 |
| 1079 | Ga0500637_0020311 | 3300053178 | Bacteria | 3595 |
| 1080 | Ga0500596_000845 | 3300053735 | Bacteria | 6080 |
| 1081 | Ga0500596_002183 | 3300053735 | Bacteria | 3877 |
| 1082 | Ga0500601_001772 | 3300053737 | Bacteria | 2324 |
| 1083 | Ga0466962_0651813 | 3300061719 | Bacteria | 538 |
| 1084 | Ga0451795_0117465 | |||
| 1085 | LJQas_1007039 | |||
| 1086 | JGI24741J21665_1057105 | |||
| 1087 | JGI25406J46586_10001570 | |||
| 1088 | rootL2_10241999 | |||
| 1089 | JGI25404J52841_10073789 | |||
| 1090 | Ga0070658_10013317 | |||
| 1091 | Ga0070658_10389682 | |||
| 1092 | Ga0070658_10826685 | |||
| 1093 | Ga0070676_10308885 | |||
| 1094 | Ga0070683_100006884 | |||
| 1095 | Ga0070683_100013050 | |||
| 1096 | Ga0070683_100021998 | |||
| 1097 | Ga0070683_100349331 | |||
| 1098 | Ga0070683_100732010 | |||
| 1099 | Ga0070690_100014248 | |||
| 1100 | Ga0070670_100353204 | |||
| 1101 | Ga0068869_101957109 | |||
| 1102 | Ga0070666_11285021 | |||
| 1103 | Ga0070680_100012621 | |||
| 1104 | Ga0070680_100111581 | |||
| 1105 | Ga0070682_100355415 | |||
| 1106 | Ga0068868_100059075 | |||
| 1107 | Ga0070660_100003001 | |||
| 1108 | Ga0070660_100577742 | |||
| 1109 | Ga0070660_100583116 | |||
| 1110 | Ga0070689_100645008 | |||
| 1111 | Ga0070691_10463483 | |||
| 1112 | Ga0070661_100052574 | |||
| 1113 | Ga0070661_100192762 | |||
| 1114 | Ga0070661_100283892 | |||
| 1115 | Ga0070661_100304134 | |||
| 1116 | Ga0070661_100795775 | |||
| 1117 | Ga0070692_10389002 | |||
| 1118 | Ga0070668_100488291 | |||
| 1119 | Ga0070668_100514746 | |||
| 1120 | Ga0070668_101488451 | |||
| 1121 | Ga0070675_100079712 | |||
| 1122 | Ga0070675_100875563 | |||
| 1123 | Ga0070671_100210121 | |||
| 1124 | Ga0070673_100587184 | |||
| 1125 | Ga0070673_102114395 | |||
| 1126 | Ga0070688_100386582 | |||
| 1127 | Ga0070659_100053855 | |||
| 1128 | Ga0070659_100351818 | |||
| 1129 | Ga0070659_100391450 | |||
| 1130 | Ga0070667_101376804 | |||
| 1131 | Ga0070709_10059529 | |||
| 1132 | Ga0070709_10184406 | |||
| 1133 | Ga0070709_10193050 | |||
| 1134 | Ga0070709_10277958 | |||
| 1135 | Ga0070709_10650576 | |||
| 1136 | Ga0070714_100049987 | |||
| 1137 | Ga0070714_100776514 | |||
| 1138 | Ga0070714_100934592 | |||
| 1139 | Ga0070714_102337496 | |||
| 1140 | Ga0070713_100013461 | |||
| 1141 | Ga0070713_100037147 | |||
| 1142 | Ga0070713_100317122 | |||
| 1143 | Ga0070713_100788139 | |||
| 1144 | Ga0070710_10029445 | |||
| 1145 | Ga0070710_10235534 | |||
| 1146 | Ga0070711_100004780 | |||
| 1147 | Ga0070711_100019277 | |||
| 1148 | Ga0070711_100180914 | |||
| 1149 | Ga0070711_100549747 | |||
| 1150 | Ga0070711_101370859 | |||
| 1151 | Ga0070711_101485296 | |||
| 1152 | Ga0070711_102031907 | |||
| 1153 | Ga0070700_100344406 | |||
| 1154 | Ga0070694_101338872 | |||
| 1155 | Ga0070694_101519134 | |||
| 1156 | Ga0070663_100011972 | |||
| 1157 | Ga0070663_100039599 | |||
| 1158 | Ga0070663_100040778 | |||
| 1159 | Ga0070663_100066779 | |||
| 1160 | Ga0070663_100095880 | |||
| 1161 | Ga0070663_100269724 | |||
| 1162 | Ga0070663_100964733 | |||
| 1163 | Ga0070678_100040699 | |||
| 1164 | Ga0070678_100535509 | |||
| 1165 | Ga0070678_100606293 | |||
| 1166 | Ga0070662_100110702 | |||
| 1167 | Ga0070662_100519159 | |||
| 1168 | Ga0070662_100739241 | |||
| 1169 | Ga0070662_101201486 | |||
| 1170 | Ga0070681_10162608 | |||
| 1171 | Ga0070681_10283388 | |||
| 1172 | Ga0070681_11791715 | |||
| 1173 | Ga0070681_11898178 | |||
| 1174 | Ga0070699_101423785 | |||
| 1175 | Ga0070679_100114331 | |||
| 1176 | Ga0070679_100295738 | |||
| 1177 | Ga0070679_100341310 | |||
| 1178 | Ga0070679_101125354 | |||
| 1179 | Ga0070684_100005044 | |||
| 1180 | Ga0070684_100009975 | |||
| 1181 | Ga0070684_100045272 | |||
| 1182 | Ga0070684_100068678 | |||
| 1183 | Ga0070684_100302077 | |||
| 1184 | Ga0070684_100443923 | |||
| 1185 | Ga0070684_101030200 | |||
| 1186 | Ga0070684_101161614 | |||
| 1187 | Ga0070684_101231612 | |||
| 1188 | Ga0070697_101208693 | |||
| 1189 | Ga0068853_100004408 | |||
| 1190 | Ga0068853_100086640 | |||
| 1191 | Ga0068853_100361598 | |||
| 1192 | Ga0068853_100580555 | |||
| 1193 | Ga0068853_100580559 | |||
| 1194 | Ga0068853_100601920 | |||
| 1195 | Ga0068853_100854725 | |||
| 1196 | Ga0068853_101012872 | |||
| 1197 | Ga0070672_100249449 | |||
| 1198 | Ga0070672_100995651 | |||
| 1199 | Ga0070686_100291808 | |||
| 1200 | Ga0070695_100115075 | |||
| 1201 | Ga0070696_100217754 | |||
| 1202 | Ga0070693_100157191 | |||
| 1203 | Ga0070693_100312179 | |||
| 1204 | Ga0070693_100693293 | |||
| 1205 | Ga0070665_100018614 | |||
| 1206 | Ga0070665_100131058 | |||
| 1207 | Ga0070665_100504238 | |||
| 1208 | Ga0070665_100776803 | |||
| 1209 | Ga0070704_101075533 | |||
| 1210 | Ga0070704_101098455 | |||
| 1211 | Ga0068855_100050152 | |||
| 1212 | Ga0068855_100171291 | |||
| 1213 | Ga0068855_100307111 | |||
| 1214 | Ga0068855_100359014 | |||
| 1215 | Ga0068855_100887410 | |||
| 1216 | Ga0068855_101107198 | |||
| 1217 | Ga0068855_101360645 | |||
| 1218 | Ga0070664_100027907 | |||
| 1219 | Ga0070664_100053668 | |||
| 1220 | Ga0070664_100488130 | |||
| 1221 | Ga0070664_101125819 | |||
| 1222 | Ga0070664_101690591 | |||
| 1223 | Ga0068857_100013385 | |||
| 1224 | Ga0068857_100058466 | |||
| 1225 | Ga0068857_100207786 | |||
| 1226 | Ga0068857_100390798 | |||
| 1227 | Ga0068854_100048949 | |||
| 1228 | Ga0068854_100242493 | |||
| 1229 | Ga0068854_100444340 | |||
| 1230 | Ga0068854_100885052 | |||
| 1231 | Ga0068856_100001827 | |||
| 1232 | Ga0068856_102718613 | |||
| 1233 | Ga0070702_100156002 | |||
| 1234 | Ga0070702_100871138 | |||
| 1235 | Ga0068852_100004020 | |||
| 1236 | Ga0068852_100108729 | |||
| 1237 | Ga0068852_100166147 | |||
| 1238 | Ga0068852_100289432 | |||
| 1239 | Ga0068852_100591767 | |||
| 1240 | Ga0068852_100696180 | |||
| 1241 | Ga0068859_101145460 | |||
| 1242 | Ga0068864_100041284 | |||
| 1243 | Ga0068864_100297936 | |||
| 1244 | Ga0068864_100592035 | |||
| 1245 | Ga0068864_100888355 | |||
| 1246 | Ga0068861_101105632 | |||
| 1247 | Ga0068851_10017775 | |||
| 1248 | Ga0068851_10312626 | |||
| 1249 | Ga0068851_10414376 | |||
| 1250 | Ga0068870_10995021 | |||
| 1251 | Ga0068870_11207383 | |||
| 1252 | Ga0068863_100277064 | |||
| 1253 | Ga0068863_102298561 | |||
| 1254 | Ga0068858_100057389 | |||
| 1255 | Ga0068858_100326322 | |||
| 1256 | Ga0068858_100397487 | |||
| 1257 | Ga0068858_101048822 | |||
| 1258 | Ga0068860_100042819 | |||
| 1259 | Ga0068862_100122818 | |||
| 1260 | Ga0068862_100425031 | |||
| 1261 | Ga0081455_10084362 | |||
| 1262 | Ga0081455_10132931 | |||
| 1263 | Ga0081455_10415908 | |||
| 1264 | Ga0081540_1003965 | |||
| 1265 | Ga0081540_1011917 | |||
| 1266 | Ga0081540_1074698 | |||
| 1267 | Ga0081539_10000768 | |||
| 1268 | Ga0070717_10005371 | |||
| 1269 | Ga0070717_10069469 | |||
| 1270 | Ga0070717_10154553 | |||
| 1271 | Ga0070717_10561571 | |||
| 1272 | Ga0070717_10815878 | |||
| 1273 | Ga0075365_10113065 | |||
| 1274 | Ga0075365_10350492 | |||
| 1275 | Ga0075365_10562563 | |||
| 1276 | Ga0075368_10035368 | |||
| 1277 | Ga0075368_10042937 | |||
| 1278 | Ga0075363_100006965 | |||
| 1279 | Ga0075364_10380618 | |||
| 1280 | Ga0070715_10455847 | |||
| 1281 | Ga0070715_10536610 | |||
| 1282 | Ga0070716_100233210 | |||
| 1283 | Ga0070712_100015666 | |||
| 1284 | Ga0070712_100044059 | |||
| 1285 | Ga0075362_10163874 | |||
| 1286 | Ga0075362_10524691 | |||
| 1287 | Ga0075362_10616432 | |||
| 1288 | Ga0075367_10189439 | |||
| 1289 | Ga0075367_10277080 | |||
| 1290 | Ga0075366_10733558 | |||
| 1291 | Ga0097621_100145191 | |||
| 1292 | Ga0097621_101154246 | |||
| 1293 | Ga0068871_100678306 | |||
| 1294 | Ga0068871_101397924 | |||
| 1295 | Ga0075428_100217647 | |||
| 1296 | Ga0068865_100040328 | |||
| 1297 | Ga0068865_100874852 | |||
| 1298 | Ga0097620_101145447 | |||
| 1299 | Ga0075435_100614950 | |||
| 1300 | Ga0099794_10018637 | |||
| 1301 | Ga0099794_10019320 | |||
| 1302 | Ga0099795_10040570 | |||
| 1303 | Ga0099795_10141039 | |||
| 1304 | Ga0099795_10361362 | |||
| 1305 | Ga0099795_10628902 | |||
| 1306 | Ga0105250_10186821 | |||
| 1307 | Ga0105250_10411882 | |||
| 1308 | Ga0105240_10026622 | |||
| 1309 | Ga0105240_10086468 | |||
| 1310 | Ga0105240_10537480 | |||
| 1311 | Ga0105240_10925157 | |||
| 1312 | Ga0111539_10186854 | |||
| 1313 | Ga0111539_11026242 | |||
| 1314 | Ga0111539_11874921 | |||
| 1315 | Ga0105245_10116668 | |||
| 1316 | Ga0105245_11752594 | |||
| 1317 | Ga0105245_12060721 | |||
| 1318 | Ga0105247_10008197 | |||
| 1319 | Ga0105247_10150019 | |||
| 1320 | Ga0105247_10391425 | |||
| 1321 | Ga0105247_10403496 | |||
| 1322 | Ga0105247_10945342 | |||
| 1323 | Ga0105243_10704136 | |||
| 1324 | Ga0105243_11324995 | |||
| 1325 | Ga0105241_10030969 | |||
| 1326 | Ga0105241_10212572 | |||
| 1327 | Ga0105241_10474026 | |||
| 1328 | Ga0105241_11379898 | |||
| 1329 | Ga0105241_11577923 | |||
| 1330 | Ga0105242_11133330 | |||
| 1331 | Ga0105242_11523098 | |||
| 1332 | Ga0105248_10500250 | |||
| 1333 | Ga0105248_10807178 | |||
| 1334 | Ga0105248_10807534 | |||
| 1335 | Ga0105248_11691992 | |||
| 1336 | Ga0105248_12896797 | |||
| 1337 | Ga0105237_10012336 | |||
| 1338 | Ga0105237_10024997 | |||
| 1339 | Ga0105237_10092495 | |||
| 1340 | Ga0105237_10131109 | |||
| 1341 | Ga0105237_10144523 | |||
| 1342 | Ga0105237_10200817 | |||
| 1343 | Ga0105237_10993859 | |||
| 1344 | Ga0105237_11120665 | |||
| 1345 | Ga0105237_11614514 | |||
| 1346 | Ga0105238_10015861 | |||
| 1347 | Ga0105238_10083037 | |||
| 1348 | Ga0105238_10127951 | |||
| 1349 | Ga0105238_10370193 | |||
| 1350 | Ga0105238_10395243 | |||
| 1351 | Ga0105238_10466447 | |||
| 1352 | Ga0105238_11288960 | |||
| 1353 | Ga0105249_10957201 | |||
| 1354 | Ga0105249_11582850 | |||
| 1355 | Ga0099796_10026459 | |||
| 1356 | Ga0099796_10043461 | |||
| 1357 | Ga0099796_10070564 | |||
| 1358 | Ga0099796_10084914 | |||
| 1359 | Ga0099796_10459921 | |||
| 1360 | Ga0105239_10017391 | |||
| 1361 | Ga0105239_10245943 | |||
| 1362 | Ga0105239_10612226 | |||
| 1363 | Ga0105239_10817327 | |||
| 1364 | Ga0105239_10880928 | |||
| 1365 | Ga0105239_11181005 | |||
| 1366 | Ga0105239_11450910 | |||
| 1367 | Ga0105239_11838203 | |||
| 1368 | Ga0105239_12166407 | |||
| 1369 | Ga0105239_12984047 | |||
| 1370 | Ga0105246_10031772 | |||
| 1371 | Ga0105246_10863549 | |||
| 1372 | Ga0157373_10187825 | |||
| 1373 | Ga0157373_10948929 | |||
| 1374 | Ga0157370_10027113 | |||
| 1375 | Ga0157370_10519389 | |||
| 1376 | Ga0157369_10012270 | |||
| 1377 | Ga0157369_10015050 | |||
| 1378 | Ga0157369_10021463 | |||
| 1379 | Ga0157369_10112059 | |||
| 1380 | Ga0157369_10720460 | |||
| 1381 | Ga0157374_10147112 | |||
| 1382 | Ga0157374_10183023 | |||
| 1383 | Ga0157374_10886989 | |||
| 1384 | Ga0157374_11457659 | |||
| 1385 | Ga0157374_11854686 | |||
| 1386 | Ga0157378_10199759 | |||
| 1387 | Ga0157378_10602544 | |||
| 1388 | Ga0163162_10171087 | |||
| 1389 | Ga0163162_10230559 | |||
| 1390 | Ga0163162_10576398 | |||
| 1391 | Ga0163162_10745514 | |||
| 1392 | Ga0163162_10861808 | |||
| 1393 | Ga0163162_11536763 | |||
| 1394 | Ga0157372_10031114 | |||
| 1395 | Ga0157372_10095637 | |||
| 1396 | Ga0157372_11751498 | |||
| 1397 | Ga0157372_12979891 | |||
| 1398 | Ga0157375_10045421 | |||
| 1399 | Ga0157375_10916659 | |||
| 1400 | Ga0163163_10027218 | |||
| 1401 | Ga0163163_10265592 | |||
| 1402 | Ga0157380_10481792 | |||
| 1403 | Ga0157377_10272694 | |||
| 1404 | Ga0157379_10201824 | |||
| 1405 | Ga0157379_11135447 | |||
| 1406 | Ga0157376_10040939 | |||
| 1407 | Ga0157376_11372840 | |||
| 1408 | Ga0157376_12506392 | |||
| 1409 | Ga0182007_10261175 | |||
| 1410 | Ga0163161_11033667 | |||
| 1411 | Ga0197907_10712594 | |||
| 1412 | Ga0206356_11290348 | |||
| 1413 | Ga0206350_11263414 | |||
| 1414 | Ga0206354_10653258 | |||
| 1415 | Ga0206353_10545694 | |||
| 1416 | Ga0213874_10038814 | |||
| 1417 | Ga0213874_10270554 | |||
| 1418 | Ga0213876_10029487 | |||
| 1419 | Ga0224712_10016094 | |||
| 1420 | Ga0209758_1002115 | |||
| 1421 | Ga0209758_1019290 | |||
| 1422 | Ga0209758_1115351 | |||
| 1423 | Ga0207697_10034140 | |||
| 1424 | Ga0207656_10032000 | |||
| 1425 | Ga0207656_10273268 | |||
| 1426 | Ga0207692_10011728 | |||
| 1427 | Ga0207692_10012280 | |||
| 1428 | Ga0207692_10429904 | |||
| 1429 | Ga0207692_11070041 | |||
| 1430 | Ga0207642_10568559 | |||
| 1431 | Ga0207710_10037351 | |||
| 1432 | Ga0207710_10194816 | |||
| 1433 | Ga0207688_10115386 | |||
| 1434 | Ga0207688_10951157 | |||
| 1435 | Ga0207680_10259313 | |||
| 1436 | Ga0207680_10428471 | |||
| 1437 | Ga0207647_10102686 | |||
| 1438 | Ga0207685_10139022 | |||
| 1439 | Ga0207685_10173484 | |||
| 1440 | Ga0207699_10141546 | |||
| 1441 | Ga0207645_10241383 | |||
| 1442 | Ga0207645_10658039 | |||
| 1443 | Ga0207643_10273399 | |||
| 1444 | Ga0207643_10283143 | |||
| 1445 | Ga0207705_10035276 | |||
| 1446 | Ga0207705_10045560 | |||
| 1447 | Ga0207705_10532020 | |||
| 1448 | Ga0207705_11146464 | |||
| 1449 | Ga0207705_11223551 | |||
| 1450 | Ga0207684_10102347 | |||
| 1451 | Ga0207654_10193490 | |||
| 1452 | Ga0207654_11445791 | |||
| 1453 | Ga0207707_10002705 | |||
| 1454 | Ga0207707_10042184 | |||
| 1455 | Ga0207707_10100018 | |||
| 1456 | Ga0207707_10531375 | |||
| 1457 | Ga0207707_10843833 | |||
| 1458 | Ga0207695_10033862 | |||
| 1459 | Ga0207695_10083368 | |||
| 1460 | Ga0207695_10151312 | |||
| 1461 | Ga0207671_10009638 | |||
| 1462 | Ga0207671_10171502 | |||
| 1463 | Ga0207671_10214178 | |||
| 1464 | Ga0207671_10223013 | |||
| 1465 | Ga0207671_10418239 | |||
| 1466 | Ga0207671_10422485 | |||
| 1467 | Ga0207671_10541477 | |||
| 1468 | Ga0207693_10006974 | |||
| 1469 | Ga0207693_10015344 | |||
| 1470 | Ga0207693_10053164 | |||
| 1471 | Ga0207693_10089056 | |||
| 1472 | Ga0207693_10516823 | |||
| 1473 | Ga0207693_11413654 | |||
| 1474 | Ga0207663_10010915 | |||
| 1475 | Ga0207663_10234599 | |||
| 1476 | Ga0207663_10471098 | |||
| 1477 | Ga0207660_10006961 | |||
| 1478 | Ga0207660_10088845 | |||
| 1479 | Ga0207660_10164737 | |||
| 1480 | Ga0207660_10275300 | |||
| 1481 | Ga0207660_10815243 | |||
| 1482 | Ga0207660_11376051 | |||
| 1483 | Ga0207657_10006890 | |||
| 1484 | Ga0207657_10076308 | |||
| 1485 | Ga0207657_10594835 | |||
| 1486 | Ga0207649_10057477 | |||
| 1487 | Ga0207649_10076980 | |||
| 1488 | Ga0207649_10324150 | |||
| 1489 | Ga0207649_10504592 | |||
| 1490 | Ga0207652_10001690 | |||
| 1491 | Ga0207652_10093203 | |||
| 1492 | Ga0207652_10335996 | |||
| 1493 | Ga0207652_10936261 | |||
| 1494 | Ga0207652_11174910 | |||
| 1495 | Ga0207652_11541564 | |||
| 1496 | Ga0207694_10005031 | |||
| 1497 | Ga0207694_10145272 | |||
| 1498 | Ga0207694_10192192 | |||
| 1499 | Ga0207694_10364382 | |||
| 1500 | Ga0207694_11629557 | |||
| 1501 | Ga0207659_10228888 | |||
| 1502 | Ga0207687_10029083 | |||
| 1503 | Ga0207687_11329433 | |||
| 1504 | Ga0207700_10028440 | |||
| 1505 | Ga0207700_10054396 | |||
| 1506 | Ga0207700_10109223 | |||
| 1507 | Ga0207700_11959361 | |||
| 1508 | Ga0207664_10214537 | |||
| 1509 | Ga0207664_10851240 | |||
| 1510 | Ga0207664_11368807 | |||
| 1511 | Ga0207664_11673240 | |||
| 1512 | Ga0207644_10506649 | |||
| 1513 | Ga0207644_10518186 | |||
| 1514 | Ga0207644_10600031 | |||
| 1515 | Ga0207644_11046256 | |||
| 1516 | Ga0207690_10260732 | |||
| 1517 | Ga0207690_10744697 | |||
| 1518 | Ga0207690_10770258 | |||
| 1519 | Ga0207706_10076843 | |||
| 1520 | Ga0207706_10586039 | |||
| 1521 | Ga0207706_11053629 | |||
| 1522 | Ga0207709_10581042 | |||
| 1523 | Ga0207670_10726134 | |||
| 1524 | Ga0207704_10475643 | |||
| 1525 | Ga0207704_11383962 | |||
| 1526 | Ga0207665_10088683 | |||
| 1527 | Ga0207665_10440126 | |||
| 1528 | Ga0207665_11447884 | |||
| 1529 | Ga0207691_10183269 | |||
| 1530 | Ga0207711_10214403 | |||
| 1531 | Ga0207711_10654839 | |||
| 1532 | Ga0207689_10030366 | |||
| 1533 | Ga0207661_10001270 | |||
| 1534 | Ga0207661_10008424 | |||
| 1535 | Ga0207661_10011867 | |||
| 1536 | Ga0207661_10073538 | |||
| 1537 | Ga0207679_10376144 | |||
| 1538 | Ga0207679_11052775 | |||
| 1539 | Ga0207667_10002017 | |||
| 1540 | Ga0207667_10102212 | |||
| 1541 | Ga0207667_10387555 | |||
| 1542 | Ga0207667_10403121 | |||
| 1543 | Ga0207667_10440183 | |||
| 1544 | Ga0207667_10482275 | |||
| 1545 | Ga0207667_11332969 | |||
| 1546 | Ga0207712_11227509 | |||
| 1547 | Ga0207668_10563465 | |||
| 1548 | Ga0207640_10039851 | |||
| 1549 | Ga0207640_10794257 | |||
| 1550 | Ga0207640_10975755 | |||
| 1551 | Ga0207640_11030283 | |||
| 1552 | Ga0207677_10014286 | |||
| 1553 | Ga0207677_11168970 | |||
| 1554 | Ga0207703_10197880 | |||
| 1555 | Ga0207703_11155289 | |||
| 1556 | Ga0207703_11275229 | |||
| 1557 | Ga0207703_11695396 | |||
| 1558 | Ga0207703_11740849 | |||
| 1559 | Ga0207639_10014358 | |||
| 1560 | Ga0207639_10328105 | |||
| 1561 | Ga0207639_10390942 | |||
| 1562 | Ga0207639_10519060 | |||
| 1563 | Ga0207639_10578631 | |||
| 1564 | Ga0207639_10747080 | |||
| 1565 | Ga0207678_10124779 | |||
| 1566 | Ga0207678_10137792 | |||
| 1567 | Ga0207678_10150582 | |||
| 1568 | Ga0207678_10202505 | |||
| 1569 | Ga0207678_10538758 | |||
| 1570 | Ga0207678_10737853 | |||
| 1571 | Ga0207708_10442900 | |||
| 1572 | Ga0207708_11236311 | |||
| 1573 | Ga0207702_10002952 | |||
| 1574 | Ga0207702_10605469 | |||
| 1575 | Ga0207641_10217974 | |||
| 1576 | Ga0207648_10338010 | |||
| 1577 | Ga0207676_10035357 | |||
| 1578 | Ga0207676_10199636 | |||
| 1579 | Ga0207676_10387048 | |||
| 1580 | Ga0207676_10487769 | |||
| 1581 | Ga0207674_10004033 | |||
| 1582 | Ga0207674_10071396 | |||
| 1583 | Ga0207674_10077740 | |||
| 1584 | Ga0207674_10246534 | |||
| 1585 | Ga0207674_10358894 | |||
| 1586 | Ga0207674_12084368 | |||
| 1587 | Ga0207675_100812006 | |||
| 1588 | Ga0207675_101317696 | |||
| 1589 | Ga0207683_10088795 | |||
| 1590 | Ga0207683_10090100 | |||
| 1591 | Ga0207683_10389035 | |||
| 1592 | Ga0207683_10651391 | |||
| 1593 | Ga0207698_10044765 | |||
| 1594 | Ga0207698_10259247 | |||
| 1595 | Ga0207698_10386117 | |||
| 1596 | Ga0207698_11052973 | |||
| 1597 | Ga0207698_11712806 | |||
| 1598 | Ga0207698_12444367 | |||
| 1599 | Ga0209179_1042023 | |||
| 1600 | Ga0209179_1129216 | |||
| 1601 | Ga0209588_1006547 | |||
| 1602 | Ga0209588_1040603 | |||
| 1603 | Ga0209813_10243410 | |||
| 1604 | Ga0268266_10008590 | |||
| 1605 | Ga0268266_10128940 | |||
| 1606 | Ga0268266_10349992 | |||
| 1607 | Ga0268266_10915679 | |||
| 1608 | Ga0268265_10027526 | |||
| 1609 | Ga0268265_10335258 | |||
| 1610 | Ga0268264_10452981 | |||
| 1611 | Ga0268264_10971755 | |||
| 1612 | Ga0268264_11529703 | |||
| 1613 | Ga0307515_10241059 | |||
| 1614 | Ga0307511_10047546 | |||
| 1615 | Ga0307512_10192333 | |||
| 1616 | Ga0265760_10149300 | |||
| 1617 | Ga0265330_10023492 | |||
| 1618 | Ga0265328_10132365 | |||
| 1619 | Ga0265339_10005842 | |||
| 1620 | Ga0265339_10008162 | |||
| 1621 | Ga0265339_10150589 | |||
| 1622 | Ga0265339_10176586 | |||
| 1623 | Ga0265339_10412572 | |||
| 1624 | Ga0307513_10305659 | |||
| 1625 | Ga0307509_10005537 | |||
| 1626 | Ga0307509_10132925 | |||
| 1627 | Ga0307509_10304889 | |||
| 1628 | Ga0307509_10357405 | |||
| 1629 | Ga0307509_10738798 | |||
| 1630 | Ga0265314_10002560 | |||
| 1631 | Ga0265314_10002580 | |||
| 1632 | Ga0265314_10199945 | |||
| 1633 | Ga0265342_10012472 | |||
| 1634 | Ga0265342_10587954 | |||
| 1635 | Ga0307516_10005934 | |||
| 1636 | Ga0307405_10578236 | |||
| 1637 | Ga0307518_10493758 | |||
| 1638 | Ga0307409_100887182 | |||
| 1639 | Ga0307411_11882123 | |||
| 1640 | Ga0307507_10270480 | |||
| 1641 | Ga0307510_10030948 | |||
| 1642 | Ga0307510_10031256 | |||
| 1643 | Ga0373926_0032900 | |||
| 1644 | Ga0373926_0154829 | |||
| 1645 | Ga0373934_0058878 | |||
| 1646 | Ga0373934_0163243 | |||
| 1647 | Ga0373944_0041167 | |||
| 1648 | Ga0373952_0291527 | |||
| 1649 | Ga0373923_0115809 | |||
| 1650 | Ga0373923_0128885 | |||
| 1651 | Ga0373923_0269878 | |||
| 1652 | Ga0373936_0019111 | |||
| 1653 | Ga0373936_0030777 | |||
| 1654 | Ga0373936_0053539 | |||
| 1655 | Ga0373936_0388387 | |||
| 1656 | Ga0373936_0405655 | |||
| 1657 | Ga0373939_0022265 | |||
| 1658 | Ga0373945_0003772 | |||
| 1659 | Ga0373953_0011105 | |||
| 1660 | Ga0373953_0141308 | |||
| 1661 | Ga0373953_0227725 | |||
| 1662 | Ga0373954_0047752 | |||
| 1663 | Ga0373954_0066378 | |||
| 1664 | Ga0373954_0090304 | |||
| 1665 | Ga0373954_0358460 | |||
| 1666 | Ga0373956_0060324 | |||
| 1667 | Ga0373956_0187648 | |||
| 1668 | Ga0373956_0432386 | |||
| 1669 | Ga0373957_0002349 | |||
| 1670 | Ga0373957_0040122 | |||
| 1671 | Ga0373957_0159100 | |||
| 1672 | Ga0373943_0013488 | |||
| 1673 | Ga0373943_0024845 | |||
| 1674 | Ga0373943_0950217 | |||
| 1675 | Ga0373943_0979944 | |||
| 1676 | Ga0373946_0009587 | |||
| 1677 | Ga0373946_0075340 | |||
| 1678 | Ga0373946_0170766 | |||
| 1679 | Ga0373955_0010472 | |||
| 1680 | Ga0373955_0012443 | |||
| 1681 | Ga0373955_0026973 | |||
| 1682 | Ga0373955_0827524 | |||
| 1683 | Ga0373924_0015854 | |||
| 1684 | Ga0373924_0079381 | |||
| 1685 | Ga0373924_0095586 | |||
| 1686 | Ga0373931_0055410 | |||
| 1687 | Ga0373931_0424639 | |||
| 1688 | Ga0373931_0476533 | |||
| 1689 | Ga0373935_0003875 | |||
| 1690 | Ga0373935_0409769 | |||
| 1691 | Ga0373935_0521569 | |||
| 1692 | Ga0373935_0537128 | |||
| 1693 | Ga0373927_0002882 | |||
| 1694 | Ga0373927_0008495 | |||
| 1695 | Ga0373927_0018156 | |||
| 1696 | Ga0373927_0043935 | |||
| 1697 | Ga0373933_0010030 | |||
| 1698 | Ga0373933_0054994 | |||
| 1699 | Ga0373933_0223527 | |||
| 1700 | Ga0373933_0429271 | |||
| 1701 | Ga0373947_0009316 | |||
| 1702 | Ga0373947_0014881 | |||
| 1703 | Ga0373947_0142854 | |||
| 1704 | Ga0373947_0404391 | |||
| 1705 | Ga0373937_0056024 | |||
| 1706 | Ga0373937_0135731 | |||
| 1707 | Ga0373937_0148861 | |||
| 1708 | Ga0373937_1838811 | |||
| 1709 | Ga0372808_029125 | |||
| 1710 | Ga0373925_0058113 | |||
| 1711 | Ga0373925_0071053 | |||
| 1712 | Ga0373925_0323486 | |||
| 1713 | Ga0373925_0348749 | |||
| 1714 | Ga0373925_0582639 | |||
| 1715 | Ga0373925_1269077 | |||
| 1716 | Ga0395899_0245006 | |||
| 1717 | Ga0395899_0317672 | |||
| 1718 | Ga0395900_0345701 | |||
| 1719 | Ga0395898_0015307 | |||
| 1720 | Ga0395898_0031629 | |||
| 1721 | Ga0395898_0056746 | |||
| 1722 | Ga0395898_0513499 | |||
| 1723 | Ga0395898_0596788 | |||
| 1724 | Ga0395905_0975062 | |||
| 1725 | Ga0395905_1390659 | |||
| 1726 | Ga0436364_0842784 | |||
| 1727 | Ga0395901_0099375 | |||
| 1728 | Ga0395901_0922324 | |||
| 1729 | Ga0436365_0485246 | |||
| 1730 | Ga0436365_0815616 | |||
| 1731 | Ga0436365_1381894 | |||
| 1732 | Ga0436365_1719439 | |||
| 1733 | Ga0436360_0000691 | |||
| 1734 | Ga0436360_0491169 | |||
| 1735 | Ga0436361_0000349 | |||
| 1736 | Ga0436363_0091919 | |||
| 1737 | Ga0436363_1385019 | |||
| 1738 | Ga0436363_1695624 | |||
| 1739 | Ga0439465_0012995 | |||
| 1740 | Ga0451791_1084933 | |||
| 1741 | Ga0451793_0178294 | |||
| 1742 | Ga0451797_0381516 | |||
| 1743 | Ga0451802_1946777 | |||
| 1744 | Ga0451839_1301463 | |||
| 1745 | Ga0451847_0886397 | |||
| 1746 | Ga0451849_0839640 | |||
| 1747 | Ga0451849_1239105 | |||
| 1748 | Ga0451853_0198280 | |||
| 1749 | Ga0451853_1211587 | |||
| 1750 | Ga0451853_1882543 | |||
| 1751 | Ga0439458_0198048 | |||
| 1752 | Ga0439459_0222924 | |||
| 1753 | Ga0466961_0391135 | |||
| 1754 | Ga0466963_0586472 | |||
| 1755 | Ga0466964_0323770 | |||
| 1756 | Ga0466968_0225552 | |||
| 1757 | Ga0466968_0285790 | |||
| 1758 | Ga0466970_0076381 | |||
| 1759 | Ga0466957_0139776 | |||
| 1760 | Ga0466957_0209559 | |||
| 1761 | Ga0466957_0741460 | |||
| 1762 | Ga0466959_0163644 | |||
| 1763 | Ga0466967_0738236 | |||
| 1764 | Ga0466967_1136904 | |||
| 1765 | Ga0466967_2529064 | |||
| 1766 | Ga0495592_0004098 | |||
| 1767 | Ga0495592_0132648 | |||
| 1768 | Ga0495603_0000217 | |||
| 1769 | Ga0495603_0009199 | |||
| 1770 | Ga0495603_0087530 | |||
| 1771 | Ga0495603_0103380 | |||
| 1772 | Ga0495603_0358235 | |||
| 1773 | Ga0495603_0494681 | |||
| 1774 | Ga0495590_0129903 | |||
| 1775 | Ga0495590_0327074 | |||
| 1776 | Ga0495591_107288 | |||
| 1777 | Ga0495629_0000862 | |||
| 1778 | Ga0495629_0021708 | |||
| 1779 | Ga0495629_0030060 | |||
| 1780 | Ga0495629_0065650 | |||
| 1781 | Ga0495629_0099483 | |||
| 1782 | Ga0495629_0229147 | |||
| 1783 | Ga0495629_0383333 | |||
| 1784 | Ga0495629_0555661 | |||
| 1785 | Ga0495638_0580026 | |||
| 1786 | Ga0495641_0003672 | |||
| 1787 | Ga0495641_0032216 | |||
| 1788 | Ga0495641_0192158 | |||
| 1789 | Ga0495651_0100456 | |||
| 1790 | Ga0495651_0296304 | |||
| 1791 | Ga0495651_0308322 | |||
| 1792 | Ga0495651_0779218 | |||
| 1793 | Ga0495653_0033474 | |||
| 1794 | Ga0495653_0229476 | |||
| 1795 | Ga0495650_0160075 | |||
| 1796 | Ga0495580_0005364 | |||
| 1797 | Ga0495580_0006588 | |||
| 1798 | Ga0495580_0397632 | |||
| 1799 | Ga0495582_0000990 | |||
| 1800 | Ga0495582_0023883 | |||
| 1801 | Ga0495582_0144056 | |||
| 1802 | Ga0495582_0266219 | |||
| 1803 | Ga0495639_0000544 | |||
| 1804 | Ga0495639_0017690 | |||
| 1805 | Ga0495639_0283025 | |||
| 1806 | Ga0495662_0001589 | |||
| 1807 | Ga0495662_0057004 | |||
| 1808 | Ga0495664_0001505 | |||
| 1809 | Ga0495664_0047310 | |||
| 1810 | Ga0495664_0122382 | |||
| 1811 | Ga0495664_0136551 | |||
| 1812 | Ga0495584_0156167 | |||
| 1813 | Ga0495585_0048859 | |||
| 1814 | Ga0495594_0000128 | |||
| 1815 | Ga0495594_0067579 | |||
| 1816 | Ga0495594_0240001 | |||
| 1817 | Ga0495607_0228292 | |||
| 1818 | Ga0495607_0377907 | |||
| 1819 | Ga0495583_0112024 | |||
| 1820 | Ga0495606_0001136 | |||
| 1821 | Ga0495606_0125530 | |||
| 1822 | Ga0495608_0026451 | |||
| 1823 | Ga0495608_0048299 | |||
| 1824 | Ga0495608_0249635 | |||
| 1825 | Ga0495610_0236140 | |||
| 1826 | Ga0495616_0041706 | |||
| 1827 | Ga0495616_0109549 | |||
| 1828 | Ga0495618_0028500 | |||
| 1829 | Ga0495618_0035913 | |||
| 1830 | Ga0495618_0148252 | |||
| 1831 | Ga0495618_0219935 | |||
| 1832 | Ga0495620_0019752 | |||
| 1833 | Ga0495628_0017576 | |||
| 1834 | Ga0495628_0024999 | |||
| 1835 | Ga0495628_0633738 | |||
| 1836 | Ga0495630_0022061 | |||
| 1837 | Ga0495630_0036462 | |||
| 1838 | Ga0495630_0375847 | |||
| 1839 | Ga0495632_0240984 | |||
| 1840 | Ga0495632_0338211 | |||
| 1841 | Ga0495643_0125140 | |||
| 1842 | Ga0495644_0062010 | |||
| 1843 | Ga0495642_0152020 | |||
| 1844 | Ga0495652_0016896 | |||
| 1845 | Ga0495652_0052716 | |||
| 1846 | Ga0495652_0111869 | |||
| 1847 | Ga0495652_0118695 | |||
| 1848 | Ga0495652_0259563 | |||
| 1849 | Ga0495652_0311456 | |||
| 1850 | Ga0495665_0001468 | |||
| 1851 | Ga0495665_0055108 | |||
| 1852 | Ga0495640_0002595 | |||
| 1853 | Ga0495640_0012990 | |||
| 1854 | Ga0495640_0022149 | |||
| 1855 | Ga0495640_0027356 | |||
| 1856 | Ga0495586_0016197 | |||
| 1857 | Ga0495587_0046121 | |||
| 1858 | Ga0495587_0064108 | |||
| 1859 | Ga0495609_0132842 | |||
| 1860 | Ga0495597_0393321 | |||
| 1861 | Ga0495645_0067766 | |||
| 1862 | Ga0495645_0265959 | |||
| 1863 | Ga0495645_0557931 | |||
| 1864 | Ga0495645_0736725 | |||
| 1865 | Ga0495622_0038006 | |||
| 1866 | Ga0495622_0081756 | |||
| 1867 | Ga0495622_0150336 | |||
| 1868 | Ga0495622_0245599 | |||
| 1869 | Ga0495667_0029236 | |||
| 1870 | Ga0495667_0116310 | |||
| 1871 | Ga0495667_0142621 | |||
| 1872 | Ga0495667_0346940 | |||
| 1873 | Ga0495667_0376648 | |||
| 1874 | Ga0495656_0110860 | |||
| 1875 | Ga0495656_0256351 | |||
| 1876 | Ga0495668_0077203 | |||
| 1877 | Ga0495668_0119718 | |||
| 1878 | Ga0495634_0001583 | |||
| 1879 | Ga0495634_0211708 | |||
| 1880 | Ga0495611_0118059 | |||
| 1881 | Ga0495625_0114234 | |||
| 1882 | Ga0495625_0817519 | |||
| 1883 | Ga0495635_0000436 | |||
| 1884 | Ga0495635_0069118 | |||
| 1885 | Ga0495635_0633453 | |||
| 1886 | Ga0495635_1012453 | |||
| 1887 | Ga0495659_0263884 | |||
| 1888 | Ga0495588_0023745 | |||
| 1889 | Ga0495588_0472957 | |||
| 1890 | Ga0495657_0027114 | |||
| 1891 | Ga0495657_0083501 | |||
| 1892 | Ga0495657_0204306 | |||
| 1893 | Ga0495657_0498528 | |||
| 1894 | Ga0495599_0050869 | |||
| 1895 | Ga0495599_0079908 | |||
| 1896 | Ga0495599_0091761 | |||
| 1897 | Ga0495599_0112584 | |||
| 1898 | Ga0495623_0026222 | |||
| 1899 | Ga0495623_0030664 | |||
| 1900 | Ga0495623_0053435 | |||
| 1901 | Ga0495623_0273707 | |||
| 1902 | Ga0495646_0014377 | |||
| 1903 | Ga0495646_0016885 | |||
| 1904 | Ga0495646_0201883 | |||
| 1905 | Ga0495646_0306763 | |||
| 1906 | Ga0495647_0000394 | |||
| 1907 | Ga0495647_0088297 | |||
| 1908 | Ga0495658_0005609 | |||
| 1909 | Ga0495658_0018051 | |||
| 1910 | Ga0495658_0143713 | |||
| 1911 | Ga0495669_0162091 | |||
| 1912 | Ga0495613_0021731 | |||
| 1913 | Ga0495613_0112154 | |||
| 1914 | Ga0495613_0150274 | |||
| 1915 | Ga0495613_0497969 | |||
| 1916 | Ga0495624_0006861 | |||
| 1917 | Ga0495670_0259728 | |||
| 1918 | Ga0495670_0634054 | |||
| 1919 | Ga0495671_0042266 | |||
| 1920 | Ga0495589_0048523 | |||
| 1921 | Ga0495589_0110118 | |||
| 1922 | Ga0495600_0051952 | |||
| 1923 | Ga0495600_0102374 | |||
| 1924 | Ga0495600_0272024 | |||
| 1925 | Ga0495600_0343852 | |||
| 1926 | Ga0495660_0213219 | |||
| 1927 | Ga0495581_0000293 | |||
| 1928 | Ga0495581_0053239 | |||
| 1929 | Ga0495581_0182137 | |||
| 1930 | Ga0495604_0090372 | |||
| 1931 | Ga0495604_0158741 | |||
| 1932 | Ga0495604_0197566 | |||
| 1933 | Ga0495674_0008903 | |||
| 1934 | Ga0495674_0053630 | |||
| 1935 | Ga0495674_0460682 | |||
| 1936 | Ga0495674_0635997 | |||
| 1937 | Ga0495674_0804026 | |||
| 1938 | Ga0495672_0323547 | |||
| 1939 | Ga0495676_0074450 | |||
| 1940 | Ga0495676_0080429 | |||
| 1941 | Ga0495676_0137243 | |||
| 1942 | Ga0495680_0114034 | |||
| 1943 | Ga0495680_0754907 | |||
| 1944 | Ga0495675_0081725 | |||
| 1945 | Ga0495675_0165007 | |||
| 1946 | Ga0495675_0328892 | |||
| 1947 | Ga0495677_0048763 | |||
| 1948 | Ga0495679_182861 | |||
| 1949 | Ga0495673_0035307 | |||
| 1950 | Ga0495673_0179438 | |||
| 1951 | Ga0495684_0008182 | |||
| 1952 | Ga0495684_0028314 | |||
| 1953 | Ga0495684_0064202 | |||
| 1954 | Ga0495686_0052996 | |||
| 1955 | Ga0495686_0713943 | |||
| 1956 | Ga0495593_0000439 | |||
| 1957 | Ga0495593_0008595 | |||
| 1958 | Ga0495593_0142244 | |||
| 1959 | Ga0495593_0219960 | |||
| 1960 | Ga0495593_0347207 | |||
| 1961 | Ga0495602_0097255 | |||
| 1962 | Ga0495602_0460589 | |||
| 1963 | Ga0495602_1056124 | |||
| 1964 | Ga0495614_0035192 | |||
| 1965 | Ga0495614_0298588 | |||
| 1966 | Ga0496100_0035084 | |||
| 1967 | Ga0496100_0183513 | |||
| 1968 | Ga0496101_0020624 | |||
| 1969 | Ga0496102_0004471 | |||
| 1970 | Ga0496102_0189619 | |||
| 1971 | Ga0496102_0231736 | |||
| 1972 | Ga0496102_0915975 | |||
| 1973 | Ga0496102_1129293 | |||
| 1974 | Ga0496103_0144277 | |||
| 1975 | Ga0496104_0225722 | |||
| 1976 | Ga0496104_0316621 | |||
| 1977 | Ga0496104_1150317 | |||
| 1978 | Ga0496104_1485662 | |||
| 1979 | Ga0496104_1685676 | |||
| 1980 | Ga0496105_0100819 | |||
| 1981 | Ga0496105_0163181 | |||
| 1982 | Ga0496105_0527719 | |||
| 1983 | Ga0496105_0716914 | |||
| 1984 | Ga0496105_1212805 | |||
| 1985 | Ga0496105_1365695 | |||
| 1986 | Ga0496106_0001552 | |||
| 1987 | Ga0496106_0016919 | |||
| 1988 | Ga0496106_0276000 | |||
| 1989 | Ga0496106_0531267 | |||
| 1990 | Ga0496106_0687556 | |||
| 1991 | Ga0496107_0001619 | |||
| 1992 | Ga0496107_0005793 | |||
| 1993 | Ga0496107_0167791 | |||
| 1994 | Ga0496107_0727704 | |||
| 1995 | Ga0496107_0963957 | |||
| 1996 | Ga0496108_0000259 | |||
| 1997 | Ga0496108_0038300 | |||
| 1998 | Ga0496108_0109529 | |||
| 1999 | Ga0496108_0121252 | |||
| 2000 | Ga0496108_0153595 | |||
| 2001 | Ga0496108_0180984 | |||
| 2002 | Ga0496109_0000250 | |||
| 2003 | Ga0496109_0094905 | |||
| 2004 | Ga0496109_0128890 | |||
| 2005 | Ga0496109_0203702 | |||
| 2006 | Ga0496109_0312368 | |||
| 2007 | Ga0496109_1268232 | |||
| 2008 | Ga0496110_0002671 | |||
| 2009 | Ga0496110_0049885 | |||
| 2010 | Ga0496110_0134307 | |||
| 2011 | Ga0496110_0303612 | |||
| 2012 | Ga0496110_0352092 | |||
| 2013 | Ga0496110_0448870 | |||
| 2014 | Ga0496111_0055154 | |||
| 2015 | Ga0496111_0079541 | |||
| 2016 | Ga0496111_0314329 | |||
| 2017 | Ga0496111_0489571 | |||
| 2018 | Ga0496111_1317489 | |||
| 2019 | Ga0496112_0000017 | |||
| 2020 | Ga0496112_0003374 | |||
| 2021 | Ga0496112_0024688 | |||
| 2022 | Ga0496112_0147638 | |||
| 2023 | Ga0496112_0406741 | |||
| 2024 | Ga0496112_0519003 | |||
| 2025 | Ga0496112_1313819 | |||
| 2026 | Ga0496113_0013101 | |||
| 2027 | Ga0496113_0073296 | |||
| 2028 | Ga0496113_0155877 | |||
| 2029 | Ga0496113_0460114 | |||
| 2030 | Ga0496113_0901253 | |||
| 2031 | Ga0496114_0183980 | |||
| 2032 | Ga0496114_0691438 | |||
| 2033 | Ga0496114_1678233 | |||
| 2034 | Ga0496115_0002446 | |||
| 2035 | Ga0496115_0045535 | |||
| 2036 | Ga0496115_0050187 | |||
| 2037 | Ga0496115_0173768 | |||
| 2038 | Ga0496115_0413051 | |||
| 2039 | Ga0496115_0548439 | |||
| 2040 | Ga0496115_0611629 | |||
| 2041 | Ga0496115_0639175 | |||
| 2042 | Ga0496115_1147358 | |||
| 2043 | Ga0496115_1321037 | |||
| 2044 | Ga0496118_0019989 | |||
| 2045 | Ga0496119_0361239 | |||
| 2046 | Ga0496120_0503856 | |||
| 2047 | Ga0496121_0104428 | |||
| 2048 | Ga0496121_0138854 | |||
| 2049 | Ga0496121_0280774 | |||
| 2050 | Ga0496124_0084045 | |||
| 2051 | Ga0496124_0496763 | |||
| 2052 | Ga0496125_0004755 | |||
| 2053 | Ga0496125_0009329 | |||
| 2054 | Ga0496125_0052858 | |||
| 2055 | Ga0496126_0013993 | |||
| 2056 | Ga0496126_0020497 | |||
| 2057 | Ga0496126_0029864 | |||
| 2058 | Ga0496126_0038137 | |||
| 2059 | Ga0496126_0042182 | |||
| 2060 | Ga0496126_0069964 | |||
| 2061 | Ga0496126_0076665 | |||
| 2062 | Ga0496126_0077425 | |||
| 2063 | Ga0496126_0084546 | |||
| 2064 | Ga0496126_0126068 | |||
| 2065 | Ga0496126_0126899 | |||
| 2066 | Ga0496126_0215064 | |||
| 2067 | Ga0496126_0233628 | |||
| 2068 | Ga0496126_0241914 | |||
| 2069 | Ga0496126_0260447 | |||
| 2070 | Ga0496126_0303283 | |||
| 2071 | Ga0496126_0545688 | |||
| 2072 | Ga0495678_050445 | |||
| 2073 | Ga0501033_0119555 | |||
| 2074 | Ga0501039_1486278 | |||
| 2075 | Ga0501046_0065753 | |||
| 2076 | Ga0501047_0012334 | |||
| 2077 | Ga0501047_0329822 | |||
| 2078 | Ga0501070_0040882 | |||
| 2079 | Ga0501071_0782091 | |||
| 2080 | Ga0501073_0037500 | |||
| 2081 | Ga0501074_0051766 | |||
| 2082 | Ga0501076_0264395 | |||
| 2083 | Ga0501080_0013729 | |||
| 2084 | Ga0501083_0219372 | |||
| 2085 | Ga0501044_0016521 | |||
| 2086 | nmdc:mga03683_213316_c1 | |||
| 2087 | nmdc:mga03683_289903_c1 | |||
| 2088 | nmdc:mga03n38_213812_c1 | |||
| 2089 | nmdc:mga03n38_7252_c1 | |||
| 2090 | nmdc:mga00v17_30161_c1 | |||
| 2091 | nmdc:mga00v17_46759_c1 | |||
| 2092 | nmdc:mga0yw44_193481_c1 | |||
| 2093 | nmdc:mga0yw44_63288_c1 | |||
| 2094 | nmdc:mga0k408_582052_c1 | |||
| 2095 | nmdc:mga06z11_144481_c1 | |||
| 2096 | nmdc:mga06z11_271052_c1 | |||
| 2097 | nmdc:mga06z11_71464_c1 | |||
| 2098 | nmdc:mga04h51_85307_c1 | |||
| 2099 | nmdc:mga08y16_1337271_c1 | |||
| 2100 | nmdc:mga08y16_785497_c1 | |||
| 2101 | nmdc:mga0n895_59607_c1 | |||
| 2102 | nmdc:mga08x19_113777_c1 | |||
| 2103 | Ga0495601_0020870 | |||
| 2104 | Ga0495601_0143986 | |||
| 2105 | Ga0495601_0167556 | |||
| 2106 | Ga0495601_0389158 | |||
| 2107 | Ga0495612_0014078 | |||
| 2108 | Ga0500635_0010159 | |||
| 2109 | Ga0500635_0043153 | |||
| 2110 | Ga0495595_0002193 | |||
| 2111 | Ga0495595_0028192 | |||
| 2112 | Ga0495619_0009059 | |||
| 2113 | Ga0495619_0034958 | |||
| 2114 | Ga0495619_0137381 | |||
| 2115 | Ga0495619_0313038 | |||
| 2116 | Ga0495619_0374487 | |||
| 2117 | Ga0495619_0840695 | |||
| 2118 | Ga0500578_0372424 | |||
| 2119 | Ga0500644_0318543 | |||
| 2120 | Ga0500647_0024609 | |||
| 2121 | Ga0500651_0213443 | |||
| 2122 | Ga0500566_0000043 | |||
| 2123 | Ga0500640_000244 | |||
| 2124 | Ga0500641_0118338 | |||
| 2125 | Ga0500648_358673 | |||
| 2126 | Ga0500654_233273 | |||
| 2127 | Ga0500554_032392 | |||
| 2128 | Ga0500555_047596 | |||
| 2129 | Ga0500562_048659 | |||
| 2130 | Ga0500572_000024 | |||
| 2131 | Ga0500591_019154 | |||
| 2132 | Ga0500594_0146610 | |||
| 2133 | Ga0500595_012441 | |||
| 2134 | Ga0500595_205830 | |||
| 2135 | Ga0500608_017517 | |||
| 2136 | Ga0500614_008732 | |||
| 2137 | Ga0500655_032961 | |||
| 2138 | Ga0500559_0003204 | |||
| 2139 | Ga0500559_0010494 | |||
| 2140 | Ga0500568_0106171 | |||
| 2141 | Ga0500573_0062148 | |||
| 2142 | Ga0500588_0167372 | |||
| 2143 | Ga0500589_136942 | |||
| 2144 | Ga0500590_043526 | |||
| 2145 | Ga0500590_225558 | |||
| 2146 | Ga0500603_000121 | |||
| 2147 | Ga0500603_000391 | |||
| 2148 | Ga0500603_228445 | |||
| 2149 | Ga0500604_0008548 | |||
| 2150 | Ga0500619_153016 | |||
| 2151 | Ga0500622_0060591 | |||
| 2152 | Ga0500630_000112 | |||
| 2153 | Ga0500633_0140406 | |||
| 2154 | Ga0500634_0084743 | |||
| 2155 | Ga0500638_120973 | |||
| 2156 | Ga0500638_182290 | |||
| 2157 | Ga0500639_000040 | |||
| 2158 | Ga0500639_179054 | |||
| 2159 | Ga0500636_0030525 | |||
| 2160 | Ga0500636_0329649 | |||
| 2161 | Ga0500637_0002167 | |||
| 2162 | Ga0500637_0020311 | |||
| 2163 | Ga0500596_000845 | |||
| 2164 | Ga0500596_002183 | |||
| 2165 | Ga0500601_001772 | |||
| 2166 | Ga0466962_0651813 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nky-assembly1.cif.gz_Q | rna polymerase ii-spt4/5-nucleosome-fact structure | 0.6492 | 3 | 26 |
| 5fuc-assembly1.cif.gz_V | biophysical and cellular characterisation of a junctional epitope antibody that locks il-6 and gp80 together in a stable complex: implications for new therapeutic strategies | 0.6209 | 6 | 71 |
| 7xt7-assembly1.cif.gz_j | rna polymerase ii elongation complex transcribing a nucleosome (ec49b) | 0.6129 | 3 | 26 |
| 7xtd-assembly1.cif.gz_j | rna polymerase ii elongation complex transcribing a nucleosome (ec58oct) | 0.6125 | 3 | 26 |
| 7xsx-assembly1.cif.gz_j | rna polymerase ii elongation complex transcribing a nucleosome (ec49) | 0.6125 | 3 | 26 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q55CI7_27_128_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8329 | 38 | 71 | 3.30.70.330 |
| af_I1K1C5_2_97_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7635 | 16 | 72 | 3.30.70.330 |
| af_A0A0R4IAL7_30_231_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.7238 | 6 | 24 | 2.60.40.10 |
| af_Q54D65_37_111_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7171 | 16 | 71 | 3.30.70.330 |
| 2go9A01 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.7144 | 14 | 70 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351ZU22-F1-model_v4 | Uncharacterized protein | 0.9943 | 1 | 68 |
|
| AF-A0A5C6XVF3-F1-model_v4 | deleted | 0.9698 | 1 | 74 |
|
| AF-A0A3D3RUI2-F1-model_v4 | deleted | 0.9525 | 1 | 77 |
|
| AF-A0A2P6N171-F1-model_v4 | DUF1446 domain-containing protein | 0.9487 | 1 | 76 |
|
| AF-A0A7J4GQY5-F1-model_v4 | Terpene utilization protein AtuA | 0.9445 | 1 | 67 |
|