F489698

General Info

Members Datasets Scaffolds Average Seq Length
1082 463 1003 389

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0156729|Ga0395905_0156729_313_1587
Length 424
Sequence LRLERGRSESAPTPPRGQVRARPESNNERRSNAMHKRTLLQTAVAVALLGAGGAALAQDNVFKIGLILPMTGQQATTGRQIEAAARLWMAQNGDTVAGKKIQLIVRDDTSLPDQTRRLAQELVVNEKVNVLAGMGITPSALAVAPIATQSKTPLVVMAAATSSITEASPYVVRSSFTLPQVSVAMADWAPKNGIKNVVTLVTDYGPGLDAEKYFSERFVFNGGKVPEKLRVPLRNPDFAPFLQKVRDLKPDALFVFVPSGAGAAVMKQFGERGMDKAGIKLIGTGDVTDDDQLNDMGDVALGVVTSHHYSAYHQSAANKKFVSEFMKANKNLRPNFMAVGGYDGMRIIYEALKKTGGKGGGDALLGAMKGQIFESPRGPVFIDAQTRDIVQNVYLRKVEKKDGQLWNVEFDVIKDVKDPGKTKH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2547132374 Acidovorax radicis N35 Isolate Unclassified
5 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
6 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
7 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
8 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
9 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
10 2643221570 Acidovorax sp. Root568 Isolate Unclassified
11 2643221596 Acidovorax sp. Root70 Isolate Unclassified
12 2643221609 Acidovorax sp. Root217 Isolate Unclassified
13 2643221611 Acidovorax sp. Root219 Isolate Unclassified
14 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
15 2643221652 Acidovorax sp. Root402 Isolate Unclassified
16 2643221658 Variovorax sp. Root411 Isolate Unclassified
17 2643221672 Variovorax sp. Root434 Isolate Unclassified
18 2643221683 Variovorax sp. Root473 Isolate Unclassified
19 2643221717 Acidovorax sp. Root267 Isolate Unclassified
20 2738541277 Variovorax sp. GV051 Isolate Unclassified
21 2738541307 Variovorax sp. GV008 Isolate Unclassified
22 2738543012 Acidovorax sp. CF301 Isolate Unclassified
23 2738543013 Variovorax sp. BT01 Isolate Unclassified
24 2738543019 Variovorax sp. GV040 Isolate Unclassified
25 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
26 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
27 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
28 2816332133 Acidovorax radicis 2721A Isolate Unclassified
29 2818991446 Variovorax sp. 1180 Isolate Unclassified
30 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
31 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
32 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
33 2842677519 Variovorax sp. R-72495 Isolate Unclassified
34 2842733646 Variovorax sp. R-72446 Isolate Unclassified
35 2842747753 Variovorax sp. R-72060 Isolate Unclassified
36 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
37 2885198086 Variovorax sp. 679 Isolate Unclassified
38 2885211737 Variovorax sp. 553 Isolate Unclassified
39 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
40 2899924645 Variovorax sp. 369 Isolate Unclassified
41 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
42 2904456579 Variovorax sp. 2002 Isolate Unclassified
43 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
44 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
45 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
46 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
47 2928037797 Variovorax sp. 1126 Isolate Unclassified
48 2928044640 Variovorax sp. 1128 Isolate Unclassified
49 2928051484 Variovorax sp. 1133 Isolate Unclassified
50 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
51 2928070936 Variovorax gossypii 1167 Isolate Unclassified
52 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
53 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
54 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
55 2929520902 Variovorax beijingensis 502 Isolate Unclassified
56 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
57 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
58 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
59 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
60 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
61 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
62 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
63 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
64 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
65 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
66 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
67 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
68 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
69 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
70 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
71 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
72 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
73 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
74 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
75 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
76 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
77 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
78 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
79 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
80 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
81 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
82 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
83 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
84 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
87 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
88 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
89 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
90 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
91 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
92 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
93 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
94 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
95 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
96 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
97 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
98 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
99 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
100 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
103 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
104 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
105 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
106 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
107 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
108 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
109 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
110 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
111 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
112 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
113 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
114 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
115 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
116 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
117 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
118 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
119 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
120 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
121 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
122 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
123 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
124 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
125 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
126 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
127 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
128 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
129 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
130 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
131 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
132 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
133 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
134 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
135 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
136 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
137 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
138 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
139 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
140 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
141 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
142 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
143 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
144 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
145 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
146 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
147 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
148 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
149 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
150 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
151 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
152 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
153 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
154 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
155 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
156 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
157 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
158 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
159 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
160 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
162 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
163 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
164 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
165 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
166 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
167 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
168 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
169 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
170 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
171 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
172 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
173 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
174 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
175 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
176 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
177 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
178 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
179 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
180 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
181 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
182 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
183 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
184 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
185 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
186 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
187 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
188 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
189 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
190 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
191 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
192 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
193 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
194 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
195 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
197 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
198 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
199 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
200 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
203 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
204 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
205 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
206 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
208 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
209 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
211 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
212 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
215 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
216 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
217 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
218 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
219 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
220 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
221 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
283 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
284 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
287 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
288 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
289 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
290 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
291 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
292 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
293 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
294 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
295 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
296 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
297 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
298 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
299 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
300 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
301 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
302 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
303 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
304 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
305 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
306 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
307 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
308 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
309 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
310 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
311 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
312 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
313 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
314 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
315 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
316 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
317 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
318 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
319 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
320 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
321 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
322 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
323 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
324 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
327 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
328 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
329 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
330 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
331 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
332 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
333 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
334 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
335 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
336 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
337 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
338 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
339 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
340 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
341 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
342 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
343 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
344 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
345 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
346 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
347 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
348 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
349 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
350 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
351 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
352 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
353 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
354 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
355 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
356 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
357 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
358 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
359 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
360 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
361 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
362 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
363 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
364 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
365 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
366 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
367 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
368 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
369 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
370 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
371 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
372 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
373 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
376 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
377 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
378 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
379 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
380 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
381 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
382 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
383 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
384 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
385 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
386 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
387 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
388 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
389 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
390 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
391 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
392 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
393 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
394 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
395 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
396 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
397 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
398 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
399 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
400 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
401 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
402 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
403 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
404 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
405 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
406 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
407 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
408 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
409 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
410 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
411 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
412 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
413 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
414 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
415 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
416 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
417 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
423 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
425 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
426 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
427 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
430 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
431 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
432 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
433 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
434 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
435 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
436 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
437 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
438 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
439 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
440 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
441 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
442 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
443 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
444 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
445 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
446 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
447 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
448 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
449 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
450 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
451 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
452 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
453 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
454 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
455 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
456 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
457 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
458 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
459 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
460 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
461 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
462 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
463 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0.09
Isolates 7.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.24
Nodule 0.46
Rhizoplane 3.14
Rhizosphere 67.01
Stem 0
Stem Tuber 0
Unclassified 9.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1156090 2162886007 Bacteria 2597
2 JGI24740J21852_10011219 3300001979 Bacteria 3418
3 JGI24740J21852_10012167 3300001979 Bacteria 3250
4 JGI25155J39150_1000092 3300002704 Bacteria 51808
5 JGI25156J39149_1000067 3300002705 Bacteria 82796
6 JGI25154J39366_1000089 3300002738 Bacteria 82796
7 JGI25157J39369_1000084 3300002741 Bacteria 82796
8 JGI25150J39212_1000694 3300002774 Bacteria 12176
9 JGI25159J45721_1000228 3300002987 Bacteria 26393
10 JGI25159J45721_1010332 3300002987 Bacteria 2386
11 JGI25151J46595_10002022 3300003187 Bacteria 12680
12 JGI25151J46595_10006434 3300003187 Bacteria 5908
13 JGI25151J46595_10006514 3300003187 Bacteria 5855
14 JGI25151J46595_10011382 3300003187 Bacteria 4089
15 JGI25160J50197_1000076 3300003354 Bacteria 102318
16 JGI25160J50197_1007974 3300003354 Bacteria 4077
17 JGI25160J50197_1008069 3300003354 Bacteria 4046
18 JGI25161J50226_1000058 3300003374 Bacteria 102318
19 Ga0055535_1000084 3300003761 Bacteria 104652
20 Ga0055535_1001221 3300003761 Bacteria 14499
21 Ga0055542_1000033 3300003762 Bacteria 233997
22 Ga0055542_1000381 3300003762 Bacteria 45199
23 Ga0055526_1007589 3300003771 Bacteria 5599
24 Ga0055537_1000304 3300003773 Bacteria 34030
25 Ga0055537_1000389 3300003773 Bacteria 29486
26 Ga0055537_1001544 3300003773 Bacteria 8811
27 Ga0055524_1000678 3300003775 Bacteria 23860
28 Ga0055524_1001685 3300003775 Bacteria 12301
29 Ga0055524_1004503 3300003775 Bacteria 6418
30 Ga0055536_1001854 3300003781 Bacteria 12355
31 Ga0055534_1000260 3300003784 Bacteria 36676
32 Ga0055534_1000289 3300003784 Bacteria 34030
33 Ga0055534_1001915 3300003784 Bacteria 7673
34 Ga0055534_1003287 3300003784 Bacteria 5137
35 Ga0055534_1004043 3300003784 Bacteria 4393
36 Ga0055528_1000468 3300003790 Bacteria 32324
37 Ga0055528_1001139 3300003790 Bacteria 17326
38 Ga0055528_1002348 3300003790 Bacteria 10236
39 Ga0055528_1008822 3300003790 Bacteria 4273
40 Ga0055528_1012104 3300003790 Bacteria 3374
41 Ga0055528_1013553 3300003790 Bacteria 3080
42 Ga0055530_10003506 3300003791 Bacteria 8878
43 Ga0055530_10005277 3300003791 Bacteria 6210
44 Ga0055540_1000088 3300003792 Bacteria 102236
45 Ga0055540_1000890 3300003792 Bacteria 19699
46 Ga0055540_1003373 3300003792 Bacteria 7744
47 Ga0055540_1003974 3300003792 Bacteria 6889
48 Ga0055531_10001335 3300003794 Bacteria 18427
49 Ga0055531_10004099 3300003794 Bacteria 9013
50 Ga0055531_10007816 3300003794 Bacteria 5759
51 Ga0055543_1001562 3300004625 Bacteria 8867
52 Ga0065165_1010395 3300005262 Bacteria 4030
53 Ga0065704_10003035 3300005289 Bacteria 7930
54 Ga0070658_10050911 3300005327 Bacteria 3357
55 Ga0070658_10069444 3300005327 Bacteria 2882
56 Ga0070658_10077442 3300005327 Bacteria 2728
57 Ga0070676_10004686 3300005328 Bacteria 7228
58 Ga0070676_10021675 3300005328 Bacteria 3598
59 Ga0070676_10027980 3300005328 Bacteria 3201
60 Ga0070676_10033636 3300005328 Bacteria 2941
61 Ga0070676_10070078 3300005328 Bacteria 2102
62 Ga0070683_100026059 3300005329 Bacteria 5259
63 Ga0070690_100001202 3300005330 Bacteria 13364
64 Ga0070690_100002924 3300005330 Bacteria 9227
65 Ga0070690_100171412 3300005330 Bacteria 1494
66 Ga0070670_100000527 3300005331 Bacteria 30691
67 Ga0070670_100007034 3300005331 Bacteria 9534
68 Ga0070670_100075632 3300005331 Bacteria 2893
69 Ga0070670_100295398 3300005331 Bacteria 1416
70 Ga0070677_10002614 3300005333 Bacteria 5766
71 Ga0070677_10008730 3300005333 Bacteria 3419
72 Ga0070677_10019143 3300005333 Bacteria 2475
73 Ga0068869_100001043 3300005334 Bacteria 16128
74 Ga0068869_100038691 3300005334 Bacteria 3402
75 Ga0068869_100201196 3300005334 Bacteria 1571
76 Ga0070666_10005740 3300005335 Bacteria 7621
77 Ga0070666_10012986 3300005335 Bacteria 5273
78 Ga0070666_10017401 3300005335 Bacteria 4607
79 Ga0070666_10033037 3300005335 Bacteria 3421
80 Ga0068868_100006495 3300005338 Bacteria 8279
81 Ga0068868_100008142 3300005338 Bacteria 7500
82 Ga0068868_100011759 3300005338 Bacteria 6379
83 Ga0068868_100016559 3300005338 Bacteria 5479
84 Ga0068868_100022882 3300005338 Bacteria 4724
85 Ga0068868_100160542 3300005338 Bacteria 1856
86 Ga0070660_100004674 3300005339 Bacteria 9481
87 Ga0070660_100010895 3300005339 Bacteria 6436
88 Ga0070660_100060830 3300005339 Bacteria 2932
89 Ga0070689_100034325 3300005340 Bacteria 3870
90 Ga0070687_100004173 3300005343 Bacteria 5724
91 Ga0070661_100002145 3300005344 Bacteria 13596
92 Ga0070661_100006191 3300005344 Bacteria 8251
93 Ga0070661_100025859 3300005344 Bacteria 4219
94 Ga0070661_100133026 3300005344 Bacteria 1869
95 Ga0070668_100002160 3300005347 Bacteria 14394
96 Ga0070668_100035155 3300005347 Bacteria 3820
97 Ga0070668_100036588 3300005347 Bacteria 3747
98 Ga0070669_100000975 3300005353 Bacteria 20894
99 Ga0070669_100037434 3300005353 Bacteria 3519
100 Ga0070675_100001244 3300005354 Bacteria 18566
101 Ga0070675_100010772 3300005354 Bacteria 7152
102 Ga0070675_100019421 3300005354 Bacteria 5416
103 Ga0070675_100045372 3300005354 Bacteria 3596
104 Ga0070675_100072505 3300005354 Bacteria 2859
105 Ga0070675_100090277 3300005354 Bacteria 2566
106 Ga0070675_100115299 3300005354 Bacteria 2277
107 Ga0070671_100000803 3300005355 Bacteria 22698
108 Ga0070671_100002319 3300005355 Bacteria 14699
109 Ga0070671_100011447 3300005355 Bacteria 7131
110 Ga0070671_100123092 3300005355 Bacteria 2183
111 Ga0070671_100147884 3300005355 Bacteria 1983
112 Ga0070671_100259914 3300005355 Bacteria 1475
113 Ga0070671_100270747 3300005355 Bacteria 1444
114 Ga0070674_100000274 3300005356 Bacteria 25095
115 Ga0070674_100015585 3300005356 Bacteria 4749
116 Ga0070674_100051434 3300005356 Bacteria 2839
117 Ga0070674_100078640 3300005356 Bacteria 2351
118 Ga0070673_100000502 3300005364 Bacteria 20926
119 Ga0070673_100000830 3300005364 Bacteria 17287
120 Ga0070673_100001613 3300005364 Bacteria 13330
121 Ga0070688_100001343 3300005365 Bacteria 12214
122 Ga0070659_100051896 3300005366 Bacteria 3225
123 Ga0070667_100001764 3300005367 Bacteria 19262
124 Ga0070667_100010428 3300005367 Bacteria 7671
125 Ga0070667_100027156 3300005367 Bacteria 4764
126 Ga0070667_100061358 3300005367 Bacteria 3183
127 Ga0070667_100069343 3300005367 Bacteria 3000
128 Ga0070667_100088093 3300005367 Bacteria 2665
129 Ga0070667_100126214 3300005367 Bacteria 2230
130 Ga0070709_10008071 3300005434 Bacteria 5776
131 Ga0070709_10086488 3300005434 Bacteria 2058
132 Ga0070714_100005399 3300005435 Bacteria 9753
133 Ga0070713_100000260 3300005436 Bacteria 34743
134 Ga0070713_100001983 3300005436 Bacteria 13210
135 Ga0070713_100128437 3300005436 Bacteria 2232
136 Ga0070713_100281540 3300005436 Bacteria 1526
137 Ga0070711_100009608 3300005439 Bacteria 5960
138 Ga0070711_100261814 3300005439 Bacteria 1361
139 Ga0070700_100047209 3300005441 Bacteria 2664
140 Ga0070708_100002558 3300005445 Bacteria 14069
141 Ga0070663_100013800 3300005455 Bacteria 5168
142 Ga0070663_100230053 3300005455 Bacteria 1459
143 Ga0070678_100002201 3300005456 Bacteria 10602
144 Ga0070678_100003193 3300005456 Bacteria 9096
145 Ga0070678_100058594 3300005456 Bacteria 2827
146 Ga0070678_100106868 3300005456 Bacteria 2181
147 Ga0070678_100107996 3300005456 Bacteria 2171
148 Ga0070678_100138332 3300005456 Bacteria 1945
149 Ga0070678_100287374 3300005456 Bacteria 1393
150 Ga0070662_100002003 3300005457 Bacteria 12491
151 Ga0070662_100017339 3300005457 Bacteria 4855
152 Ga0070662_100018662 3300005457 Bacteria 4696
153 Ga0070681_10110400 3300005458 Bacteria 2690
154 Ga0068867_100001459 3300005459 Bacteria 16391
155 Ga0068867_100002610 3300005459 Bacteria 12706
156 Ga0068867_100047178 3300005459 Bacteria 3166
157 Ga0068867_100065386 3300005459 Bacteria 2706
158 Ga0070685_10000750 3300005466 Bacteria 17640
159 Ga0070679_100021986 3300005530 Bacteria 6231
160 Ga0070679_100046845 3300005530 Bacteria 4310
161 Ga0070684_100009859 3300005535 Bacteria 7546
162 Ga0070684_100020569 3300005535 Bacteria 5474
163 Ga0070684_100059867 3300005535 Bacteria 3330
164 Ga0070684_100159330 3300005535 Bacteria 2047
165 Ga0068853_100006479 3300005539 Bacteria 9310
166 Ga0068853_100008837 3300005539 Bacteria 8104
167 Ga0068853_100167693 3300005539 Bacteria 1985
168 Ga0068853_100342775 3300005539 Bacteria 1389
169 Ga0070672_100000202 3300005543 Bacteria 32978
170 Ga0070672_100000616 3300005543 Bacteria 20862
171 Ga0070672_100135704 3300005543 Bacteria 2026
172 Ga0070672_100139403 3300005543 Bacteria 1999
173 Ga0070672_100222122 3300005543 Bacteria 1585
174 Ga0070686_100060217 3300005544 Bacteria 2449
175 Ga0070693_100124387 3300005547 Bacteria 1603
176 Ga0070665_100000982 3300005548 Bacteria 36142
177 Ga0070665_100001071 3300005548 Bacteria 34085
178 Ga0070665_100002968 3300005548 Bacteria 18325
179 Ga0070665_100014568 3300005548 Bacteria 7889
180 Ga0070665_100243138 3300005548 Bacteria 1800
181 Ga0070704_100175022 3300005549 Bacteria 1711
182 Ga0068855_100014542 3300005563 Bacteria 9478
183 Ga0068855_100015933 3300005563 Bacteria 9042
184 Ga0068855_100037558 3300005563 Bacteria 5759
185 Ga0068855_100055098 3300005563 Bacteria 4671
186 Ga0068855_100134917 3300005563 Bacteria 2816
187 Ga0070664_100006995 3300005564 Bacteria 9097
188 Ga0070664_100043072 3300005564 Bacteria 3808
189 Ga0070664_100060159 3300005564 Bacteria 3234
190 Ga0070664_100061589 3300005564 Bacteria 3198
191 Ga0070664_100099020 3300005564 Bacteria 2533
192 Ga0068857_100002632 3300005577 Bacteria 14734
193 Ga0068857_100067392 3300005577 Bacteria 3186
194 Ga0068857_100113025 3300005577 Bacteria 2441
195 Ga0068857_100193748 3300005577 Bacteria 1851
196 Ga0068854_100015673 3300005578 Bacteria 5031
197 Ga0068854_100029294 3300005578 Bacteria 3811
198 Ga0068856_100032839 3300005614 Bacteria 5082
199 Ga0068856_100035047 3300005614 Bacteria 4917
200 Ga0068856_100041356 3300005614 Bacteria 4529
201 Ga0068856_100071382 3300005614 Bacteria 3437
202 Ga0068852_100001296 3300005616 Bacteria 16715
203 Ga0068852_100002427 3300005616 Bacteria 12829
204 Ga0068852_100002469 3300005616 Bacteria 12727
205 Ga0068852_100003642 3300005616 Bacteria 10791
206 Ga0068852_100202190 3300005616 Bacteria 1880
207 Ga0068859_100000299 3300005617 Bacteria 49331
208 Ga0068864_100000973 3300005618 Bacteria 24018
209 Ga0068864_100001865 3300005618 Bacteria 17299
210 Ga0068864_100014639 3300005618 Bacteria 6516
211 Ga0068864_100017389 3300005618 Bacteria 5996
212 Ga0068864_100036399 3300005618 Bacteria 4195
213 Ga0068864_100044498 3300005618 Bacteria 3806
214 Ga0068866_10007175 3300005718 Bacteria 4661
215 Ga0068861_100000405 3300005719 Bacteria 24937
216 Ga0068861_100003338 3300005719 Bacteria 10628
217 Ga0068861_100047283 3300005719 Bacteria 3247
218 Ga0068861_100078425 3300005719 Bacteria 2579
219 Ga0068851_10005924 3300005834 Bacteria 5563
220 Ga0068851_10005937 3300005834 Bacteria 5557
221 Ga0068851_10023969 3300005834 Bacteria 2985
222 Ga0068851_10038082 3300005834 Bacteria 2412
223 Ga0068851_10072028 3300005834 Bacteria 1789
224 Ga0068870_10027062 3300005840 Bacteria 2865
225 Ga0068863_100008043 3300005841 Bacteria 10298
226 Ga0068863_100036282 3300005841 Bacteria 4697
227 Ga0068863_100057950 3300005841 Bacteria 3666
228 Ga0068863_100089185 3300005841 Bacteria 2924
229 Ga0068863_100106122 3300005841 Bacteria 2672
230 Ga0068863_100169078 3300005841 Bacteria 2096
231 Ga0068863_100186824 3300005841 Bacteria 1991
232 Ga0068858_100002362 3300005842 Bacteria 19076
233 Ga0068858_100051954 3300005842 Bacteria 3792
234 Ga0068860_100000216 3300005843 Bacteria 90423
235 Ga0068860_100001383 3300005843 Bacteria 26323
236 Ga0068860_100038831 3300005843 Bacteria 4555
237 Ga0068860_100056478 3300005843 Bacteria 3732
238 Ga0068860_100058929 3300005843 Bacteria 3651
239 Ga0068860_100226510 3300005843 Bacteria 1816
240 Ga0068862_100015000 3300005844 Bacteria 6435
241 Ga0070717_10051736 3300006028 Bacteria 3382
242 Ga0075365_10022743 3300006038 Bacteria 3932
243 Ga0075365_10081033 3300006038 Bacteria 2198
244 Ga0075365_10088354 3300006038 Bacteria 2108
245 Ga0075368_10021210 3300006042 Bacteria 2466
246 Ga0075363_100021432 3300006048 Bacteria 3255
247 Ga0075363_100065389 3300006048 Bacteria 1966
248 Ga0075363_100101348 3300006048 Bacteria 1594
249 Ga0075364_10025483 3300006051 Bacteria 3764
250 Ga0075364_10091324 3300006051 Bacteria 2020
251 Ga0075364_10131519 3300006051 Bacteria 1679
252 Ga0070715_10041445 3300006163 Bacteria 1930
253 Ga0070716_100009928 3300006173 Bacteria 4761
254 Ga0070712_100002075 3300006175 Bacteria 12294
255 Ga0075362_10008038 3300006177 Bacteria 4019
256 Ga0075362_10053803 3300006177 Bacteria 1808
257 Ga0075362_10071687 3300006177 Bacteria 1583
258 Ga0075367_10022602 3300006178 Bacteria 3529
259 Ga0075369_10024533 3300006186 Bacteria 2500
260 Ga0075369_10106548 3300006186 Bacteria 1261
261 Ga0075366_10008556 3300006195 Bacteria 5693
262 Ga0075366_10012284 3300006195 Bacteria 4855
263 Ga0075366_10043910 3300006195 Bacteria 2648
264 Ga0075366_10069834 3300006195 Bacteria 2091
265 Ga0075366_10138889 3300006195 Bacteria 1468
266 Ga0097621_100025467 3300006237 Bacteria 4630
267 Ga0097621_100032630 3300006237 Bacteria 4141
268 Ga0097621_100034930 3300006237 Bacteria 4013
269 Ga0097621_100055054 3300006237 Bacteria 3247
270 Ga0075370_10004900 3300006353 Bacteria 6572
271 Ga0075370_10024685 3300006353 Bacteria 3322
272 Ga0075370_10033431 3300006353 Bacteria 2880
273 Ga0068871_100020380 3300006358 Bacteria 5078
274 Ga0068871_100039339 3300006358 Bacteria 3783
275 Ga0068871_100067809 3300006358 Bacteria 2928
276 Ga0075434_100163224 3300006871 Bacteria 2248
277 Ga0068865_100014828 3300006881 Bacteria 4959
278 Ga0068865_100022953 3300006881 Bacteria 4078
279 Ga0068865_100032381 3300006881 Bacteria 3491
280 Ga0097620_100000299 3300006931 Bacteria 49331
281 Ga0079104_1021813 3300006946 Bacteria 1737
282 Ga0099826_10000044 3300006948 Bacteria 88060
283 Ga0105244_10001156 3300009036 Bacteria 21857
284 Ga0105244_10021526 3300009036 Bacteria 3565
285 Ga0105240_10014739 3300009093 Bacteria 10662
286 Ga0105240_10047143 3300009093 Bacteria 5455
287 Ga0105240_10060157 3300009093 Bacteria 4736
288 Ga0105240_10410890 3300009093 Bacteria 1522
289 Ga0105245_10009237 3300009098 Bacteria 8596
290 Ga0105245_10015868 3300009098 Bacteria 6563
291 Ga0105245_10107469 3300009098 Bacteria 2590
292 Ga0105245_10339106 3300009098 Bacteria 1486
293 Ga0105245_10400144 3300009098 Bacteria 1372
294 Ga0105247_10005757 3300009101 Bacteria 7760
295 Ga0105243_10002240 3300009148 Bacteria 16253
296 Ga0105243_10002379 3300009148 Bacteria 15749
297 Ga0105243_10003283 3300009148 Bacteria 13145
298 Ga0105243_10062928 3300009148 Bacteria 2972
299 Ga0105241_10007933 3300009174 Bacteria 7806
300 Ga0105241_10025815 3300009174 Bacteria 4367
301 Ga0105241_10175159 3300009174 Bacteria 1775
302 Ga0105242_10121367 3300009176 Bacteria 2243
303 Ga0105248_10028897 3300009177 Bacteria 6181
304 Ga0105248_10090531 3300009177 Bacteria 3445
305 Ga0105248_10180854 3300009177 Bacteria 2376
306 Ga0105237_10000933 3300009545 Bacteria 39346
307 Ga0105237_10037996 3300009545 Bacteria 4864
308 Ga0105237_10096912 3300009545 Bacteria 2940
309 Ga0105238_10008227 3300009551 Bacteria 10433
310 Ga0105238_10030064 3300009551 Bacteria 5528
311 Ga0105238_10082419 3300009551 Bacteria 3206
312 Ga0105238_10111427 3300009551 Bacteria 2717
313 Ga0105249_10064275 3300009553 Bacteria 3373
314 Ga0105249_10152469 3300009553 Bacteria 2226
315 Ga0105239_10007368 3300010375 Bacteria 12638
316 Ga0105239_10320371 3300010375 Bacteria 1748
317 Ga0105246_10068407 3300011119 Bacteria 2491
318 Ga0105246_10176241 3300011119 Bacteria 1642
319 Ga0157373_10001556 3300013100 Bacteria 17499
320 Ga0157373_10013744 3300013100 Bacteria 5935
321 Ga0157371_10015422 3300013102 Bacteria 5733
322 Ga0157371_10043853 3300013102 Bacteria 3185
323 Ga0157371_10051612 3300013102 Bacteria 2922
324 Ga0157371_10087976 3300013102 Bacteria 2199
325 Ga0157370_10057280 3300013104 Bacteria 3706
326 Ga0157370_10217311 3300013104 Bacteria 1771
327 Ga0157369_10000456 3300013105 Bacteria 54115
328 Ga0157369_10039411 3300013105 Bacteria 5163
329 Ga0157369_10040205 3300013105 Bacteria 5106
330 Ga0157369_10172220 3300013105 Bacteria 2280
331 Ga0157374_10008825 3300013296 Bacteria 8629
332 Ga0157374_10168342 3300013296 Bacteria 2137
333 Ga0157378_10002940 3300013297 Bacteria 15150
334 Ga0157378_10010946 3300013297 Bacteria 7934
335 Ga0163162_10009038 3300013306 Bacteria 9685
336 Ga0163162_10010013 3300013306 Bacteria 9217
337 Ga0163162_10014511 3300013306 Bacteria 7699
338 Ga0163162_10050004 3300013306 Bacteria 4191
339 Ga0163162_10312657 3300013306 Bacteria 1703
340 Ga0163162_10361502 3300013306 Bacteria 1585
341 Ga0157372_10031835 3300013307 Bacteria 5779
342 Ga0157372_10104164 3300013307 Bacteria 3243
343 Ga0157372_10326825 3300013307 Bacteria 1786
344 Ga0157375_10001479 3300013308 Bacteria 20180
345 Ga0157375_10002234 3300013308 Bacteria 16754
346 Ga0157375_10004157 3300013308 Bacteria 12560
347 Ga0157375_10069870 3300013308 Bacteria 3519
348 Ga0163163_10010522 3300014325 Bacteria 8323
349 Ga0163163_10017385 3300014325 Bacteria 6706
350 Ga0157380_10005798 3300014326 Bacteria 8645
351 Ga0157380_10041751 3300014326 Bacteria 3582
352 Ga0182008_10003337 3300014497 Bacteria 9751
353 Ga0182008_10006370 3300014497 Bacteria 6609
354 Ga0182008_10014906 3300014497 Bacteria 4066
355 Ga0182008_10060982 3300014497 Bacteria 1859
356 Ga0157377_10000246 3300014745 Bacteria 26794
357 Ga0157377_10036460 3300014745 Bacteria 2705
358 Ga0157379_10000911 3300014968 Bacteria 23851
359 Ga0157379_10004260 3300014968 Bacteria 12214
360 Ga0157379_10004346 3300014968 Bacteria 12120
361 Ga0157379_10015058 3300014968 Bacteria 6784
362 Ga0157379_10024195 3300014968 Bacteria 5390
363 Ga0157379_10126688 3300014968 Bacteria 2298
364 Ga0157376_10010329 3300014969 Bacteria 6822
365 Ga0157376_10031559 3300014969 Bacteria 4245
366 Ga0157376_10054119 3300014969 Bacteria 3344
367 Ga0182006_1001535 3300015261 Bacteria 13801
368 Ga0182006_1003085 3300015261 Bacteria 8734
369 Ga0182006_1031627 3300015261 Bacteria 2130
370 Ga0182007_10002970 3300015262 Bacteria 8217
371 Ga0183362_10006 3300015683 Bacteria 287231
372 Ga0163161_10000308 3300017792 Bacteria 42596
373 Ga0163161_10057833 3300017792 Bacteria 2818
374 Ga0163161_10161183 3300017792 Bacteria 1710
375 Ga0206350_11076645 3300020080 Bacteria 1322
376 Ga0213876_10016615 3300021384 Bacteria 3888
377 Ga0213876_10038786 3300021384 Bacteria 2515
378 Ga0213875_10001420 3300021388 Bacteria 15553
379 Ga0209435_100008 3300025206 Bacteria 503644
380 Ga0209436_104850 3300025208 Bacteria 3225
381 Ga0209672_100529 3300025228 Bacteria 20856
382 Ga0209672_102290 3300025228 Bacteria 4895
383 Ga0209147_100715 3300025229 Bacteria 16813
384 Ga0209147_101310 3300025229 Bacteria 9576
385 Ga0209258_100089 3300025242 Bacteria 234040
386 Ga0209258_100454 3300025242 Bacteria 45089
387 Ga0207425_1000355 3300025245 Bacteria 31804
388 Ga0207425_1000483 3300025245 Bacteria 25107
389 Ga0207425_1001782 3300025245 Bacteria 8362
390 Ga0207425_1002298 3300025245 Bacteria 6860
391 Ga0207425_1008002 3300025245 Bacteria 2741
392 Ga0209646_1000029 3300025246 Bacteria 386414
393 Ga0209026_1000016 3300025250 Bacteria 386457
394 Ga0209148_1000097 3300025254 Bacteria 234049
395 Ga0209148_1000449 3300025254 Bacteria 45110
396 Ga0209759_1000016 3300025256 Bacteria 386414
397 Ga0209129_1000033 3300025258 Bacteria 336894
398 Ga0209129_1005867 3300025258 Bacteria 4173
399 Ga0209565_1000019 3300025263 Bacteria 438920
400 Ga0209565_1000047 3300025263 Bacteria 225745
401 Ga0209565_1000120 3300025263 Bacteria 111458
402 Ga0209565_1000586 3300025263 Bacteria 24589
403 Ga0209565_1008452 3300025263 Bacteria 2690
404 Ga0209673_1000079 3300025273 Bacteria 225746
405 Ga0209673_1000099 3300025273 Bacteria 193248
406 Ga0209673_1000185 3300025273 Bacteria 125742
407 Ga0209673_1000492 3300025273 Bacteria 65573
408 Ga0209673_1001345 3300025273 Bacteria 24589
409 Ga0209673_1002128 3300025273 Bacteria 14787
410 Ga0209673_1002340 3300025273 Bacteria 13407
411 Ga0209673_1010691 3300025273 Bacteria 3847
412 Ga0209130_1000011 3300025284 Bacteria 431723
413 Ga0209130_1000014 3300025284 Bacteria 412039
414 Ga0209130_1000272 3300025284 Bacteria 64696
415 Ga0209130_1000736 3300025284 Bacteria 28751
416 Ga0209130_1001586 3300025284 Bacteria 14275
417 Ga0209130_1001885 3300025284 Bacteria 11906
418 Ga0209130_1010381 3300025284 Bacteria 2568
419 Ga0209675_1000046 3300025291 Bacteria 225746
420 Ga0209675_1000054 3300025291 Bacteria 193248
421 Ga0209675_1000073 3300025291 Bacteria 163009
422 Ga0209675_1000296 3300025291 Bacteria 46253
423 Ga0209675_1000539 3300025291 Bacteria 27695
424 Ga0209675_1000622 3300025291 Bacteria 25332
425 Ga0209675_1001599 3300025291 Bacteria 12794
426 Ga0209675_1006949 3300025291 Bacteria 4439
427 Ga0209675_1019145 3300025291 Bacteria 1892
428 Ga0209676_1000013 3300025292 Bacteria 816080
429 Ga0209676_1000153 3300025292 Bacteria 166393
430 Ga0209676_1000179 3300025292 Bacteria 150096
431 Ga0209676_1000896 3300025292 Bacteria 37733
432 Ga0209676_1001185 3300025292 Bacteria 28045
433 Ga0209676_1010360 3300025292 Bacteria 3898
434 Ga0209676_1011930 3300025292 Bacteria 3459
435 Ga0209676_1019621 3300025292 Bacteria 2321
436 Ga0209025_1000714 3300025294 Bacteria 56537
437 Ga0209025_1000743 3300025294 Bacteria 54915
438 Ga0209025_1000973 3300025294 Bacteria 42929
439 Ga0209025_1001001 3300025294 Bacteria 41900
440 Ga0209025_1005221 3300025294 Bacteria 10713
441 Ga0209025_1005695 3300025294 Bacteria 10034
442 Ga0209025_1005712 3300025294 Bacteria 10001
443 Ga0209025_1008443 3300025294 Bacteria 7411
444 Ga0209025_1017032 3300025294 Bacteria 4230
445 Ga0209025_1019327 3300025294 Bacteria 3792
446 Ga0209025_1037003 3300025294 Bacteria 2173
447 Ga0209564_1000040 3300025295 Bacteria 411388
448 Ga0209564_1000151 3300025295 Bacteria 168783
449 Ga0209564_1000246 3300025295 Bacteria 117096
450 Ga0209564_1000725 3300025295 Bacteria 47333
451 Ga0209758_1000027 3300025297 Bacteria 549650
452 Ga0209758_1000037 3300025297 Bacteria 439101
453 Ga0209758_1004818 3300025297 Bacteria 10892
454 Ga0209758_1011129 3300025297 Bacteria 5256
455 Ga0209758_1014773 3300025297 Bacteria 4118
456 Ga0209758_1040496 3300025297 Bacteria 1756
457 Ga0209050_1000008 3300025298 Bacteria 1144179
458 Ga0209050_1000172 3300025298 Bacteria 150096
459 Ga0209050_1002148 3300025298 Bacteria 17949
460 Ga0209050_1003172 3300025298 Bacteria 12496
461 Ga0209050_1005822 3300025298 Bacteria 7560
462 Ga0209050_1024418 3300025298 Bacteria 2092
463 Ga0209050_1028869 3300025298 Bacteria 1789
464 Ga0209256_1000023 3300025299 Bacteria 461150
465 Ga0209256_1000039 3300025299 Bacteria 372337
466 Ga0209256_1000069 3300025299 Bacteria 245640
467 Ga0209256_1000161 3300025299 Bacteria 138270
468 Ga0209256_1006705 3300025299 Bacteria 5974
469 Ga0207426_1000027 3300025302 Bacteria 513176
470 Ga0207426_1000029 3300025302 Bacteria 473835
471 Ga0207426_1000115 3300025302 Bacteria 227423
472 Ga0207426_1000174 3300025302 Bacteria 160877
473 Ga0207426_1000411 3300025302 Bacteria 71437
474 Ga0209051_1000005 3300025303 Bacteria 1142353
475 Ga0209051_1000046 3300025303 Bacteria 296424
476 Ga0209051_1000055 3300025303 Bacteria 277194
477 Ga0209051_1000128 3300025303 Bacteria 142159
478 Ga0209051_1000483 3300025303 Bacteria 51423
479 Ga0209051_1000762 3300025303 Bacteria 34275
480 Ga0209051_1000841 3300025303 Bacteria 31619
481 Ga0209051_1002685 3300025303 Bacteria 12424
482 Ga0209051_1002686 3300025303 Bacteria 12422
483 Ga0209051_1009810 3300025303 Bacteria 4902
484 Ga0209257_1000031 3300025304 Bacteria 688770
485 Ga0209257_1000101 3300025304 Bacteria 251553
486 Ga0209257_1000281 3300025304 Bacteria 114413
487 Ga0209257_1000377 3300025304 Bacteria 89033
488 Ga0209257_1001061 3300025304 Bacteria 36348
489 Ga0209257_1017705 3300025304 Bacteria 2790
490 Ga0207697_10008475 3300025315 Bacteria 4494
491 Ga0207697_10015952 3300025315 Bacteria 3098
492 Ga0207656_10009598 3300025321 Bacteria 3596
493 Ga0207656_10017111 3300025321 Bacteria 2835
494 Ga0207655_1005421 3300025728 Bacteria 8674
495 Ga0207682_10000930 3300025893 Bacteria 13586
496 Ga0207682_10001271 3300025893 Bacteria 11579
497 Ga0207682_10012418 3300025893 Bacteria 3325
498 Ga0207682_10035668 3300025893 Bacteria 2010
499 Ga0207692_10050644 3300025898 Bacteria 2102
500 Ga0207642_10071197 3300025899 Bacteria 1655
501 Ga0207710_10012742 3300025900 Bacteria 3540
502 Ga0207688_10129459 3300025901 Bacteria 1478
503 Ga0207680_10003123 3300025903 Bacteria 7780
504 Ga0207680_10003924 3300025903 Bacteria 7018
505 Ga0207680_10035243 3300025903 Bacteria 2871
506 Ga0207699_10007585 3300025906 Bacteria 5311
507 Ga0207645_10000242 3300025907 Bacteria 45222
508 Ga0207645_10000481 3300025907 Bacteria 33007
509 Ga0207645_10023328 3300025907 Bacteria 4022
510 Ga0207645_10151049 3300025907 Bacteria 1516
511 Ga0207643_10014273 3300025908 Bacteria 4314
512 Ga0207643_10037378 3300025908 Bacteria 2725
513 Ga0207654_10015755 3300025911 Bacteria 3928
514 Ga0207654_10090825 3300025911 Bacteria 1861
515 Ga0207707_10082168 3300025912 Bacteria 2813
516 Ga0207695_10040965 3300025913 Bacteria 4961
517 Ga0207695_10061561 3300025913 Bacteria 3878
518 Ga0207695_10062000 3300025913 Bacteria 3863
519 Ga0207695_10215361 3300025913 Bacteria 1830
520 Ga0207671_10008055 3300025914 Bacteria 9007
521 Ga0207693_10000405 3300025915 Bacteria 39292
522 Ga0207663_10003087 3300025916 Bacteria 8076
523 Ga0207663_10225900 3300025916 Bacteria 1365
524 Ga0207662_10004572 3300025918 Bacteria 7294
525 Ga0207662_10019814 3300025918 Bacteria 3834
526 Ga0207657_10021044 3300025919 Bacteria 6149
527 Ga0207657_10030031 3300025919 Bacteria 4938
528 Ga0207657_10069103 3300025919 Bacteria 2999
529 Ga0207657_10102655 3300025919 Bacteria 2371
530 Ga0207657_10241732 3300025919 Bacteria 1441
531 Ga0207652_10087621 3300025921 Bacteria 2730
532 Ga0207681_10000162 3300025923 Bacteria 55291
533 Ga0207681_10013644 3300025923 Bacteria 5031
534 Ga0207681_10019030 3300025923 Bacteria 4334
535 Ga0207681_10066479 3300025923 Bacteria 2496
536 Ga0207694_10029379 3300025924 Bacteria 4194
537 Ga0207694_10079787 3300025924 Bacteria 2567
538 Ga0207694_10125408 3300025924 Bacteria 2054
539 Ga0207650_10001039 3300025925 Bacteria 20830
540 Ga0207650_10004268 3300025925 Bacteria 9753
541 Ga0207650_10012479 3300025925 Bacteria 5865
542 Ga0207650_10040447 3300025925 Bacteria 3412
543 Ga0207650_10047698 3300025925 Bacteria 3157
544 Ga0207650_10067893 3300025925 Bacteria 2676
545 Ga0207650_10154738 3300025925 Bacteria 1812
546 Ga0207650_10327360 3300025925 Bacteria 1256
547 Ga0207659_10004029 3300025926 Bacteria 8865
548 Ga0207659_10018283 3300025926 Bacteria 4593
549 Ga0207659_10062930 3300025926 Bacteria 2680
550 Ga0207659_10074965 3300025926 Bacteria 2481
551 Ga0207659_10312004 3300025926 Bacteria 1295
552 Ga0207687_10005515 3300025927 Bacteria 8371
553 Ga0207687_10036680 3300025927 Bacteria 3340
554 Ga0207700_10001855 3300025928 Bacteria 11973
555 Ga0207664_10089203 3300025929 Bacteria 2524
556 Ga0207644_10000236 3300025931 Bacteria 37953
557 Ga0207644_10003418 3300025931 Bacteria 10251
558 Ga0207644_10008705 3300025931 Bacteria 6643
559 Ga0207644_10014552 3300025931 Bacteria 5265
560 Ga0207644_10014708 3300025931 Bacteria 5244
561 Ga0207644_10101692 3300025931 Bacteria 2160
562 Ga0207644_10130324 3300025931 Bacteria 1924
563 Ga0207690_10072446 3300025932 Bacteria 2379
564 Ga0207690_10152698 3300025932 Bacteria 1713
565 Ga0207706_10002936 3300025933 Bacteria 16479
566 Ga0207706_10006657 3300025933 Bacteria 10682
567 Ga0207686_10035034 3300025934 Bacteria 3010
568 Ga0207686_10236463 3300025934 Bacteria 1327
569 Ga0207709_10000319 3300025935 Bacteria 52470
570 Ga0207709_10000868 3300025935 Bacteria 23068
571 Ga0207709_10002362 3300025935 Bacteria 11916
572 Ga0207670_10013702 3300025936 Bacteria 4790
573 Ga0207669_10002721 3300025937 Bacteria 7570
574 Ga0207669_10003694 3300025937 Bacteria 6654
575 Ga0207669_10024902 3300025937 Bacteria 3224
576 Ga0207669_10117174 3300025937 Bacteria 1799
577 Ga0207704_10006650 3300025938 Bacteria 5411
578 Ga0207691_10000084 3300025940 Bacteria 80075
579 Ga0207691_10002250 3300025940 Bacteria 18932
580 Ga0207691_10002324 3300025940 Bacteria 18618
581 Ga0207691_10019132 3300025940 Bacteria 6482
582 Ga0207691_10114013 3300025940 Bacteria 2402
583 Ga0207691_10232243 3300025940 Bacteria 1597
584 Ga0207711_10000320 3300025941 Bacteria 51464
585 Ga0207711_10009403 3300025941 Bacteria 8163
586 Ga0207711_10050769 3300025941 Bacteria 3551
587 Ga0207689_10000725 3300025942 Bacteria 31641
588 Ga0207689_10008373 3300025942 Bacteria 9006
589 Ga0207689_10094751 3300025942 Bacteria 2452
590 Ga0207689_10146300 3300025942 Bacteria 1947
591 Ga0207661_10121699 3300025944 Bacteria 2222
592 Ga0207679_10008059 3300025945 Bacteria 6698
593 Ga0207679_10008384 3300025945 Bacteria 6581
594 Ga0207679_10045774 3300025945 Bacteria 3167
595 Ga0207679_10133938 3300025945 Bacteria 1992
596 Ga0207667_10013088 3300025949 Bacteria 9522
597 Ga0207667_10033228 3300025949 Bacteria 5550
598 Ga0207667_10048599 3300025949 Bacteria 4485
599 Ga0207667_10268640 3300025949 Bacteria 1744
600 Ga0207651_10001535 3300025960 Bacteria 10540
601 Ga0207651_10011801 3300025960 Bacteria 4906
602 Ga0207712_10013041 3300025961 Bacteria 5324
603 Ga0207712_10163635 3300025961 Bacteria 1732
604 Ga0207668_10001266 3300025972 Bacteria 15063
605 Ga0207668_10011750 3300025972 Bacteria 5335
606 Ga0207668_10019585 3300025972 Bacteria 4280
607 Ga0207668_10042208 3300025972 Bacteria 3088
608 Ga0207668_10088267 3300025972 Bacteria 2270
609 Ga0207668_10186334 3300025972 Bacteria 1641
610 Ga0207640_10027346 3300025981 Bacteria 3474
611 Ga0207640_10032378 3300025981 Bacteria 3241
612 Ga0207640_10083221 3300025981 Bacteria 2193
613 Ga0207640_10123093 3300025981 Bacteria 1862
614 Ga0207658_10000181 3300025986 Bacteria 67700
615 Ga0207658_10028994 3300025986 Bacteria 3903
616 Ga0207658_10037345 3300025986 Bacteria 3489
617 Ga0207658_10062420 3300025986 Bacteria 2788
618 Ga0207658_10123511 3300025986 Bacteria 2068
619 Ga0207658_10266012 3300025986 Bacteria 1463
620 Ga0207677_10001129 3300026023 Bacteria 14557
621 Ga0207677_10003051 3300026023 Bacteria 8854
622 Ga0207677_10048120 3300026023 Bacteria 2869
623 Ga0207677_10069671 3300026023 Bacteria 2474
624 Ga0207677_10088010 3300026023 Bacteria 2250
625 Ga0207703_10000377 3300026035 Bacteria 47621
626 Ga0207703_10002749 3300026035 Bacteria 15066
627 Ga0207703_10013218 3300026035 Bacteria 6430
628 Ga0207703_10018081 3300026035 Bacteria 5505
629 Ga0207703_10135870 3300026035 Bacteria 2129
630 Ga0207703_10147716 3300026035 Bacteria 2046
631 Ga0207639_10003425 3300026041 Bacteria 10668
632 Ga0207639_10009290 3300026041 Bacteria 6780
633 Ga0207639_10026001 3300026041 Bacteria 4250
634 Ga0207639_10078064 3300026041 Bacteria 2612
635 Ga0207678_10024411 3300026067 Bacteria 5279
636 Ga0207678_10043678 3300026067 Bacteria 3878
637 Ga0207678_10047219 3300026067 Bacteria 3724
638 Ga0207708_10080307 3300026075 Bacteria 2506
639 Ga0207702_10005209 3300026078 Bacteria 11415
640 Ga0207702_10029549 3300026078 Bacteria 4561
641 Ga0207702_10035879 3300026078 Bacteria 4146
642 Ga0207702_10260513 3300026078 Bacteria 1633
643 Ga0207641_10001807 3300026088 Bacteria 20576
644 Ga0207641_10007514 3300026088 Bacteria 9070
645 Ga0207641_10041170 3300026088 Bacteria 3871
646 Ga0207641_10042857 3300026088 Bacteria 3798
647 Ga0207641_10108018 3300026088 Bacteria 2462
648 Ga0207641_10119563 3300026088 Bacteria 2349
649 Ga0207641_10141317 3300026088 Bacteria 2172
650 Ga0207648_10000799 3300026089 Bacteria 35474
651 Ga0207648_10002006 3300026089 Bacteria 22204
652 Ga0207648_10008220 3300026089 Bacteria 10130
653 Ga0207648_10012486 3300026089 Bacteria 7953
654 Ga0207648_10220242 3300026089 Bacteria 1686
655 Ga0207676_10012888 3300026095 Bacteria 6003
656 Ga0207676_10015861 3300026095 Bacteria 5447
657 Ga0207676_10027124 3300026095 Bacteria 4263
658 Ga0207676_10042038 3300026095 Bacteria 3513
659 Ga0207676_10080947 3300026095 Bacteria 2637
660 Ga0207676_10191354 3300026095 Bacteria 1800
661 Ga0207674_10002241 3300026116 Bacteria 24492
662 Ga0207674_10041068 3300026116 Bacteria 4786
663 Ga0207674_10128118 3300026116 Bacteria 2502
664 Ga0207674_10208960 3300026116 Bacteria 1901
665 Ga0207675_100000273 3300026118 Bacteria 49026
666 Ga0207675_100000770 3300026118 Bacteria 31956
667 Ga0207675_100003220 3300026118 Bacteria 16019
668 Ga0207675_100016216 3300026118 Bacteria 6955
669 Ga0207683_10000003 3300026121 Bacteria 191866
670 Ga0207683_10003562 3300026121 Bacteria 13579
671 Ga0207683_10016614 3300026121 Bacteria 6264
672 Ga0207683_10020310 3300026121 Bacteria 5680
673 Ga0207683_10065538 3300026121 Bacteria 3203
674 Ga0207683_10066195 3300026121 Bacteria 3186
675 Ga0207683_10135533 3300026121 Bacteria 2216
676 Ga0207698_10001703 3300026142 Bacteria 12820
677 Ga0207698_10006587 3300026142 Bacteria 7261
678 Ga0207698_10015574 3300026142 Bacteria 5096
679 Ga0207698_10034839 3300026142 Bacteria 3675
680 Ga0207698_10071400 3300026142 Bacteria 2755
681 Ga0207698_10074270 3300026142 Bacteria 2712
682 Ga0209282_1014520 3300027666 Bacteria 5014
683 Ga0209974_10000572 3300027876 Bacteria 12285
684 Ga0209974_10020721 3300027876 Bacteria 2179
685 Ga0268266_10013197 3300028379 Bacteria 7124
686 Ga0268266_10064760 3300028379 Bacteria 3158
687 Ga0268266_10372303 3300028379 Bacteria 1345
688 Ga0268264_10002625 3300028381 Bacteria 15693
689 Ga0268264_10018448 3300028381 Bacteria 5706
690 Ga0268264_10025144 3300028381 Bacteria 4864
691 Ga0268264_10029519 3300028381 Bacteria 4492
692 Ga0268264_10343893 3300028381 Bacteria 1418
693 Ga0307515_10000257 3300028794 Bacteria 131732
694 Ga0307515_10000737 3300028794 Bacteria 75687
695 Ga0307515_10000911 3300028794 Bacteria 68106
696 Ga0307515_10001517 3300028794 Bacteria 51954
697 Ga0307515_10002263 3300028794 Bacteria 42131
698 Ga0307515_10002980 3300028794 Bacteria 35948
699 Ga0307515_10080406 3300028794 Bacteria 4252
700 Ga0307511_10000086 3300030521 Bacteria 77931
701 Ga0307512_10012428 3300030522 Bacteria 8035
702 Ga0316180_1037273 3300030736 Bacteria 1470
703 Ga0316183_1058424 3300030742 Bacteria 5149
704 Ga0316182_1247809 3300030745 Bacteria 2626
705 Ga0265330_10025219 3300031235 Bacteria 2696
706 Ga0307513_10000037 3300031456 Bacteria 175364
707 Ga0307513_10014317 3300031456 Bacteria 9691
708 Ga0307513_10166806 3300031456 Bacteria 2085
709 Ga0307509_10028187 3300031507 Bacteria 6246
710 Ga0307408_100000117 3300031548 Bacteria 87442
711 Ga0307408_100005526 3300031548 Bacteria 8445
712 Ga0307408_100029623 3300031548 Bacteria 3794
713 Ga0307408_100142692 3300031548 Bacteria 1881
714 Ga0307508_10000101 3300031616 Bacteria 100858
715 Ga0307514_10000408 3300031649 Bacteria 95961
716 Ga0307514_10001925 3300031649 Bacteria 22740
717 Ga0265314_10005849 3300031711 Bacteria 11012
718 Ga0265314_10061543 3300031711 Bacteria 2555
719 Ga0307516_10004632 3300031730 Bacteria 16868
720 Ga0307516_10004894 3300031730 Bacteria 16300
721 Ga0307405_10005204 3300031731 Bacteria 6246
722 Ga0307405_10007347 3300031731 Bacteria 5500
723 Ga0307405_10031026 3300031731 Bacteria 3141
724 Ga0307405_10033033 3300031731 Bacteria 3065
725 Ga0307413_10086242 3300031824 Bacteria 2029
726 Ga0307406_10000717 3300031901 Bacteria 18697
727 Ga0307406_10001362 3300031901 Bacteria 13677
728 Ga0307406_10001703 3300031901 Bacteria 12091
729 Ga0307406_10008835 3300031901 Bacteria 5631
730 Ga0307412_10032584 3300031911 Bacteria 3304
731 Ga0307412_10061904 3300031911 Bacteria 2517
732 Ga0307412_10077918 3300031911 Bacteria 2281
733 Ga0307409_100234697 3300031995 Bacteria 1665
734 Ga0307416_100005940 3300032002 Bacteria 7585
735 Ga0307411_10141963 3300032005 Bacteria 1772
736 Ga0373934_0031443 3300035086 Bacteria 2078
737 Ga0373944_0012434 3300035089 Bacteria 2345
738 Ga0373952_0017932 3300035092 Bacteria 1459
739 Ga0373923_0024304 3300035111 Bacteria 2391
740 Ga0373954_0056826 3300035118 Bacteria 1842
741 Ga0373956_0020838 3300035119 Bacteria 2794
742 Ga0373956_0037296 3300035119 Bacteria 2148
743 Ga0373957_0009807 3300035120 Bacteria 3143
744 Ga0373943_0037724 3300035170 Bacteria 2320
745 Ga0373943_0045843 3300035170 Bacteria 2132
746 Ga0373924_0001355 3300035410 Bacteria 7900
747 Ga0373924_0005008 3300035410 Bacteria 4662
748 Ga0373935_0027565 3300035692 Bacteria 3512
749 Ga0373935_0088661 3300035692 Bacteria 2021
750 Ga0373927_0146437 3300035695 Bacteria 1546
751 Ga0373933_0026327 3300035724 Bacteria 3339
752 Ga0373933_0038139 3300035724 Bacteria 2823
753 Ga0373947_0017539 3300035725 Bacteria 4118
754 Ga0373947_0105003 3300035725 Bacteria 1779
755 Ga0373937_0003621 3300036401 Bacteria 13032
756 Ga0373937_0006249 3300036401 Bacteria 10274
757 Ga0373937_0013535 3300036401 Bacteria 7184
758 Ga0373937_0045827 3300036401 Bacteria 3997
759 Ga0373937_0282586 3300036401 Bacteria 1567
760 Ga0373925_0031507 3300037068 Bacteria 3897
761 Ga0373925_0062778 3300037068 Bacteria 2794
762 Ga0373925_0274969 3300037068 Bacteria 1355
763 Ga0395899_0000729 3300037312 Bacteria 32868
764 Ga0395899_0000953 3300037312 Bacteria 27077
765 Ga0395899_0004365 3300037312 Bacteria 11030
766 Ga0395899_0142355 3300037312 Bacteria 1705
767 Ga0395900_0003921 3300037418 Bacteria 15886
768 Ga0395900_0012212 3300037418 Bacteria 8780
769 Ga0395900_0013023 3300037418 Bacteria 8498
770 Ga0395900_0013168 3300037418 Bacteria 8453
771 Ga0395900_0023654 3300037418 Bacteria 6285
772 Ga0395900_0042298 3300037418 Bacteria 4694
773 Ga0395900_0299272 3300037418 Bacteria 1595
774 Ga0395898_0002404 3300037466 Bacteria 22217
775 Ga0395898_0021652 3300037466 Bacteria 6516
776 Ga0395898_0029788 3300037466 Bacteria 5463
777 Ga0395905_0000773 3300037471 Bacteria 42104
778 Ga0395905_0002341 3300037471 Bacteria 21134
779 Ga0395905_0006414 3300037471 Bacteria 11843
780 Ga0395905_0007480 3300037471 Bacteria 10866
781 Ga0395905_0008399 3300037471 Bacteria 10183
782 Ga0395905_0025327 3300037471 Bacteria 5594
783 Ga0395905_0034441 3300037471 Bacteria 4755
784 Ga0395905_0127970 3300037471 Bacteria 2388
785 Ga0395905_0148231 3300037471 Bacteria 2208
786 Ga0395905_0156729 3300037471 Bacteria 2141
787 Ga0436364_0001604 3300037853 Bacteria 2885
788 Ga0436364_0810222 3300037853 Bacteria 5386
789 Ga0436364_1195167 3300037853 Bacteria 4748
790 Ga0395901_0015521 3300038443 Bacteria 7756
791 Ga0395901_0210306 3300038443 Bacteria 2036
792 Ga0395901_0221072 3300038443 Bacteria 1979
793 Ga0436365_0085001 3300039437 Bacteria 1220
794 Ga0436365_0697045 3300039437 Bacteria 35162
795 Ga0436361_0206236 3300039447 Bacteria 37288
796 Ga0436363_0279939 3300039450 Bacteria 13836
797 Ga0436363_1334668 3300039450 Bacteria 12831
798 Ga0436362_0430762 3300039453 Bacteria 3666
799 Ga0439436_0010842 3300041404 Bacteria 2776
800 Ga0439447_014462 3300041407 Bacteria 2214
801 Ga0439431_0013721 3300041997 Bacteria 1871
802 Ga0439445_0019986 3300042004 Bacteria 1673
803 Ga0439445_0030848 3300042004 Bacteria 1391
804 Ga0439432_000428 3300042006 Bacteria 15693
805 Ga0439449_0006422 3300042007 Bacteria 4496
806 Ga0439449_0011558 3300042007 Bacteria 3320
807 Ga0439462_0008801 3300042015 Bacteria 2551
808 Ga0450911_000033 3300042115 Bacteria 65955
809 Ga0450911_000416 3300042115 Bacteria 14088
810 Ga0439434_0004056 3300042435 Bacteria 4275
811 Ga0450918_002189 3300042531 Bacteria 3726
812 Ga0451577_0002494 3300042876 Bacteria 21855
813 Ga0466969_0007935 3300044656 Bacteria 5634
814 Ga0453683_0007748 3300044673 Bacteria 7263
815 Ga0466966_0015680 3300044684 Bacteria 5010
816 Ga0466964_0012946 3300044706 Bacteria 3160
817 Ga0453684_0006738 3300044712 Bacteria 21642
818 Ga0453684_0015963 3300044712 Bacteria 11805
819 Ga0453684_0075827 3300044712 Bacteria 4224
820 Ga0466968_0013088 3300044735 Bacteria 3256
821 Ga0466957_0041422 3300044842 Bacteria 2785
822 Ga0466959_0053187 3300045049 Bacteria 2961
823 Ga0451576_0004732 3300045051 Bacteria 17494
824 Ga0451576_0042754 3300045051 Bacteria 4784
825 Ga0451576_0079716 3300045051 Bacteria 3407
826 Ga0466958_0022473 3300045836 Bacteria 3695
827 Ga0495629_0000409 3300046459 Bacteria 35959
828 Ga0495629_0014553 3300046459 Bacteria 5661
829 Ga0495651_0001051 3300046462 Bacteria 21350
830 Ga0495653_0019732 3300046463 Bacteria 5465
831 Ga0495580_0109441 3300046472 Bacteria 1918
832 Ga0495580_0174216 3300046472 Bacteria 1486
833 Ga0495582_0103162 3300046473 Bacteria 1598
834 Ga0495639_0010877 3300046475 Bacteria 3919
835 Ga0495662_0016655 3300046476 Bacteria 3561
836 Ga0495662_0094866 3300046476 Bacteria 1457
837 Ga0495584_0121854 3300046491 Bacteria 1321
838 Ga0495583_0000463 3300046506 Bacteria 59986
839 Ga0495606_0004903 3300046507 Bacteria 13099
840 Ga0495610_0025647 3300046512 Bacteria 3159
841 Ga0495610_0044980 3300046512 Bacteria 2187
842 Ga0495618_0002201 3300046514 Bacteria 12750
843 Ga0495630_0011056 3300046517 Bacteria 6530
844 Ga0495630_0135154 3300046517 Bacteria 1874
845 Ga0495631_0000760 3300046518 Bacteria 20700
846 Ga0495632_0004880 3300046519 Bacteria 8995
847 Ga0495632_0043077 3300046519 Bacteria 2258
848 Ga0495637_0009149 3300046520 Bacteria 4837
849 Ga0495643_0000398 3300046522 Bacteria 57089
850 Ga0495643_0000960 3300046522 Bacteria 29547
851 Ga0495654_0002132 3300046530 Bacteria 12923
852 Ga0495665_0016123 3300046531 Bacteria 4025
853 Ga0495640_0017299 3300046533 Bacteria 5375
854 Ga0495587_0005039 3300046536 Bacteria 8644
855 Ga0495587_0150586 3300046536 Bacteria 1326
856 Ga0495667_0007034 3300046559 Bacteria 7635
857 Ga0495667_0154892 3300046559 Bacteria 1475
858 Ga0495656_0000340 3300046615 Bacteria 15933
859 Ga0495656_0022112 3300046615 Bacteria 2486
860 Ga0495625_0002232 3300046660 Bacteria 21407
861 Ga0495625_0005135 3300046660 Bacteria 12089
862 Ga0495635_0028200 3300046663 Bacteria 3902
863 Ga0495661_0013991 3300046665 Bacteria 5380
864 Ga0495588_0070443 3300046674 Bacteria 1817
865 Ga0495623_0036475 3300046679 Bacteria 3149
866 Ga0495623_0083794 3300046679 Bacteria 1968
867 Ga0495646_0006787 3300046680 Bacteria 7263
868 Ga0495647_0005749 3300046681 Bacteria 4077
869 Ga0495658_0060115 3300046683 Bacteria 2178
870 Ga0495670_0064298 3300046691 Bacteria 1848
871 Ga0495600_0003659 3300046809 Bacteria 9072
872 Ga0495604_0001090 3300047317 Bacteria 22540
873 Ga0495674_0003125 3300047319 Bacteria 16088
874 Ga0495680_0000795 3300047322 Bacteria 35314
875 Ga0495675_0016020 3300047444 Bacteria 4740
876 Ga0495684_0005001 3300047471 Bacteria 10343
877 Ga0495684_0039919 3300047471 Bacteria 3598
878 Ga0495684_0084289 3300047471 Bacteria 2411
879 Ga0495593_0009993 3300047673 Bacteria 5499
880 Ga0495593_0046206 3300047673 Bacteria 2321
881 Ga0495602_0010500 3300048088 Bacteria 9612
882 Ga0495626_0000868 3300048091 Bacteria 26883
883 Ga0495626_0008192 3300048091 Bacteria 5756
884 Ga0495626_0010129 3300048091 Bacteria 5057
885 Ga0495626_0058254 3300048091 Bacteria 1765
886 Ga0496100_0037447 3300048903 Bacteria 3067
887 Ga0496100_0243514 3300048903 Bacteria 1328
888 Ga0496101_0002523 3300048904 Bacteria 11243
889 Ga0496101_0007754 3300048904 Bacteria 6975
890 Ga0496101_0259532 3300048904 Bacteria 1355
891 Ga0496102_0006650 3300048905 Bacteria 9882
892 Ga0496103_0093559 3300048906 Bacteria 1898
893 Ga0496104_0003535 3300048907 Bacteria 13476
894 Ga0496105_0005191 3300048908 Bacteria 9868
895 Ga0496105_0058115 3300048908 Bacteria 3192
896 Ga0496106_0057080 3300048909 Bacteria 2952
897 Ga0496107_0013884 3300048910 Bacteria 5630
898 Ga0496108_0138887 3300048911 Bacteria 2093
899 Ga0496109_0005079 3300048912 Bacteria 10995
900 Ga0496109_0027699 3300048912 Bacteria 5064
901 Ga0496110_0025566 3300048913 Bacteria 5046
902 Ga0496110_0162028 3300048913 Bacteria 2028
903 Ga0496110_0206482 3300048913 Bacteria 1785
904 Ga0496112_0003897 3300048915 Bacteria 12482
905 Ga0496112_0004675 3300048915 Bacteria 11641
906 Ga0496112_0015232 3300048915 Bacteria 7168
907 Ga0496112_0049858 3300048915 Bacteria 4104
908 Ga0496113_0037995 3300048916 Bacteria 3537
909 Ga0496113_0089139 3300048916 Bacteria 2374
910 Ga0496114_0071643 3300048917 Bacteria 2913
911 Ga0496114_0108143 3300048917 Bacteria 2380
912 Ga0496115_0024747 3300048918 Bacteria 4669
913 Ga0496115_0059915 3300048918 Bacteria 3066
914 Ga0496117_0000965 3300048920 Bacteria 44061
915 Ga0496117_0026287 3300048920 Bacteria 4557
916 Ga0496118_0001301 3300048921 Bacteria 38037
917 Ga0496118_0023891 3300048921 Bacteria 5293
918 Ga0496118_0102815 3300048921 Bacteria 1924
919 Ga0496121_0029040 3300048924 Bacteria 5128
920 Ga0496121_0034728 3300048924 Bacteria 4534
921 Ga0496122_0000199 3300048925 Bacteria 133898
922 Ga0496122_0000310 3300048925 Bacteria 107506
923 Ga0496123_0000102 3300048926 Bacteria 169327
924 Ga0496123_0000312 3300048926 Bacteria 93478
925 Ga0496124_0007963 3300048927 Bacteria 11153
926 Ga0496124_0013624 3300048927 Bacteria 7927
927 Ga0496125_0000361 3300048928 Bacteria 85699
928 Ga0496125_0001359 3300048928 Bacteria 36008
929 Ga0496125_0002445 3300048928 Bacteria 24130
930 Ga0496125_0011871 3300048928 Bacteria 8678
931 Ga0496125_0026569 3300048928 Bacteria 5270
932 Ga0496125_0185624 3300048928 Bacteria 1380
933 Ga0496126_0076353 3300048929 Bacteria 2972
934 Ga0501033_0147141 3300049570 Bacteria 1701
935 Ga0501037_0044434 3300049573 Bacteria 3263
936 Ga0501037_0048122 3300049573 Bacteria 3125
937 Ga0501038_0050943 3300049574 Bacteria 3576
938 Ga0501039_0004592 3300049575 Bacteria 10444
939 Ga0501041_0001425 3300049577 Bacteria 13218
940 Ga0501043_0041705 3300049579 Bacteria 3606
941 Ga0501047_0055347 3300049581 Bacteria 3837
942 Ga0501071_0020912 3300049587 Bacteria 4553
943 Ga0501072_0096621 3300049588 Bacteria 2347
944 Ga0501076_0002101 3300049592 Bacteria 13659
945 Ga0501079_0000442 3300049741 Bacteria 26958
946 Ga0501080_0005112 3300049742 Bacteria 11689
947 Ga0501081_0001609 3300049743 Bacteria 13933
948 Ga0501083_0022417 3300049744 Bacteria 4384
949 Ga0501262_000023 3300049759 Bacteria 21585
950 Ga0501262_000311 3300049759 Bacteria 5938
951 Ga0501045_0016595 3300049824 Bacteria 5232
952 nmdc:mga03683_16298_c1 3300050489 Bacteria 2789
953 nmdc:mga03683_49284_c1 3300050489 Bacteria 1753
954 nmdc:mga00v17_16695_c1 3300050491 Bacteria 4141
955 nmdc:mga0k408_100441_c1 3300050493 Bacteria 1706
956 nmdc:mga0k408_109991_c1 3300050493 Bacteria 1629
957 nmdc:mga0k408_17256_c1 3300050493 Bacteria 4019
958 nmdc:mga0k408_29173_c1 3300050493 Bacteria 3140
959 nmdc:mga0k408_3909_c1 3300050493 Bacteria 7898
960 nmdc:mga0k408_44496_c1 3300050493 Bacteria 2560
961 nmdc:mga0k408_47553_c1 3300050493 Bacteria 2480
962 nmdc:mga06z11_157283_c1 3300050494 Bacteria 1297
963 nmdc:mga07m45_20766_c1 3300050496 Bacteria 3569
964 nmdc:mga07m45_357_c1 3300050496 Bacteria 18685
965 nmdc:mga07m45_4231_c1 3300050496 Bacteria 7024
966 nmdc:mga07m45_6994_c1 3300050496 Bacteria 5739
967 nmdc:mga07m45_94235_c1 3300050496 Bacteria 1717
968 nmdc:mga0n895_325932_c1 3300050512 Bacteria 1556
969 nmdc:mga0sz30_5942_c1 3300050516 Bacteria 4503
970 nmdc:mga0sz30_96834_c1 3300050516 Bacteria 1287
971 Ga0495601_0059253 3300053077 Bacteria 2428
972 Ga0495595_0001232 3300053084 Bacteria 9952
973 Ga0495619_0001190 3300053085 Bacteria 17140
974 Ga0495619_0011643 3300053085 Bacteria 5541
975 Ga0495619_0032340 3300053085 Bacteria 3394
976 Ga0500583_0037911 3300053092 Bacteria 2167
977 Ga0500651_0000165 3300053093 Bacteria 42850
978 Ga0500651_0124697 3300053093 Bacteria 1561
979 Ga0500641_0025876 3300053096 Bacteria 2274
980 Ga0500562_005454 3300053108 Bacteria 3194
981 Ga0500571_000235 3300053110 Bacteria 20748
982 Ga0500618_013591 3300053125 Bacteria 2098
983 Ga0500658_0000102 3300053134 Bacteria 39059
984 Ga0500658_0000693 3300053134 Bacteria 13911
985 Ga0500559_0007382 3300053136 Bacteria 4876
986 Ga0500559_0009091 3300053136 Bacteria 4317
987 Ga0500568_0000375 3300053139 Bacteria 34271
988 Ga0500568_0008065 3300053139 Bacteria 5111
989 Ga0500586_029290 3300053145 Bacteria 1804
990 Ga0500590_022668 3300053148 Bacteria 3264
991 Ga0500616_0029700 3300053153 Bacteria 3007
992 Ga0500616_0046223 3300053153 Bacteria 2315
993 Ga0500616_0095962 3300053153 Bacteria 1458
994 Ga0500622_0011106 3300053156 Bacteria 4917
995 Ga0500634_0038674 3300053161 Bacteria 2593
996 Ga0500638_055171 3300053162 Bacteria 1915
997 Ga0500570_037731 3300053724 Bacteria 2554
998 Ga0500645_000250 3300053730 Bacteria 40018
999 Ga0501084_0034987 3300054114 Bacteria 4200
1000 Ga0501082_0016744 3300060353 Bacteria 6312
1001 Ga0466962_0015127 3300061719 Bacteria 3720
1002 Ga0466962_0105467 3300061719 Bacteria 1355
1003 Ga0530510_0083125 3300061734 Bacteria 2332

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049579 Ga0501043_0041705 Ga0501043_0041705_2066_3061 328
2 3300025923 Ga0207681_10066479 Ga0207681_100664792 352
3 3300036401 Ga0373937_0006249 Ga0373937_0006249_4577_5764 352
4 3300046691 Ga0495670_0064298 Ga0495670_0064298_10_1074 353
5 3300014968 Ga0157379_10024195 Ga0157379_100241952 354
6 3300027876 Ga0209974_10000572 Ga0209974_1000057212 355
7 3300028794 Ga0307515_10002980 Ga0307515_1000298013 356
8 3300031730 Ga0307516_10004894 Ga0307516_100048949 356
9 3300046519 Ga0495632_0043077 Ga0495632_0043077_16_1185 356
10 3300050493 nmdc:mga0k408_47553_c1 nmdc:mga0k408_47553_c1_897_2066 356
11 3300053724 Ga0500570_037731 Ga0500570_037731_878_2047 356
12 3300028794 Ga0307515_10000911 Ga0307515_1000091151 357
13 3300028794 Ga0307515_10002263 Ga0307515_1000226317 357
14 3300030522 Ga0307512_10012428 Ga0307512_100124284 357
15 3300031507 Ga0307509_10028187 Ga0307509_100281875 357
16 3300031616 Ga0307508_10000101 Ga0307508_1000010148 357
17 3300005618 Ga0068864_100036399 Ga0068864_1000363992 361
18 3300025908 Ga0207643_10014273 Ga0207643_100142733 361
19 3300025925 Ga0207650_10001039 Ga0207650_1000103912 361
20 3300045051 Ga0451576_0079716 Ga0451576_0079716_1849_3036 361
21 3300005841 Ga0068863_100057950 Ga0068863_1000579502 362
22 3300026088 Ga0207641_10108018 Ga0207641_101080182 362
23 3300053148 Ga0500590_022668 Ga0500590_022668_990_2222 362
24 3300005841 Ga0068863_100186824 Ga0068863_1001868242 363
25 3300005331 Ga0070670_100295398 Ga0070670_1002953981 364
26 3300005333 Ga0070677_10008730 Ga0070677_100087303 364
27 3300005353 Ga0070669_100037434 Ga0070669_1000374342 364
28 3300005354 Ga0070675_100115299 Ga0070675_1001152991 364
29 3300005355 Ga0070671_100011447 Ga0070671_1000114472 364
30 3300005364 Ga0070673_100001613 Ga0070673_1000016136 364
31 3300005459 Ga0068867_100065386 Ga0068867_1000653862 364
32 3300005564 Ga0070664_100043072 Ga0070664_1000430723 364
33 3300005618 Ga0068864_100014639 Ga0068864_1000146397 364
34 3300025893 Ga0207682_10000930 Ga0207682_100009306 364
35 3300025923 Ga0207681_10013644 Ga0207681_100136442 364
36 3300025925 Ga0207650_10012479 Ga0207650_100124795 364
37 3300025926 Ga0207659_10018283 Ga0207659_100182833 364
38 3300025931 Ga0207644_10014552 Ga0207644_100145524 364
39 3300025940 Ga0207691_10002250 Ga0207691_1000225017 364
40 3300025945 Ga0207679_10045774 Ga0207679_100457745 364
41 3300025960 Ga0207651_10001535 Ga0207651_100015354 364
42 3300025972 Ga0207668_10042208 Ga0207668_100422082 364
43 3300026023 Ga0207677_10069671 Ga0207677_100696711 364
44 3300026095 Ga0207676_10191354 Ga0207676_101913542 364
45 3300026121 Ga0207683_10020310 Ga0207683_100203105 364
46 3300005328 Ga0070676_10033636 Ga0070676_100336363 365
47 3300025907 Ga0207645_10023328 Ga0207645_100233283 365
48 3300025981 Ga0207640_10032378 Ga0207640_100323783 365
49 3300032005 Ga0307411_10141963 Ga0307411_101419632 365
50 3300035695 Ga0373927_0146437 Ga0373927_0146437_73_1185 365
51 3300046681 Ga0495647_0005749 Ga0495647_0005749_2921_4033 365
52 3300005843 Ga0068860_100056478 Ga0068860_1000564782 366
53 3300026035 Ga0207703_10135870 Ga0207703_101358702 366
54 3300026088 Ga0207641_10119563 Ga0207641_101195632 366
55 3300028381 Ga0268264_10018448 Ga0268264_100184485 366
56 3300031731 Ga0307405_10005204 Ga0307405_100052044 366
57 3300031824 Ga0307413_10086242 Ga0307413_100862421 366
58 3300031995 Ga0307409_100234697 Ga0307409_1002346971 366
59 3300048912 Ga0496109_0027699 Ga0496109_0027699_1103_2281 367
60 iso_pu_bacteria 2895511927 2895517930 367
61 3300005330 Ga0070690_100002924 Ga0070690_1000029242 368
62 3300005331 Ga0070670_100007034 Ga0070670_1000070348 368
63 3300005335 Ga0070666_10012986 Ga0070666_100129863 368
64 3300005338 Ga0068868_100008142 Ga0068868_1000081427 368
65 3300005340 Ga0070689_100034325 Ga0070689_1000343254 368
66 3300005354 Ga0070675_100090277 Ga0070675_1000902772 368
67 3300005355 Ga0070671_100123092 Ga0070671_1001230921 368
68 3300005364 Ga0070673_100000830 Ga0070673_10000083013 368
69 3300005365 Ga0070688_100001343 Ga0070688_1000013437 368
70 3300005367 Ga0070667_100069343 Ga0070667_1000693432 368
71 3300005434 Ga0070709_10008071 Ga0070709_100080713 368
72 3300005436 Ga0070713_100001983 Ga0070713_1000019838 368
73 3300005439 Ga0070711_100009608 Ga0070711_1000096084 368
74 3300005466 Ga0070685_10000750 Ga0070685_1000075015 368
75 3300005535 Ga0070684_100159330 Ga0070684_1001593302 368
76 3300005548 Ga0070665_100001071 Ga0070665_1000010718 368
77 3300005614 Ga0068856_100041356 Ga0068856_1000413562 368
78 3300005617 Ga0068859_100000299 Ga0068859_10000029941 368
79 3300005618 Ga0068864_100000973 Ga0068864_10000097320 368
80 3300005841 Ga0068863_100008043 Ga0068863_1000080437 368
81 3300005843 Ga0068860_100058929 Ga0068860_1000589293 368
82 3300006163 Ga0070715_10041445 Ga0070715_100414452 368
83 3300006173 Ga0070716_100009928 Ga0070716_1000099282 368
84 3300006175 Ga0070712_100002075 Ga0070712_10000207513 368
85 3300006237 Ga0097621_100034930 Ga0097621_1000349303 368
86 3300006358 Ga0068871_100067809 Ga0068871_1000678092 368
87 3300006931 Ga0097620_100000299 Ga0097620_10000029941 368
88 3300009098 Ga0105245_10009237 Ga0105245_100092378 368
89 3300009101 Ga0105247_10005757 Ga0105247_100057572 368
90 3300009176 Ga0105242_10121367 Ga0105242_101213672 368
91 3300011119 Ga0105246_10176241 Ga0105246_101762412 368
92 3300013296 Ga0157374_10008825 Ga0157374_100088258 368
93 3300013297 Ga0157378_10010946 Ga0157378_100109468 368
94 3300013306 Ga0163162_10014511 Ga0163162_100145118 368
95 3300013308 Ga0157375_10002234 Ga0157375_100022348 368
96 3300014325 Ga0163163_10017385 Ga0163163_100173858 368
97 3300014745 Ga0157377_10036460 Ga0157377_100364602 368
98 3300014968 Ga0157379_10004346 Ga0157379_100043467 368
99 3300014969 Ga0157376_10010329 Ga0157376_100103298 368
100 3300025898 Ga0207692_10050644 Ga0207692_100506441 368
101 3300025900 Ga0207710_10012742 Ga0207710_100127422 368
102 3300025903 Ga0207680_10003924 Ga0207680_100039243 368
103 3300025906 Ga0207699_10007585 Ga0207699_100075853 368
104 3300025915 Ga0207693_10000405 Ga0207693_1000040532 368
105 3300025916 Ga0207663_10003087 Ga0207663_100030873 368
106 3300025918 Ga0207662_10004572 Ga0207662_100045722 368
107 3300025925 Ga0207650_10047698 Ga0207650_100476983 368
108 3300025926 Ga0207659_10062930 Ga0207659_100629301 368
109 3300025927 Ga0207687_10005515 Ga0207687_100055153 368
110 3300025928 Ga0207700_10001855 Ga0207700_100018558 368
111 3300025931 Ga0207644_10008705 Ga0207644_100087051 368
112 3300025934 Ga0207686_10236463 Ga0207686_102364631 368
113 3300025936 Ga0207670_10013702 Ga0207670_100137025 368
114 3300025941 Ga0207711_10000320 Ga0207711_1000032042 368
115 3300025960 Ga0207651_10011801 Ga0207651_100118014 368
116 3300025986 Ga0207658_10062420 Ga0207658_100624202 368
117 3300026023 Ga0207677_10001129 Ga0207677_100011299 368
118 3300026035 Ga0207703_10000377 Ga0207703_100003779 368
119 3300026078 Ga0207702_10029549 Ga0207702_100295492 368
120 3300026088 Ga0207641_10007514 Ga0207641_100075148 368
121 3300026095 Ga0207676_10015861 Ga0207676_100158614 368
122 3300028379 Ga0268266_10013197 Ga0268266_100131977 368
123 3300035086 Ga0373934_0031443 Ga0373934_0031443_747_1931 368
124 3300035089 Ga0373944_0012434 Ga0373944_0012434_914_2098 368
125 3300035118 Ga0373954_0056826 Ga0373954_0056826_501_1685 368
126 3300035119 Ga0373956_0037296 Ga0373956_0037296_449_1639 368
127 3300035120 Ga0373957_0009807 Ga0373957_0009807_1387_2571 368
128 3300035170 Ga0373943_0037724 Ga0373943_0037724_690_1880 368
129 3300035410 Ga0373924_0001355 Ga0373924_0001355_796_1980 368
130 3300035692 Ga0373935_0027565 Ga0373935_0027565_981_2165 368
131 3300035692 Ga0373935_0088661 Ga0373935_0088661_527_1717 368
132 3300035724 Ga0373933_0026327 Ga0373933_0026327_1896_3080 368
133 3300035725 Ga0373947_0017539 Ga0373947_0017539_712_1896 368
134 3300035725 Ga0373947_0105003 Ga0373947_0105003_165_1355 368
135 3300036401 Ga0373937_0013535 Ga0373937_0013535_5428_6612 368
136 3300036401 Ga0373937_0045827 Ga0373937_0045827_2179_3363 368
137 3300037068 Ga0373925_0031507 Ga0373925_0031507_180_1364 368
138 3300046459 Ga0495629_0014553 Ga0495629_0014553_2385_3569 368
139 3300046472 Ga0495580_0109441 Ga0495580_0109441_637_1821 368
140 3300046472 Ga0495580_0174216 Ga0495580_0174216_44_1228 368
141 3300046475 Ga0495639_0010877 Ga0495639_0010877_2001_3185 368
142 3300046476 Ga0495662_0016655 Ga0495662_0016655_1467_2651 368
143 3300046517 Ga0495630_0135154 Ga0495630_0135154_321_1505 368
144 3300046531 Ga0495665_0016123 Ga0495665_0016123_2180_3364 368
145 3300046679 Ga0495623_0036475 Ga0495623_0036475_567_1757 368
146 3300046683 Ga0495658_0060115 Ga0495658_0060115_333_1517 368
147 3300047471 Ga0495684_0039919 Ga0495684_0039919_424_1608 368
148 3300047471 Ga0495684_0084289 Ga0495684_0084289_390_1574 368
149 3300048903 Ga0496100_0037447 Ga0496100_0037447_1244_2428 368
150 3300048904 Ga0496101_0259532 Ga0496101_0259532_75_1265 368
151 3300048907 Ga0496104_0003535 Ga0496104_0003535_7021_8211 368
152 3300048908 Ga0496105_0005191 Ga0496105_0005191_5384_6574 368
153 3300048911 Ga0496108_0138887 Ga0496108_0138887_562_1746 368
154 3300048915 Ga0496112_0003897 Ga0496112_0003897_5336_6520 368
155 3300048917 Ga0496114_0071643 Ga0496114_0071643_441_1631 368
156 3300048918 Ga0496115_0024747 Ga0496115_0024747_2730_3914 368
157 3300053085 Ga0495619_0011643 Ga0495619_0011643_2063_3247 368
158 3300009036 Ga0105244_10001156 Ga0105244_1000115614 369
159 3300009148 Ga0105243_10002240 Ga0105243_1000224014 369
160 3300013306 Ga0163162_10361502 Ga0163162_103615021 369
161 3300014497 Ga0182008_10006370 Ga0182008_100063701 369
162 3300015261 Ga0182006_1001535 Ga0182006_100153513 369
163 3300046518 Ga0495631_0000760 Ga0495631_0000760_12034_13155 369
164 3300046522 Ga0495643_0000960 Ga0495643_0000960_1232_2449 369
165 3300048091 Ga0495626_0008192 Ga0495626_0008192_1430_2647 369
166 3300048921 Ga0496118_0102815 Ga0496118_0102815_62_1180 369
167 3300003187 JGI25151J46595_10006514 JGI25151J46595_100065145 370
168 3300005543 Ga0070672_100135704 Ga0070672_1001357042 370
169 3300025294 Ga0209025_1000743 Ga0209025_100074315 370
170 3300036401 Ga0373937_0282586 Ga0373937_0282586_42_1283 370
171 3300037068 Ga0373925_0062778 Ga0373925_0062778_1178_2419 370
172 3300046473 Ga0495582_0103162 Ga0495582_0103162_208_1389 370
173 3300046559 Ga0495667_0154892 Ga0495667_0154892_52_1293 370
174 3300053077 Ga0495601_0059253 Ga0495601_0059253_824_2065 370
175 3300005355 Ga0070671_100002319 Ga0070671_1000023195 371
176 3300005356 Ga0070674_100051434 Ga0070674_1000514342 371
177 3300006358 Ga0068871_100020380 Ga0068871_1000203802 371
178 3300009177 Ga0105248_10028897 Ga0105248_100288972 371
179 3300025893 Ga0207682_10012418 Ga0207682_100124183 371
180 3300025931 Ga0207644_10000236 Ga0207644_1000023633 371
181 3300025934 Ga0207686_10035034 Ga0207686_100350342 371
182 3300025941 Ga0207711_10009403 Ga0207711_100094032 371
183 3300046536 Ga0495587_0150586 Ga0495587_0150586_125_1315 371
184 3300026089 Ga0207648_10220242 Ga0207648_102202422 372
185 3300005327 Ga0070658_10050911 Ga0070658_100509111 373
186 3300005339 Ga0070660_100004674 Ga0070660_1000046749 373
187 3300005344 Ga0070661_100002145 Ga0070661_10000214513 373
188 3300005366 Ga0070659_100051896 Ga0070659_1000518962 373
189 3300005435 Ga0070714_100005399 Ga0070714_1000053997 373
190 3300005458 Ga0070681_10110400 Ga0070681_101104003 373
191 3300005535 Ga0070684_100009859 Ga0070684_1000098594 373
192 3300005563 Ga0068855_100014542 Ga0068855_1000145429 373
193 3300005564 Ga0070664_100006995 Ga0070664_1000069954 373
194 3300005577 Ga0068857_100002632 Ga0068857_1000026323 373
195 3300005614 Ga0068856_100035047 Ga0068856_1000350474 373
196 3300005616 Ga0068852_100003642 Ga0068852_1000036429 373
197 3300009093 Ga0105240_10060157 Ga0105240_100601573 373
198 3300009174 Ga0105241_10025815 Ga0105241_100258154 373
199 3300009551 Ga0105238_10030064 Ga0105238_100300643 373
200 3300013100 Ga0157373_10013744 Ga0157373_100137442 373
201 3300013102 Ga0157371_10043853 Ga0157371_100438533 373
202 3300013105 Ga0157369_10040205 Ga0157369_100402053 373
203 3300013307 Ga0157372_10031835 Ga0157372_100318356 373
204 3300025911 Ga0207654_10090825 Ga0207654_100908252 373
205 3300025912 Ga0207707_10082168 Ga0207707_100821683 373
206 3300025913 Ga0207695_10062000 Ga0207695_100620003 373
207 3300025919 Ga0207657_10030031 Ga0207657_100300312 373
208 3300025924 Ga0207694_10029379 Ga0207694_100293791 373
209 3300025929 Ga0207664_10089203 Ga0207664_100892032 373
210 3300025945 Ga0207679_10008059 Ga0207679_100080593 373
211 3300025945 Ga0207679_10133938 Ga0207679_101339381 373
212 3300025949 Ga0207667_10048599 Ga0207667_100485993 373
213 3300026041 Ga0207639_10078064 Ga0207639_100780642 373
214 3300026078 Ga0207702_10035879 Ga0207702_100358793 373
215 3300026116 Ga0207674_10002241 Ga0207674_1000224124 373
216 3300026142 Ga0207698_10034839 Ga0207698_100348393 373
217 3300044712 Ga0453684_0006738 Ga0453684_0006738_2285_3469 373
218 3300002987 JGI25159J45721_1000228 JGI25159J45721_100022814 374
219 3300003354 JGI25160J50197_1000076 JGI25160J50197_100007631 374
220 3300003374 JGI25161J50226_1000058 JGI25161J50226_100005862 374
221 3300004625 Ga0055543_1001562 Ga0055543_10015623 374
222 3300005434 Ga0070709_10086488 Ga0070709_100864882 374
223 3300005843 Ga0068860_100226510 Ga0068860_1002265102 374
224 3300025208 Ga0209436_104850 Ga0209436_1048503 374
225 3300025284 Ga0209130_1000014 Ga0209130_1000014289 374
226 3300025291 Ga0209675_1006949 Ga0209675_10069494 374
227 3300025298 Ga0209050_1003172 Ga0209050_10031722 374
228 3300025302 Ga0207426_1000174 Ga0207426_1000174102 374
229 3300028794 Ga0307515_10000257 Ga0307515_10000257108 374
230 3300030521 Ga0307511_10000086 Ga0307511_1000008650 374
231 3300031649 Ga0307514_10001925 Ga0307514_100019255 374
232 3300046530 Ga0495654_0002132 Ga0495654_0002132_5875_7047 374
233 3300049581 Ga0501047_0055347 Ga0501047_0055347_790_1947 374
234 3300053092 Ga0500583_0037911 Ga0500583_0037911_340_1512 374
235 3300053093 Ga0500651_0124697 Ga0500651_0124697_189_1385 374
236 3300053096 Ga0500641_0025876 Ga0500641_0025876_1015_2187 374
237 iso_pu_bacteria 2585428062 2587757075 374
238 3300005436 Ga0070713_100000260 Ga0070713_1000002602 375
239 3300009177 Ga0105248_10180854 Ga0105248_101808541 375
240 3300013296 Ga0157374_10168342 Ga0157374_101683423 375
241 3300014968 Ga0157379_10004260 Ga0157379_100042603 375
242 3300026035 Ga0207703_10013218 Ga0207703_100132185 375
243 3300046476 Ga0495662_0094866 Ga0495662_0094866_30_1193 375
244 3300046512 Ga0495610_0025647 Ga0495610_0025647_282_1478 375
245 3300048913 Ga0496110_0162028 Ga0496110_0162028_530_1687 375
246 3300053153 Ga0500616_0046223 Ga0500616_0046223_565_1761 375
247 3300053156 Ga0500622_0011106 Ga0500622_0011106_696_1892 375
248 iso_pu_bacteria 2511231002 2511243313 375
249 iso_pu_bacteria 2738543012 2739244323 375
250 iso_pu_bacteria 2816332133 2816469754 375
251 iso_pu_bacteria 2821443989 2821450559 375
252 iso_pu_bacteria 2842747753 2842748630 375
253 3300005328 Ga0070676_10004686 Ga0070676_100046869 376
254 3300005333 Ga0070677_10002614 Ga0070677_100026148 376
255 3300005334 Ga0068869_100201196 Ga0068869_1002011962 376
256 3300005335 Ga0070666_10017401 Ga0070666_100174013 376
257 3300005338 Ga0068868_100011759 Ga0068868_1000117592 376
258 3300005347 Ga0070668_100002160 Ga0070668_10000216011 376
259 3300005354 Ga0070675_100019421 Ga0070675_1000194218 376
260 3300005355 Ga0070671_100000803 Ga0070671_1000008035 376
261 3300005356 Ga0070674_100000274 Ga0070674_10000027412 376
262 3300005356 Ga0070674_100015585 Ga0070674_1000155851 376
263 3300005364 Ga0070673_100000502 Ga0070673_10000050224 376
264 3300005367 Ga0070667_100010428 Ga0070667_1000104289 376
265 3300005367 Ga0070667_100027156 Ga0070667_1000271561 376
266 3300005367 Ga0070667_100126214 Ga0070667_1001262142 376
267 3300005441 Ga0070700_100047209 Ga0070700_1000472092 376
268 3300005456 Ga0070678_100002201 Ga0070678_1000022012 376
269 3300005456 Ga0070678_100003193 Ga0070678_10000319312 376
270 3300005456 Ga0070678_100107996 Ga0070678_1001079962 376
271 3300005459 Ga0068867_100001459 Ga0068867_10000145915 376
272 3300005459 Ga0068867_100002610 Ga0068867_10000261014 376
273 3300005539 Ga0068853_100008837 Ga0068853_1000088379 376
274 3300005543 Ga0070672_100000202 Ga0070672_10000020215 376
275 3300005543 Ga0070672_100222122 Ga0070672_1002221221 376
276 3300005548 Ga0070665_100000982 Ga0070665_10000098233 376
277 3300005548 Ga0070665_100014568 Ga0070665_1000145689 376
278 3300005616 Ga0068852_100002427 Ga0068852_1000024279 376
279 3300005618 Ga0068864_100017389 Ga0068864_1000173895 376
280 3300005718 Ga0068866_10007175 Ga0068866_100071752 376
281 3300005719 Ga0068861_100047283 Ga0068861_1000472833 376
282 3300005719 Ga0068861_100078425 Ga0068861_1000784252 376
283 3300005834 Ga0068851_10005924 Ga0068851_100059242 376
284 3300005840 Ga0068870_10027062 Ga0068870_100270624 376
285 3300005841 Ga0068863_100036282 Ga0068863_1000362821 376
286 3300005843 Ga0068860_100001383 Ga0068860_10000138312 376
287 3300005843 Ga0068860_100038831 Ga0068860_1000388313 376
288 3300006048 Ga0075363_100065389 Ga0075363_1000653892 376
289 3300006051 Ga0075364_10091324 Ga0075364_100913242 376
290 3300006177 Ga0075362_10071687 Ga0075362_100716872 376
291 3300006195 Ga0075366_10008556 Ga0075366_100085562 376
292 3300006195 Ga0075366_10043910 Ga0075366_100439103 376
293 3300006195 Ga0075366_10138889 Ga0075366_101388892 376
294 3300006881 Ga0068865_100014828 Ga0068865_1000148283 376
295 3300009093 Ga0105240_10014739 Ga0105240_100147395 376
296 3300009148 Ga0105243_10062928 Ga0105243_100629283 376
297 3300009553 Ga0105249_10064275 Ga0105249_100642753 376
298 3300013297 Ga0157378_10002940 Ga0157378_100029408 376
299 3300013306 Ga0163162_10009038 Ga0163162_100090388 376
300 3300013308 Ga0157375_10001479 Ga0157375_1000147915 376
301 3300013308 Ga0157375_10069870 Ga0157375_100698702 376
302 3300014326 Ga0157380_10005798 Ga0157380_100057987 376
303 3300014969 Ga0157376_10031559 Ga0157376_100315592 376
304 3300017792 Ga0163161_10161183 Ga0163161_101611832 376
305 3300025893 Ga0207682_10001271 Ga0207682_100012718 376
306 3300025893 Ga0207682_10035668 Ga0207682_100356682 376
307 3300025899 Ga0207642_10071197 Ga0207642_100711972 376
308 3300025907 Ga0207645_10000242 Ga0207645_100002423 376
309 3300025908 Ga0207643_10037378 Ga0207643_100373783 376
310 3300025931 Ga0207644_10003418 Ga0207644_1000341810 376
311 3300025937 Ga0207669_10002721 Ga0207669_100027217 376
312 3300025937 Ga0207669_10003694 Ga0207669_100036943 376
313 3300025937 Ga0207669_10117174 Ga0207669_101171741 376
314 3300025938 Ga0207704_10006650 Ga0207704_100066506 376
315 3300025940 Ga0207691_10000084 Ga0207691_1000008439 376
316 3300025940 Ga0207691_10232243 Ga0207691_102322431 376
317 3300025942 Ga0207689_10146300 Ga0207689_101463001 376
318 3300025961 Ga0207712_10163635 Ga0207712_101636352 376
319 3300025972 Ga0207668_10011750 Ga0207668_100117503 376
320 3300025972 Ga0207668_10088267 Ga0207668_100882672 376
321 3300025986 Ga0207658_10028994 Ga0207658_100289945 376
322 3300025986 Ga0207658_10037345 Ga0207658_100373452 376
323 3300025986 Ga0207658_10123511 Ga0207658_101235112 376
324 3300026023 Ga0207677_10088010 Ga0207677_100880102 376
325 3300026035 Ga0207703_10018081 Ga0207703_100180811 376
326 3300026041 Ga0207639_10009290 Ga0207639_100092908 376
327 3300026067 Ga0207678_10024411 Ga0207678_100244112 376
328 3300026075 Ga0207708_10080307 Ga0207708_100803072 376
329 3300026088 Ga0207641_10141317 Ga0207641_101413172 376
330 3300026089 Ga0207648_10000799 Ga0207648_1000079924 376
331 3300026089 Ga0207648_10002006 Ga0207648_1000200615 376
332 3300026095 Ga0207676_10080947 Ga0207676_100809473 376
333 3300026118 Ga0207675_100003220 Ga0207675_1000032204 376
334 3300026118 Ga0207675_100016216 Ga0207675_1000162163 376
335 3300026121 Ga0207683_10000003 Ga0207683_10000003136 376
336 3300026121 Ga0207683_10016614 Ga0207683_100166143 376
337 3300026121 Ga0207683_10135533 Ga0207683_101355332 376
338 3300026142 Ga0207698_10006587 Ga0207698_100065879 376
339 3300028379 Ga0268266_10064760 Ga0268266_100647603 376
340 3300028379 Ga0268266_10372303 Ga0268266_103723031 376
341 3300028381 Ga0268264_10002625 Ga0268264_1000262515 376
342 3300028381 Ga0268264_10025144 Ga0268264_100251443 376
343 3300031711 Ga0265314_10061543 Ga0265314_100615431 376
344 3300044712 Ga0453684_0075827 Ga0453684_0075827_2156_3313 376
345 3300045051 Ga0451576_0042754 Ga0451576_0042754_3127_4284 376
346 3300048915 Ga0496112_0004675 Ga0496112_0004675_3345_4508 376
347 3300050489 nmdc:mga03683_16298_c1 nmdc:mga03683_16298_c1_546_1718 376
348 3300050491 nmdc:mga00v17_16695_c1 nmdc:mga00v17_16695_c1_908_2080 376
349 3300050493 nmdc:mga0k408_100441_c1 nmdc:mga0k408_100441_c1_139_1326 376
350 3300050493 nmdc:mga0k408_109991_c1 nmdc:mga0k408_109991_c1_256_1422 376
351 3300050493 nmdc:mga0k408_29173_c1 nmdc:mga0k408_29173_c1_1520_2692 376
352 3300050493 nmdc:mga0k408_44496_c1 nmdc:mga0k408_44496_c1_1258_2424 376
353 3300050494 nmdc:mga06z11_157283_c1 nmdc:mga06z11_157283_c1_87_1259 376
354 iso_pu_bacteria 2513020051 2513227893 376
355 iso_pu_bacteria 2599185214 2599624234 376
356 iso_pu_bacteria 2599185226 2599672246 376
357 iso_pu_bacteria 2599185227 2599681670 376
358 iso_pu_bacteria 2599185229 2599693684 376
359 iso_pu_bacteria 2643221628 2644162707 376
360 iso_pu_bacteria 2643221658 2644328902 376
361 iso_pu_bacteria 2643221672 2644397732 376
362 iso_pu_bacteria 2738541307 2738879766 376
363 iso_pu_bacteria 2818991446 2819596601 376
364 iso_pu_bacteria 2831265667 2831267929 376
365 iso_pu_bacteria 2838054893 2838060129 376
366 iso_pu_bacteria 2842677519 2842677904 376
367 iso_pu_bacteria 2842733646 2842735629 376
368 iso_pu_bacteria 2885198086 2885199318 376
369 iso_pu_bacteria 2885211737 2885212969 376
370 iso_pu_bacteria 2899924645 2899931319 376
371 iso_pu_bacteria 2904449895 2904450179 376
372 iso_pu_bacteria 2904456579 2904456998 376
373 iso_pu_bacteria 2904541872 2904544035 376
374 iso_pu_bacteria 2919462493 2919464808 376
375 iso_pu_bacteria 2928037797 2928037908 376
376 iso_pu_bacteria 2928044640 2928046486 376
377 iso_pu_bacteria 2928051484 2928054181 376
378 iso_pu_bacteria 2928064002 2928065934 376
379 iso_pu_bacteria 2928070936 2928076841 376
380 iso_pu_bacteria 2928084124 2928087853 376
381 iso_pu_bacteria 2929160207 2929162406 376
382 iso_pu_bacteria 2929520902 2929525514 376
383 iso_pu_bacteria 2945945610 2945948839 376
384 iso_pu_bacteria 2945972063 2945972959 376
385 iso_pu_bacteria 2945984333 2945984502 376
386 iso_pu_bacteria 2954767861 2954772974 376
387 3300005331 Ga0070670_100075632 Ga0070670_1000756323 377
388 3300005338 Ga0068868_100160542 Ga0068868_1001605421 377
389 3300005347 Ga0070668_100036588 Ga0070668_1000365883 377
390 3300005355 Ga0070671_100270747 Ga0070671_1002707471 377
391 3300005455 Ga0070663_100230053 Ga0070663_1002300532 377
392 3300005543 Ga0070672_100139403 Ga0070672_1001394032 377
393 3300005841 Ga0068863_100106122 Ga0068863_1001061223 377
394 3300006186 Ga0075369_10106548 Ga0075369_101065481 377
395 3300006358 Ga0068871_100039339 Ga0068871_1000393394 377
396 3300025925 Ga0207650_10154738 Ga0207650_101547381 377
397 3300025931 Ga0207644_10014708 Ga0207644_100147085 377
398 3300025940 Ga0207691_10114013 Ga0207691_101140132 377
399 3300025972 Ga0207668_10019585 Ga0207668_100195853 377
400 3300025972 Ga0207668_10186334 Ga0207668_101863341 377
401 3300026067 Ga0207678_10047219 Ga0207678_100472192 377
402 3300026121 Ga0207683_10066195 Ga0207683_100661952 377
403 3300050516 nmdc:mga0sz30_96834_c1 nmdc:mga0sz30_96834_c1_100_1269 377
404 iso_pu_bacteria 2547132374 2548500330 377
405 iso_pu_bacteria 2643221570 2643864634 377
406 iso_pu_bacteria 2643221596 2643992751 377
407 iso_pu_bacteria 2643221609 2644058335 377
408 iso_pu_bacteria 2643221611 2644073387 377
409 iso_pu_bacteria 2643221652 2644296430 377
410 iso_pu_bacteria 2643221683 2644469044 377
411 iso_pu_bacteria 2643221717 2644647121 377
412 iso_pu_bacteria 2738541277 2738719825 377
413 iso_pu_bacteria 2738543013 2739252254 377
414 iso_pu_bacteria 2738543019 2739279024 377
415 iso_pu_bacteria 2928115317 2928117845 377
416 iso_pu_bacteria 2990710928 2990715216 377
417 3300003792 Ga0055540_1003974 Ga0055540_10039746 378
418 3300003794 Ga0055531_10001335 Ga0055531_1000133518 378
419 3300005329 Ga0070683_100026059 Ga0070683_1000260596 378
420 3300005339 Ga0070660_100060830 Ga0070660_1000608302 378
421 3300005344 Ga0070661_100006191 Ga0070661_1000061912 378
422 3300005535 Ga0070684_100020569 Ga0070684_1000205696 378
423 3300005564 Ga0070664_100099020 Ga0070664_1000990202 378
424 3300005577 Ga0068857_100113025 Ga0068857_1001130252 378
425 3300005578 Ga0068854_100029294 Ga0068854_1000292942 378
426 3300005614 Ga0068856_100032839 Ga0068856_1000328395 378
427 3300005616 Ga0068852_100001296 Ga0068852_1000012962 378
428 3300005834 Ga0068851_10023969 Ga0068851_100239693 378
429 3300006038 Ga0075365_10081033 Ga0075365_100810331 378
430 3300006042 Ga0075368_10021210 Ga0075368_100212102 378
431 3300006048 Ga0075363_100101348 Ga0075363_1001013481 378
432 3300006178 Ga0075367_10022602 Ga0075367_100226023 378
433 3300009174 Ga0105241_10175159 Ga0105241_101751592 378
434 3300009551 Ga0105238_10111427 Ga0105238_101114273 378
435 3300013105 Ga0157369_10039411 Ga0157369_100394117 378
436 3300013307 Ga0157372_10326825 Ga0157372_103268252 378
437 3300014325 Ga0163163_10010522 Ga0163163_100105223 378
438 3300015261 Ga0182006_1003085 Ga0182006_10030851 378
439 3300025273 Ga0209673_1010691 Ga0209673_10106912 378
440 3300025297 Ga0209758_1040496 Ga0209758_10404962 378
441 3300025303 Ga0209051_1000055 Ga0209051_1000055258 378
442 3300025304 Ga0209257_1000101 Ga0209257_1000101232 378
443 3300025919 Ga0207657_10069103 Ga0207657_100691032 378
444 3300025932 Ga0207690_10152698 Ga0207690_101526982 378
445 3300025944 Ga0207661_10121699 Ga0207661_101216992 378
446 3300025945 Ga0207679_10008384 Ga0207679_100083842 378
447 3300025949 Ga0207667_10268640 Ga0207667_102686402 378
448 3300025981 Ga0207640_10123093 Ga0207640_101230932 378
449 3300026078 Ga0207702_10005209 Ga0207702_100052093 378
450 3300026116 Ga0207674_10041068 Ga0207674_100410686 378
451 3300026142 Ga0207698_10074270 Ga0207698_100742702 378
452 3300028381 Ga0268264_10343893 Ga0268264_103438932 378
453 3300037312 Ga0395899_0142355 Ga0395899_0142355_21_1244 378
454 3300037418 Ga0395900_0299272 Ga0395900_0299272_362_1585 378
455 3300044735 Ga0466968_0013088 Ga0466968_0013088_372_1556 378
456 3300048905 Ga0496102_0006650 Ga0496102_0006650_7713_8897 378
457 3300048915 Ga0496112_0015232 Ga0496112_0015232_3286_4458 378
458 3300048916 Ga0496113_0089139 Ga0496113_0089139_505_1689 378
459 3300048924 Ga0496121_0029040 Ga0496121_0029040_663_1841 378
460 3300048928 Ga0496125_0026569 Ga0496125_0026569_1542_2708 378
461 3300048929 Ga0496126_0076353 Ga0496126_0076353_200_1381 378
462 3300049573 Ga0501037_0044434 Ga0501037_0044434_1885_3060 378
463 3300053161 Ga0500634_0038674 Ga0500634_0038674_443_1630 378
464 3300061719 Ga0466962_0105467 Ga0466962_0105467_72_1250 378
465 iso_pu_bacteria 2808606386 2808982702 378
466 iso_pu_bacteria 2808606415 2809130203 378
467 iso_pu_bacteria 2808606419 2809150320 378
468 iso_pu_bacteria 2852618963 2852621457 378
469 iso_pu_bacteria 2904601388 2904606175 378
470 3300002704 JGI25155J39150_1000092 JGI25155J39150_100009238 379
471 3300002705 JGI25156J39149_1000067 JGI25156J39149_10000678 379
472 3300002738 JGI25154J39366_1000089 JGI25154J39366_100008972 379
473 3300002741 JGI25157J39369_1000084 JGI25157J39369_10000848 379
474 3300002987 JGI25159J45721_1010332 JGI25159J45721_10103321 379
475 3300003187 JGI25151J46595_10011382 JGI25151J46595_100113823 379
476 3300003771 Ga0055526_1007589 Ga0055526_10075892 379
477 3300003775 Ga0055524_1000678 Ga0055524_10006787 379
478 3300003781 Ga0055536_1001854 Ga0055536_10018547 379
479 3300003790 Ga0055528_1000468 Ga0055528_100046816 379
480 3300003791 Ga0055530_10005277 Ga0055530_100052775 379
481 3300003792 Ga0055540_1000088 Ga0055540_100008893 379
482 3300005262 Ga0065165_1010395 Ga0065165_10103951 379
483 3300005328 Ga0070676_10021675 Ga0070676_100216752 379
484 3300005328 Ga0070676_10027980 Ga0070676_100279802 379
485 3300005328 Ga0070676_10070078 Ga0070676_100700782 379
486 3300005330 Ga0070690_100001202 Ga0070690_10000120213 379
487 3300005330 Ga0070690_100171412 Ga0070690_1001714121 379
488 3300005331 Ga0070670_100000527 Ga0070670_10000052731 379
489 3300005333 Ga0070677_10019143 Ga0070677_100191432 379
490 3300005334 Ga0068869_100001043 Ga0068869_1000010438 379
491 3300005334 Ga0068869_100038691 Ga0068869_1000386913 379
492 3300005335 Ga0070666_10005740 Ga0070666_100057405 379
493 3300005335 Ga0070666_10033037 Ga0070666_100330372 379
494 3300005338 Ga0068868_100006495 Ga0068868_1000064955 379
495 3300005338 Ga0068868_100016559 Ga0068868_1000165592 379
496 3300005338 Ga0068868_100022882 Ga0068868_1000228822 379
497 3300005343 Ga0070687_100004173 Ga0070687_1000041732 379
498 3300005344 Ga0070661_100133026 Ga0070661_1001330262 379
499 3300005347 Ga0070668_100035155 Ga0070668_1000351552 379
500 3300005353 Ga0070669_100000975 Ga0070669_10000097518 379
501 3300005354 Ga0070675_100001244 Ga0070675_1000012444 379
502 3300005354 Ga0070675_100010772 Ga0070675_10001077210 379
503 3300005354 Ga0070675_100045372 Ga0070675_1000453723 379
504 3300005354 Ga0070675_100072505 Ga0070675_1000725052 379
505 3300005355 Ga0070671_100147884 Ga0070671_1001478841 379
506 3300005355 Ga0070671_100259914 Ga0070671_1002599141 379
507 3300005356 Ga0070674_100078640 Ga0070674_1000786401 379
508 3300005367 Ga0070667_100001764 Ga0070667_1000017642 379
509 3300005367 Ga0070667_100061358 Ga0070667_1000613581 379
510 3300005445 Ga0070708_100002558 Ga0070708_1000025587 379
511 3300005455 Ga0070663_100013800 Ga0070663_1000138004 379
512 3300005456 Ga0070678_100058594 Ga0070678_1000585942 379
513 3300005456 Ga0070678_100106868 Ga0070678_1001068682 379
514 3300005456 Ga0070678_100138332 Ga0070678_1001383322 379
515 3300005456 Ga0070678_100287374 Ga0070678_1002873741 379
516 3300005457 Ga0070662_100002003 Ga0070662_1000020032 379
517 3300005457 Ga0070662_100018662 Ga0070662_1000186623 379
518 3300005459 Ga0068867_100047178 Ga0068867_1000471783 379
519 3300005535 Ga0070684_100059867 Ga0070684_1000598672 379
520 3300005539 Ga0068853_100167693 Ga0068853_1001676931 379
521 3300005543 Ga0070672_100000616 Ga0070672_1000006162 379
522 3300005544 Ga0070686_100060217 Ga0070686_1000602173 379
523 3300005563 Ga0068855_100015933 Ga0068855_1000159334 379
524 3300005563 Ga0068855_100055098 Ga0068855_1000550982 379
525 3300005564 Ga0070664_100060159 Ga0070664_1000601592 379
526 3300005564 Ga0070664_100061589 Ga0070664_1000615892 379
527 3300005577 Ga0068857_100193748 Ga0068857_1001937482 379
528 3300005614 Ga0068856_100071382 Ga0068856_1000713824 379
529 3300005616 Ga0068852_100202190 Ga0068852_1002021902 379
530 3300005618 Ga0068864_100001865 Ga0068864_1000018652 379
531 3300005618 Ga0068864_100044498 Ga0068864_1000444983 379
532 3300005719 Ga0068861_100000405 Ga0068861_10000040514 379
533 3300005719 Ga0068861_100003338 Ga0068861_1000033384 379
534 3300005834 Ga0068851_10005937 Ga0068851_100059372 379
535 3300005834 Ga0068851_10072028 Ga0068851_100720281 379
536 3300005841 Ga0068863_100089185 Ga0068863_1000891851 379
537 3300005841 Ga0068863_100169078 Ga0068863_1001690782 379
538 3300005842 Ga0068858_100002362 Ga0068858_10000236215 379
539 3300005842 Ga0068858_100051954 Ga0068858_1000519542 379
540 3300005843 Ga0068860_100000216 Ga0068860_10000021652 379
541 3300005844 Ga0068862_100015000 Ga0068862_1000150005 379
542 3300006038 Ga0075365_10088354 Ga0075365_100883541 379
543 3300006051 Ga0075364_10131519 Ga0075364_101315192 379
544 3300006195 Ga0075366_10012284 Ga0075366_100122844 379
545 3300006195 Ga0075366_10069834 Ga0075366_100698341 379
546 3300006237 Ga0097621_100025467 Ga0097621_1000254672 379
547 3300006237 Ga0097621_100032630 Ga0097621_1000326303 379
548 3300006237 Ga0097621_100055054 Ga0097621_1000550541 379
549 3300006871 Ga0075434_100163224 Ga0075434_1001632242 379
550 3300006881 Ga0068865_100022953 Ga0068865_1000229534 379
551 3300006881 Ga0068865_100032381 Ga0068865_1000323812 379
552 3300006946 Ga0079104_1021813 Ga0079104_10218132 379
553 3300009098 Ga0105245_10339106 Ga0105245_103391061 379
554 3300009148 Ga0105243_10003283 Ga0105243_100032832 379
555 3300009177 Ga0105248_10090531 Ga0105248_100905312 379
556 3300009545 Ga0105237_10037996 Ga0105237_100379964 379
557 3300009551 Ga0105238_10082419 Ga0105238_100824192 379
558 3300009553 Ga0105249_10152469 Ga0105249_101524692 379
559 3300010375 Ga0105239_10320371 Ga0105239_103203712 379
560 3300013306 Ga0163162_10010013 Ga0163162_100100134 379
561 3300013306 Ga0163162_10050004 Ga0163162_100500045 379
562 3300013308 Ga0157375_10004157 Ga0157375_100041577 379
563 3300014326 Ga0157380_10041751 Ga0157380_100417512 379
564 3300014745 Ga0157377_10000246 Ga0157377_1000024620 379
565 3300014968 Ga0157379_10000911 Ga0157379_100009118 379
566 3300014968 Ga0157379_10015058 Ga0157379_100150584 379
567 3300014968 Ga0157379_10126688 Ga0157379_101266881 379
568 3300014969 Ga0157376_10054119 Ga0157376_100541193 379
569 3300021384 Ga0213876_10038786 Ga0213876_100387862 379
570 3300021388 Ga0213875_10001420 Ga0213875_100014202 379
571 3300025206 Ga0209435_100008 Ga0209435_100008200 379
572 3300025245 Ga0207425_1001782 Ga0207425_10017824 379
573 3300025245 Ga0207425_1002298 Ga0207425_10022982 379
574 3300025246 Ga0209646_1000029 Ga0209646_100002979 379
575 3300025250 Ga0209026_1000016 Ga0209026_100001679 379
576 3300025256 Ga0209759_1000016 Ga0209759_100001679 379
577 3300025273 Ga0209673_1000492 Ga0209673_100049249 379
578 3300025284 Ga0209130_1010381 Ga0209130_10103812 379
579 3300025291 Ga0209675_1000622 Ga0209675_10006228 379
580 3300025292 Ga0209676_1000013 Ga0209676_1000013463 379
581 3300025292 Ga0209676_1000153 Ga0209676_100015333 379
582 3300025292 Ga0209676_1010360 Ga0209676_10103604 379
583 3300025294 Ga0209025_1005695 Ga0209025_10056952 379
584 3300025294 Ga0209025_1005712 Ga0209025_10057122 379
585 3300025294 Ga0209025_1008443 Ga0209025_10084437 379
586 3300025297 Ga0209758_1014773 Ga0209758_10147733 379
587 3300025298 Ga0209050_1000008 Ga0209050_1000008463 379
588 3300025299 Ga0209256_1000039 Ga0209256_100003963 379
589 3300025303 Ga0209051_1000005 Ga0209051_1000005463 379
590 3300025303 Ga0209051_1000762 Ga0209051_100076217 379
591 3300025304 Ga0209257_1000031 Ga0209257_100003153 379
592 3300025315 Ga0207697_10008475 Ga0207697_100084755 379
593 3300025315 Ga0207697_10015952 Ga0207697_100159523 379
594 3300025321 Ga0207656_10017111 Ga0207656_100171112 379
595 3300025903 Ga0207680_10003123 Ga0207680_100031235 379
596 3300025903 Ga0207680_10035243 Ga0207680_100352431 379
597 3300025907 Ga0207645_10000481 Ga0207645_1000048121 379
598 3300025918 Ga0207662_10019814 Ga0207662_100198144 379
599 3300025919 Ga0207657_10102655 Ga0207657_101026552 379
600 3300025919 Ga0207657_10241732 Ga0207657_102417322 379
601 3300025923 Ga0207681_10000162 Ga0207681_1000016234 379
602 3300025923 Ga0207681_10019030 Ga0207681_100190302 379
603 3300025924 Ga0207694_10079787 Ga0207694_100797873 379
604 3300025925 Ga0207650_10004268 Ga0207650_100042685 379
605 3300025925 Ga0207650_10040447 Ga0207650_100404473 379
606 3300025925 Ga0207650_10067893 Ga0207650_100678932 379
607 3300025926 Ga0207659_10004029 Ga0207659_100040294 379
608 3300025926 Ga0207659_10074965 Ga0207659_100749651 379
609 3300025926 Ga0207659_10312004 Ga0207659_103120041 379
610 3300025927 Ga0207687_10036680 Ga0207687_100366802 379
611 3300025931 Ga0207644_10101692 Ga0207644_101016922 379
612 3300025931 Ga0207644_10130324 Ga0207644_101303241 379
613 3300025932 Ga0207690_10072446 Ga0207690_100724462 379
614 3300025933 Ga0207706_10002936 Ga0207706_1000293614 379
615 3300025933 Ga0207706_10006657 Ga0207706_100066574 379
616 3300025935 Ga0207709_10002362 Ga0207709_100023623 379
617 3300025937 Ga0207669_10024902 Ga0207669_100249022 379
618 3300025940 Ga0207691_10002324 Ga0207691_1000232412 379
619 3300025940 Ga0207691_10019132 Ga0207691_100191327 379
620 3300025941 Ga0207711_10050769 Ga0207711_100507692 379
621 3300025942 Ga0207689_10000725 Ga0207689_1000072519 379
622 3300025942 Ga0207689_10008373 Ga0207689_100083733 379
623 3300025942 Ga0207689_10094751 Ga0207689_100947512 379
624 3300025949 Ga0207667_10013088 Ga0207667_100130884 379
625 3300025961 Ga0207712_10013041 Ga0207712_100130416 379
626 3300025972 Ga0207668_10001266 Ga0207668_100012667 379
627 3300025981 Ga0207640_10027346 Ga0207640_100273463 379
628 3300025986 Ga0207658_10000181 Ga0207658_1000018114 379
629 3300026023 Ga0207677_10003051 Ga0207677_100030518 379
630 3300026023 Ga0207677_10048120 Ga0207677_100481203 379
631 3300026035 Ga0207703_10002749 Ga0207703_1000274913 379
632 3300026035 Ga0207703_10147716 Ga0207703_101477163 379
633 3300026041 Ga0207639_10026001 Ga0207639_100260014 379
634 3300026067 Ga0207678_10043678 Ga0207678_100436782 379
635 3300026088 Ga0207641_10001807 Ga0207641_100018074 379
636 3300026088 Ga0207641_10041170 Ga0207641_100411706 379
637 3300026088 Ga0207641_10042857 Ga0207641_100428572 379
638 3300026089 Ga0207648_10008220 Ga0207648_100082203 379
639 3300026089 Ga0207648_10012486 Ga0207648_100124863 379
640 3300026095 Ga0207676_10012888 Ga0207676_100128886 379
641 3300026095 Ga0207676_10027124 Ga0207676_100271244 379
642 3300026095 Ga0207676_10042038 Ga0207676_100420385 379
643 3300026116 Ga0207674_10128118 Ga0207674_101281182 379
644 3300026118 Ga0207675_100000273 Ga0207675_10000027323 379
645 3300026118 Ga0207675_100000770 Ga0207675_1000007706 379
646 3300026121 Ga0207683_10003562 Ga0207683_100035623 379
647 3300026142 Ga0207698_10015574 Ga0207698_100155745 379
648 3300028381 Ga0268264_10029519 Ga0268264_100295192 379
649 3300028794 Ga0307515_10000737 Ga0307515_1000073731 379
650 3300028794 Ga0307515_10080406 Ga0307515_100804063 379
651 3300031456 Ga0307513_10000037 Ga0307513_10000037114 379
652 3300031649 Ga0307514_10000408 Ga0307514_1000040812 379
653 3300031730 Ga0307516_10004632 Ga0307516_100046327 379
654 3300031901 Ga0307406_10008835 Ga0307406_100088352 379
655 3300031911 Ga0307412_10077918 Ga0307412_100779182 379
656 3300035092 Ga0373952_0017932 Ga0373952_0017932_268_1443 379
657 3300035410 Ga0373924_0005008 Ga0373924_0005008_1056_2243 379
658 3300037312 Ga0395899_0000953 Ga0395899_0000953_15611_16798 379
659 3300037418 Ga0395900_0013168 Ga0395900_0013168_1957_3132 379
660 3300037418 Ga0395900_0023654 Ga0395900_0023654_371_1543 379
661 3300037418 Ga0395900_0042298 Ga0395900_0042298_518_1705 379
662 3300037466 Ga0395898_0002404 Ga0395898_0002404_9810_10982 379
663 3300037466 Ga0395898_0029788 Ga0395898_0029788_779_1954 379
664 3300037471 Ga0395905_0000773 Ga0395905_0000773_31693_32865 379
665 3300037471 Ga0395905_0002341 Ga0395905_0002341_14489_15688 379
666 3300037471 Ga0395905_0006414 Ga0395905_0006414_629_1801 379
667 3300037471 Ga0395905_0008399 Ga0395905_0008399_3849_5021 379
668 3300037471 Ga0395905_0034441 Ga0395905_0034441_1124_2296 379
669 3300037471 Ga0395905_0127970 Ga0395905_0127970_1107_2282 379
670 3300037853 Ga0436364_0001604 Ga0436364_0001604_388_1563 379
671 3300037853 Ga0436364_0810222 Ga0436364_0810222_4093_5289 379
672 3300037853 Ga0436364_1195167 Ga0436364_1195167_218_1405 379
673 3300038443 Ga0395901_0221072 Ga0395901_0221072_371_1543 379
674 3300039437 Ga0436365_0085001 Ga0436365_0085001_27_1193 379
675 3300039450 Ga0436363_1334668 Ga0436363_1334668_1951_3126 379
676 3300039453 Ga0436362_0430762 Ga0436362_0430762_2330_3517 379
677 3300042876 Ga0451577_0002494 Ga0451577_0002494_1688_2860 379
678 3300044673 Ga0453683_0007748 Ga0453683_0007748_6003_7178 379
679 3300044684 Ga0466966_0015680 Ga0466966_0015680_3002_4183 379
680 3300044706 Ga0466964_0012946 Ga0466964_0012946_1034_2266 379
681 3300044712 Ga0453684_0015963 Ga0453684_0015963_8946_10118 379
682 3300044842 Ga0466957_0041422 Ga0466957_0041422_1044_2246 379
683 3300045049 Ga0466959_0053187 Ga0466959_0053187_1571_2803 379
684 3300045051 Ga0451576_0004732 Ga0451576_0004732_6265_7437 379
685 3300045836 Ga0466958_0022473 Ga0466958_0022473_1259_2461 379
686 3300046491 Ga0495584_0121854 Ga0495584_0121854_99_1283 379
687 3300046506 Ga0495583_0000463 Ga0495583_0000463_4521_5705 379
688 3300046507 Ga0495606_0004903 Ga0495606_0004903_7220_8407 379
689 3300046522 Ga0495643_0000398 Ga0495643_0000398_9873_11057 379
690 3300046615 Ga0495656_0000340 Ga0495656_0000340_6531_7700 379
691 3300046615 Ga0495656_0022112 Ga0495656_0022112_746_1918 379
692 3300046665 Ga0495661_0013991 Ga0495661_0013991_4056_5231 379
693 3300048091 Ga0495626_0000868 Ga0495626_0000868_24786_25970 379
694 3300048091 Ga0495626_0058254 Ga0495626_0058254_453_1637 379
695 3300048903 Ga0496100_0243514 Ga0496100_0243514_65_1237 379
696 3300048904 Ga0496101_0007754 Ga0496101_0007754_2754_3929 379
697 3300048910 Ga0496107_0013884 Ga0496107_0013884_2908_4083 379
698 3300048912 Ga0496109_0005079 Ga0496109_0005079_5590_6783 379
699 3300048913 Ga0496110_0025566 Ga0496110_0025566_2197_3372 379
700 3300048915 Ga0496112_0049858 Ga0496112_0049858_1119_2294 379
701 3300048916 Ga0496113_0037995 Ga0496113_0037995_1664_2857 379
702 3300048917 Ga0496114_0108143 Ga0496114_0108143_944_2119 379
703 3300048918 Ga0496115_0059915 Ga0496115_0059915_245_1420 379
704 3300048925 Ga0496122_0000310 Ga0496122_0000310_49414_50607 379
705 3300048926 Ga0496123_0000312 Ga0496123_0000312_43029_44222 379
706 3300048928 Ga0496125_0002445 Ga0496125_0002445_5347_6540 379
707 3300048928 Ga0496125_0011871 Ga0496125_0011871_1114_2295 379
708 3300050493 nmdc:mga0k408_3909_c1 nmdc:mga0k408_3909_c1_2794_3978 379
709 3300050512 nmdc:mga0n895_325932_c1 nmdc:mga0n895_325932_c1_155_1330 379
710 3300053125 Ga0500618_013591 Ga0500618_013591_857_2047 379
711 3300053730 Ga0500645_000250 Ga0500645_000250_6900_8072 379
712 3300061719 Ga0466962_0015127 Ga0466962_0015127_955_2187 379
713 iso_pu_bacteria 2904479285 2904483368 379
714 3300001979 JGI24740J21852_10012167 JGI24740J21852_100121673 380
715 3300003187 JGI25151J46595_10006434 JGI25151J46595_100064344 380
716 3300003354 JGI25160J50197_1008069 JGI25160J50197_10080691 380
717 3300003761 Ga0055535_1000084 Ga0055535_100008422 380
718 3300003762 Ga0055542_1000033 Ga0055542_1000033167 380
719 3300003773 Ga0055537_1000304 Ga0055537_100030417 380
720 3300003773 Ga0055537_1001544 Ga0055537_10015448 380
721 3300003775 Ga0055524_1004503 Ga0055524_10045035 380
722 3300003784 Ga0055534_1000289 Ga0055534_100028917 380
723 3300003784 Ga0055534_1003287 Ga0055534_10032875 380
724 3300003790 Ga0055528_1012104 Ga0055528_10121042 380
725 3300003790 Ga0055528_1013553 Ga0055528_10135533 380
726 3300003791 Ga0055530_10003506 Ga0055530_100035063 380
727 3300003794 Ga0055531_10007816 Ga0055531_100078164 380
728 3300005327 Ga0070658_10069444 Ga0070658_100694443 380
729 3300005327 Ga0070658_10077442 Ga0070658_100774422 380
730 3300005339 Ga0070660_100010895 Ga0070660_1000108957 380
731 3300005344 Ga0070661_100025859 Ga0070661_1000258592 380
732 3300005457 Ga0070662_100017339 Ga0070662_1000173392 380
733 3300005530 Ga0070679_100046845 Ga0070679_1000468452 380
734 3300005539 Ga0068853_100006479 Ga0068853_1000064791 380
735 3300005547 Ga0070693_100124387 Ga0070693_1001243872 380
736 3300005563 Ga0068855_100134917 Ga0068855_1001349171 380
737 3300005616 Ga0068852_100002469 Ga0068852_1000024695 380
738 3300006038 Ga0075365_10022743 Ga0075365_100227433 380
739 3300006048 Ga0075363_100021432 Ga0075363_1000214323 380
740 3300006353 Ga0075370_10024685 Ga0075370_100246852 380
741 3300009098 Ga0105245_10400144 Ga0105245_104001441 380
742 3300009148 Ga0105243_10002379 Ga0105243_100023795 380
743 3300011119 Ga0105246_10068407 Ga0105246_100684071 380
744 3300013100 Ga0157373_10001556 Ga0157373_1000155616 380
745 3300013102 Ga0157371_10051612 Ga0157371_100516121 380
746 3300013102 Ga0157371_10087976 Ga0157371_100879762 380
747 3300013104 Ga0157370_10057280 Ga0157370_100572804 380
748 3300013104 Ga0157370_10217311 Ga0157370_102173112 380
749 3300013105 Ga0157369_10172220 Ga0157369_101722202 380
750 3300013306 Ga0163162_10312657 Ga0163162_103126573 380
751 3300013307 Ga0157372_10104164 Ga0157372_101041643 380
752 3300014497 Ga0182008_10003337 Ga0182008_100033374 380
753 3300014497 Ga0182008_10014906 Ga0182008_100149064 380
754 3300015262 Ga0182007_10002970 Ga0182007_1000297010 380
755 3300017792 Ga0163161_10057833 Ga0163161_100578331 380
756 3300020080 Ga0206350_11076645 Ga0206350_110766451 380
757 3300021384 Ga0213876_10016615 Ga0213876_100166153 380
758 3300025228 Ga0209672_102290 Ga0209672_1022903 380
759 3300025229 Ga0209147_101310 Ga0209147_1013102 380
760 3300025242 Ga0209258_100089 Ga0209258_100089166 380
761 3300025245 Ga0207425_1000355 Ga0207425_100035514 380
762 3300025245 Ga0207425_1008002 Ga0207425_10080022 380
763 3300025254 Ga0209148_1000097 Ga0209148_1000097166 380
764 3300025258 Ga0209129_1000033 Ga0209129_1000033168 380
765 3300025258 Ga0209129_1005867 Ga0209129_10058673 380
766 3300025263 Ga0209565_1000120 Ga0209565_100012018 380
767 3300025263 Ga0209565_1000586 Ga0209565_100058611 380
768 3300025273 Ga0209673_1000099 Ga0209673_1000099181 380
769 3300025273 Ga0209673_1000185 Ga0209673_1000185111 380
770 3300025273 Ga0209673_1001345 Ga0209673_100134511 380
771 3300025273 Ga0209673_1002340 Ga0209673_10023407 380
772 3300025284 Ga0209130_1000736 Ga0209130_100073612 380
773 3300025284 Ga0209130_1001586 Ga0209130_10015865 380
774 3300025291 Ga0209675_1000054 Ga0209675_1000054181 380
775 3300025291 Ga0209675_1000296 Ga0209675_100029636 380
776 3300025291 Ga0209675_1000539 Ga0209675_100053914 380
777 3300025292 Ga0209676_1000179 Ga0209676_100017996 380
778 3300025292 Ga0209676_1000896 Ga0209676_100089616 380
779 3300025292 Ga0209676_1001185 Ga0209676_100118514 380
780 3300025292 Ga0209676_1011930 Ga0209676_10119303 380
781 3300025294 Ga0209025_1000714 Ga0209025_10007142 380
782 3300025294 Ga0209025_1001001 Ga0209025_100100115 380
783 3300025294 Ga0209025_1037003 Ga0209025_10370032 380
784 3300025295 Ga0209564_1000151 Ga0209564_100015116 380
785 3300025295 Ga0209564_1000246 Ga0209564_100024688 380
786 3300025297 Ga0209758_1000027 Ga0209758_1000027168 380
787 3300025297 Ga0209758_1011129 Ga0209758_10111293 380
788 3300025298 Ga0209050_1000172 Ga0209050_100017255 380
789 3300025298 Ga0209050_1002148 Ga0209050_100214814 380
790 3300025299 Ga0209256_1000069 Ga0209256_1000069133 380
791 3300025299 Ga0209256_1000161 Ga0209256_100016154 380
792 3300025302 Ga0207426_1000027 Ga0207426_1000027128 380
793 3300025302 Ga0207426_1000115 Ga0207426_100011553 380
794 3300025303 Ga0209051_1000046 Ga0209051_100004655 380
795 3300025303 Ga0209051_1000483 Ga0209051_100048330 380
796 3300025303 Ga0209051_1000841 Ga0209051_100084117 380
797 3300025304 Ga0209257_1000281 Ga0209257_100028152 380
798 3300025304 Ga0209257_1001061 Ga0209257_100106122 380
799 3300025304 Ga0209257_1017705 Ga0209257_10177052 380
800 3300025728 Ga0207655_1005421 Ga0207655_10054214 380
801 3300025901 Ga0207688_10129459 Ga0207688_101294591 380
802 3300025907 Ga0207645_10151049 Ga0207645_101510492 380
803 3300025913 Ga0207695_10040965 Ga0207695_100409653 380
804 3300025913 Ga0207695_10215361 Ga0207695_102153611 380
805 3300025919 Ga0207657_10021044 Ga0207657_100210445 380
806 3300025921 Ga0207652_10087621 Ga0207652_100876212 380
807 3300025925 Ga0207650_10327360 Ga0207650_103273601 380
808 3300025935 Ga0207709_10000319 Ga0207709_1000031932 380
809 3300025935 Ga0207709_10000868 Ga0207709_1000086814 380
810 3300025986 Ga0207658_10266012 Ga0207658_102660122 380
811 3300026121 Ga0207683_10065538 Ga0207683_100655383 380
812 3300026142 Ga0207698_10001703 Ga0207698_100017035 380
813 3300027876 Ga0209974_10020721 Ga0209974_100207212 380
814 3300030742 Ga0316183_1058424 Ga0316183_10584241 380
815 3300031235 Ga0265330_10025219 Ga0265330_100252192 380
816 3300031456 Ga0307513_10166806 Ga0307513_101668061 380
817 3300031548 Ga0307408_100005526 Ga0307408_1000055268 380
818 3300031711 Ga0265314_10005849 Ga0265314_100058495 380
819 3300031731 Ga0307405_10031026 Ga0307405_100310262 380
820 3300031901 Ga0307406_10001703 Ga0307406_100017039 380
821 3300031911 Ga0307412_10032584 Ga0307412_100325841 380
822 3300031911 Ga0307412_10061904 Ga0307412_100619041 380
823 3300037312 Ga0395899_0004365 Ga0395899_0004365_6694_7863 380
824 3300037418 Ga0395900_0013023 Ga0395900_0013023_765_1934 380
825 3300037466 Ga0395898_0021652 Ga0395898_0021652_4583_5752 380
826 3300037471 Ga0395905_0007480 Ga0395905_0007480_4693_5877 380
827 3300037471 Ga0395905_0156729 Ga0395905_0156729_313_1587 380
828 3300038443 Ga0395901_0015521 Ga0395901_0015521_5823_6992 380
829 3300039437 Ga0436365_0697045 Ga0436365_0697045_32617_33837 380
830 3300039450 Ga0436363_0279939 Ga0436363_0279939_11743_12963 380
831 3300041404 Ga0439436_0010842 Ga0439436_0010842_85_1260 380
832 3300042004 Ga0439445_0030848 Ga0439445_0030848_147_1322 380
833 3300042006 Ga0439432_000428 Ga0439432_000428_8588_9760 380
834 3300042007 Ga0439449_0006422 Ga0439449_0006422_1366_2538 380
835 3300042015 Ga0439462_0008801 Ga0439462_0008801_1323_2495 380
836 3300042435 Ga0439434_0004056 Ga0439434_0004056_713_1888 380
837 3300042531 Ga0450918_002189 Ga0450918_002189_784_1959 380
838 3300044656 Ga0466969_0007935 Ga0466969_0007935_2999_4183 380
839 3300046512 Ga0495610_0044980 Ga0495610_0044980_490_1665 380
840 3300046519 Ga0495632_0004880 Ga0495632_0004880_7537_8754 380
841 3300046520 Ga0495637_0009149 Ga0495637_0009149_2772_4019 380
842 3300046660 Ga0495625_0002232 Ga0495625_0002232_114_1289 380
843 3300047673 Ga0495593_0009993 Ga0495593_0009993_111_1286 380
844 3300048091 Ga0495626_0010129 Ga0495626_0010129_1647_2864 380
845 3300048904 Ga0496101_0002523 Ga0496101_0002523_9894_11069 380
846 3300048906 Ga0496103_0093559 Ga0496103_0093559_108_1283 380
847 3300048908 Ga0496105_0058115 Ga0496105_0058115_1837_3012 380
848 3300048909 Ga0496106_0057080 Ga0496106_0057080_1544_2719 380
849 3300048913 Ga0496110_0206482 Ga0496110_0206482_541_1716 380
850 3300048920 Ga0496117_0026287 Ga0496117_0026287_2311_3483 380
851 3300048924 Ga0496121_0034728 Ga0496121_0034728_1448_2623 380
852 3300049570 Ga0501033_0147141 Ga0501033_0147141_428_1603 380
853 3300049759 Ga0501262_000311 Ga0501262_000311_3234_4409 380
854 3300050496 nmdc:mga07m45_20766_c1 nmdc:mga07m45_20766_c1_2334_3506 380
855 3300050496 nmdc:mga07m45_357_c1 nmdc:mga07m45_357_c1_13649_14824 380
856 3300050496 nmdc:mga07m45_4231_c1 nmdc:mga07m45_4231_c1_2237_3412 380
857 3300053093 Ga0500651_0000165 Ga0500651_0000165_13697_14872 380
858 3300053110 Ga0500571_000235 Ga0500571_000235_140_1315 380
859 3300053134 Ga0500658_0000693 Ga0500658_0000693_12725_13900 380
860 3300053136 Ga0500559_0007382 Ga0500559_0007382_2302_3477 380
861 3300053139 Ga0500568_0008065 Ga0500568_0008065_3342_4517 380
862 3300053153 Ga0500616_0095962 Ga0500616_0095962_203_1378 380
863 3300053162 Ga0500638_055171 Ga0500638_055171_251_1426 380
864 3300003784 Ga0055534_1001915 Ga0055534_10019154 381
865 3300003784 Ga0055534_1004043 Ga0055534_10040435 381
866 3300005539 Ga0068853_100342775 Ga0068853_1003427751 381
867 3300005548 Ga0070665_100002968 Ga0070665_10000296811 381
868 3300006177 Ga0075362_10008038 Ga0075362_100080383 381
869 3300006186 Ga0075369_10024533 Ga0075369_100245332 381
870 3300015261 Ga0182006_1031627 Ga0182006_10316272 381
871 3300025284 Ga0209130_1001885 Ga0209130_10018858 381
872 3300025291 Ga0209675_1001599 Ga0209675_10015998 381
873 3300025291 Ga0209675_1019145 Ga0209675_10191452 381
874 3300025292 Ga0209676_1019621 Ga0209676_10196212 381
875 3300025298 Ga0209050_1005822 Ga0209050_10058227 381
876 3300025298 Ga0209050_1028869 Ga0209050_10288692 381
877 3300025303 Ga0209051_1009810 Ga0209051_10098102 381
878 3300028794 Ga0307515_10001517 Ga0307515_1000151710 381
879 3300030736 Ga0316180_1037273 Ga0316180_10372732 381
880 3300031456 Ga0307513_10014317 Ga0307513_1001431710 381
881 3300031548 Ga0307408_100000117 Ga0307408_10000011784 381
882 3300031548 Ga0307408_100142692 Ga0307408_1001426922 381
883 3300031901 Ga0307406_10001362 Ga0307406_1000136210 381
884 3300035119 Ga0373956_0020838 Ga0373956_0020838_915_2090 381
885 3300035170 Ga0373943_0045843 Ga0373943_0045843_18_1193 381
886 3300035724 Ga0373933_0038139 Ga0373933_0038139_1420_2595 381
887 3300036401 Ga0373937_0003621 Ga0373937_0003621_3940_5115 381
888 3300037418 Ga0395900_0012212 Ga0395900_0012212_3449_4621 381
889 3300037471 Ga0395905_0025327 Ga0395905_0025327_1785_2957 381
890 3300038443 Ga0395901_0210306 Ga0395901_0210306_392_1564 381
891 3300039447 Ga0436361_0206236 Ga0436361_0206236_34431_35603 381
892 3300041407 Ga0439447_014462 Ga0439447_014462_18_1193 381
893 3300041997 Ga0439431_0013721 Ga0439431_0013721_660_1838 381
894 3300042007 Ga0439449_0011558 Ga0439449_0011558_429_1604 381
895 3300042115 Ga0450911_000416 Ga0450911_000416_5501_6745 381
896 3300046459 Ga0495629_0000409 Ga0495629_0000409_4760_5935 381
897 3300046462 Ga0495651_0001051 Ga0495651_0001051_4645_5820 381
898 3300046463 Ga0495653_0019732 Ga0495653_0019732_449_1624 381
899 3300046514 Ga0495618_0002201 Ga0495618_0002201_6103_7278 381
900 3300046517 Ga0495630_0011056 Ga0495630_0011056_3961_5136 381
901 3300046533 Ga0495640_0017299 Ga0495640_0017299_2137_3312 381
902 3300046536 Ga0495587_0005039 Ga0495587_0005039_6066_7241 381
903 3300046559 Ga0495667_0007034 Ga0495667_0007034_3226_4401 381
904 3300046663 Ga0495635_0028200 Ga0495635_0028200_1107_2282 381
905 3300046674 Ga0495588_0070443 Ga0495588_0070443_448_1698 381
906 3300046679 Ga0495623_0083794 Ga0495623_0083794_431_1606 381
907 3300046680 Ga0495646_0006787 Ga0495646_0006787_630_1805 381
908 3300046809 Ga0495600_0003659 Ga0495600_0003659_3835_5010 381
909 3300047317 Ga0495604_0001090 Ga0495604_0001090_14467_15642 381
910 3300047319 Ga0495674_0003125 Ga0495674_0003125_12798_13973 381
911 3300047322 Ga0495680_0000795 Ga0495680_0000795_22934_24109 381
912 3300047444 Ga0495675_0016020 Ga0495675_0016020_525_1700 381
913 3300047471 Ga0495684_0005001 Ga0495684_0005001_975_2150 381
914 3300047673 Ga0495593_0046206 Ga0495593_0046206_475_1650 381
915 3300048088 Ga0495602_0010500 Ga0495602_0010500_1570_2745 381
916 3300048925 Ga0496122_0000199 Ga0496122_0000199_116709_117887 381
917 3300048926 Ga0496123_0000102 Ga0496123_0000102_150905_152083 381
918 3300050516 nmdc:mga0sz30_5942_c1 nmdc:mga0sz30_5942_c1_2266_3438 381
919 3300053084 Ga0495595_0001232 Ga0495595_0001232_5839_7014 381
920 3300053085 Ga0495619_0001190 Ga0495619_0001190_14457_15632 381
921 3300053085 Ga0495619_0032340 Ga0495619_0032340_85_1290 381
922 3300053108 Ga0500562_005454 Ga0500562_005454_417_1595 381
923 3300053145 Ga0500586_029290 Ga0500586_029290_357_1535 381
924 3300053153 Ga0500616_0029700 Ga0500616_0029700_632_1810 381
925 3300009098 Ga0105245_10107469 Ga0105245_101074692 383
926 3300005549 Ga0070704_100175022 Ga0070704_1001750222 384
927 3300049573 Ga0501037_0048122 Ga0501037_0048122_850_2037 385
928 3300049574 Ga0501038_0050943 Ga0501038_0050943_1956_3143 385
929 3300049575 Ga0501039_0004592 Ga0501039_0004592_3412_4599 385
930 3300049577 Ga0501041_0001425 Ga0501041_0001425_842_2029 385
931 3300049587 Ga0501071_0020912 Ga0501071_0020912_3316_4503 385
932 3300049588 Ga0501072_0096621 Ga0501072_0096621_713_1900 385
933 3300049592 Ga0501076_0002101 Ga0501076_0002101_8424_9611 385
934 3300049741 Ga0501079_0000442 Ga0501079_0000442_3660_4847 385
935 3300049742 Ga0501080_0005112 Ga0501080_0005112_7565_8752 385
936 3300049743 Ga0501081_0001609 Ga0501081_0001609_2708_3895 385
937 3300049744 Ga0501083_0022417 Ga0501083_0022417_2572_3759 385
938 3300049824 Ga0501045_0016595 Ga0501045_0016595_1148_2335 385
939 3300054114 Ga0501084_0034987 Ga0501084_0034987_1598_2785 385
940 3300060353 Ga0501082_0016744 Ga0501082_0016744_3514_4701 385
941 3300061734 Ga0530510_0083125 Ga0530510_0083125_703_1890 385
942 3300005367 Ga0070667_100088093 Ga0070667_1000880932 387
943 3300005436 Ga0070713_100128437 Ga0070713_1001284372 387
944 3300005436 Ga0070713_100281540 Ga0070713_1002815402 387
945 3300005439 Ga0070711_100261814 Ga0070711_1002618141 387
946 3300005530 Ga0070679_100021986 Ga0070679_1000219866 387
947 3300005548 Ga0070665_100243138 Ga0070665_1002431382 387
948 3300006028 Ga0070717_10051736 Ga0070717_100517362 387
949 3300014497 Ga0182008_10060982 Ga0182008_100609822 387
950 3300025916 Ga0207663_10225900 Ga0207663_102259001 387
951 3300035111 Ga0373923_0024304 Ga0373923_0024304_1097_2287 387
952 3300037068 Ga0373925_0274969 Ga0373925_0274969_52_1242 387
953 iso_pu_bacteria 2738541307 2738885326 388
954 iso_pu_bacteria 2818991446 2819598482 388
955 iso_pu_bacteria 2838054893 2838061396 388
956 iso_pu_bacteria 2899924645 2899926268 388
957 iso_pu_bacteria 2904449895 2904453810 388
958 iso_pu_bacteria 2904456579 2904462285 388
959 iso_pu_bacteria 2904541872 2904550030 388
960 iso_pu_bacteria 2928037797 2928044200 388
961 iso_pu_bacteria 2928044640 2928051039 388
962 iso_pu_bacteria 2928051484 2928057125 388
963 iso_pu_bacteria 2928064002 2928069358 388
964 iso_pu_bacteria 2928070936 2928077109 388
965 iso_pu_bacteria 2928084124 2928089902 388
966 iso_pu_bacteria 2928115317 2928118709 388
967 iso_pu_bacteria 2929160207 2929166524 388
968 2162886007 SwRhRL2b_contig_1156090 SwRhRL2b_0893.00007190 392
969 3300001979 JGI24740J21852_10011219 JGI24740J21852_100112193 392
970 3300002774 JGI25150J39212_1000694 JGI25150J39212_10006947 392
971 3300003187 JGI25151J46595_10002022 JGI25151J46595_100020228 392
972 3300003354 JGI25160J50197_1007974 JGI25160J50197_10079741 392
973 3300003761 Ga0055535_1001221 Ga0055535_100122110 392
974 3300003762 Ga0055542_1000381 Ga0055542_100038132 392
975 3300003773 Ga0055537_1000389 Ga0055537_10003898 392
976 3300003775 Ga0055524_1001685 Ga0055524_10016855 392
977 3300003784 Ga0055534_1000260 Ga0055534_100026015 392
978 3300003790 Ga0055528_1001139 Ga0055528_10011399 392
979 3300003790 Ga0055528_1002348 Ga0055528_10023483 392
980 3300003790 Ga0055528_1008822 Ga0055528_10088222 392
981 3300003792 Ga0055540_1000890 Ga0055540_10008908 392
982 3300003792 Ga0055540_1003373 Ga0055540_10033732 392
983 3300003794 Ga0055531_10004099 Ga0055531_100040999 392
984 3300005289 Ga0065704_10003035 Ga0065704_100030358 392
985 3300005563 Ga0068855_100037558 Ga0068855_1000375584 392
986 3300005577 Ga0068857_100067392 Ga0068857_1000673922 392
987 3300005578 Ga0068854_100015673 Ga0068854_1000156733 392
988 3300005834 Ga0068851_10038082 Ga0068851_100380823 392
989 3300006051 Ga0075364_10025483 Ga0075364_100254832 392
990 3300006177 Ga0075362_10053803 Ga0075362_100538032 392
991 3300006353 Ga0075370_10004900 Ga0075370_100049006 392
992 3300006353 Ga0075370_10033431 Ga0075370_100334312 392
993 3300006948 Ga0099826_10000044 Ga0099826_1000004415 392
994 3300009036 Ga0105244_10021526 Ga0105244_100215263 392
995 3300009093 Ga0105240_10047143 Ga0105240_100471434 392
996 3300009093 Ga0105240_10410890 Ga0105240_104108902 392
997 3300009098 Ga0105245_10015868 Ga0105245_100158686 392
998 3300009174 Ga0105241_10007933 Ga0105241_100079334 392
999 3300009545 Ga0105237_10000933 Ga0105237_1000093327 392
1000 3300009545 Ga0105237_10096912 Ga0105237_100969123 392
1001 3300009551 Ga0105238_10008227 Ga0105238_100082273 392
1002 3300010375 Ga0105239_10007368 Ga0105239_100073686 392
1003 3300013102 Ga0157371_10015422 Ga0157371_100154223 392
1004 3300013105 Ga0157369_10000456 Ga0157369_1000045614 392
1005 3300015683 Ga0183362_10006 Ga0183362_10006129 392
1006 3300017792 Ga0163161_10000308 Ga0163161_100003088 392
1007 3300025228 Ga0209672_100529 Ga0209672_10052912 392
1008 3300025229 Ga0209147_100715 Ga0209147_10071510 392
1009 3300025242 Ga0209258_100454 Ga0209258_10045414 392
1010 3300025245 Ga0207425_1000483 Ga0207425_100048313 392
1011 3300025254 Ga0209148_1000449 Ga0209148_100044914 392
1012 3300025263 Ga0209565_1000019 Ga0209565_100001972 392
1013 3300025263 Ga0209565_1000047 Ga0209565_100004714 392
1014 3300025263 Ga0209565_1008452 Ga0209565_10084522 392
1015 3300025273 Ga0209673_1000079 Ga0209673_1000079205 392
1016 3300025273 Ga0209673_1002128 Ga0209673_100212811 392
1017 3300025284 Ga0209130_1000011 Ga0209130_100001165 392
1018 3300025284 Ga0209130_1000272 Ga0209130_100027254 392
1019 3300025291 Ga0209675_1000046 Ga0209675_100004614 392
1020 3300025291 Ga0209675_1000073 Ga0209675_100007379 392
1021 3300025294 Ga0209025_1000973 Ga0209025_100097334 392
1022 3300025294 Ga0209025_1005221 Ga0209025_10052219 392
1023 3300025294 Ga0209025_1017032 Ga0209025_10170322 392
1024 3300025294 Ga0209025_1019327 Ga0209025_10193272 392
1025 3300025295 Ga0209564_1000040 Ga0209564_100004011 392
1026 3300025295 Ga0209564_1000725 Ga0209564_100072531 392
1027 3300025297 Ga0209758_1000037 Ga0209758_1000037339 392
1028 3300025297 Ga0209758_1004818 Ga0209758_10048186 392
1029 3300025298 Ga0209050_1024418 Ga0209050_10244182 392
1030 3300025299 Ga0209256_1000023 Ga0209256_1000023428 392
1031 3300025299 Ga0209256_1006705 Ga0209256_10067055 392
1032 3300025302 Ga0207426_1000029 Ga0207426_1000029338 392
1033 3300025302 Ga0207426_1000411 Ga0207426_100041111 392
1034 3300025303 Ga0209051_1000128 Ga0209051_100012882 392
1035 3300025303 Ga0209051_1002685 Ga0209051_100268513 392
1036 3300025303 Ga0209051_1002686 Ga0209051_100268613 392
1037 3300025304 Ga0209257_1000377 Ga0209257_100037712 392
1038 3300025321 Ga0207656_10009598 Ga0207656_100095983 392
1039 3300025911 Ga0207654_10015755 Ga0207654_100157553 392
1040 3300025913 Ga0207695_10061561 Ga0207695_100615613 392
1041 3300025914 Ga0207671_10008055 Ga0207671_100080553 392
1042 3300025924 Ga0207694_10125408 Ga0207694_101254082 392
1043 3300025949 Ga0207667_10033228 Ga0207667_100332283 392
1044 3300025981 Ga0207640_10083221 Ga0207640_100832213 392
1045 3300026041 Ga0207639_10003425 Ga0207639_1000342510 392
1046 3300026078 Ga0207702_10260513 Ga0207702_102605132 392
1047 3300026116 Ga0207674_10208960 Ga0207674_102089602 392
1048 3300026142 Ga0207698_10071400 Ga0207698_100714002 392
1049 3300027666 Ga0209282_1014520 Ga0209282_10145203 392
1050 3300030745 Ga0316182_1247809 Ga0316182_12478092 392
1051 3300031548 Ga0307408_100029623 Ga0307408_1000296233 392
1052 3300031731 Ga0307405_10007347 Ga0307405_100073475 392
1053 3300031731 Ga0307405_10033033 Ga0307405_100330333 392
1054 3300031901 Ga0307406_10000717 Ga0307406_1000071719 392
1055 3300032002 Ga0307416_100005940 Ga0307416_1000059403 392
1056 3300037312 Ga0395899_0000729 Ga0395899_0000729_6366_7544 392
1057 3300037418 Ga0395900_0003921 Ga0395900_0003921_12183_13361 392
1058 3300037471 Ga0395905_0148231 Ga0395905_0148231_115_1293 392
1059 3300042004 Ga0439445_0019986 Ga0439445_0019986_373_1551 392
1060 3300042115 Ga0450911_000033 Ga0450911_000033_12152_13330 392
1061 3300046660 Ga0495625_0005135 Ga0495625_0005135_9569_10747 392
1062 3300048920 Ga0496117_0000965 Ga0496117_0000965_29474_30685 392
1063 3300048921 Ga0496118_0001301 Ga0496118_0001301_23864_25075 392
1064 3300048921 Ga0496118_0023891 Ga0496118_0023891_93_1271 392
1065 3300048927 Ga0496124_0007963 Ga0496124_0007963_4822_6000 392
1066 3300048927 Ga0496124_0013624 Ga0496124_0013624_328_1539 392
1067 3300048928 Ga0496125_0000361 Ga0496125_0000361_49882_51060 392
1068 3300048928 Ga0496125_0001359 Ga0496125_0001359_22489_23667 392
1069 3300048928 Ga0496125_0185624 Ga0496125_0185624_188_1366 392
1070 3300049759 Ga0501262_000023 Ga0501262_000023_6782_7960 392
1071 3300050489 nmdc:mga03683_49284_c1 nmdc:mga03683_49284_c1_245_1423 392
1072 3300050493 nmdc:mga0k408_17256_c1 nmdc:mga0k408_17256_c1_536_1714 392
1073 3300050496 nmdc:mga07m45_6994_c1 nmdc:mga07m45_6994_c1_3437_4615 392
1074 3300050496 nmdc:mga07m45_94235_c1 nmdc:mga07m45_94235_c1_181_1359 392
1075 3300053134 Ga0500658_0000102 Ga0500658_0000102_13792_14970 392
1076 3300053136 Ga0500559_0009091 Ga0500559_0009091_1398_2576 392
1077 3300053139 Ga0500568_0000375 Ga0500568_0000375_19247_20425 392
1078 iso_pu_bacteria 2599185214 2599627740 392
1079 iso_pu_bacteria 2599185226 2599677339 392
1080 iso_pu_bacteria 2599185227 2599685403 392
1081 iso_pu_bacteria 2599185229 2599697183 392
1082 iso_pu_bacteria 2954767861 2954767889 392

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

61

404

0.95

PF13433

Peripla_BP_5

Periplasmic binding protein domain

62

421

0.9

PF01094

ANF_receptor

Receptor family ligand binding region

89

393

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f06-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid 0.963 23 385
4evs-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0985) in complex with 4-hydroxybenzoate 0.96 23 385
4f06-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris haa2 rpb_2270 in complex with p-hydroxybenzoic acid 0.9476 23 385
4evs-assembly1.cif.gz_A crystal structure of abc transporter from r. palustris - solute binding protein (rpa0985) in complex with 4-hydroxybenzoate 0.9448 23 385
4eyk-assembly1.cif.gz_A crystal structure of solute binding protein of abc transporter from rhodopseudomonas palustris bisb5 in complex with 3,4-dihydroxy benzoic acid 0.9417 23 387
ID Description Score Start End Superfamily
4f06A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.961 143 385 3.40.50.2300
4evqB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9318 141 271 3.40.50.2300
4f06A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9272 143 385 3.40.50.2300
4ey3A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9168 141 387 3.40.50.2300
4ey3A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9115 141 387 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3C0K8Z4-F1-model_v4 ABC transporter substrate-binding protein 0.9579 136 383
AF-A0A537X4X2-F1-model_v4 ABC transporter substrate-binding protein 0.946 24 389 GO:0006865
AF-A0A537X4X2-F1-model_v4 ABC transporter substrate-binding protein 0.9361 24 389 GO:0006865
AF-A0A5C9CTM2-F1-model_v4 Branched-chain amino acid transport system substrate-binding protein 0.9332 232 388
AF-A0A536XNG0-F1-model_v4 Leucine-binding protein domain-containing protein 0.9322 7 347

Feature Viewer

pLDDT pTM Quality
92.38 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map