F489662

General Info

Members Datasets Scaffolds Average Seq Length
1080 325 2160 103

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_101019267|Ga0070712_1010192672
Length 107
Sequence MKNFQKNVKSLEASDTQVLGVSMDSPFANKAFADSIGVTFPLLSDWGGKMSKEYGVVQNIGKLGYEASRRVTYLIDKSGKIAEVQVDDAAIDPTKIVQACERKKHGG

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
105 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
111 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
161 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
162 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
167 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
195 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
196 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
228 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
229 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
230 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
231 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
232 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
233 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
234 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
235 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
236 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
237 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
242 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.15
Metatranscriptomes 11.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.52
Rhizosphere 95.46
Stem 0
Stem Tuber 0
Unclassified 38.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_101019267 3300006175 Unclassified 717
2 LJNas_1000562 3300000546 Bacteria 6390
3 rootH1_10275960 3300003323 Bacteria 1043
4 Ga0058863_10047664 3300004799 Unclassified 547
5 Ga0058863_10173066 3300004799 Unclassified 3271
6 Ga0058863_11654109 3300004799 Unclassified 746
7 Ga0058863_11662177 3300004799 Unclassified 762
8 Ga0058861_11644902 3300004800 Unclassified 732
9 Ga0058861_11680532 3300004800 Unclassified 626
10 Ga0058861_11905019 3300004800 Unclassified 585
11 Ga0058862_10184300 3300004803 Unclassified 626
12 Ga0058862_12590030 3300004803 Unclassified 743
13 Ga0058862_12648726 3300004803 Unclassified 565
14 Ga0058862_12829145 3300004803 Bacteria 596
15 Ga0058862_12890471 3300004803 Bacteria 592
16 Ga0065712_10004477 3300005290 Bacteria 4619
17 Ga0065715_10927599 3300005293 Unclassified 566
18 Ga0070658_10454785 3300005327 Unclassified 1103
19 Ga0070683_100029028 3300005329 Bacteria 5005
20 Ga0070683_100032910 3300005329 Bacteria 4725
21 Ga0070683_100050518 3300005329 Unclassified 3850
22 Ga0070683_100063058 3300005329 Bacteria 3447
23 Ga0070683_100099292 3300005329 Bacteria 2740
24 Ga0070670_100033268 3300005331 Bacteria 4441
25 Ga0070670_100200266 3300005331 Bacteria 1735
26 Ga0070680_100068634 3300005336 Bacteria 2910
27 Ga0070680_100185584 3300005336 Unclassified 1752
28 Ga0070680_100550338 3300005336 Bacteria 989
29 Ga0070682_100021501 3300005337 Bacteria 3808
30 Ga0068868_100023580 3300005338 Unclassified 4658
31 Ga0068868_100608172 3300005338 Unclassified 969
32 Ga0068868_102010386 3300005338 Unclassified 549
33 Ga0070687_100010047 3300005343 Bacteria 4075
34 Ga0070661_100050659 3300005344 Bacteria 3038
35 Ga0070661_100482584 3300005344 Unclassified 990
36 Ga0070661_100741363 3300005344 Unclassified 803
37 Ga0070661_101083988 3300005344 Unclassified 667
38 Ga0070668_101081230 3300005347 Unclassified 723
39 Ga0070671_100138283 3300005355 Bacteria 2054
40 Ga0070659_100325710 3300005366 Unclassified 1285
41 Ga0070709_10001568 3300005434 Bacteria 12332
42 Ga0070709_10004307 3300005434 Bacteria 7675
43 Ga0070709_10010600 3300005434 Bacteria 5109
44 Ga0070709_10058936 3300005434 Bacteria 2436
45 Ga0070709_10077265 3300005434 Unclassified 2164
46 Ga0070709_10085018 3300005434 Bacteria 2074
47 Ga0070709_10093598 3300005434 Bacteria 1987
48 Ga0070709_10208008 3300005434 Bacteria 1389
49 Ga0070709_10255407 3300005434 Bacteria 1264
50 Ga0070709_10282023 3300005434 Bacteria 1208
51 Ga0070709_10623534 3300005434 Unclassified 832
52 Ga0070709_10817046 3300005434 Bacteria 733
53 Ga0070714_100000134 3300005435 Bacteria 58475
54 Ga0070714_100007313 3300005435 Bacteria 8588
55 Ga0070714_100019452 3300005435 Bacteria 5533
56 Ga0070714_100071760 3300005435 Bacteria 2995
57 Ga0070714_100107153 3300005435 Bacteria 2470
58 Ga0070714_100153055 3300005435 Bacteria 2080
59 Ga0070714_100245381 3300005435 Unclassified 1654
60 Ga0070714_100282903 3300005435 Bacteria 1541
61 Ga0070714_100367742 3300005435 Bacteria 1353
62 Ga0070714_100369358 3300005435 Bacteria 1350
63 Ga0070714_100394007 3300005435 Bacteria 1308
64 Ga0070714_100480672 3300005435 Bacteria 1183
65 Ga0070714_100698186 3300005435 Bacteria 979
66 Ga0070714_100841585 3300005435 Bacteria 889
67 Ga0070714_101104924 3300005435 Unclassified 773
68 Ga0070713_100000455 3300005436 Bacteria 26196
69 Ga0070713_100000888 3300005436 Bacteria 19171
70 Ga0070713_100004293 3300005436 Bacteria 9548
71 Ga0070713_100010694 3300005436 Bacteria 6642
72 Ga0070713_100015714 3300005436 Bacteria 5671
73 Ga0070713_100035462 3300005436 Bacteria 4016
74 Ga0070713_100065497 3300005436 Bacteria 3052
75 Ga0070713_100083953 3300005436 Bacteria 2724
76 Ga0070713_100187746 3300005436 Unclassified 1861
77 Ga0070713_100195717 3300005436 Bacteria 1823
78 Ga0070713_100276405 3300005436 Unclassified 1539
79 Ga0070713_100330686 3300005436 Unclassified 1409
80 Ga0070713_100499520 3300005436 Bacteria 1147
81 Ga0070713_100824393 3300005436 Unclassified 890
82 Ga0070713_101414648 3300005436 Unclassified 674
83 Ga0070713_101925698 3300005436 Unclassified 573
84 Ga0070710_10001659 3300005437 Bacteria 10481
85 Ga0070710_10017404 3300005437 Bacteria 3677
86 Ga0070710_10024604 3300005437 Bacteria 3179
87 Ga0070710_10064137 3300005437 Unclassified 2100
88 Ga0070710_10115498 3300005437 Bacteria 1618
89 Ga0070710_10128616 3300005437 Bacteria 1541
90 Ga0070710_10183812 3300005437 Bacteria 1310
91 Ga0070710_10195594 3300005437 Unclassified 1274
92 Ga0070710_10216030 3300005437 Bacteria 1218
93 Ga0070710_10668814 3300005437 Bacteria 730
94 Ga0070710_11239588 3300005437 Unclassified 553
95 Ga0070711_100000138 3300005439 Bacteria 38924
96 Ga0070711_100004490 3300005439 Bacteria 8246
97 Ga0070711_100023588 3300005439 Bacteria 4004
98 Ga0070711_100028885 3300005439 Bacteria 3653
99 Ga0070711_100054633 3300005439 Bacteria 2756
100 Ga0070711_100069874 3300005439 Bacteria 2471
101 Ga0070711_100135018 3300005439 Bacteria 1843
102 Ga0070711_100165446 3300005439 Bacteria 1681
103 Ga0070711_100189613 3300005439 Bacteria 1579
104 Ga0070711_100703940 3300005439 Bacteria 851
105 Ga0070711_100741329 3300005439 Bacteria 830
106 Ga0070711_100842998 3300005439 Unclassified 779
107 Ga0070711_101635656 3300005439 Unclassified 563
108 Ga0070705_100167271 3300005440 Bacteria 1476
109 Ga0070708_100006623 3300005445 Bacteria 9220
110 Ga0070708_100010321 3300005445 Bacteria 7563
111 Ga0070708_100021434 3300005445 Bacteria 5464
112 Ga0070708_100031007 3300005445 Unclassified 4625
113 Ga0070708_100050095 3300005445 Bacteria 3696
114 Ga0070708_100062000 3300005445 Bacteria 3342
115 Ga0070708_100068032 3300005445 Bacteria 3200
116 Ga0070708_100070254 3300005445 Unclassified 3150
117 Ga0070708_100190957 3300005445 Bacteria 1915
118 Ga0070708_100191442 3300005445 Unclassified 1913
119 Ga0070708_101524092 3300005445 Unclassified 623
120 Ga0070663_100083459 3300005455 Bacteria 2353
121 Ga0070678_101081542 3300005456 Unclassified 740
122 Ga0070662_100028600 3300005457 Bacteria 3880
123 Ga0070662_100124696 3300005457 Unclassified 1978
124 Ga0070681_10000655 3300005458 Bacteria 28573
125 Ga0070681_10003758 3300005458 Bacteria 14249
126 Ga0070681_10292972 3300005458 Unclassified 1537
127 Ga0070681_10361054 3300005458 Unclassified 1363
128 Ga0070681_10402307 3300005458 Bacteria 1280
129 Ga0070681_10679901 3300005458 Unclassified 945
130 Ga0068867_100029267 3300005459 Bacteria 3968
131 Ga0070706_100012946 3300005467 Bacteria 7722
132 Ga0070706_100015992 3300005467 Bacteria 6929
133 Ga0070706_100162768 3300005467 Bacteria 2083
134 Ga0070706_100180543 3300005467 Bacteria 1970
135 Ga0070706_100335935 3300005467 Bacteria 1409
136 Ga0070706_100509367 3300005467 Bacteria 1119
137 Ga0070706_100729331 3300005467 Bacteria 919
138 Ga0070706_101050171 3300005467 Bacteria 751
139 Ga0070707_100017410 3300005468 Bacteria 6755
140 Ga0070707_100040648 3300005468 Bacteria 4449
141 Ga0070707_100068858 3300005468 Unclassified 3406
142 Ga0070707_100074091 3300005468 Bacteria 3283
143 Ga0070707_100311287 3300005468 Bacteria 1530
144 Ga0070707_100311658 3300005468 Bacteria 1529
145 Ga0070707_100342791 3300005468 Bacteria 1452
146 Ga0070707_101526208 3300005468 Unclassified 635
147 Ga0070707_101882275 3300005468 Bacteria 566
148 Ga0070698_100010229 3300005471 Bacteria 10018
149 Ga0070698_100037918 3300005471 Unclassified 4968
150 Ga0070698_100067029 3300005471 Bacteria 3611
151 Ga0070698_100291962 3300005471 Bacteria 1561
152 Ga0070698_100378630 3300005471 Bacteria 1348
153 Ga0070699_100001209 3300005518 Bacteria 23875
154 Ga0070699_100065797 3300005518 Unclassified 3146
155 Ga0070699_100711848 3300005518 Bacteria 917
156 Ga0070699_101070868 3300005518 Unclassified 740
157 Ga0070699_102080663 3300005518 Bacteria 519
158 Ga0070679_100021754 3300005530 Bacteria 6264
159 Ga0070679_100098891 3300005530 Bacteria 2905
160 Ga0070679_100145619 3300005530 Bacteria 2347
161 Ga0070679_100161015 3300005530 Bacteria 2219
162 Ga0070679_100386596 3300005530 Bacteria 1346
163 Ga0070684_100093821 3300005535 Unclassified 2672
164 Ga0070684_100324002 3300005535 Unclassified 1415
165 Ga0070684_101672998 3300005535 Unclassified 600
166 Ga0070697_100000111 3300005536 Bacteria 63543
167 Ga0070697_100007335 3300005536 Bacteria 8579
168 Ga0070697_100198645 3300005536 Bacteria 1704
169 Ga0070697_100925975 3300005536 Bacteria 774
170 Ga0070697_101901485 3300005536 Bacteria 533
171 Ga0068853_100012877 3300005539 Bacteria 6816
172 Ga0068853_100073401 3300005539 Bacteria 2983
173 Ga0068853_100561934 3300005539 Bacteria 1081
174 Ga0068853_100603069 3300005539 Bacteria 1043
175 Ga0070686_100298523 3300005544 Unclassified 1194
176 Ga0070696_100032477 3300005546 Bacteria 3581
177 Ga0070693_100022502 3300005547 Bacteria 3353
178 Ga0070693_100036808 3300005547 Unclassified 2723
179 Ga0070693_100037041 3300005547 Bacteria 2717
180 Ga0070693_101151163 3300005547 Unclassified 594
181 Ga0068855_100000427 3300005563 Bacteria 52063
182 Ga0068855_100000507 3300005563 Bacteria 48210
183 Ga0068855_100005274 3300005563 Bacteria 15778
184 Ga0068855_100125696 3300005563 Bacteria 2932
185 Ga0068855_100612126 3300005563 Unclassified 1173
186 Ga0068855_100683584 3300005563 Unclassified 1100
187 Ga0070664_100001749 3300005564 Bacteria 17386
188 Ga0070664_100014977 3300005564 Bacteria 6328
189 Ga0070664_100452660 3300005564 Bacteria 1179
190 Ga0070664_100686694 3300005564 Bacteria 953
191 Ga0068857_100000136 3300005577 Bacteria 44769
192 Ga0068857_100000352 3300005577 Bacteria 31917
193 Ga0068857_100259667 3300005577 Unclassified 1594
194 Ga0068857_100432766 3300005577 Unclassified 1228
195 Ga0068857_101543254 3300005577 Unclassified 648
196 Ga0068854_100043260 3300005578 Bacteria 3192
197 Ga0068854_100246553 3300005578 Unclassified 1424
198 Ga0068854_100541277 3300005578 Bacteria 986
199 Ga0068854_100552916 3300005578 Unclassified 976
200 Ga0068856_100000493 3300005614 Bacteria 43650
201 Ga0068856_100013453 3300005614 Bacteria 7919
202 Ga0068856_100013498 3300005614 Bacteria 7909
203 Ga0068856_100021235 3300005614 Bacteria 6308
204 Ga0068856_100041989 3300005614 Bacteria 4497
205 Ga0068856_100053931 3300005614 Bacteria 3964
206 Ga0068856_100081009 3300005614 Unclassified 3220
207 Ga0068856_100131834 3300005614 Unclassified 2504
208 Ga0068856_100313320 3300005614 Unclassified 1587
209 Ga0068856_100752297 3300005614 Bacteria 995
210 Ga0068856_101641806 3300005614 Unclassified 656
211 Ga0070702_100030070 3300005615 Bacteria 2958
212 Ga0068852_100019189 3300005616 Bacteria 5404
213 Ga0068852_100039271 3300005616 Unclassified 3984
214 Ga0068852_100872568 3300005616 Unclassified 916
215 Ga0068859_100010398 3300005617 Bacteria 9364
216 Ga0068864_100003365 3300005618 Bacteria 13218
217 Ga0068866_10026082 3300005718 Bacteria 2755
218 Ga0068866_10844471 3300005718 Unclassified 640
219 Ga0068861_100348592 3300005719 Bacteria 1298
220 Ga0068861_100562321 3300005719 Unclassified 1041
221 Ga0068851_10039955 3300005834 Bacteria 2357
222 Ga0068851_10191675 3300005834 Bacteria 1137
223 Ga0068851_10453029 3300005834 Unclassified 763
224 Ga0068870_10557119 3300005840 Unclassified 773
225 Ga0068870_11226646 3300005840 Unclassified 544
226 Ga0068863_100019241 3300005841 Bacteria 6532
227 Ga0068863_100084407 3300005841 Bacteria 3010
228 Ga0068863_100712758 3300005841 Unclassified 998
229 Ga0068858_100006486 3300005842 Bacteria 11388
230 Ga0068858_100230516 3300005842 Unclassified 1756
231 Ga0068858_100246567 3300005842 Unclassified 1696
232 Ga0068860_100129134 3300005843 Bacteria 2424
233 Ga0068860_101010496 3300005843 Unclassified 850
234 Ga0070717_10001333 3300006028 Bacteria 16948
235 Ga0070717_10001426 3300006028 Bacteria 16472
236 Ga0070717_10003705 3300006028 Bacteria 10982
237 Ga0070717_10008299 3300006028 Bacteria 7755
238 Ga0070717_10046652 3300006028 Bacteria 3546
239 Ga0070717_10049446 3300006028 Bacteria 3452
240 Ga0070717_10056923 3300006028 Unclassified 3232
241 Ga0070717_10088709 3300006028 Bacteria 2607
242 Ga0070717_10128957 3300006028 Unclassified 2173
243 Ga0070717_10132507 3300006028 Bacteria 2144
244 Ga0070717_10179465 3300006028 Bacteria 1845
245 Ga0070717_10211283 3300006028 Bacteria 1703
246 Ga0070717_10222163 3300006028 Unclassified 1661
247 Ga0070717_10284389 3300006028 Bacteria 1467
248 Ga0070717_10527251 3300006028 Bacteria 1069
249 Ga0070717_10695823 3300006028 Bacteria 923
250 Ga0070717_10834496 3300006028 Unclassified 839
251 Ga0070717_11860083 3300006028 Unclassified 544
252 Ga0070715_10006489 3300006163 Bacteria 3981
253 Ga0070715_10085035 3300006163 Bacteria 1444
254 Ga0070715_10179960 3300006163 Unclassified 1059
255 Ga0070715_10221726 3300006163 Bacteria 973
256 Ga0070716_100001005 3300006173 Bacteria 12325
257 Ga0070716_100037181 3300006173 Bacteria 2689
258 Ga0070716_100069884 3300006173 Bacteria 2060
259 Ga0070716_100078149 3300006173 Bacteria 1966
260 Ga0070716_100090519 3300006173 Bacteria 1851
261 Ga0070716_100105744 3300006173 Bacteria 1734
262 Ga0070716_100291682 3300006173 Unclassified 1131
263 Ga0070716_100345165 3300006173 Bacteria 1052
264 Ga0070716_100454433 3300006173 Bacteria 935
265 Ga0070716_101062924 3300006173 Unclassified 643
266 Ga0070716_101381015 3300006173 Unclassified 572
267 Ga0070716_101493943 3300006173 Bacteria 552
268 Ga0070712_100000484 3300006175 Bacteria 22755
269 Ga0070712_100001333 3300006175 Bacteria 14967
270 Ga0070712_100003916 3300006175 Bacteria 9169
271 Ga0070712_100005530 3300006175 Bacteria 7820
272 Ga0070712_100033370 3300006175 Bacteria 3482
273 Ga0070712_100046838 3300006175 Bacteria 2990
274 Ga0070712_100058391 3300006175 Bacteria 2714
275 Ga0070712_100121120 3300006175 Bacteria 1968
276 Ga0070712_100345353 3300006175 Unclassified 1216
277 Ga0097621_100000419 3300006237 Bacteria 29596
278 Ga0097621_100012574 3300006237 Bacteria 6280
279 Ga0097621_100098359 3300006237 Bacteria 2458
280 Ga0097621_100217927 3300006237 Bacteria 1662
281 Ga0068871_100000048 3300006358 Bacteria 66152
282 Ga0068871_100009029 3300006358 Bacteria 7201
283 Ga0068871_100442566 3300006358 Bacteria 1164
284 Ga0068871_101371423 3300006358 Unclassified 666
285 Ga0068871_101483405 3300006358 Bacteria 640
286 Ga0075433_10000909 3300006852 Bacteria 20857
287 Ga0075434_100000080 3300006871 Bacteria 52022
288 Ga0075434_100126946 3300006871 Bacteria 2567
289 Ga0075434_100674098 3300006871 Bacteria 1052
290 Ga0075434_102523806 3300006871 Unclassified 515
291 Ga0075434_102590415 3300006871 Unclassified 508
292 Ga0068865_100012958 3300006881 Bacteria 5258
293 Ga0068865_100027893 3300006881 Bacteria 3735
294 Ga0075436_100011564 3300006914 Bacteria 6054
295 Ga0075436_100030810 3300006914 Bacteria 3691
296 Ga0075436_100160688 3300006914 Bacteria 1583
297 Ga0075436_100164357 3300006914 Bacteria 1565
298 Ga0075436_100284314 3300006914 Unclassified 1183
299 Ga0075436_100411372 3300006914 Unclassified 981
300 Ga0075436_100620095 3300006914 Unclassified 798
301 Ga0097620_100010398 3300006931 Bacteria 9364
302 Ga0075435_100000142 3300007076 Bacteria 40637
303 Ga0075435_100035077 3300007076 Bacteria 3979
304 Ga0075435_100275162 3300007076 Bacteria 1437
305 Ga0075435_100611079 3300007076 Bacteria 946
306 Ga0099794_10072326 3300007265 Bacteria 1690
307 Ga0099794_10785165 3300007265 Unclassified 509
308 Ga0099795_10020473 3300007788 Bacteria 2156
309 Ga0099795_10051874 3300007788 Bacteria 1496
310 Ga0099795_10085923 3300007788 Bacteria 1212
311 Ga0099795_10600825 3300007788 Bacteria 524
312 Ga0105240_10010692 3300009093 Bacteria 12879
313 Ga0105240_10034008 3300009093 Bacteria 6580
314 Ga0105240_10049650 3300009093 Bacteria 5294
315 Ga0105240_10076934 3300009093 Bacteria 4112
316 Ga0105240_10078613 3300009093 Unclassified 4062
317 Ga0105240_10104179 3300009093 Bacteria 3445
318 Ga0105240_10316011 3300009093 Bacteria 1782
319 Ga0105240_10316666 3300009093 Bacteria 1779
320 Ga0105240_10433691 3300009093 Bacteria 1474
321 Ga0105240_10489548 3300009093 Bacteria 1369
322 Ga0105240_11095868 3300009093 Unclassified 847
323 Ga0105240_11233274 3300009093 Unclassified 791
324 Ga0105245_10011029 3300009098 Bacteria 7866
325 Ga0105245_10013122 3300009098 Bacteria 7220
326 Ga0105245_10275573 3300009098 Bacteria 1642
327 Ga0105247_11178814 3300009101 Bacteria 609
328 Ga0105247_11263125 3300009101 Unclassified 591
329 Ga0114129_10446350 3300009147 Bacteria 1697
330 Ga0105241_10000878 3300009174 Bacteria 22713
331 Ga0105241_10015193 3300009174 Bacteria 5638
332 Ga0105241_10021165 3300009174 Bacteria 4808
333 Ga0105241_10045725 3300009174 Bacteria 3323
334 Ga0105241_10120354 3300009174 Bacteria 2113
335 Ga0105241_10184033 3300009174 Unclassified 1735
336 Ga0105241_10437936 3300009174 Unclassified 1154
337 Ga0105242_10265572 3300009176 Unclassified 1552
338 Ga0105242_10482920 3300009176 Bacteria 1175
339 Ga0105248_10034039 3300009177 Bacteria 5695
340 Ga0105248_10038402 3300009177 Bacteria 5358
341 Ga0105237_10060500 3300009545 Bacteria 3789
342 Ga0105237_10063320 3300009545 Bacteria 3696
343 Ga0105237_10077509 3300009545 Bacteria 3313
344 Ga0105237_10140681 3300009545 Bacteria 2407
345 Ga0105237_10181653 3300009545 Bacteria 2104
346 Ga0105237_11869011 3300009545 Unclassified 608
347 Ga0105237_12444295 3300009545 Unclassified 533
348 Ga0105237_12708944 3300009545 Unclassified 507
349 Ga0105238_10000135 3300009551 Bacteria 81026
350 Ga0105238_10024741 3300009551 Bacteria 6120
351 Ga0105238_10256265 3300009551 Bacteria 1729
352 Ga0105238_10268289 3300009551 Bacteria 1687
353 Ga0105238_10630861 3300009551 Bacteria 1081
354 Ga0105238_10713395 3300009551 Bacteria 1015
355 Ga0105238_10733544 3300009551 Unclassified 1001
356 Ga0105238_11474565 3300009551 Unclassified 709
357 Ga0105238_12192816 3300009551 Unclassified 587
358 Ga0105249_10711375 3300009553 Unclassified 1065
359 Ga0099796_10090133 3300010159 Bacteria 1139
360 Ga0099796_10202795 3300010159 Unclassified 805
361 Ga0099796_10303038 3300010159 Unclassified 678
362 Ga0105239_10013061 3300010375 Bacteria 9230
363 Ga0105239_10025069 3300010375 Bacteria 6569
364 Ga0105239_10080657 3300010375 Bacteria 3580
365 Ga0105239_10086009 3300010375 Unclassified 3465
366 Ga0105239_10185996 3300010375 Bacteria 2325
367 Ga0105239_10254453 3300010375 Unclassified 1973
368 Ga0105239_10911621 3300010375 Unclassified 1009
369 Ga0105239_11070573 3300010375 Bacteria 928
370 Ga0157326_1099490 3300012513 Unclassified 501
371 Ga0157373_10001908 3300013100 Bacteria 15811
372 Ga0157373_10100205 3300013100 Bacteria 2038
373 Ga0157373_10182718 3300013100 Bacteria 1477
374 Ga0157373_10224199 3300013100 Unclassified 1327
375 Ga0157373_10278848 3300013100 Bacteria 1184
376 Ga0157373_10283303 3300013100 Bacteria 1175
377 Ga0157373_10529691 3300013100 Bacteria 853
378 Ga0157371_10062056 3300013102 Bacteria 2650
379 Ga0157371_10873761 3300013102 Unclassified 681
380 Ga0157370_10018270 3300013104 Bacteria 7053
381 Ga0157370_10096135 3300013104 Bacteria 2779
382 Ga0157370_10232465 3300013104 Unclassified 1706
383 Ga0157369_10000034 3300013105 Bacteria 200710
384 Ga0157369_10020521 3300013105 Bacteria 7387
385 Ga0157369_10028231 3300013105 Bacteria 6211
386 Ga0157369_10075478 3300013105 Unclassified 3615
387 Ga0157369_10095983 3300013105 Bacteria 3163
388 Ga0157369_10103642 3300013105 Bacteria 3030
389 Ga0157369_10107201 3300013105 Bacteria 2972
390 Ga0157369_10207016 3300013105 Bacteria 2057
391 Ga0157369_10244530 3300013105 Bacteria 1873
392 Ga0157369_10496461 3300013105 Unclassified 1263
393 Ga0157369_10672993 3300013105 Bacteria 1066
394 Ga0157369_10906248 3300013105 Unclassified 904
395 Ga0157374_10000112 3300013296 Bacteria 74313
396 Ga0157374_10000183 3300013296 Bacteria 58330
397 Ga0157374_10000210 3300013296 Bacteria 53686
398 Ga0157374_10175254 3300013296 Bacteria 2093
399 Ga0157374_10277523 3300013296 Unclassified 1654
400 Ga0157374_10383774 3300013296 Unclassified 1400
401 Ga0157374_10641844 3300013296 Bacteria 1073
402 Ga0157378_10000107 3300013297 Bacteria 79357
403 Ga0157378_10000127 3300013297 Bacteria 74509
404 Ga0157378_10007947 3300013297 Bacteria 9258
405 Ga0157378_10026030 3300013297 Bacteria 5156
406 Ga0157378_10460498 3300013297 Bacteria 1264
407 Ga0157378_12347859 3300013297 Bacteria 585
408 Ga0163162_10194520 3300013306 Bacteria 2156
409 Ga0163162_10247648 3300013306 Unclassified 1914
410 Ga0163162_10370841 3300013306 Bacteria 1565
411 Ga0163162_10382194 3300013306 Bacteria 1541
412 Ga0163162_11244368 3300013306 Unclassified 845
413 Ga0157372_10000059 3300013307 Bacteria 124697
414 Ga0157372_10000153 3300013307 Bacteria 74783
415 Ga0157372_10002821 3300013307 Bacteria 18772
416 Ga0157372_10003843 3300013307 Bacteria 16137
417 Ga0157372_10010295 3300013307 Bacteria 9935
418 Ga0157372_10025802 3300013307 Bacteria 6391
419 Ga0157372_10042214 3300013307 Bacteria 5043
420 Ga0157372_10124432 3300013307 Bacteria 2964
421 Ga0157372_10213178 3300013307 Bacteria 2238
422 Ga0157372_10242206 3300013307 Bacteria 2093
423 Ga0157372_10268689 3300013307 Bacteria 1981
424 Ga0157372_10897677 3300013307 Bacteria 1028
425 Ga0157372_10938583 3300013307 Unclassified 1003
426 Ga0157372_10951001 3300013307 Unclassified 996
427 Ga0157372_11406346 3300013307 Bacteria 804
428 Ga0157372_11677067 3300013307 Unclassified 731
429 Ga0157372_11698172 3300013307 Unclassified 726
430 Ga0157372_12251814 3300013307 Unclassified 626
431 Ga0157375_11180935 3300013308 Unclassified 897
432 Ga0163163_10214386 3300014325 Bacteria 1974
433 Ga0182008_10432526 3300014497 Unclassified 712
434 Ga0182008_10931855 3300014497 Unclassified 513
435 Ga0157379_10857964 3300014968 Bacteria 859
436 Ga0157376_10004651 3300014969 Bacteria 9565
437 Ga0157376_10346892 3300014969 Unclassified 1419
438 Ga0157376_10360164 3300014969 Unclassified 1395
439 Ga0157376_12845185 3300014969 Unclassified 524
440 Ga0182006_1247657 3300015261 Unclassified 585
441 Ga0182007_10006797 3300015262 Bacteria 4870
442 Ga0182007_10064398 3300015262 Unclassified 1201
443 Ga0182007_10208001 3300015262 Unclassified 687
444 Ga0182005_1148284 3300015265 Bacteria 681
445 Ga0197907_10258267 3300020069 Unclassified 529
446 Ga0197907_10489849 3300020069 Unclassified 532
447 Ga0197907_11396651 3300020069 Unclassified 564
448 Ga0206356_10111165 3300020070 Unclassified 946
449 Ga0206356_10630039 3300020070 Unclassified 771
450 Ga0206356_10808840 3300020070 Unclassified 656
451 Ga0206356_11024997 3300020070 Unclassified 531
452 Ga0206356_11223647 3300020070 Unclassified 627
453 Ga0206356_11349120 3300020070 Bacteria 738
454 Ga0206349_1972346 3300020075 Unclassified 559
455 Ga0206355_1392844 3300020076 Unclassified 638
456 Ga0206352_10041766 3300020078 Unclassified 917
457 Ga0206352_10267634 3300020078 Unclassified 570
458 Ga0206352_10724634 3300020078 Unclassified 602
459 Ga0206352_10859100 3300020078 Unclassified 612
460 Ga0206352_11112670 3300020078 Bacteria 566
461 Ga0206352_11299062 3300020078 Unclassified 673
462 Ga0206350_10726275 3300020080 Unclassified 608
463 Ga0206354_10857068 3300020081 Unclassified 570
464 Ga0206353_10196849 3300020082 Unclassified 504
465 Ga0213874_10334747 3300021377 Unclassified 577
466 Ga0213875_10132854 3300021388 Bacteria 1164
467 Ga0224712_10367311 3300022467 Unclassified 682
468 Ga0224712_10483769 3300022467 Unclassified 597
469 Ga0228598_1120632 3300024227 Unclassified 532
470 Ga0207656_10146100 3300025321 Unclassified 1117
471 Ga0207656_10207127 3300025321 Unclassified 949
472 Ga0207692_10001123 3300025898 Bacteria 9851
473 Ga0207692_10176941 3300025898 Bacteria 1240
474 Ga0207692_10212072 3300025898 Unclassified 1144
475 Ga0207692_10275268 3300025898 Bacteria 1016
476 Ga0207692_10288771 3300025898 Bacteria 995
477 Ga0207692_10290612 3300025898 Unclassified 992
478 Ga0207692_10338443 3300025898 Bacteria 925
479 Ga0207692_10796099 3300025898 Bacteria 618
480 Ga0207647_10146704 3300025904 Unclassified 1380
481 Ga0207685_10013877 3300025905 Unclassified 2505
482 Ga0207685_10114675 3300025905 Bacteria 1173
483 Ga0207685_10164635 3300025905 Bacteria 1015
484 Ga0207685_10176975 3300025905 Bacteria 986
485 Ga0207685_10375131 3300025905 Unclassified 723
486 Ga0207699_10001179 3300025906 Bacteria 12374
487 Ga0207699_10013292 3300025906 Bacteria 4210
488 Ga0207699_10022387 3300025906 Bacteria 3423
489 Ga0207699_10036546 3300025906 Bacteria 2801
490 Ga0207699_10057913 3300025906 Bacteria 2316
491 Ga0207699_10130776 3300025906 Unclassified 1637
492 Ga0207699_10286630 3300025906 Bacteria 1146
493 Ga0207699_10545593 3300025906 Unclassified 840
494 Ga0207699_11235177 3300025906 Bacteria 553
495 Ga0207643_10033887 3300025908 Unclassified 2858
496 Ga0207643_10363483 3300025908 Unclassified 910
497 Ga0207684_10000623 3300025910 Bacteria 42146
498 Ga0207684_10166148 3300025910 Bacteria 1901
499 Ga0207684_10274061 3300025910 Bacteria 1456
500 Ga0207684_10425921 3300025910 Bacteria 1140
501 Ga0207684_10473655 3300025910 Bacteria 1074
502 Ga0207684_10510815 3300025910 Unclassified 1030
503 Ga0207684_10617137 3300025910 Bacteria 925
504 Ga0207684_11221622 3300025910 Bacteria 622
505 Ga0207654_10078313 3300025911 Bacteria 1983
506 Ga0207654_10105154 3300025911 Bacteria 1746
507 Ga0207654_10485364 3300025911 Unclassified 871
508 Ga0207707_10025137 3300025912 Bacteria 5209
509 Ga0207707_10035225 3300025912 Bacteria 4378
510 Ga0207707_10164179 3300025912 Bacteria 1941
511 Ga0207707_11017558 3300025912 Unclassified 679
512 Ga0207707_11267719 3300025912 Unclassified 594
513 Ga0207695_10044785 3300025913 Bacteria 4703
514 Ga0207695_10072295 3300025913 Bacteria 3520
515 Ga0207695_10108054 3300025913 Bacteria 2767
516 Ga0207695_10277788 3300025913 Unclassified 1569
517 Ga0207695_10497888 3300025913 Bacteria 1101
518 Ga0207695_10772142 3300025913 Unclassified 841
519 Ga0207695_11114694 3300025913 Unclassified 669
520 Ga0207671_10051401 3300025914 Bacteria 3054
521 Ga0207671_10492317 3300025914 Bacteria 977
522 Ga0207693_10000022 3300025915 Bacteria 127887
523 Ga0207693_10000820 3300025915 Bacteria 27693
524 Ga0207693_10006127 3300025915 Bacteria 9967
525 Ga0207693_10010331 3300025915 Bacteria 7577
526 Ga0207693_10067882 3300025915 Bacteria 2792
527 Ga0207693_10081325 3300025915 Bacteria 2536
528 Ga0207693_10083803 3300025915 Bacteria 2498
529 Ga0207693_10114030 3300025915 Bacteria 2120
530 Ga0207693_10156541 3300025915 Unclassified 1792
531 Ga0207693_10541419 3300025915 Unclassified 908
532 Ga0207693_11086680 3300025915 Unclassified 608
533 Ga0207663_10003426 3300025916 Bacteria 7762
534 Ga0207663_10007954 3300025916 Bacteria 5532
535 Ga0207663_10017744 3300025916 Bacteria 3973
536 Ga0207663_10048932 3300025916 Bacteria 2619
537 Ga0207663_10069246 3300025916 Bacteria 2269
538 Ga0207663_10078040 3300025916 Bacteria 2158
539 Ga0207663_10106865 3300025916 Bacteria 1892
540 Ga0207663_10204076 3300025916 Bacteria 1428
541 Ga0207663_10270004 3300025916 Bacteria 1259
542 Ga0207663_10411491 3300025916 Unclassified 1036
543 Ga0207663_10879285 3300025916 Bacteria 716
544 Ga0207663_11081640 3300025916 Unclassified 644
545 Ga0207660_10050113 3300025917 Bacteria 2964
546 Ga0207660_10108862 3300025917 Unclassified 2082
547 Ga0207657_10003709 3300025919 Bacteria 16233
548 Ga0207649_10016068 3300025920 Bacteria 4214
549 Ga0207649_10668435 3300025920 Unclassified 804
550 Ga0207652_10090651 3300025921 Bacteria 2687
551 Ga0207652_10159047 3300025921 Bacteria 2025
552 Ga0207652_10309414 3300025921 Bacteria 1426
553 Ga0207652_10444118 3300025921 Unclassified 1169
554 Ga0207652_10453034 3300025921 Unclassified 1156
555 Ga0207652_11096986 3300025921 Unclassified 696
556 Ga0207652_11228525 3300025921 Unclassified 651
557 Ga0207652_11286640 3300025921 Unclassified 634
558 Ga0207646_10000332 3300025922 Bacteria 64190
559 Ga0207646_10124875 3300025922 Bacteria 2314
560 Ga0207646_10129566 3300025922 Bacteria 2270
561 Ga0207646_10421806 3300025922 Bacteria 1204
562 Ga0207646_10719702 3300025922 Unclassified 892
563 Ga0207646_10826557 3300025922 Bacteria 824
564 Ga0207694_10000722 3300025924 Bacteria 29682
565 Ga0207694_10209983 3300025924 Bacteria 1586
566 Ga0207694_10319482 3300025924 Bacteria 1281
567 Ga0207694_10367243 3300025924 Bacteria 1193
568 Ga0207694_10434452 3300025924 Bacteria 1095
569 Ga0207694_11207955 3300025924 Unclassified 640
570 Ga0207694_11679204 3300025924 Unclassified 535
571 Ga0207650_10022032 3300025925 Bacteria 4509
572 Ga0207650_10167627 3300025925 Bacteria 1744
573 Ga0207687_10004632 3300025927 Bacteria 9149
574 Ga0207687_10205345 3300025927 Bacteria 1542
575 Ga0207687_10319869 3300025927 Bacteria 1256
576 Ga0207700_10000056 3300025928 Bacteria 71553
577 Ga0207700_10002505 3300025928 Bacteria 10530
578 Ga0207700_10002969 3300025928 Bacteria 9782
579 Ga0207700_10008231 3300025928 Bacteria 6444
580 Ga0207700_10023517 3300025928 Bacteria 4250
581 Ga0207700_10122768 3300025928 Bacteria 2108
582 Ga0207700_10133720 3300025928 Bacteria 2029
583 Ga0207700_10205979 3300025928 Unclassified 1660
584 Ga0207700_10233400 3300025928 Bacteria 1565
585 Ga0207700_10301062 3300025928 Unclassified 1385
586 Ga0207700_10445806 3300025928 Bacteria 1140
587 Ga0207700_10561502 3300025928 Unclassified 1014
588 Ga0207700_10674488 3300025928 Unclassified 922
589 Ga0207700_11015603 3300025928 Bacteria 742
590 Ga0207700_11032128 3300025928 Unclassified 736
591 Ga0207700_11494429 3300025928 Bacteria 599
592 Ga0207664_10000143 3300025929 Bacteria 58667
593 Ga0207664_10002694 3300025929 Bacteria 11783
594 Ga0207664_10006310 3300025929 Bacteria 8148
595 Ga0207664_10058116 3300025929 Bacteria 3076
596 Ga0207664_10062318 3300025929 Bacteria 2978
597 Ga0207664_10092432 3300025929 Bacteria 2483
598 Ga0207664_10233448 3300025929 Unclassified 1599
599 Ga0207664_10591222 3300025929 Bacteria 997
600 Ga0207664_10754918 3300025929 Bacteria 875
601 Ga0207664_10880446 3300025929 Bacteria 804
602 Ga0207664_10951437 3300025929 Unclassified 770
603 Ga0207664_10951685 3300025929 Bacteria 770
604 Ga0207664_11090869 3300025929 Bacteria 714
605 Ga0207664_11122512 3300025929 Unclassified 702
606 Ga0207664_11457714 3300025929 Bacteria 606
607 Ga0207644_10627549 3300025931 Unclassified 893
608 Ga0207644_10917472 3300025931 Unclassified 734
609 Ga0207690_10027935 3300025932 Bacteria 3571
610 Ga0207690_10284908 3300025932 Unclassified 1288
611 Ga0207704_10016830 3300025938 Bacteria 3770
612 Ga0207704_10037395 3300025938 Bacteria 2804
613 Ga0207665_10003243 3300025939 Bacteria 10897
614 Ga0207665_10012455 3300025939 Bacteria 5586
615 Ga0207665_10023801 3300025939 Bacteria 4033
616 Ga0207665_10029343 3300025939 Bacteria 3636
617 Ga0207665_10037952 3300025939 Bacteria 3206
618 Ga0207665_10126198 3300025939 Bacteria 1812
619 Ga0207665_10216591 3300025939 Bacteria 1401
620 Ga0207665_10330875 3300025939 Bacteria 1146
621 Ga0207665_10338969 3300025939 Unclassified 1132
622 Ga0207665_10427054 3300025939 Bacteria 1013
623 Ga0207665_10607563 3300025939 Bacteria 854
624 Ga0207665_10849103 3300025939 Bacteria 723
625 Ga0207665_11448757 3300025939 Unclassified 546
626 Ga0207711_10040765 3300025941 Unclassified 3951
627 Ga0207711_10178762 3300025941 Bacteria 1928
628 Ga0207689_10096804 3300025942 Bacteria 2424
629 Ga0207661_10020975 3300025944 Bacteria 4893
630 Ga0207661_10139192 3300025944 Bacteria 2087
631 Ga0207679_10001953 3300025945 Bacteria 12799
632 Ga0207679_10156552 3300025945 Bacteria 1861
633 Ga0207679_10500874 3300025945 Unclassified 1084
634 Ga0207679_10932731 3300025945 Bacteria 795
635 Ga0207679_11031610 3300025945 Unclassified 754
636 Ga0207667_10002755 3300025949 Bacteria 21728
637 Ga0207667_10003317 3300025949 Bacteria 19862
638 Ga0207667_10054522 3300025949 Bacteria 4205
639 Ga0207667_10745127 3300025949 Unclassified 979
640 Ga0207667_10788137 3300025949 Unclassified 948
641 Ga0207667_11802424 3300025949 Unclassified 576
642 Ga0207651_10206832 3300025960 Bacteria 1577
643 Ga0207640_10017610 3300025981 Bacteria 4184
644 Ga0207640_10144889 3300025981 Unclassified 1737
645 Ga0207640_10199445 3300025981 Bacteria 1515
646 Ga0207640_10383377 3300025981 Unclassified 1140
647 Ga0207640_11373165 3300025981 Unclassified 632
648 Ga0207640_11616205 3300025981 Unclassified 584
649 Ga0207677_10054258 3300026023 Bacteria 2734
650 Ga0207677_10471857 3300026023 Unclassified 1079
651 Ga0207677_10474766 3300026023 Bacteria 1076
652 Ga0207677_10669469 3300026023 Unclassified 918
653 Ga0207703_10004306 3300026035 Bacteria 11702
654 Ga0207703_10547565 3300026035 Bacteria 1091
655 Ga0207639_10064001 3300026041 Bacteria 2850
656 Ga0207639_10184246 3300026041 Unclassified 1778
657 Ga0207639_10244891 3300026041 Bacteria 1561
658 Ga0207678_10408916 3300026067 Unclassified 1176
659 Ga0207702_10000171 3300026078 Bacteria 77495
660 Ga0207702_10004667 3300026078 Bacteria 12106
661 Ga0207702_10005214 3300026078 Bacteria 11411
662 Ga0207702_10018480 3300026078 Bacteria 5768
663 Ga0207702_10033096 3300026078 Bacteria 4316
664 Ga0207702_10067499 3300026078 Bacteria 3069
665 Ga0207702_11893981 3300026078 Unclassified 588
666 Ga0207641_10013876 3300026088 Bacteria 6609
667 Ga0207641_12201949 3300026088 Unclassified 551
668 Ga0207648_10042480 3300026089 Bacteria 3991
669 Ga0207676_10008218 3300026095 Bacteria 7427
670 Ga0207674_10000126 3300026116 Bacteria 88965
671 Ga0207674_10000230 3300026116 Bacteria 69765
672 Ga0207674_10071474 3300026116 Unclassified 3486
673 Ga0207674_10140862 3300026116 Unclassified 2371
674 Ga0207675_101466147 3300026118 Unclassified 703
675 Ga0207683_10917862 3300026121 Unclassified 813
676 Ga0207698_10104365 3300026142 Unclassified 2358
677 Ga0207698_10213858 3300026142 Bacteria 1736
678 Ga0207698_10338953 3300026142 Unclassified 1415
679 Ga0207698_10923263 3300026142 Unclassified 881
680 Ga0209179_1061338 3300027512 Unclassified 816
681 Ga0209179_1109634 3300027512 Bacteria 616
682 Ga0265354_1001518 3300028016 Bacteria 3279
683 Ga0265356_1005152 3300028017 Bacteria 1573
684 Ga0265356_1005696 3300028017 Bacteria 1477
685 Ga0265355_1009091 3300028036 Bacteria 801
686 Ga0265355_1017696 3300028036 Unclassified 609
687 Ga0268264_10327763 3300028381 Unclassified 1450
688 Ga0265336_10057607 3300028666 Bacteria 1167
689 Ga0265338_10000352 3300028800 Bacteria 83563
690 Ga0265338_10006522 3300028800 Bacteria 14837
691 Ga0265338_10019949 3300028800 Bacteria 7078
692 Ga0265338_10177218 3300028800 Unclassified 1628
693 Ga0265338_10220215 3300028800 Bacteria 1418
694 Ga0265324_10078795 3300029957 Bacteria 1121
695 Ga0265762_1000945 3300030760 Bacteria 5206
696 Ga0265762_1042491 3300030760 Bacteria 893
697 Ga0265763_1026593 3300030763 Unclassified 637
698 Ga0265770_1016019 3300030878 Bacteria 1146
699 Ga0265765_1046549 3300030879 Unclassified 587
700 Ga0265760_10003368 3300031090 Bacteria 4660
701 Ga0265760_10005801 3300031090 Bacteria 3531
702 Ga0265760_10008109 3300031090 Bacteria 3000
703 Ga0265760_10009506 3300031090 Bacteria 2776
704 Ga0265760_10106178 3300031090 Bacteria 891
705 Ga0265328_10028487 3300031239 Bacteria 2089
706 Ga0265325_10019838 3300031241 Bacteria 3712
707 Ga0265325_10204845 3300031241 Bacteria 908
708 Ga0265329_10312938 3300031242 Unclassified 532
709 Ga0265339_10013614 3300031249 Unclassified 4926
710 Ga0265339_10064430 3300031249 Bacteria 1966
711 Ga0265339_10085214 3300031249 Unclassified 1664
712 Ga0265331_10543433 3300031250 Unclassified 524
713 Ga0265316_10013501 3300031344 Bacteria 7249
714 Ga0265316_10119372 3300031344 Bacteria 1992
715 Ga0307408_102339127 3300031548 Unclassified 518
716 Ga0265314_10036059 3300031711 Bacteria 3598
717 Ga0265314_10045866 3300031711 Bacteria 3087
718 Ga0265314_10080354 3300031711 Bacteria 2153
719 Ga0265342_10531585 3300031712 Unclassified 598
720 Ga0307412_12290455 3300031911 Unclassified 504
721 Ga0373926_0001236 3300035083 Bacteria 7690
722 Ga0373926_0025756 3300035083 Bacteria 2054
723 Ga0373926_0106830 3300035083 Bacteria 1050
724 Ga0373926_0123847 3300035083 Bacteria 976
725 Ga0373926_0193208 3300035083 Unclassified 782
726 Ga0373934_0011542 3300035086 Bacteria 3323
727 Ga0373934_0054809 3300035086 Bacteria 1583
728 Ga0373944_0045162 3300035089 Unclassified 1374
729 Ga0373944_0288575 3300035089 Unclassified 613
730 Ga0373952_0221025 3300035092 Bacteria 563
731 Ga0373923_0026086 3300035111 Bacteria 2322
732 Ga0373923_0129846 3300035111 Bacteria 1131
733 Ga0373923_0135719 3300035111 Unclassified 1109
734 Ga0373923_0326499 3300035111 Bacteria 729
735 Ga0373932_0305078 3300035112 Unclassified 595
736 Ga0373936_0006487 3300035113 Bacteria 4412
737 Ga0373936_0022692 3300035113 Bacteria 2443
738 Ga0373936_0155606 3300035113 Bacteria 993
739 Ga0373936_0262399 3300035113 Unclassified 773
740 Ga0373945_0004750 3300035116 Bacteria 4328
741 Ga0373945_0006937 3300035116 Bacteria 3662
742 Ga0373945_0096911 3300035116 Unclassified 1149
743 Ga0373953_0012461 3300035117 Unclassified 3012
744 Ga0373953_0110008 3300035117 Bacteria 1165
745 Ga0373954_0013500 3300035118 Bacteria 3641
746 Ga0373954_0120039 3300035118 Unclassified 1276
747 Ga0373954_0136327 3300035118 Unclassified 1196
748 Ga0373956_0016495 3300035119 Bacteria 3103
749 Ga0373956_0069808 3300035119 Bacteria 1602
750 Ga0373956_0559702 3300035119 Unclassified 546
751 Ga0373957_0083717 3300035120 Bacteria 1261
752 Ga0373957_0449661 3300035120 Unclassified 557
753 Ga0373943_0000116 3300035170 Bacteria 29820
754 Ga0373943_0099992 3300035170 Bacteria 1515
755 Ga0373943_0539532 3300035170 Unclassified 684
756 Ga0373946_0003133 3300035171 Bacteria 5859
757 Ga0373946_0034039 3300035171 Unclassified 2054
758 Ga0373946_0261240 3300035171 Bacteria 847
759 Ga0373946_0720521 3300035171 Unclassified 522
760 Ga0373955_0163711 3300035172 Bacteria 1314
761 Ga0373955_0348418 3300035172 Unclassified 897
762 Ga0373955_0430828 3300035172 Unclassified 803
763 Ga0373955_0498738 3300035172 Bacteria 743
764 Ga0373955_0720616 3300035172 Unclassified 612
765 Ga0373962_0269731 3300035242 Unclassified 596
766 Ga0373924_0000483 3300035410 Bacteria 12180
767 Ga0373931_0443140 3300035691 Unclassified 829
768 Ga0373935_0001975 3300035692 Bacteria 11546
769 Ga0373935_0003523 3300035692 Bacteria 9108
770 Ga0373935_0005149 3300035692 Bacteria 7696
771 Ga0373935_0027330 3300035692 Bacteria 3526
772 Ga0373935_0062488 3300035692 Bacteria 2385
773 Ga0373935_0105724 3300035692 Bacteria 1861
774 Ga0373935_0131229 3300035692 Bacteria 1684
775 Ga0373935_0562204 3300035692 Bacteria 832
776 Ga0373935_1003184 3300035692 Bacteria 620
777 Ga0373935_1252308 3300035692 Unclassified 553
778 Ga0373927_0000118 3300035695 Bacteria 59794
779 Ga0373927_0022021 3300035695 Bacteria 4176
780 Ga0373927_0082888 3300035695 Bacteria 2079
781 Ga0373927_0303687 3300035695 Bacteria 1050
782 Ga0373927_0421912 3300035695 Unclassified 880
783 Ga0373927_0588628 3300035695 Unclassified 735
784 Ga0373933_0005233 3300035724 Bacteria 7078
785 Ga0373933_0045132 3300035724 Bacteria 2613
786 Ga0373933_0062768 3300035724 Bacteria 2245
787 Ga0373933_0112538 3300035724 Bacteria 1699
788 Ga0373933_0494507 3300035724 Unclassified 801
789 Ga0373933_0695753 3300035724 Unclassified 668
790 Ga0373933_0812244 3300035724 Bacteria 615
791 Ga0373947_0004767 3300035725 Bacteria 7941
792 Ga0373947_0005481 3300035725 Bacteria 7405
793 Ga0373947_0006908 3300035725 Bacteria 6580
794 Ga0373947_0042147 3300035725 Bacteria 2724
795 Ga0373947_0097000 3300035725 Bacteria 1847
796 Ga0373947_0718345 3300035725 Unclassified 682
797 Ga0373947_0928620 3300035725 Unclassified 594
798 Ga0373937_0008419 3300036401 Bacteria 8967
799 Ga0373937_0242943 3300036401 Bacteria 1696
800 Ga0373937_0578759 3300036401 Bacteria 1066
801 Ga0373937_1051076 3300036401 Unclassified 763
802 Ga0373937_1099843 3300036401 Unclassified 743
803 Ga0373937_1461194 3300036401 Unclassified 631
804 Ga0265778_007379 3300036457 Bacteria 1203
805 Ga0265778_014072 3300036457 Unclassified 943
806 Ga0373925_0002638 3300037068 Bacteria 14224
807 Ga0373925_0059363 3300037068 Bacteria 2869
808 Ga0373925_0101439 3300037068 Bacteria 2213
809 Ga0373925_0101695 3300037068 Bacteria 2210
810 Ga0373925_0341080 3300037068 Unclassified 1215
811 Ga0373925_0395553 3300037068 Bacteria 1126
812 Ga0373925_0424803 3300037068 Unclassified 1086
813 Ga0373925_0819043 3300037068 Bacteria 767
814 Ga0373925_1077903 3300037068 Bacteria 661
815 Ga0373925_1209380 3300037068 Unclassified 621
816 Ga0395900_0497151 3300037418 Bacteria 1170
817 Ga0395900_0646194 3300037418 Bacteria 995
818 Ga0395905_0014337 3300037471 Bacteria 7575
819 Ga0395905_0425490 3300037471 Bacteria 1224
820 Ga0395905_0429496 3300037471 Bacteria 1218
821 Ga0395905_0585323 3300037471 Unclassified 1018
822 Ga0395905_1154890 3300037471 Unclassified 678
823 Ga0395905_1195284 3300037471 Unclassified 664
824 Ga0436364_0718644 3300037853 Bacteria 590
825 Ga0436364_1209441 3300037853 Bacteria 1672
826 Ga0395901_1229128 3300038443 Bacteria 714
827 Ga0395901_1330092 3300038443 Unclassified 679
828 Ga0436365_1285273 3300039437 Bacteria 1128
829 Ga0436361_0473294 3300039447 Unclassified 667
830 Ga0436363_0339936 3300039450 Bacteria 1845
831 Ga0436363_0644164 3300039450 Unclassified 776
832 Ga0436363_1175243 3300039450 Bacteria 728
833 Ga0436363_1451564 3300039450 Bacteria 1457
834 Ga0436362_0380443 3300039453 Unclassified 522
835 Ga0436362_0484552 3300039453 Unclassified 552
836 Ga0451839_0359763 3300041496 Unclassified 891
837 Ga0451577_0529712 3300042876 Bacteria 1070
838 Ga0466963_0103799 3300044694 Bacteria 1947
839 Ga0466963_0172440 3300044694 Bacteria 1508
840 Ga0466964_0161003 3300044706 Unclassified 1049
841 Ga0466964_0500467 3300044706 Unclassified 652
842 Ga0466971_0024151 3300044719 Bacteria 2712
843 Ga0466968_0305491 3300044735 Bacteria 766
844 Ga0466970_0397342 3300044765 Unclassified 786
845 Ga0466957_0191541 3300044842 Bacteria 1340
846 Ga0466959_0807034 3300045049 Bacteria 627
847 Ga0451576_0054004 3300045051 Bacteria 4207
848 Ga0451576_0386136 3300045051 Bacteria 1468
849 Ga0451576_0471234 3300045051 Unclassified 1319
850 Ga0451576_0780898 3300045051 Bacteria 1003
851 Ga0466967_0007474 3300045976 Bacteria 7884
852 Ga0466967_0016737 3300045976 Bacteria 5794
853 Ga0466967_0611165 3300045976 Unclassified 1076
854 Ga0466967_1704533 3300045976 Bacteria 628
855 Ga0466967_2485015 3300045976 Unclassified 513
856 Ga0495592_0235602 3300046454 Bacteria 1217
857 Ga0495629_0003956 3300046459 Bacteria 11142
858 Ga0495629_1134695 3300046459 Bacteria 504
859 Ga0495641_0357020 3300046461 Unclassified 661
860 Ga0495651_0431524 3300046462 Unclassified 855
861 Ga0495651_0879568 3300046462 Bacteria 549
862 Ga0495653_0428294 3300046463 Bacteria 836
863 Ga0495580_0000255 3300046472 Bacteria 42406
864 Ga0495580_0001135 3300046472 Bacteria 23464
865 Ga0495580_0001634 3300046472 Bacteria 19724
866 Ga0495580_0010770 3300046472 Bacteria 7102
867 Ga0495580_0033759 3300046472 Bacteria 3685
868 Ga0495580_0062917 3300046472 Unclassified 2603
869 Ga0495580_0306287 3300046472 Bacteria 1081
870 Ga0495580_0326981 3300046472 Unclassified 1041
871 Ga0495580_0368086 3300046472 Bacteria 972
872 Ga0495580_0435194 3300046472 Unclassified 881
873 Ga0495580_0518614 3300046472 Bacteria 794
874 Ga0495580_0581816 3300046472 Bacteria 741
875 Ga0495580_0736943 3300046472 Unclassified 643
876 Ga0495582_0001022 3300046473 Bacteria 15658
877 Ga0495582_0001816 3300046473 Bacteria 12068
878 Ga0495582_0226426 3300046473 Unclassified 1070
879 Ga0495582_0759083 3300046473 Unclassified 561
880 Ga0495639_0251700 3300046475 Unclassified 873
881 Ga0495662_0398782 3300046476 Bacteria 676
882 Ga0495664_0020430 3300046477 Bacteria 3820
883 Ga0495608_0025414 3300046511 Bacteria 4043
884 Ga0495618_0260908 3300046514 Bacteria 1085
885 Ga0495628_0414596 3300046516 Unclassified 982
886 Ga0495630_0030815 3300046517 Unclassified 3992
887 Ga0495630_0076895 3300046517 Bacteria 2516
888 Ga0495630_0096649 3300046517 Bacteria 2233
889 Ga0495630_0342821 3300046517 Bacteria 1143
890 Ga0495630_0387194 3300046517 Unclassified 1071
891 Ga0495630_0524083 3300046517 Unclassified 909
892 Ga0495666_0048033 3300046526 Bacteria 2056
893 Ga0495652_0715787 3300046529 Unclassified 672
894 Ga0495665_0005508 3300046531 Bacteria 6820
895 Ga0495665_0098371 3300046531 Unclassified 1536
896 Ga0495665_0252979 3300046531 Bacteria 907
897 Ga0495665_0266815 3300046531 Unclassified 880
898 Ga0495665_0407163 3300046531 Unclassified 690
899 Ga0495587_0281053 3300046536 Bacteria 933
900 Ga0495645_0304571 3300046543 Unclassified 1040
901 Ga0495667_0174953 3300046559 Bacteria 1379
902 Ga0495634_0277964 3300046642 Bacteria 1018
903 Ga0495635_0273787 3300046663 Unclassified 1135
904 Ga0495635_0375526 3300046663 Bacteria 946
905 Ga0495588_0250991 3300046674 Bacteria 933
906 Ga0495599_0178262 3300046678 Unclassified 1310
907 Ga0495623_0341322 3300046679 Unclassified 818
908 Ga0495646_0464353 3300046680 Unclassified 653
909 Ga0495647_0235750 3300046681 Bacteria 811
910 Ga0495658_0062032 3300046683 Bacteria 2148
911 Ga0495658_0075217 3300046683 Unclassified 1970
912 Ga0495669_0010544 3300046684 Bacteria 3908
913 Ga0495669_0059144 3300046684 Bacteria 1730
914 Ga0495669_0387493 3300046684 Unclassified 677
915 Ga0495613_1094769 3300046689 Unclassified 509
916 Ga0495624_0475268 3300046690 Bacteria 748
917 Ga0495581_0019223 3300047315 Bacteria 3965
918 Ga0495581_0530835 3300047315 Unclassified 683
919 Ga0495604_0049079 3300047317 Bacteria 3281
920 Ga0495604_0504684 3300047317 Unclassified 784
921 Ga0495674_0004353 3300047319 Bacteria 13610
922 Ga0495674_0006067 3300047319 Bacteria 11596
923 Ga0495674_0105039 3300047319 Bacteria 2401
924 Ga0495674_0389182 3300047319 Bacteria 1127
925 Ga0495674_1381332 3300047319 Unclassified 525
926 Ga0495675_0249749 3300047444 Bacteria 1066
927 Ga0495675_0407349 3300047444 Bacteria 792
928 Ga0495684_0307611 3300047471 Bacteria 1137
929 Ga0495684_0634418 3300047471 Unclassified 716
930 Ga0495593_0368187 3300047673 Unclassified 718
931 Ga0495602_0081476 3300048088 Bacteria 2721
932 Ga0495602_0112020 3300048088 Bacteria 2215
933 Ga0495602_0143062 3300048088 Bacteria 1891
934 Ga0495602_0343977 3300048088 Bacteria 1078
935 Ga0495602_0368486 3300048088 Bacteria 1032
936 Ga0495614_0061167 3300048089 Unclassified 1618
937 Ga0495614_0106381 3300048089 Bacteria 1230
938 Ga0495614_0427314 3300048089 Unclassified 625
939 Ga0495615_0113748 3300048090 Bacteria 777
940 Ga0496100_0937086 3300048903 Unclassified 681
941 Ga0496101_0408315 3300048904 Bacteria 1070
942 Ga0496102_0031359 3300048905 Bacteria 4768
943 Ga0496102_0095643 3300048905 Bacteria 2753
944 Ga0496102_0214053 3300048905 Bacteria 1816
945 Ga0496102_0542778 3300048905 Unclassified 1085
946 Ga0496103_0073409 3300048906 Unclassified 2143
947 Ga0496104_0080282 3300048907 Bacteria 3110
948 Ga0496104_0085102 3300048907 Bacteria 3018
949 Ga0496104_0089105 3300048907 Unclassified 2948
950 Ga0496104_0156736 3300048907 Bacteria 2185
951 Ga0496104_0518680 3300048907 Bacteria 1103
952 Ga0496104_1774138 3300048907 Unclassified 519
953 Ga0496105_0015430 3300048908 Bacteria 6088
954 Ga0496106_0185479 3300048909 Unclassified 1653
955 Ga0496106_0792120 3300048909 Unclassified 752
956 Ga0496108_1149981 3300048911 Unclassified 658
957 Ga0496109_0346838 3300048912 Bacteria 1402
958 Ga0496110_0188264 3300048913 Bacteria 1874
959 Ga0496110_0640156 3300048913 Bacteria 963
960 Ga0496111_0010026 3300048914 Bacteria 6339
961 Ga0496111_0091884 3300048914 Bacteria 2224
962 Ga0496112_0004567 3300048915 Bacteria 11765
963 Ga0496112_0007155 3300048915 Bacteria 9880
964 Ga0496112_0013968 3300048915 Bacteria 7432
965 Ga0496112_0041580 3300048915 Unclassified 4498
966 Ga0496112_0137029 3300048915 Bacteria 2417
967 Ga0496112_0249350 3300048915 Bacteria 1727
968 Ga0496112_0348844 3300048915 Bacteria 1423
969 Ga0496112_0350265 3300048915 Bacteria 1419
970 Ga0496112_0380131 3300048915 Bacteria 1353
971 Ga0496113_0509075 3300048916 Unclassified 966
972 Ga0496113_0510042 3300048916 Bacteria 965
973 Ga0496113_1108204 3300048916 Unclassified 621
974 Ga0496113_1163118 3300048916 Unclassified 603
975 Ga0496114_0058677 3300048917 Unclassified 3214
976 Ga0496115_0050088 3300048918 Bacteria 3345
977 Ga0496115_0052541 3300048918 Unclassified 3269
978 Ga0501067_0282572 3300049583 Archaea 924
979 nmdc:mga05p37_302135_c2 3300050507 Bacteria 1504
980 nmdc:mga0n895_125_c1 3300050512 Bacteria 45661
981 nmdc:mga0n895_2069452_c1 3300050512 Unclassified 526
982 nmdc:mga0n895_275082_c1 3300050512 Bacteria 1708
983 nmdc:mga0n895_304338_c1 3300050512 Bacteria 1616
984 nmdc:mga0rr50_1046767_c1 3300050513 Unclassified 695
985 nmdc:mga0rr50_1357_c1 3300050513 Bacteria 13378
986 nmdc:mga0rr50_248633_c1 3300050513 Bacteria 1476
987 nmdc:mga0rr50_43383_c1 3300050513 Bacteria 3291
988 nmdc:mga08x19_1090877_c1 3300050514 Unclassified 566
989 nmdc:mga08x19_16026_c1 3300050514 Bacteria 4567
990 nmdc:mga08x19_404993_c1 3300050514 Unclassified 957
991 nmdc:mga08x19_8698_c1 3300050514 Bacteria 6054
992 nmdc:mga08x19_930998_c1 3300050514 Bacteria 617
993 nmdc:mga0a205_5864_c2 3300050515 Bacteria 10037
994 Ga0495601_0013413 3300053077 Bacteria 4928
995 Ga0495612_0208189 3300053078 Unclassified 864
996 Ga0495619_0300888 3300053085 Bacteria 1111
997 Ga0495619_0994372 3300053085 Unclassified 561
998 Ga0587084_098213 3300059477 Unclassified 590
999 Ga0587084_113935 3300059477 Bacteria 562
1000 Ga0587084_133480 3300059477 Unclassified 533
1001 Ga0587093_028989 3300059478 Unclassified 786
1002 Ga0587093_046910 3300059478 Unclassified 671
1003 Ga0587093_068845 3300059478 Unclassified 591
1004 Ga0587093_070759 3300059478 Unclassified 586
1005 Ga0587066_079374 3300059490 Unclassified 708
1006 Ga0587066_130047 3300059490 Unclassified 604
1007 Ga0587066_149219 3300059490 Unclassified 578
1008 Ga0587070_139553 3300059491 Unclassified 597
1009 Ga0587070_143576 3300059491 Bacteria 592
1010 Ga0587070_169979 3300059491 Unclassified 560
1011 Ga0587073_0007548 3300059492 Bacteria 1724
1012 Ga0587073_0129917 3300059492 Unclassified 690
1013 Ga0587073_0160074 3300059492 Unclassified 644
1014 Ga0587073_0180238 3300059492 Unclassified 619
1015 Ga0587073_0191234 3300059492 Unclassified 607
1016 Ga0587077_050473 3300059493 Unclassified 869
1017 Ga0587077_121989 3300059493 Unclassified 651
1018 Ga0587077_143784 3300059493 Bacteria 617
1019 Ga0587077_164388 3300059493 Unclassified 590
1020 Ga0587080_065871 3300059503 Unclassified 715
1021 Ga0587080_076606 3300059503 Unclassified 679
1022 Ga0587080_096507 3300059503 Bacteria 627
1023 Ga0587082_113382 3300059504 Unclassified 605
1024 Ga0587082_123510 3300059504 Unclassified 587
1025 Ga0587083_0014707 3300059505 Bacteria 1353
1026 Ga0587083_0156400 3300059505 Unclassified 620
1027 Ga0587083_0163281 3300059505 Unclassified 611
1028 Ga0587083_0183023 3300059505 Bacteria 588
1029 Ga0587085_037629 3300059506 Unclassified 828
1030 Ga0587085_105429 3300059506 Unclassified 601
1031 Ga0587085_143427 3300059506 Unclassified 545
1032 Ga0587089_096014 3300059509 Unclassified 533
1033 Ga0587090_085290 3300059510 Unclassified 639
1034 Ga0587090_145262 3300059510 Unclassified 533
1035 Ga0587091_149355 3300059511 Unclassified 592
1036 Ga0587091_168689 3300059511 Unclassified 568
1037 Ga0587091_171792 3300059511 Unclassified 564
1038 Ga0587092_033196 3300059512 Unclassified 865
1039 Ga0587094_084308 3300059513 Unclassified 592
1040 Ga0587094_120556 3300059513 Unclassified 525
1041 Ga0587106_106111 3300059605 Unclassified 580
1042 Ga0587101_025561 3300059623 Unclassified 886
1043 Ga0587109_114410 3300059624 Unclassified 634
1044 Ga0587109_207847 3300059624 Unclassified 513
1045 Ga0587115_068359 3300059626 Unclassified 609
1046 Ga0587117_088028 3300059627 Unclassified 575
1047 Ga0587128_067268 3300059630 Unclassified 690
1048 Ga0587128_082072 3300059630 Unclassified 647
1049 Ga0587062_084764 3300059639 Bacteria 594
1050 Ga0587067_035591 3300059640 Unclassified 943
1051 Ga0587067_135907 3300059640 Unclassified 604
1052 Ga0587067_166785 3300059640 Unclassified 564
1053 Ga0587068_099892 3300059641 Unclassified 608
1054 Ga0587069_037866 3300059642 Unclassified 811
1055 Ga0587069_060283 3300059642 Unclassified 697
1056 Ga0587075_044054 3300059644 Unclassified 758
1057 Ga0587075_068044 3300059644 Bacteria 656
1058 Ga0587075_098467 3300059644 Unclassified 581
1059 Ga0587076_077715 3300059645 Unclassified 702
1060 Ga0587076_087046 3300059645 Unclassified 676
1061 Ga0587076_095291 3300059645 Unclassified 657
1062 Ga0587078_033426 3300059646 Unclassified 702
1063 Ga0587078_046621 3300059646 Unclassified 626
1064 Ga0587078_051963 3300059646 Unclassified 603
1065 Ga0587078_052777 3300059646 Unclassified 599
1066 Ga0587079_033473 3300059647 Unclassified 1001
1067 Ga0587079_062609 3300059647 Unclassified 810
1068 Ga0587079_185899 3300059647 Unclassified 559
1069 Ga0587102_044607 3300059649 Unclassified 582
1070 Ga0587102_045586 3300059649 Unclassified 578
1071 Ga0587107_029582 3300059652 Unclassified 825
1072 Ga0587119_055081 3300059658 Unclassified 602
1073 Ga0587119_065862 3300059658 Unclassified 567
1074 Ga0587060_036802 3300060243 Unclassified 514
1075 Ga0587071_046728 3300060344 Unclassified 884
1076 Ga0587071_144394 3300060344 Unclassified 587
1077 Ga0587071_179176 3300060344 Unclassified 543
1078 Ga0587111_0064732 3300060346 Unclassified 840
1079 Ga0587111_0141020 3300060346 Unclassified 639
1080 Ga0466962_0037678 3300061719 Bacteria 2316
1081 Ga0070712_101019267
1082 LJNas_1000562
1083 rootH1_10275960
1084 Ga0058863_10047664
1085 Ga0058863_10173066
1086 Ga0058863_11654109
1087 Ga0058863_11662177
1088 Ga0058861_11644902
1089 Ga0058861_11680532
1090 Ga0058861_11905019
1091 Ga0058862_10184300
1092 Ga0058862_12590030
1093 Ga0058862_12648726
1094 Ga0058862_12829145
1095 Ga0058862_12890471
1096 Ga0065712_10004477
1097 Ga0065715_10927599
1098 Ga0070658_10454785
1099 Ga0070683_100029028
1100 Ga0070683_100032910
1101 Ga0070683_100050518
1102 Ga0070683_100063058
1103 Ga0070683_100099292
1104 Ga0070670_100033268
1105 Ga0070670_100200266
1106 Ga0070680_100068634
1107 Ga0070680_100185584
1108 Ga0070680_100550338
1109 Ga0070682_100021501
1110 Ga0068868_100023580
1111 Ga0068868_100608172
1112 Ga0068868_102010386
1113 Ga0070687_100010047
1114 Ga0070661_100050659
1115 Ga0070661_100482584
1116 Ga0070661_100741363
1117 Ga0070661_101083988
1118 Ga0070668_101081230
1119 Ga0070671_100138283
1120 Ga0070659_100325710
1121 Ga0070709_10001568
1122 Ga0070709_10004307
1123 Ga0070709_10010600
1124 Ga0070709_10058936
1125 Ga0070709_10077265
1126 Ga0070709_10085018
1127 Ga0070709_10093598
1128 Ga0070709_10208008
1129 Ga0070709_10255407
1130 Ga0070709_10282023
1131 Ga0070709_10623534
1132 Ga0070709_10817046
1133 Ga0070714_100000134
1134 Ga0070714_100007313
1135 Ga0070714_100019452
1136 Ga0070714_100071760
1137 Ga0070714_100107153
1138 Ga0070714_100153055
1139 Ga0070714_100245381
1140 Ga0070714_100282903
1141 Ga0070714_100367742
1142 Ga0070714_100369358
1143 Ga0070714_100394007
1144 Ga0070714_100480672
1145 Ga0070714_100698186
1146 Ga0070714_100841585
1147 Ga0070714_101104924
1148 Ga0070713_100000455
1149 Ga0070713_100000888
1150 Ga0070713_100004293
1151 Ga0070713_100010694
1152 Ga0070713_100015714
1153 Ga0070713_100035462
1154 Ga0070713_100065497
1155 Ga0070713_100083953
1156 Ga0070713_100187746
1157 Ga0070713_100195717
1158 Ga0070713_100276405
1159 Ga0070713_100330686
1160 Ga0070713_100499520
1161 Ga0070713_100824393
1162 Ga0070713_101414648
1163 Ga0070713_101925698
1164 Ga0070710_10001659
1165 Ga0070710_10017404
1166 Ga0070710_10024604
1167 Ga0070710_10064137
1168 Ga0070710_10115498
1169 Ga0070710_10128616
1170 Ga0070710_10183812
1171 Ga0070710_10195594
1172 Ga0070710_10216030
1173 Ga0070710_10668814
1174 Ga0070710_11239588
1175 Ga0070711_100000138
1176 Ga0070711_100004490
1177 Ga0070711_100023588
1178 Ga0070711_100028885
1179 Ga0070711_100054633
1180 Ga0070711_100069874
1181 Ga0070711_100135018
1182 Ga0070711_100165446
1183 Ga0070711_100189613
1184 Ga0070711_100703940
1185 Ga0070711_100741329
1186 Ga0070711_100842998
1187 Ga0070711_101635656
1188 Ga0070705_100167271
1189 Ga0070708_100006623
1190 Ga0070708_100010321
1191 Ga0070708_100021434
1192 Ga0070708_100031007
1193 Ga0070708_100050095
1194 Ga0070708_100062000
1195 Ga0070708_100068032
1196 Ga0070708_100070254
1197 Ga0070708_100190957
1198 Ga0070708_100191442
1199 Ga0070708_101524092
1200 Ga0070663_100083459
1201 Ga0070678_101081542
1202 Ga0070662_100028600
1203 Ga0070662_100124696
1204 Ga0070681_10000655
1205 Ga0070681_10003758
1206 Ga0070681_10292972
1207 Ga0070681_10361054
1208 Ga0070681_10402307
1209 Ga0070681_10679901
1210 Ga0068867_100029267
1211 Ga0070706_100012946
1212 Ga0070706_100015992
1213 Ga0070706_100162768
1214 Ga0070706_100180543
1215 Ga0070706_100335935
1216 Ga0070706_100509367
1217 Ga0070706_100729331
1218 Ga0070706_101050171
1219 Ga0070707_100017410
1220 Ga0070707_100040648
1221 Ga0070707_100068858
1222 Ga0070707_100074091
1223 Ga0070707_100311287
1224 Ga0070707_100311658
1225 Ga0070707_100342791
1226 Ga0070707_101526208
1227 Ga0070707_101882275
1228 Ga0070698_100010229
1229 Ga0070698_100037918
1230 Ga0070698_100067029
1231 Ga0070698_100291962
1232 Ga0070698_100378630
1233 Ga0070699_100001209
1234 Ga0070699_100065797
1235 Ga0070699_100711848
1236 Ga0070699_101070868
1237 Ga0070699_102080663
1238 Ga0070679_100021754
1239 Ga0070679_100098891
1240 Ga0070679_100145619
1241 Ga0070679_100161015
1242 Ga0070679_100386596
1243 Ga0070684_100093821
1244 Ga0070684_100324002
1245 Ga0070684_101672998
1246 Ga0070697_100000111
1247 Ga0070697_100007335
1248 Ga0070697_100198645
1249 Ga0070697_100925975
1250 Ga0070697_101901485
1251 Ga0068853_100012877
1252 Ga0068853_100073401
1253 Ga0068853_100561934
1254 Ga0068853_100603069
1255 Ga0070686_100298523
1256 Ga0070696_100032477
1257 Ga0070693_100022502
1258 Ga0070693_100036808
1259 Ga0070693_100037041
1260 Ga0070693_101151163
1261 Ga0068855_100000427
1262 Ga0068855_100000507
1263 Ga0068855_100005274
1264 Ga0068855_100125696
1265 Ga0068855_100612126
1266 Ga0068855_100683584
1267 Ga0070664_100001749
1268 Ga0070664_100014977
1269 Ga0070664_100452660
1270 Ga0070664_100686694
1271 Ga0068857_100000136
1272 Ga0068857_100000352
1273 Ga0068857_100259667
1274 Ga0068857_100432766
1275 Ga0068857_101543254
1276 Ga0068854_100043260
1277 Ga0068854_100246553
1278 Ga0068854_100541277
1279 Ga0068854_100552916
1280 Ga0068856_100000493
1281 Ga0068856_100013453
1282 Ga0068856_100013498
1283 Ga0068856_100021235
1284 Ga0068856_100041989
1285 Ga0068856_100053931
1286 Ga0068856_100081009
1287 Ga0068856_100131834
1288 Ga0068856_100313320
1289 Ga0068856_100752297
1290 Ga0068856_101641806
1291 Ga0070702_100030070
1292 Ga0068852_100019189
1293 Ga0068852_100039271
1294 Ga0068852_100872568
1295 Ga0068859_100010398
1296 Ga0068864_100003365
1297 Ga0068866_10026082
1298 Ga0068866_10844471
1299 Ga0068861_100348592
1300 Ga0068861_100562321
1301 Ga0068851_10039955
1302 Ga0068851_10191675
1303 Ga0068851_10453029
1304 Ga0068870_10557119
1305 Ga0068870_11226646
1306 Ga0068863_100019241
1307 Ga0068863_100084407
1308 Ga0068863_100712758
1309 Ga0068858_100006486
1310 Ga0068858_100230516
1311 Ga0068858_100246567
1312 Ga0068860_100129134
1313 Ga0068860_101010496
1314 Ga0070717_10001333
1315 Ga0070717_10001426
1316 Ga0070717_10003705
1317 Ga0070717_10008299
1318 Ga0070717_10046652
1319 Ga0070717_10049446
1320 Ga0070717_10056923
1321 Ga0070717_10088709
1322 Ga0070717_10128957
1323 Ga0070717_10132507
1324 Ga0070717_10179465
1325 Ga0070717_10211283
1326 Ga0070717_10222163
1327 Ga0070717_10284389
1328 Ga0070717_10527251
1329 Ga0070717_10695823
1330 Ga0070717_10834496
1331 Ga0070717_11860083
1332 Ga0070715_10006489
1333 Ga0070715_10085035
1334 Ga0070715_10179960
1335 Ga0070715_10221726
1336 Ga0070716_100001005
1337 Ga0070716_100037181
1338 Ga0070716_100069884
1339 Ga0070716_100078149
1340 Ga0070716_100090519
1341 Ga0070716_100105744
1342 Ga0070716_100291682
1343 Ga0070716_100345165
1344 Ga0070716_100454433
1345 Ga0070716_101062924
1346 Ga0070716_101381015
1347 Ga0070716_101493943
1348 Ga0070712_100000484
1349 Ga0070712_100001333
1350 Ga0070712_100003916
1351 Ga0070712_100005530
1352 Ga0070712_100033370
1353 Ga0070712_100046838
1354 Ga0070712_100058391
1355 Ga0070712_100121120
1356 Ga0070712_100345353
1357 Ga0097621_100000419
1358 Ga0097621_100012574
1359 Ga0097621_100098359
1360 Ga0097621_100217927
1361 Ga0068871_100000048
1362 Ga0068871_100009029
1363 Ga0068871_100442566
1364 Ga0068871_101371423
1365 Ga0068871_101483405
1366 Ga0075433_10000909
1367 Ga0075434_100000080
1368 Ga0075434_100126946
1369 Ga0075434_100674098
1370 Ga0075434_102523806
1371 Ga0075434_102590415
1372 Ga0068865_100012958
1373 Ga0068865_100027893
1374 Ga0075436_100011564
1375 Ga0075436_100030810
1376 Ga0075436_100160688
1377 Ga0075436_100164357
1378 Ga0075436_100284314
1379 Ga0075436_100411372
1380 Ga0075436_100620095
1381 Ga0097620_100010398
1382 Ga0075435_100000142
1383 Ga0075435_100035077
1384 Ga0075435_100275162
1385 Ga0075435_100611079
1386 Ga0099794_10072326
1387 Ga0099794_10785165
1388 Ga0099795_10020473
1389 Ga0099795_10051874
1390 Ga0099795_10085923
1391 Ga0099795_10600825
1392 Ga0105240_10010692
1393 Ga0105240_10034008
1394 Ga0105240_10049650
1395 Ga0105240_10076934
1396 Ga0105240_10078613
1397 Ga0105240_10104179
1398 Ga0105240_10316011
1399 Ga0105240_10316666
1400 Ga0105240_10433691
1401 Ga0105240_10489548
1402 Ga0105240_11095868
1403 Ga0105240_11233274
1404 Ga0105245_10011029
1405 Ga0105245_10013122
1406 Ga0105245_10275573
1407 Ga0105247_11178814
1408 Ga0105247_11263125
1409 Ga0114129_10446350
1410 Ga0105241_10000878
1411 Ga0105241_10015193
1412 Ga0105241_10021165
1413 Ga0105241_10045725
1414 Ga0105241_10120354
1415 Ga0105241_10184033
1416 Ga0105241_10437936
1417 Ga0105242_10265572
1418 Ga0105242_10482920
1419 Ga0105248_10034039
1420 Ga0105248_10038402
1421 Ga0105237_10060500
1422 Ga0105237_10063320
1423 Ga0105237_10077509
1424 Ga0105237_10140681
1425 Ga0105237_10181653
1426 Ga0105237_11869011
1427 Ga0105237_12444295
1428 Ga0105237_12708944
1429 Ga0105238_10000135
1430 Ga0105238_10024741
1431 Ga0105238_10256265
1432 Ga0105238_10268289
1433 Ga0105238_10630861
1434 Ga0105238_10713395
1435 Ga0105238_10733544
1436 Ga0105238_11474565
1437 Ga0105238_12192816
1438 Ga0105249_10711375
1439 Ga0099796_10090133
1440 Ga0099796_10202795
1441 Ga0099796_10303038
1442 Ga0105239_10013061
1443 Ga0105239_10025069
1444 Ga0105239_10080657
1445 Ga0105239_10086009
1446 Ga0105239_10185996
1447 Ga0105239_10254453
1448 Ga0105239_10911621
1449 Ga0105239_11070573
1450 Ga0157326_1099490
1451 Ga0157373_10001908
1452 Ga0157373_10100205
1453 Ga0157373_10182718
1454 Ga0157373_10224199
1455 Ga0157373_10278848
1456 Ga0157373_10283303
1457 Ga0157373_10529691
1458 Ga0157371_10062056
1459 Ga0157371_10873761
1460 Ga0157370_10018270
1461 Ga0157370_10096135
1462 Ga0157370_10232465
1463 Ga0157369_10000034
1464 Ga0157369_10020521
1465 Ga0157369_10028231
1466 Ga0157369_10075478
1467 Ga0157369_10095983
1468 Ga0157369_10103642
1469 Ga0157369_10107201
1470 Ga0157369_10207016
1471 Ga0157369_10244530
1472 Ga0157369_10496461
1473 Ga0157369_10672993
1474 Ga0157369_10906248
1475 Ga0157374_10000112
1476 Ga0157374_10000183
1477 Ga0157374_10000210
1478 Ga0157374_10175254
1479 Ga0157374_10277523
1480 Ga0157374_10383774
1481 Ga0157374_10641844
1482 Ga0157378_10000107
1483 Ga0157378_10000127
1484 Ga0157378_10007947
1485 Ga0157378_10026030
1486 Ga0157378_10460498
1487 Ga0157378_12347859
1488 Ga0163162_10194520
1489 Ga0163162_10247648
1490 Ga0163162_10370841
1491 Ga0163162_10382194
1492 Ga0163162_11244368
1493 Ga0157372_10000059
1494 Ga0157372_10000153
1495 Ga0157372_10002821
1496 Ga0157372_10003843
1497 Ga0157372_10010295
1498 Ga0157372_10025802
1499 Ga0157372_10042214
1500 Ga0157372_10124432
1501 Ga0157372_10213178
1502 Ga0157372_10242206
1503 Ga0157372_10268689
1504 Ga0157372_10897677
1505 Ga0157372_10938583
1506 Ga0157372_10951001
1507 Ga0157372_11406346
1508 Ga0157372_11677067
1509 Ga0157372_11698172
1510 Ga0157372_12251814
1511 Ga0157375_11180935
1512 Ga0163163_10214386
1513 Ga0182008_10432526
1514 Ga0182008_10931855
1515 Ga0157379_10857964
1516 Ga0157376_10004651
1517 Ga0157376_10346892
1518 Ga0157376_10360164
1519 Ga0157376_12845185
1520 Ga0182006_1247657
1521 Ga0182007_10006797
1522 Ga0182007_10064398
1523 Ga0182007_10208001
1524 Ga0182005_1148284
1525 Ga0197907_10258267
1526 Ga0197907_10489849
1527 Ga0197907_11396651
1528 Ga0206356_10111165
1529 Ga0206356_10630039
1530 Ga0206356_10808840
1531 Ga0206356_11024997
1532 Ga0206356_11223647
1533 Ga0206356_11349120
1534 Ga0206349_1972346
1535 Ga0206355_1392844
1536 Ga0206352_10041766
1537 Ga0206352_10267634
1538 Ga0206352_10724634
1539 Ga0206352_10859100
1540 Ga0206352_11112670
1541 Ga0206352_11299062
1542 Ga0206350_10726275
1543 Ga0206354_10857068
1544 Ga0206353_10196849
1545 Ga0213874_10334747
1546 Ga0213875_10132854
1547 Ga0224712_10367311
1548 Ga0224712_10483769
1549 Ga0228598_1120632
1550 Ga0207656_10146100
1551 Ga0207656_10207127
1552 Ga0207692_10001123
1553 Ga0207692_10176941
1554 Ga0207692_10212072
1555 Ga0207692_10275268
1556 Ga0207692_10288771
1557 Ga0207692_10290612
1558 Ga0207692_10338443
1559 Ga0207692_10796099
1560 Ga0207647_10146704
1561 Ga0207685_10013877
1562 Ga0207685_10114675
1563 Ga0207685_10164635
1564 Ga0207685_10176975
1565 Ga0207685_10375131
1566 Ga0207699_10001179
1567 Ga0207699_10013292
1568 Ga0207699_10022387
1569 Ga0207699_10036546
1570 Ga0207699_10057913
1571 Ga0207699_10130776
1572 Ga0207699_10286630
1573 Ga0207699_10545593
1574 Ga0207699_11235177
1575 Ga0207643_10033887
1576 Ga0207643_10363483
1577 Ga0207684_10000623
1578 Ga0207684_10166148
1579 Ga0207684_10274061
1580 Ga0207684_10425921
1581 Ga0207684_10473655
1582 Ga0207684_10510815
1583 Ga0207684_10617137
1584 Ga0207684_11221622
1585 Ga0207654_10078313
1586 Ga0207654_10105154
1587 Ga0207654_10485364
1588 Ga0207707_10025137
1589 Ga0207707_10035225
1590 Ga0207707_10164179
1591 Ga0207707_11017558
1592 Ga0207707_11267719
1593 Ga0207695_10044785
1594 Ga0207695_10072295
1595 Ga0207695_10108054
1596 Ga0207695_10277788
1597 Ga0207695_10497888
1598 Ga0207695_10772142
1599 Ga0207695_11114694
1600 Ga0207671_10051401
1601 Ga0207671_10492317
1602 Ga0207693_10000022
1603 Ga0207693_10000820
1604 Ga0207693_10006127
1605 Ga0207693_10010331
1606 Ga0207693_10067882
1607 Ga0207693_10081325
1608 Ga0207693_10083803
1609 Ga0207693_10114030
1610 Ga0207693_10156541
1611 Ga0207693_10541419
1612 Ga0207693_11086680
1613 Ga0207663_10003426
1614 Ga0207663_10007954
1615 Ga0207663_10017744
1616 Ga0207663_10048932
1617 Ga0207663_10069246
1618 Ga0207663_10078040
1619 Ga0207663_10106865
1620 Ga0207663_10204076
1621 Ga0207663_10270004
1622 Ga0207663_10411491
1623 Ga0207663_10879285
1624 Ga0207663_11081640
1625 Ga0207660_10050113
1626 Ga0207660_10108862
1627 Ga0207657_10003709
1628 Ga0207649_10016068
1629 Ga0207649_10668435
1630 Ga0207652_10090651
1631 Ga0207652_10159047
1632 Ga0207652_10309414
1633 Ga0207652_10444118
1634 Ga0207652_10453034
1635 Ga0207652_11096986
1636 Ga0207652_11228525
1637 Ga0207652_11286640
1638 Ga0207646_10000332
1639 Ga0207646_10124875
1640 Ga0207646_10129566
1641 Ga0207646_10421806
1642 Ga0207646_10719702
1643 Ga0207646_10826557
1644 Ga0207694_10000722
1645 Ga0207694_10209983
1646 Ga0207694_10319482
1647 Ga0207694_10367243
1648 Ga0207694_10434452
1649 Ga0207694_11207955
1650 Ga0207694_11679204
1651 Ga0207650_10022032
1652 Ga0207650_10167627
1653 Ga0207687_10004632
1654 Ga0207687_10205345
1655 Ga0207687_10319869
1656 Ga0207700_10000056
1657 Ga0207700_10002505
1658 Ga0207700_10002969
1659 Ga0207700_10008231
1660 Ga0207700_10023517
1661 Ga0207700_10122768
1662 Ga0207700_10133720
1663 Ga0207700_10205979
1664 Ga0207700_10233400
1665 Ga0207700_10301062
1666 Ga0207700_10445806
1667 Ga0207700_10561502
1668 Ga0207700_10674488
1669 Ga0207700_11015603
1670 Ga0207700_11032128
1671 Ga0207700_11494429
1672 Ga0207664_10000143
1673 Ga0207664_10002694
1674 Ga0207664_10006310
1675 Ga0207664_10058116
1676 Ga0207664_10062318
1677 Ga0207664_10092432
1678 Ga0207664_10233448
1679 Ga0207664_10591222
1680 Ga0207664_10754918
1681 Ga0207664_10880446
1682 Ga0207664_10951437
1683 Ga0207664_10951685
1684 Ga0207664_11090869
1685 Ga0207664_11122512
1686 Ga0207664_11457714
1687 Ga0207644_10627549
1688 Ga0207644_10917472
1689 Ga0207690_10027935
1690 Ga0207690_10284908
1691 Ga0207704_10016830
1692 Ga0207704_10037395
1693 Ga0207665_10003243
1694 Ga0207665_10012455
1695 Ga0207665_10023801
1696 Ga0207665_10029343
1697 Ga0207665_10037952
1698 Ga0207665_10126198
1699 Ga0207665_10216591
1700 Ga0207665_10330875
1701 Ga0207665_10338969
1702 Ga0207665_10427054
1703 Ga0207665_10607563
1704 Ga0207665_10849103
1705 Ga0207665_11448757
1706 Ga0207711_10040765
1707 Ga0207711_10178762
1708 Ga0207689_10096804
1709 Ga0207661_10020975
1710 Ga0207661_10139192
1711 Ga0207679_10001953
1712 Ga0207679_10156552
1713 Ga0207679_10500874
1714 Ga0207679_10932731
1715 Ga0207679_11031610
1716 Ga0207667_10002755
1717 Ga0207667_10003317
1718 Ga0207667_10054522
1719 Ga0207667_10745127
1720 Ga0207667_10788137
1721 Ga0207667_11802424
1722 Ga0207651_10206832
1723 Ga0207640_10017610
1724 Ga0207640_10144889
1725 Ga0207640_10199445
1726 Ga0207640_10383377
1727 Ga0207640_11373165
1728 Ga0207640_11616205
1729 Ga0207677_10054258
1730 Ga0207677_10471857
1731 Ga0207677_10474766
1732 Ga0207677_10669469
1733 Ga0207703_10004306
1734 Ga0207703_10547565
1735 Ga0207639_10064001
1736 Ga0207639_10184246
1737 Ga0207639_10244891
1738 Ga0207678_10408916
1739 Ga0207702_10000171
1740 Ga0207702_10004667
1741 Ga0207702_10005214
1742 Ga0207702_10018480
1743 Ga0207702_10033096
1744 Ga0207702_10067499
1745 Ga0207702_11893981
1746 Ga0207641_10013876
1747 Ga0207641_12201949
1748 Ga0207648_10042480
1749 Ga0207676_10008218
1750 Ga0207674_10000126
1751 Ga0207674_10000230
1752 Ga0207674_10071474
1753 Ga0207674_10140862
1754 Ga0207675_101466147
1755 Ga0207683_10917862
1756 Ga0207698_10104365
1757 Ga0207698_10213858
1758 Ga0207698_10338953
1759 Ga0207698_10923263
1760 Ga0209179_1061338
1761 Ga0209179_1109634
1762 Ga0265354_1001518
1763 Ga0265356_1005152
1764 Ga0265356_1005696
1765 Ga0265355_1009091
1766 Ga0265355_1017696
1767 Ga0268264_10327763
1768 Ga0265336_10057607
1769 Ga0265338_10000352
1770 Ga0265338_10006522
1771 Ga0265338_10019949
1772 Ga0265338_10177218
1773 Ga0265338_10220215
1774 Ga0265324_10078795
1775 Ga0265762_1000945
1776 Ga0265762_1042491
1777 Ga0265763_1026593
1778 Ga0265770_1016019
1779 Ga0265765_1046549
1780 Ga0265760_10003368
1781 Ga0265760_10005801
1782 Ga0265760_10008109
1783 Ga0265760_10009506
1784 Ga0265760_10106178
1785 Ga0265328_10028487
1786 Ga0265325_10019838
1787 Ga0265325_10204845
1788 Ga0265329_10312938
1789 Ga0265339_10013614
1790 Ga0265339_10064430
1791 Ga0265339_10085214
1792 Ga0265331_10543433
1793 Ga0265316_10013501
1794 Ga0265316_10119372
1795 Ga0307408_102339127
1796 Ga0265314_10036059
1797 Ga0265314_10045866
1798 Ga0265314_10080354
1799 Ga0265342_10531585
1800 Ga0307412_12290455
1801 Ga0373926_0001236
1802 Ga0373926_0025756
1803 Ga0373926_0106830
1804 Ga0373926_0123847
1805 Ga0373926_0193208
1806 Ga0373934_0011542
1807 Ga0373934_0054809
1808 Ga0373944_0045162
1809 Ga0373944_0288575
1810 Ga0373952_0221025
1811 Ga0373923_0026086
1812 Ga0373923_0129846
1813 Ga0373923_0135719
1814 Ga0373923_0326499
1815 Ga0373932_0305078
1816 Ga0373936_0006487
1817 Ga0373936_0022692
1818 Ga0373936_0155606
1819 Ga0373936_0262399
1820 Ga0373945_0004750
1821 Ga0373945_0006937
1822 Ga0373945_0096911
1823 Ga0373953_0012461
1824 Ga0373953_0110008
1825 Ga0373954_0013500
1826 Ga0373954_0120039
1827 Ga0373954_0136327
1828 Ga0373956_0016495
1829 Ga0373956_0069808
1830 Ga0373956_0559702
1831 Ga0373957_0083717
1832 Ga0373957_0449661
1833 Ga0373943_0000116
1834 Ga0373943_0099992
1835 Ga0373943_0539532
1836 Ga0373946_0003133
1837 Ga0373946_0034039
1838 Ga0373946_0261240
1839 Ga0373946_0720521
1840 Ga0373955_0163711
1841 Ga0373955_0348418
1842 Ga0373955_0430828
1843 Ga0373955_0498738
1844 Ga0373955_0720616
1845 Ga0373962_0269731
1846 Ga0373924_0000483
1847 Ga0373931_0443140
1848 Ga0373935_0001975
1849 Ga0373935_0003523
1850 Ga0373935_0005149
1851 Ga0373935_0027330
1852 Ga0373935_0062488
1853 Ga0373935_0105724
1854 Ga0373935_0131229
1855 Ga0373935_0562204
1856 Ga0373935_1003184
1857 Ga0373935_1252308
1858 Ga0373927_0000118
1859 Ga0373927_0022021
1860 Ga0373927_0082888
1861 Ga0373927_0303687
1862 Ga0373927_0421912
1863 Ga0373927_0588628
1864 Ga0373933_0005233
1865 Ga0373933_0045132
1866 Ga0373933_0062768
1867 Ga0373933_0112538
1868 Ga0373933_0494507
1869 Ga0373933_0695753
1870 Ga0373933_0812244
1871 Ga0373947_0004767
1872 Ga0373947_0005481
1873 Ga0373947_0006908
1874 Ga0373947_0042147
1875 Ga0373947_0097000
1876 Ga0373947_0718345
1877 Ga0373947_0928620
1878 Ga0373937_0008419
1879 Ga0373937_0242943
1880 Ga0373937_0578759
1881 Ga0373937_1051076
1882 Ga0373937_1099843
1883 Ga0373937_1461194
1884 Ga0265778_007379
1885 Ga0265778_014072
1886 Ga0373925_0002638
1887 Ga0373925_0059363
1888 Ga0373925_0101439
1889 Ga0373925_0101695
1890 Ga0373925_0341080
1891 Ga0373925_0395553
1892 Ga0373925_0424803
1893 Ga0373925_0819043
1894 Ga0373925_1077903
1895 Ga0373925_1209380
1896 Ga0395900_0497151
1897 Ga0395900_0646194
1898 Ga0395905_0014337
1899 Ga0395905_0425490
1900 Ga0395905_0429496
1901 Ga0395905_0585323
1902 Ga0395905_1154890
1903 Ga0395905_1195284
1904 Ga0436364_0718644
1905 Ga0436364_1209441
1906 Ga0395901_1229128
1907 Ga0395901_1330092
1908 Ga0436365_1285273
1909 Ga0436361_0473294
1910 Ga0436363_0339936
1911 Ga0436363_0644164
1912 Ga0436363_1175243
1913 Ga0436363_1451564
1914 Ga0436362_0380443
1915 Ga0436362_0484552
1916 Ga0451839_0359763
1917 Ga0451577_0529712
1918 Ga0466963_0103799
1919 Ga0466963_0172440
1920 Ga0466964_0161003
1921 Ga0466964_0500467
1922 Ga0466971_0024151
1923 Ga0466968_0305491
1924 Ga0466970_0397342
1925 Ga0466957_0191541
1926 Ga0466959_0807034
1927 Ga0451576_0054004
1928 Ga0451576_0386136
1929 Ga0451576_0471234
1930 Ga0451576_0780898
1931 Ga0466967_0007474
1932 Ga0466967_0016737
1933 Ga0466967_0611165
1934 Ga0466967_1704533
1935 Ga0466967_2485015
1936 Ga0495592_0235602
1937 Ga0495629_0003956
1938 Ga0495629_1134695
1939 Ga0495641_0357020
1940 Ga0495651_0431524
1941 Ga0495651_0879568
1942 Ga0495653_0428294
1943 Ga0495580_0000255
1944 Ga0495580_0001135
1945 Ga0495580_0001634
1946 Ga0495580_0010770
1947 Ga0495580_0033759
1948 Ga0495580_0062917
1949 Ga0495580_0306287
1950 Ga0495580_0326981
1951 Ga0495580_0368086
1952 Ga0495580_0435194
1953 Ga0495580_0518614
1954 Ga0495580_0581816
1955 Ga0495580_0736943
1956 Ga0495582_0001022
1957 Ga0495582_0001816
1958 Ga0495582_0226426
1959 Ga0495582_0759083
1960 Ga0495639_0251700
1961 Ga0495662_0398782
1962 Ga0495664_0020430
1963 Ga0495608_0025414
1964 Ga0495618_0260908
1965 Ga0495628_0414596
1966 Ga0495630_0030815
1967 Ga0495630_0076895
1968 Ga0495630_0096649
1969 Ga0495630_0342821
1970 Ga0495630_0387194
1971 Ga0495630_0524083
1972 Ga0495666_0048033
1973 Ga0495652_0715787
1974 Ga0495665_0005508
1975 Ga0495665_0098371
1976 Ga0495665_0252979
1977 Ga0495665_0266815
1978 Ga0495665_0407163
1979 Ga0495587_0281053
1980 Ga0495645_0304571
1981 Ga0495667_0174953
1982 Ga0495634_0277964
1983 Ga0495635_0273787
1984 Ga0495635_0375526
1985 Ga0495588_0250991
1986 Ga0495599_0178262
1987 Ga0495623_0341322
1988 Ga0495646_0464353
1989 Ga0495647_0235750
1990 Ga0495658_0062032
1991 Ga0495658_0075217
1992 Ga0495669_0010544
1993 Ga0495669_0059144
1994 Ga0495669_0387493
1995 Ga0495613_1094769
1996 Ga0495624_0475268
1997 Ga0495581_0019223
1998 Ga0495581_0530835
1999 Ga0495604_0049079
2000 Ga0495604_0504684
2001 Ga0495674_0004353
2002 Ga0495674_0006067
2003 Ga0495674_0105039
2004 Ga0495674_0389182
2005 Ga0495674_1381332
2006 Ga0495675_0249749
2007 Ga0495675_0407349
2008 Ga0495684_0307611
2009 Ga0495684_0634418
2010 Ga0495593_0368187
2011 Ga0495602_0081476
2012 Ga0495602_0112020
2013 Ga0495602_0143062
2014 Ga0495602_0343977
2015 Ga0495602_0368486
2016 Ga0495614_0061167
2017 Ga0495614_0106381
2018 Ga0495614_0427314
2019 Ga0495615_0113748
2020 Ga0496100_0937086
2021 Ga0496101_0408315
2022 Ga0496102_0031359
2023 Ga0496102_0095643
2024 Ga0496102_0214053
2025 Ga0496102_0542778
2026 Ga0496103_0073409
2027 Ga0496104_0080282
2028 Ga0496104_0085102
2029 Ga0496104_0089105
2030 Ga0496104_0156736
2031 Ga0496104_0518680
2032 Ga0496104_1774138
2033 Ga0496105_0015430
2034 Ga0496106_0185479
2035 Ga0496106_0792120
2036 Ga0496108_1149981
2037 Ga0496109_0346838
2038 Ga0496110_0188264
2039 Ga0496110_0640156
2040 Ga0496111_0010026
2041 Ga0496111_0091884
2042 Ga0496112_0004567
2043 Ga0496112_0007155
2044 Ga0496112_0013968
2045 Ga0496112_0041580
2046 Ga0496112_0137029
2047 Ga0496112_0249350
2048 Ga0496112_0348844
2049 Ga0496112_0350265
2050 Ga0496112_0380131
2051 Ga0496113_0509075
2052 Ga0496113_0510042
2053 Ga0496113_1108204
2054 Ga0496113_1163118
2055 Ga0496114_0058677
2056 Ga0496115_0050088
2057 Ga0496115_0052541
2058 Ga0501067_0282572
2059 nmdc:mga05p37_302135_c2
2060 nmdc:mga0n895_125_c1
2061 nmdc:mga0n895_2069452_c1
2062 nmdc:mga0n895_275082_c1
2063 nmdc:mga0n895_304338_c1
2064 nmdc:mga0rr50_1046767_c1
2065 nmdc:mga0rr50_1357_c1
2066 nmdc:mga0rr50_248633_c1
2067 nmdc:mga0rr50_43383_c1
2068 nmdc:mga08x19_1090877_c1
2069 nmdc:mga08x19_16026_c1
2070 nmdc:mga08x19_404993_c1
2071 nmdc:mga08x19_8698_c1
2072 nmdc:mga08x19_930998_c1
2073 nmdc:mga0a205_5864_c2
2074 Ga0495601_0013413
2075 Ga0495612_0208189
2076 Ga0495619_0300888
2077 Ga0495619_0994372
2078 Ga0587084_098213
2079 Ga0587084_113935
2080 Ga0587084_133480
2081 Ga0587093_028989
2082 Ga0587093_046910
2083 Ga0587093_068845
2084 Ga0587093_070759
2085 Ga0587066_079374
2086 Ga0587066_130047
2087 Ga0587066_149219
2088 Ga0587070_139553
2089 Ga0587070_143576
2090 Ga0587070_169979
2091 Ga0587073_0007548
2092 Ga0587073_0129917
2093 Ga0587073_0160074
2094 Ga0587073_0180238
2095 Ga0587073_0191234
2096 Ga0587077_050473
2097 Ga0587077_121989
2098 Ga0587077_143784
2099 Ga0587077_164388
2100 Ga0587080_065871
2101 Ga0587080_076606
2102 Ga0587080_096507
2103 Ga0587082_113382
2104 Ga0587082_123510
2105 Ga0587083_0014707
2106 Ga0587083_0156400
2107 Ga0587083_0163281
2108 Ga0587083_0183023
2109 Ga0587085_037629
2110 Ga0587085_105429
2111 Ga0587085_143427
2112 Ga0587089_096014
2113 Ga0587090_085290
2114 Ga0587090_145262
2115 Ga0587091_149355
2116 Ga0587091_168689
2117 Ga0587091_171792
2118 Ga0587092_033196
2119 Ga0587094_084308
2120 Ga0587094_120556
2121 Ga0587106_106111
2122 Ga0587101_025561
2123 Ga0587109_114410
2124 Ga0587109_207847
2125 Ga0587115_068359
2126 Ga0587117_088028
2127 Ga0587128_067268
2128 Ga0587128_082072
2129 Ga0587062_084764
2130 Ga0587067_035591
2131 Ga0587067_135907
2132 Ga0587067_166785
2133 Ga0587068_099892
2134 Ga0587069_037866
2135 Ga0587069_060283
2136 Ga0587075_044054
2137 Ga0587075_068044
2138 Ga0587075_098467
2139 Ga0587076_077715
2140 Ga0587076_087046
2141 Ga0587076_095291
2142 Ga0587078_033426
2143 Ga0587078_046621
2144 Ga0587078_051963
2145 Ga0587078_052777
2146 Ga0587079_033473
2147 Ga0587079_062609
2148 Ga0587079_185899
2149 Ga0587102_044607
2150 Ga0587102_045586
2151 Ga0587107_029582
2152 Ga0587119_055081
2153 Ga0587119_065862
2154 Ga0587060_036802
2155 Ga0587071_046728
2156 Ga0587071_144394
2157 Ga0587071_179176
2158 Ga0587111_0064732
2159 Ga0587111_0141020
2160 Ga0466962_0037678

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

1

84

0.96

PF08534

Redoxin

Redoxin

1

99

0.75

Map