F489662
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1080 | 325 | 2160 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300006175|Ga0070712_101019267|Ga0070712_1010192672 |
| Length | 107 |
| Sequence | MKNFQKNVKSLEASDTQVLGVSMDSPFANKAFADSIGVTFPLLSDWGGKMSKEYGVVQNIGKLGYEASRRVTYLIDKSGKIAEVQVDDAAIDPTKIVQACERKKHGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 71 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 100 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 105 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 110 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 111 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 113 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 161 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 162 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 171 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 183 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 185 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 194 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 195 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 196 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 197 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 213 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 214 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 215 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 216 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 217 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 218 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 219 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 220 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 221 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 269 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 270 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 271 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 272 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 273 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 276 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 277 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 278 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 279 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 280 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 281 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.15 |
| Metatranscriptomes | 11.85 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.52 |
| Rhizosphere | 95.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 38.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070712_101019267 | 3300006175 | Unclassified | 717 |
| 2 | LJNas_1000562 | 3300000546 | Bacteria | 6390 |
| 3 | rootH1_10275960 | 3300003323 | Bacteria | 1043 |
| 4 | Ga0058863_10047664 | 3300004799 | Unclassified | 547 |
| 5 | Ga0058863_10173066 | 3300004799 | Unclassified | 3271 |
| 6 | Ga0058863_11654109 | 3300004799 | Unclassified | 746 |
| 7 | Ga0058863_11662177 | 3300004799 | Unclassified | 762 |
| 8 | Ga0058861_11644902 | 3300004800 | Unclassified | 732 |
| 9 | Ga0058861_11680532 | 3300004800 | Unclassified | 626 |
| 10 | Ga0058861_11905019 | 3300004800 | Unclassified | 585 |
| 11 | Ga0058862_10184300 | 3300004803 | Unclassified | 626 |
| 12 | Ga0058862_12590030 | 3300004803 | Unclassified | 743 |
| 13 | Ga0058862_12648726 | 3300004803 | Unclassified | 565 |
| 14 | Ga0058862_12829145 | 3300004803 | Bacteria | 596 |
| 15 | Ga0058862_12890471 | 3300004803 | Bacteria | 592 |
| 16 | Ga0065712_10004477 | 3300005290 | Bacteria | 4619 |
| 17 | Ga0065715_10927599 | 3300005293 | Unclassified | 566 |
| 18 | Ga0070658_10454785 | 3300005327 | Unclassified | 1103 |
| 19 | Ga0070683_100029028 | 3300005329 | Bacteria | 5005 |
| 20 | Ga0070683_100032910 | 3300005329 | Bacteria | 4725 |
| 21 | Ga0070683_100050518 | 3300005329 | Unclassified | 3850 |
| 22 | Ga0070683_100063058 | 3300005329 | Bacteria | 3447 |
| 23 | Ga0070683_100099292 | 3300005329 | Bacteria | 2740 |
| 24 | Ga0070670_100033268 | 3300005331 | Bacteria | 4441 |
| 25 | Ga0070670_100200266 | 3300005331 | Bacteria | 1735 |
| 26 | Ga0070680_100068634 | 3300005336 | Bacteria | 2910 |
| 27 | Ga0070680_100185584 | 3300005336 | Unclassified | 1752 |
| 28 | Ga0070680_100550338 | 3300005336 | Bacteria | 989 |
| 29 | Ga0070682_100021501 | 3300005337 | Bacteria | 3808 |
| 30 | Ga0068868_100023580 | 3300005338 | Unclassified | 4658 |
| 31 | Ga0068868_100608172 | 3300005338 | Unclassified | 969 |
| 32 | Ga0068868_102010386 | 3300005338 | Unclassified | 549 |
| 33 | Ga0070687_100010047 | 3300005343 | Bacteria | 4075 |
| 34 | Ga0070661_100050659 | 3300005344 | Bacteria | 3038 |
| 35 | Ga0070661_100482584 | 3300005344 | Unclassified | 990 |
| 36 | Ga0070661_100741363 | 3300005344 | Unclassified | 803 |
| 37 | Ga0070661_101083988 | 3300005344 | Unclassified | 667 |
| 38 | Ga0070668_101081230 | 3300005347 | Unclassified | 723 |
| 39 | Ga0070671_100138283 | 3300005355 | Bacteria | 2054 |
| 40 | Ga0070659_100325710 | 3300005366 | Unclassified | 1285 |
| 41 | Ga0070709_10001568 | 3300005434 | Bacteria | 12332 |
| 42 | Ga0070709_10004307 | 3300005434 | Bacteria | 7675 |
| 43 | Ga0070709_10010600 | 3300005434 | Bacteria | 5109 |
| 44 | Ga0070709_10058936 | 3300005434 | Bacteria | 2436 |
| 45 | Ga0070709_10077265 | 3300005434 | Unclassified | 2164 |
| 46 | Ga0070709_10085018 | 3300005434 | Bacteria | 2074 |
| 47 | Ga0070709_10093598 | 3300005434 | Bacteria | 1987 |
| 48 | Ga0070709_10208008 | 3300005434 | Bacteria | 1389 |
| 49 | Ga0070709_10255407 | 3300005434 | Bacteria | 1264 |
| 50 | Ga0070709_10282023 | 3300005434 | Bacteria | 1208 |
| 51 | Ga0070709_10623534 | 3300005434 | Unclassified | 832 |
| 52 | Ga0070709_10817046 | 3300005434 | Bacteria | 733 |
| 53 | Ga0070714_100000134 | 3300005435 | Bacteria | 58475 |
| 54 | Ga0070714_100007313 | 3300005435 | Bacteria | 8588 |
| 55 | Ga0070714_100019452 | 3300005435 | Bacteria | 5533 |
| 56 | Ga0070714_100071760 | 3300005435 | Bacteria | 2995 |
| 57 | Ga0070714_100107153 | 3300005435 | Bacteria | 2470 |
| 58 | Ga0070714_100153055 | 3300005435 | Bacteria | 2080 |
| 59 | Ga0070714_100245381 | 3300005435 | Unclassified | 1654 |
| 60 | Ga0070714_100282903 | 3300005435 | Bacteria | 1541 |
| 61 | Ga0070714_100367742 | 3300005435 | Bacteria | 1353 |
| 62 | Ga0070714_100369358 | 3300005435 | Bacteria | 1350 |
| 63 | Ga0070714_100394007 | 3300005435 | Bacteria | 1308 |
| 64 | Ga0070714_100480672 | 3300005435 | Bacteria | 1183 |
| 65 | Ga0070714_100698186 | 3300005435 | Bacteria | 979 |
| 66 | Ga0070714_100841585 | 3300005435 | Bacteria | 889 |
| 67 | Ga0070714_101104924 | 3300005435 | Unclassified | 773 |
| 68 | Ga0070713_100000455 | 3300005436 | Bacteria | 26196 |
| 69 | Ga0070713_100000888 | 3300005436 | Bacteria | 19171 |
| 70 | Ga0070713_100004293 | 3300005436 | Bacteria | 9548 |
| 71 | Ga0070713_100010694 | 3300005436 | Bacteria | 6642 |
| 72 | Ga0070713_100015714 | 3300005436 | Bacteria | 5671 |
| 73 | Ga0070713_100035462 | 3300005436 | Bacteria | 4016 |
| 74 | Ga0070713_100065497 | 3300005436 | Bacteria | 3052 |
| 75 | Ga0070713_100083953 | 3300005436 | Bacteria | 2724 |
| 76 | Ga0070713_100187746 | 3300005436 | Unclassified | 1861 |
| 77 | Ga0070713_100195717 | 3300005436 | Bacteria | 1823 |
| 78 | Ga0070713_100276405 | 3300005436 | Unclassified | 1539 |
| 79 | Ga0070713_100330686 | 3300005436 | Unclassified | 1409 |
| 80 | Ga0070713_100499520 | 3300005436 | Bacteria | 1147 |
| 81 | Ga0070713_100824393 | 3300005436 | Unclassified | 890 |
| 82 | Ga0070713_101414648 | 3300005436 | Unclassified | 674 |
| 83 | Ga0070713_101925698 | 3300005436 | Unclassified | 573 |
| 84 | Ga0070710_10001659 | 3300005437 | Bacteria | 10481 |
| 85 | Ga0070710_10017404 | 3300005437 | Bacteria | 3677 |
| 86 | Ga0070710_10024604 | 3300005437 | Bacteria | 3179 |
| 87 | Ga0070710_10064137 | 3300005437 | Unclassified | 2100 |
| 88 | Ga0070710_10115498 | 3300005437 | Bacteria | 1618 |
| 89 | Ga0070710_10128616 | 3300005437 | Bacteria | 1541 |
| 90 | Ga0070710_10183812 | 3300005437 | Bacteria | 1310 |
| 91 | Ga0070710_10195594 | 3300005437 | Unclassified | 1274 |
| 92 | Ga0070710_10216030 | 3300005437 | Bacteria | 1218 |
| 93 | Ga0070710_10668814 | 3300005437 | Bacteria | 730 |
| 94 | Ga0070710_11239588 | 3300005437 | Unclassified | 553 |
| 95 | Ga0070711_100000138 | 3300005439 | Bacteria | 38924 |
| 96 | Ga0070711_100004490 | 3300005439 | Bacteria | 8246 |
| 97 | Ga0070711_100023588 | 3300005439 | Bacteria | 4004 |
| 98 | Ga0070711_100028885 | 3300005439 | Bacteria | 3653 |
| 99 | Ga0070711_100054633 | 3300005439 | Bacteria | 2756 |
| 100 | Ga0070711_100069874 | 3300005439 | Bacteria | 2471 |
| 101 | Ga0070711_100135018 | 3300005439 | Bacteria | 1843 |
| 102 | Ga0070711_100165446 | 3300005439 | Bacteria | 1681 |
| 103 | Ga0070711_100189613 | 3300005439 | Bacteria | 1579 |
| 104 | Ga0070711_100703940 | 3300005439 | Bacteria | 851 |
| 105 | Ga0070711_100741329 | 3300005439 | Bacteria | 830 |
| 106 | Ga0070711_100842998 | 3300005439 | Unclassified | 779 |
| 107 | Ga0070711_101635656 | 3300005439 | Unclassified | 563 |
| 108 | Ga0070705_100167271 | 3300005440 | Bacteria | 1476 |
| 109 | Ga0070708_100006623 | 3300005445 | Bacteria | 9220 |
| 110 | Ga0070708_100010321 | 3300005445 | Bacteria | 7563 |
| 111 | Ga0070708_100021434 | 3300005445 | Bacteria | 5464 |
| 112 | Ga0070708_100031007 | 3300005445 | Unclassified | 4625 |
| 113 | Ga0070708_100050095 | 3300005445 | Bacteria | 3696 |
| 114 | Ga0070708_100062000 | 3300005445 | Bacteria | 3342 |
| 115 | Ga0070708_100068032 | 3300005445 | Bacteria | 3200 |
| 116 | Ga0070708_100070254 | 3300005445 | Unclassified | 3150 |
| 117 | Ga0070708_100190957 | 3300005445 | Bacteria | 1915 |
| 118 | Ga0070708_100191442 | 3300005445 | Unclassified | 1913 |
| 119 | Ga0070708_101524092 | 3300005445 | Unclassified | 623 |
| 120 | Ga0070663_100083459 | 3300005455 | Bacteria | 2353 |
| 121 | Ga0070678_101081542 | 3300005456 | Unclassified | 740 |
| 122 | Ga0070662_100028600 | 3300005457 | Bacteria | 3880 |
| 123 | Ga0070662_100124696 | 3300005457 | Unclassified | 1978 |
| 124 | Ga0070681_10000655 | 3300005458 | Bacteria | 28573 |
| 125 | Ga0070681_10003758 | 3300005458 | Bacteria | 14249 |
| 126 | Ga0070681_10292972 | 3300005458 | Unclassified | 1537 |
| 127 | Ga0070681_10361054 | 3300005458 | Unclassified | 1363 |
| 128 | Ga0070681_10402307 | 3300005458 | Bacteria | 1280 |
| 129 | Ga0070681_10679901 | 3300005458 | Unclassified | 945 |
| 130 | Ga0068867_100029267 | 3300005459 | Bacteria | 3968 |
| 131 | Ga0070706_100012946 | 3300005467 | Bacteria | 7722 |
| 132 | Ga0070706_100015992 | 3300005467 | Bacteria | 6929 |
| 133 | Ga0070706_100162768 | 3300005467 | Bacteria | 2083 |
| 134 | Ga0070706_100180543 | 3300005467 | Bacteria | 1970 |
| 135 | Ga0070706_100335935 | 3300005467 | Bacteria | 1409 |
| 136 | Ga0070706_100509367 | 3300005467 | Bacteria | 1119 |
| 137 | Ga0070706_100729331 | 3300005467 | Bacteria | 919 |
| 138 | Ga0070706_101050171 | 3300005467 | Bacteria | 751 |
| 139 | Ga0070707_100017410 | 3300005468 | Bacteria | 6755 |
| 140 | Ga0070707_100040648 | 3300005468 | Bacteria | 4449 |
| 141 | Ga0070707_100068858 | 3300005468 | Unclassified | 3406 |
| 142 | Ga0070707_100074091 | 3300005468 | Bacteria | 3283 |
| 143 | Ga0070707_100311287 | 3300005468 | Bacteria | 1530 |
| 144 | Ga0070707_100311658 | 3300005468 | Bacteria | 1529 |
| 145 | Ga0070707_100342791 | 3300005468 | Bacteria | 1452 |
| 146 | Ga0070707_101526208 | 3300005468 | Unclassified | 635 |
| 147 | Ga0070707_101882275 | 3300005468 | Bacteria | 566 |
| 148 | Ga0070698_100010229 | 3300005471 | Bacteria | 10018 |
| 149 | Ga0070698_100037918 | 3300005471 | Unclassified | 4968 |
| 150 | Ga0070698_100067029 | 3300005471 | Bacteria | 3611 |
| 151 | Ga0070698_100291962 | 3300005471 | Bacteria | 1561 |
| 152 | Ga0070698_100378630 | 3300005471 | Bacteria | 1348 |
| 153 | Ga0070699_100001209 | 3300005518 | Bacteria | 23875 |
| 154 | Ga0070699_100065797 | 3300005518 | Unclassified | 3146 |
| 155 | Ga0070699_100711848 | 3300005518 | Bacteria | 917 |
| 156 | Ga0070699_101070868 | 3300005518 | Unclassified | 740 |
| 157 | Ga0070699_102080663 | 3300005518 | Bacteria | 519 |
| 158 | Ga0070679_100021754 | 3300005530 | Bacteria | 6264 |
| 159 | Ga0070679_100098891 | 3300005530 | Bacteria | 2905 |
| 160 | Ga0070679_100145619 | 3300005530 | Bacteria | 2347 |
| 161 | Ga0070679_100161015 | 3300005530 | Bacteria | 2219 |
| 162 | Ga0070679_100386596 | 3300005530 | Bacteria | 1346 |
| 163 | Ga0070684_100093821 | 3300005535 | Unclassified | 2672 |
| 164 | Ga0070684_100324002 | 3300005535 | Unclassified | 1415 |
| 165 | Ga0070684_101672998 | 3300005535 | Unclassified | 600 |
| 166 | Ga0070697_100000111 | 3300005536 | Bacteria | 63543 |
| 167 | Ga0070697_100007335 | 3300005536 | Bacteria | 8579 |
| 168 | Ga0070697_100198645 | 3300005536 | Bacteria | 1704 |
| 169 | Ga0070697_100925975 | 3300005536 | Bacteria | 774 |
| 170 | Ga0070697_101901485 | 3300005536 | Bacteria | 533 |
| 171 | Ga0068853_100012877 | 3300005539 | Bacteria | 6816 |
| 172 | Ga0068853_100073401 | 3300005539 | Bacteria | 2983 |
| 173 | Ga0068853_100561934 | 3300005539 | Bacteria | 1081 |
| 174 | Ga0068853_100603069 | 3300005539 | Bacteria | 1043 |
| 175 | Ga0070686_100298523 | 3300005544 | Unclassified | 1194 |
| 176 | Ga0070696_100032477 | 3300005546 | Bacteria | 3581 |
| 177 | Ga0070693_100022502 | 3300005547 | Bacteria | 3353 |
| 178 | Ga0070693_100036808 | 3300005547 | Unclassified | 2723 |
| 179 | Ga0070693_100037041 | 3300005547 | Bacteria | 2717 |
| 180 | Ga0070693_101151163 | 3300005547 | Unclassified | 594 |
| 181 | Ga0068855_100000427 | 3300005563 | Bacteria | 52063 |
| 182 | Ga0068855_100000507 | 3300005563 | Bacteria | 48210 |
| 183 | Ga0068855_100005274 | 3300005563 | Bacteria | 15778 |
| 184 | Ga0068855_100125696 | 3300005563 | Bacteria | 2932 |
| 185 | Ga0068855_100612126 | 3300005563 | Unclassified | 1173 |
| 186 | Ga0068855_100683584 | 3300005563 | Unclassified | 1100 |
| 187 | Ga0070664_100001749 | 3300005564 | Bacteria | 17386 |
| 188 | Ga0070664_100014977 | 3300005564 | Bacteria | 6328 |
| 189 | Ga0070664_100452660 | 3300005564 | Bacteria | 1179 |
| 190 | Ga0070664_100686694 | 3300005564 | Bacteria | 953 |
| 191 | Ga0068857_100000136 | 3300005577 | Bacteria | 44769 |
| 192 | Ga0068857_100000352 | 3300005577 | Bacteria | 31917 |
| 193 | Ga0068857_100259667 | 3300005577 | Unclassified | 1594 |
| 194 | Ga0068857_100432766 | 3300005577 | Unclassified | 1228 |
| 195 | Ga0068857_101543254 | 3300005577 | Unclassified | 648 |
| 196 | Ga0068854_100043260 | 3300005578 | Bacteria | 3192 |
| 197 | Ga0068854_100246553 | 3300005578 | Unclassified | 1424 |
| 198 | Ga0068854_100541277 | 3300005578 | Bacteria | 986 |
| 199 | Ga0068854_100552916 | 3300005578 | Unclassified | 976 |
| 200 | Ga0068856_100000493 | 3300005614 | Bacteria | 43650 |
| 201 | Ga0068856_100013453 | 3300005614 | Bacteria | 7919 |
| 202 | Ga0068856_100013498 | 3300005614 | Bacteria | 7909 |
| 203 | Ga0068856_100021235 | 3300005614 | Bacteria | 6308 |
| 204 | Ga0068856_100041989 | 3300005614 | Bacteria | 4497 |
| 205 | Ga0068856_100053931 | 3300005614 | Bacteria | 3964 |
| 206 | Ga0068856_100081009 | 3300005614 | Unclassified | 3220 |
| 207 | Ga0068856_100131834 | 3300005614 | Unclassified | 2504 |
| 208 | Ga0068856_100313320 | 3300005614 | Unclassified | 1587 |
| 209 | Ga0068856_100752297 | 3300005614 | Bacteria | 995 |
| 210 | Ga0068856_101641806 | 3300005614 | Unclassified | 656 |
| 211 | Ga0070702_100030070 | 3300005615 | Bacteria | 2958 |
| 212 | Ga0068852_100019189 | 3300005616 | Bacteria | 5404 |
| 213 | Ga0068852_100039271 | 3300005616 | Unclassified | 3984 |
| 214 | Ga0068852_100872568 | 3300005616 | Unclassified | 916 |
| 215 | Ga0068859_100010398 | 3300005617 | Bacteria | 9364 |
| 216 | Ga0068864_100003365 | 3300005618 | Bacteria | 13218 |
| 217 | Ga0068866_10026082 | 3300005718 | Bacteria | 2755 |
| 218 | Ga0068866_10844471 | 3300005718 | Unclassified | 640 |
| 219 | Ga0068861_100348592 | 3300005719 | Bacteria | 1298 |
| 220 | Ga0068861_100562321 | 3300005719 | Unclassified | 1041 |
| 221 | Ga0068851_10039955 | 3300005834 | Bacteria | 2357 |
| 222 | Ga0068851_10191675 | 3300005834 | Bacteria | 1137 |
| 223 | Ga0068851_10453029 | 3300005834 | Unclassified | 763 |
| 224 | Ga0068870_10557119 | 3300005840 | Unclassified | 773 |
| 225 | Ga0068870_11226646 | 3300005840 | Unclassified | 544 |
| 226 | Ga0068863_100019241 | 3300005841 | Bacteria | 6532 |
| 227 | Ga0068863_100084407 | 3300005841 | Bacteria | 3010 |
| 228 | Ga0068863_100712758 | 3300005841 | Unclassified | 998 |
| 229 | Ga0068858_100006486 | 3300005842 | Bacteria | 11388 |
| 230 | Ga0068858_100230516 | 3300005842 | Unclassified | 1756 |
| 231 | Ga0068858_100246567 | 3300005842 | Unclassified | 1696 |
| 232 | Ga0068860_100129134 | 3300005843 | Bacteria | 2424 |
| 233 | Ga0068860_101010496 | 3300005843 | Unclassified | 850 |
| 234 | Ga0070717_10001333 | 3300006028 | Bacteria | 16948 |
| 235 | Ga0070717_10001426 | 3300006028 | Bacteria | 16472 |
| 236 | Ga0070717_10003705 | 3300006028 | Bacteria | 10982 |
| 237 | Ga0070717_10008299 | 3300006028 | Bacteria | 7755 |
| 238 | Ga0070717_10046652 | 3300006028 | Bacteria | 3546 |
| 239 | Ga0070717_10049446 | 3300006028 | Bacteria | 3452 |
| 240 | Ga0070717_10056923 | 3300006028 | Unclassified | 3232 |
| 241 | Ga0070717_10088709 | 3300006028 | Bacteria | 2607 |
| 242 | Ga0070717_10128957 | 3300006028 | Unclassified | 2173 |
| 243 | Ga0070717_10132507 | 3300006028 | Bacteria | 2144 |
| 244 | Ga0070717_10179465 | 3300006028 | Bacteria | 1845 |
| 245 | Ga0070717_10211283 | 3300006028 | Bacteria | 1703 |
| 246 | Ga0070717_10222163 | 3300006028 | Unclassified | 1661 |
| 247 | Ga0070717_10284389 | 3300006028 | Bacteria | 1467 |
| 248 | Ga0070717_10527251 | 3300006028 | Bacteria | 1069 |
| 249 | Ga0070717_10695823 | 3300006028 | Bacteria | 923 |
| 250 | Ga0070717_10834496 | 3300006028 | Unclassified | 839 |
| 251 | Ga0070717_11860083 | 3300006028 | Unclassified | 544 |
| 252 | Ga0070715_10006489 | 3300006163 | Bacteria | 3981 |
| 253 | Ga0070715_10085035 | 3300006163 | Bacteria | 1444 |
| 254 | Ga0070715_10179960 | 3300006163 | Unclassified | 1059 |
| 255 | Ga0070715_10221726 | 3300006163 | Bacteria | 973 |
| 256 | Ga0070716_100001005 | 3300006173 | Bacteria | 12325 |
| 257 | Ga0070716_100037181 | 3300006173 | Bacteria | 2689 |
| 258 | Ga0070716_100069884 | 3300006173 | Bacteria | 2060 |
| 259 | Ga0070716_100078149 | 3300006173 | Bacteria | 1966 |
| 260 | Ga0070716_100090519 | 3300006173 | Bacteria | 1851 |
| 261 | Ga0070716_100105744 | 3300006173 | Bacteria | 1734 |
| 262 | Ga0070716_100291682 | 3300006173 | Unclassified | 1131 |
| 263 | Ga0070716_100345165 | 3300006173 | Bacteria | 1052 |
| 264 | Ga0070716_100454433 | 3300006173 | Bacteria | 935 |
| 265 | Ga0070716_101062924 | 3300006173 | Unclassified | 643 |
| 266 | Ga0070716_101381015 | 3300006173 | Unclassified | 572 |
| 267 | Ga0070716_101493943 | 3300006173 | Bacteria | 552 |
| 268 | Ga0070712_100000484 | 3300006175 | Bacteria | 22755 |
| 269 | Ga0070712_100001333 | 3300006175 | Bacteria | 14967 |
| 270 | Ga0070712_100003916 | 3300006175 | Bacteria | 9169 |
| 271 | Ga0070712_100005530 | 3300006175 | Bacteria | 7820 |
| 272 | Ga0070712_100033370 | 3300006175 | Bacteria | 3482 |
| 273 | Ga0070712_100046838 | 3300006175 | Bacteria | 2990 |
| 274 | Ga0070712_100058391 | 3300006175 | Bacteria | 2714 |
| 275 | Ga0070712_100121120 | 3300006175 | Bacteria | 1968 |
| 276 | Ga0070712_100345353 | 3300006175 | Unclassified | 1216 |
| 277 | Ga0097621_100000419 | 3300006237 | Bacteria | 29596 |
| 278 | Ga0097621_100012574 | 3300006237 | Bacteria | 6280 |
| 279 | Ga0097621_100098359 | 3300006237 | Bacteria | 2458 |
| 280 | Ga0097621_100217927 | 3300006237 | Bacteria | 1662 |
| 281 | Ga0068871_100000048 | 3300006358 | Bacteria | 66152 |
| 282 | Ga0068871_100009029 | 3300006358 | Bacteria | 7201 |
| 283 | Ga0068871_100442566 | 3300006358 | Bacteria | 1164 |
| 284 | Ga0068871_101371423 | 3300006358 | Unclassified | 666 |
| 285 | Ga0068871_101483405 | 3300006358 | Bacteria | 640 |
| 286 | Ga0075433_10000909 | 3300006852 | Bacteria | 20857 |
| 287 | Ga0075434_100000080 | 3300006871 | Bacteria | 52022 |
| 288 | Ga0075434_100126946 | 3300006871 | Bacteria | 2567 |
| 289 | Ga0075434_100674098 | 3300006871 | Bacteria | 1052 |
| 290 | Ga0075434_102523806 | 3300006871 | Unclassified | 515 |
| 291 | Ga0075434_102590415 | 3300006871 | Unclassified | 508 |
| 292 | Ga0068865_100012958 | 3300006881 | Bacteria | 5258 |
| 293 | Ga0068865_100027893 | 3300006881 | Bacteria | 3735 |
| 294 | Ga0075436_100011564 | 3300006914 | Bacteria | 6054 |
| 295 | Ga0075436_100030810 | 3300006914 | Bacteria | 3691 |
| 296 | Ga0075436_100160688 | 3300006914 | Bacteria | 1583 |
| 297 | Ga0075436_100164357 | 3300006914 | Bacteria | 1565 |
| 298 | Ga0075436_100284314 | 3300006914 | Unclassified | 1183 |
| 299 | Ga0075436_100411372 | 3300006914 | Unclassified | 981 |
| 300 | Ga0075436_100620095 | 3300006914 | Unclassified | 798 |
| 301 | Ga0097620_100010398 | 3300006931 | Bacteria | 9364 |
| 302 | Ga0075435_100000142 | 3300007076 | Bacteria | 40637 |
| 303 | Ga0075435_100035077 | 3300007076 | Bacteria | 3979 |
| 304 | Ga0075435_100275162 | 3300007076 | Bacteria | 1437 |
| 305 | Ga0075435_100611079 | 3300007076 | Bacteria | 946 |
| 306 | Ga0099794_10072326 | 3300007265 | Bacteria | 1690 |
| 307 | Ga0099794_10785165 | 3300007265 | Unclassified | 509 |
| 308 | Ga0099795_10020473 | 3300007788 | Bacteria | 2156 |
| 309 | Ga0099795_10051874 | 3300007788 | Bacteria | 1496 |
| 310 | Ga0099795_10085923 | 3300007788 | Bacteria | 1212 |
| 311 | Ga0099795_10600825 | 3300007788 | Bacteria | 524 |
| 312 | Ga0105240_10010692 | 3300009093 | Bacteria | 12879 |
| 313 | Ga0105240_10034008 | 3300009093 | Bacteria | 6580 |
| 314 | Ga0105240_10049650 | 3300009093 | Bacteria | 5294 |
| 315 | Ga0105240_10076934 | 3300009093 | Bacteria | 4112 |
| 316 | Ga0105240_10078613 | 3300009093 | Unclassified | 4062 |
| 317 | Ga0105240_10104179 | 3300009093 | Bacteria | 3445 |
| 318 | Ga0105240_10316011 | 3300009093 | Bacteria | 1782 |
| 319 | Ga0105240_10316666 | 3300009093 | Bacteria | 1779 |
| 320 | Ga0105240_10433691 | 3300009093 | Bacteria | 1474 |
| 321 | Ga0105240_10489548 | 3300009093 | Bacteria | 1369 |
| 322 | Ga0105240_11095868 | 3300009093 | Unclassified | 847 |
| 323 | Ga0105240_11233274 | 3300009093 | Unclassified | 791 |
| 324 | Ga0105245_10011029 | 3300009098 | Bacteria | 7866 |
| 325 | Ga0105245_10013122 | 3300009098 | Bacteria | 7220 |
| 326 | Ga0105245_10275573 | 3300009098 | Bacteria | 1642 |
| 327 | Ga0105247_11178814 | 3300009101 | Bacteria | 609 |
| 328 | Ga0105247_11263125 | 3300009101 | Unclassified | 591 |
| 329 | Ga0114129_10446350 | 3300009147 | Bacteria | 1697 |
| 330 | Ga0105241_10000878 | 3300009174 | Bacteria | 22713 |
| 331 | Ga0105241_10015193 | 3300009174 | Bacteria | 5638 |
| 332 | Ga0105241_10021165 | 3300009174 | Bacteria | 4808 |
| 333 | Ga0105241_10045725 | 3300009174 | Bacteria | 3323 |
| 334 | Ga0105241_10120354 | 3300009174 | Bacteria | 2113 |
| 335 | Ga0105241_10184033 | 3300009174 | Unclassified | 1735 |
| 336 | Ga0105241_10437936 | 3300009174 | Unclassified | 1154 |
| 337 | Ga0105242_10265572 | 3300009176 | Unclassified | 1552 |
| 338 | Ga0105242_10482920 | 3300009176 | Bacteria | 1175 |
| 339 | Ga0105248_10034039 | 3300009177 | Bacteria | 5695 |
| 340 | Ga0105248_10038402 | 3300009177 | Bacteria | 5358 |
| 341 | Ga0105237_10060500 | 3300009545 | Bacteria | 3789 |
| 342 | Ga0105237_10063320 | 3300009545 | Bacteria | 3696 |
| 343 | Ga0105237_10077509 | 3300009545 | Bacteria | 3313 |
| 344 | Ga0105237_10140681 | 3300009545 | Bacteria | 2407 |
| 345 | Ga0105237_10181653 | 3300009545 | Bacteria | 2104 |
| 346 | Ga0105237_11869011 | 3300009545 | Unclassified | 608 |
| 347 | Ga0105237_12444295 | 3300009545 | Unclassified | 533 |
| 348 | Ga0105237_12708944 | 3300009545 | Unclassified | 507 |
| 349 | Ga0105238_10000135 | 3300009551 | Bacteria | 81026 |
| 350 | Ga0105238_10024741 | 3300009551 | Bacteria | 6120 |
| 351 | Ga0105238_10256265 | 3300009551 | Bacteria | 1729 |
| 352 | Ga0105238_10268289 | 3300009551 | Bacteria | 1687 |
| 353 | Ga0105238_10630861 | 3300009551 | Bacteria | 1081 |
| 354 | Ga0105238_10713395 | 3300009551 | Bacteria | 1015 |
| 355 | Ga0105238_10733544 | 3300009551 | Unclassified | 1001 |
| 356 | Ga0105238_11474565 | 3300009551 | Unclassified | 709 |
| 357 | Ga0105238_12192816 | 3300009551 | Unclassified | 587 |
| 358 | Ga0105249_10711375 | 3300009553 | Unclassified | 1065 |
| 359 | Ga0099796_10090133 | 3300010159 | Bacteria | 1139 |
| 360 | Ga0099796_10202795 | 3300010159 | Unclassified | 805 |
| 361 | Ga0099796_10303038 | 3300010159 | Unclassified | 678 |
| 362 | Ga0105239_10013061 | 3300010375 | Bacteria | 9230 |
| 363 | Ga0105239_10025069 | 3300010375 | Bacteria | 6569 |
| 364 | Ga0105239_10080657 | 3300010375 | Bacteria | 3580 |
| 365 | Ga0105239_10086009 | 3300010375 | Unclassified | 3465 |
| 366 | Ga0105239_10185996 | 3300010375 | Bacteria | 2325 |
| 367 | Ga0105239_10254453 | 3300010375 | Unclassified | 1973 |
| 368 | Ga0105239_10911621 | 3300010375 | Unclassified | 1009 |
| 369 | Ga0105239_11070573 | 3300010375 | Bacteria | 928 |
| 370 | Ga0157326_1099490 | 3300012513 | Unclassified | 501 |
| 371 | Ga0157373_10001908 | 3300013100 | Bacteria | 15811 |
| 372 | Ga0157373_10100205 | 3300013100 | Bacteria | 2038 |
| 373 | Ga0157373_10182718 | 3300013100 | Bacteria | 1477 |
| 374 | Ga0157373_10224199 | 3300013100 | Unclassified | 1327 |
| 375 | Ga0157373_10278848 | 3300013100 | Bacteria | 1184 |
| 376 | Ga0157373_10283303 | 3300013100 | Bacteria | 1175 |
| 377 | Ga0157373_10529691 | 3300013100 | Bacteria | 853 |
| 378 | Ga0157371_10062056 | 3300013102 | Bacteria | 2650 |
| 379 | Ga0157371_10873761 | 3300013102 | Unclassified | 681 |
| 380 | Ga0157370_10018270 | 3300013104 | Bacteria | 7053 |
| 381 | Ga0157370_10096135 | 3300013104 | Bacteria | 2779 |
| 382 | Ga0157370_10232465 | 3300013104 | Unclassified | 1706 |
| 383 | Ga0157369_10000034 | 3300013105 | Bacteria | 200710 |
| 384 | Ga0157369_10020521 | 3300013105 | Bacteria | 7387 |
| 385 | Ga0157369_10028231 | 3300013105 | Bacteria | 6211 |
| 386 | Ga0157369_10075478 | 3300013105 | Unclassified | 3615 |
| 387 | Ga0157369_10095983 | 3300013105 | Bacteria | 3163 |
| 388 | Ga0157369_10103642 | 3300013105 | Bacteria | 3030 |
| 389 | Ga0157369_10107201 | 3300013105 | Bacteria | 2972 |
| 390 | Ga0157369_10207016 | 3300013105 | Bacteria | 2057 |
| 391 | Ga0157369_10244530 | 3300013105 | Bacteria | 1873 |
| 392 | Ga0157369_10496461 | 3300013105 | Unclassified | 1263 |
| 393 | Ga0157369_10672993 | 3300013105 | Bacteria | 1066 |
| 394 | Ga0157369_10906248 | 3300013105 | Unclassified | 904 |
| 395 | Ga0157374_10000112 | 3300013296 | Bacteria | 74313 |
| 396 | Ga0157374_10000183 | 3300013296 | Bacteria | 58330 |
| 397 | Ga0157374_10000210 | 3300013296 | Bacteria | 53686 |
| 398 | Ga0157374_10175254 | 3300013296 | Bacteria | 2093 |
| 399 | Ga0157374_10277523 | 3300013296 | Unclassified | 1654 |
| 400 | Ga0157374_10383774 | 3300013296 | Unclassified | 1400 |
| 401 | Ga0157374_10641844 | 3300013296 | Bacteria | 1073 |
| 402 | Ga0157378_10000107 | 3300013297 | Bacteria | 79357 |
| 403 | Ga0157378_10000127 | 3300013297 | Bacteria | 74509 |
| 404 | Ga0157378_10007947 | 3300013297 | Bacteria | 9258 |
| 405 | Ga0157378_10026030 | 3300013297 | Bacteria | 5156 |
| 406 | Ga0157378_10460498 | 3300013297 | Bacteria | 1264 |
| 407 | Ga0157378_12347859 | 3300013297 | Bacteria | 585 |
| 408 | Ga0163162_10194520 | 3300013306 | Bacteria | 2156 |
| 409 | Ga0163162_10247648 | 3300013306 | Unclassified | 1914 |
| 410 | Ga0163162_10370841 | 3300013306 | Bacteria | 1565 |
| 411 | Ga0163162_10382194 | 3300013306 | Bacteria | 1541 |
| 412 | Ga0163162_11244368 | 3300013306 | Unclassified | 845 |
| 413 | Ga0157372_10000059 | 3300013307 | Bacteria | 124697 |
| 414 | Ga0157372_10000153 | 3300013307 | Bacteria | 74783 |
| 415 | Ga0157372_10002821 | 3300013307 | Bacteria | 18772 |
| 416 | Ga0157372_10003843 | 3300013307 | Bacteria | 16137 |
| 417 | Ga0157372_10010295 | 3300013307 | Bacteria | 9935 |
| 418 | Ga0157372_10025802 | 3300013307 | Bacteria | 6391 |
| 419 | Ga0157372_10042214 | 3300013307 | Bacteria | 5043 |
| 420 | Ga0157372_10124432 | 3300013307 | Bacteria | 2964 |
| 421 | Ga0157372_10213178 | 3300013307 | Bacteria | 2238 |
| 422 | Ga0157372_10242206 | 3300013307 | Bacteria | 2093 |
| 423 | Ga0157372_10268689 | 3300013307 | Bacteria | 1981 |
| 424 | Ga0157372_10897677 | 3300013307 | Bacteria | 1028 |
| 425 | Ga0157372_10938583 | 3300013307 | Unclassified | 1003 |
| 426 | Ga0157372_10951001 | 3300013307 | Unclassified | 996 |
| 427 | Ga0157372_11406346 | 3300013307 | Bacteria | 804 |
| 428 | Ga0157372_11677067 | 3300013307 | Unclassified | 731 |
| 429 | Ga0157372_11698172 | 3300013307 | Unclassified | 726 |
| 430 | Ga0157372_12251814 | 3300013307 | Unclassified | 626 |
| 431 | Ga0157375_11180935 | 3300013308 | Unclassified | 897 |
| 432 | Ga0163163_10214386 | 3300014325 | Bacteria | 1974 |
| 433 | Ga0182008_10432526 | 3300014497 | Unclassified | 712 |
| 434 | Ga0182008_10931855 | 3300014497 | Unclassified | 513 |
| 435 | Ga0157379_10857964 | 3300014968 | Bacteria | 859 |
| 436 | Ga0157376_10004651 | 3300014969 | Bacteria | 9565 |
| 437 | Ga0157376_10346892 | 3300014969 | Unclassified | 1419 |
| 438 | Ga0157376_10360164 | 3300014969 | Unclassified | 1395 |
| 439 | Ga0157376_12845185 | 3300014969 | Unclassified | 524 |
| 440 | Ga0182006_1247657 | 3300015261 | Unclassified | 585 |
| 441 | Ga0182007_10006797 | 3300015262 | Bacteria | 4870 |
| 442 | Ga0182007_10064398 | 3300015262 | Unclassified | 1201 |
| 443 | Ga0182007_10208001 | 3300015262 | Unclassified | 687 |
| 444 | Ga0182005_1148284 | 3300015265 | Bacteria | 681 |
| 445 | Ga0197907_10258267 | 3300020069 | Unclassified | 529 |
| 446 | Ga0197907_10489849 | 3300020069 | Unclassified | 532 |
| 447 | Ga0197907_11396651 | 3300020069 | Unclassified | 564 |
| 448 | Ga0206356_10111165 | 3300020070 | Unclassified | 946 |
| 449 | Ga0206356_10630039 | 3300020070 | Unclassified | 771 |
| 450 | Ga0206356_10808840 | 3300020070 | Unclassified | 656 |
| 451 | Ga0206356_11024997 | 3300020070 | Unclassified | 531 |
| 452 | Ga0206356_11223647 | 3300020070 | Unclassified | 627 |
| 453 | Ga0206356_11349120 | 3300020070 | Bacteria | 738 |
| 454 | Ga0206349_1972346 | 3300020075 | Unclassified | 559 |
| 455 | Ga0206355_1392844 | 3300020076 | Unclassified | 638 |
| 456 | Ga0206352_10041766 | 3300020078 | Unclassified | 917 |
| 457 | Ga0206352_10267634 | 3300020078 | Unclassified | 570 |
| 458 | Ga0206352_10724634 | 3300020078 | Unclassified | 602 |
| 459 | Ga0206352_10859100 | 3300020078 | Unclassified | 612 |
| 460 | Ga0206352_11112670 | 3300020078 | Bacteria | 566 |
| 461 | Ga0206352_11299062 | 3300020078 | Unclassified | 673 |
| 462 | Ga0206350_10726275 | 3300020080 | Unclassified | 608 |
| 463 | Ga0206354_10857068 | 3300020081 | Unclassified | 570 |
| 464 | Ga0206353_10196849 | 3300020082 | Unclassified | 504 |
| 465 | Ga0213874_10334747 | 3300021377 | Unclassified | 577 |
| 466 | Ga0213875_10132854 | 3300021388 | Bacteria | 1164 |
| 467 | Ga0224712_10367311 | 3300022467 | Unclassified | 682 |
| 468 | Ga0224712_10483769 | 3300022467 | Unclassified | 597 |
| 469 | Ga0228598_1120632 | 3300024227 | Unclassified | 532 |
| 470 | Ga0207656_10146100 | 3300025321 | Unclassified | 1117 |
| 471 | Ga0207656_10207127 | 3300025321 | Unclassified | 949 |
| 472 | Ga0207692_10001123 | 3300025898 | Bacteria | 9851 |
| 473 | Ga0207692_10176941 | 3300025898 | Bacteria | 1240 |
| 474 | Ga0207692_10212072 | 3300025898 | Unclassified | 1144 |
| 475 | Ga0207692_10275268 | 3300025898 | Bacteria | 1016 |
| 476 | Ga0207692_10288771 | 3300025898 | Bacteria | 995 |
| 477 | Ga0207692_10290612 | 3300025898 | Unclassified | 992 |
| 478 | Ga0207692_10338443 | 3300025898 | Bacteria | 925 |
| 479 | Ga0207692_10796099 | 3300025898 | Bacteria | 618 |
| 480 | Ga0207647_10146704 | 3300025904 | Unclassified | 1380 |
| 481 | Ga0207685_10013877 | 3300025905 | Unclassified | 2505 |
| 482 | Ga0207685_10114675 | 3300025905 | Bacteria | 1173 |
| 483 | Ga0207685_10164635 | 3300025905 | Bacteria | 1015 |
| 484 | Ga0207685_10176975 | 3300025905 | Bacteria | 986 |
| 485 | Ga0207685_10375131 | 3300025905 | Unclassified | 723 |
| 486 | Ga0207699_10001179 | 3300025906 | Bacteria | 12374 |
| 487 | Ga0207699_10013292 | 3300025906 | Bacteria | 4210 |
| 488 | Ga0207699_10022387 | 3300025906 | Bacteria | 3423 |
| 489 | Ga0207699_10036546 | 3300025906 | Bacteria | 2801 |
| 490 | Ga0207699_10057913 | 3300025906 | Bacteria | 2316 |
| 491 | Ga0207699_10130776 | 3300025906 | Unclassified | 1637 |
| 492 | Ga0207699_10286630 | 3300025906 | Bacteria | 1146 |
| 493 | Ga0207699_10545593 | 3300025906 | Unclassified | 840 |
| 494 | Ga0207699_11235177 | 3300025906 | Bacteria | 553 |
| 495 | Ga0207643_10033887 | 3300025908 | Unclassified | 2858 |
| 496 | Ga0207643_10363483 | 3300025908 | Unclassified | 910 |
| 497 | Ga0207684_10000623 | 3300025910 | Bacteria | 42146 |
| 498 | Ga0207684_10166148 | 3300025910 | Bacteria | 1901 |
| 499 | Ga0207684_10274061 | 3300025910 | Bacteria | 1456 |
| 500 | Ga0207684_10425921 | 3300025910 | Bacteria | 1140 |
| 501 | Ga0207684_10473655 | 3300025910 | Bacteria | 1074 |
| 502 | Ga0207684_10510815 | 3300025910 | Unclassified | 1030 |
| 503 | Ga0207684_10617137 | 3300025910 | Bacteria | 925 |
| 504 | Ga0207684_11221622 | 3300025910 | Bacteria | 622 |
| 505 | Ga0207654_10078313 | 3300025911 | Bacteria | 1983 |
| 506 | Ga0207654_10105154 | 3300025911 | Bacteria | 1746 |
| 507 | Ga0207654_10485364 | 3300025911 | Unclassified | 871 |
| 508 | Ga0207707_10025137 | 3300025912 | Bacteria | 5209 |
| 509 | Ga0207707_10035225 | 3300025912 | Bacteria | 4378 |
| 510 | Ga0207707_10164179 | 3300025912 | Bacteria | 1941 |
| 511 | Ga0207707_11017558 | 3300025912 | Unclassified | 679 |
| 512 | Ga0207707_11267719 | 3300025912 | Unclassified | 594 |
| 513 | Ga0207695_10044785 | 3300025913 | Bacteria | 4703 |
| 514 | Ga0207695_10072295 | 3300025913 | Bacteria | 3520 |
| 515 | Ga0207695_10108054 | 3300025913 | Bacteria | 2767 |
| 516 | Ga0207695_10277788 | 3300025913 | Unclassified | 1569 |
| 517 | Ga0207695_10497888 | 3300025913 | Bacteria | 1101 |
| 518 | Ga0207695_10772142 | 3300025913 | Unclassified | 841 |
| 519 | Ga0207695_11114694 | 3300025913 | Unclassified | 669 |
| 520 | Ga0207671_10051401 | 3300025914 | Bacteria | 3054 |
| 521 | Ga0207671_10492317 | 3300025914 | Bacteria | 977 |
| 522 | Ga0207693_10000022 | 3300025915 | Bacteria | 127887 |
| 523 | Ga0207693_10000820 | 3300025915 | Bacteria | 27693 |
| 524 | Ga0207693_10006127 | 3300025915 | Bacteria | 9967 |
| 525 | Ga0207693_10010331 | 3300025915 | Bacteria | 7577 |
| 526 | Ga0207693_10067882 | 3300025915 | Bacteria | 2792 |
| 527 | Ga0207693_10081325 | 3300025915 | Bacteria | 2536 |
| 528 | Ga0207693_10083803 | 3300025915 | Bacteria | 2498 |
| 529 | Ga0207693_10114030 | 3300025915 | Bacteria | 2120 |
| 530 | Ga0207693_10156541 | 3300025915 | Unclassified | 1792 |
| 531 | Ga0207693_10541419 | 3300025915 | Unclassified | 908 |
| 532 | Ga0207693_11086680 | 3300025915 | Unclassified | 608 |
| 533 | Ga0207663_10003426 | 3300025916 | Bacteria | 7762 |
| 534 | Ga0207663_10007954 | 3300025916 | Bacteria | 5532 |
| 535 | Ga0207663_10017744 | 3300025916 | Bacteria | 3973 |
| 536 | Ga0207663_10048932 | 3300025916 | Bacteria | 2619 |
| 537 | Ga0207663_10069246 | 3300025916 | Bacteria | 2269 |
| 538 | Ga0207663_10078040 | 3300025916 | Bacteria | 2158 |
| 539 | Ga0207663_10106865 | 3300025916 | Bacteria | 1892 |
| 540 | Ga0207663_10204076 | 3300025916 | Bacteria | 1428 |
| 541 | Ga0207663_10270004 | 3300025916 | Bacteria | 1259 |
| 542 | Ga0207663_10411491 | 3300025916 | Unclassified | 1036 |
| 543 | Ga0207663_10879285 | 3300025916 | Bacteria | 716 |
| 544 | Ga0207663_11081640 | 3300025916 | Unclassified | 644 |
| 545 | Ga0207660_10050113 | 3300025917 | Bacteria | 2964 |
| 546 | Ga0207660_10108862 | 3300025917 | Unclassified | 2082 |
| 547 | Ga0207657_10003709 | 3300025919 | Bacteria | 16233 |
| 548 | Ga0207649_10016068 | 3300025920 | Bacteria | 4214 |
| 549 | Ga0207649_10668435 | 3300025920 | Unclassified | 804 |
| 550 | Ga0207652_10090651 | 3300025921 | Bacteria | 2687 |
| 551 | Ga0207652_10159047 | 3300025921 | Bacteria | 2025 |
| 552 | Ga0207652_10309414 | 3300025921 | Bacteria | 1426 |
| 553 | Ga0207652_10444118 | 3300025921 | Unclassified | 1169 |
| 554 | Ga0207652_10453034 | 3300025921 | Unclassified | 1156 |
| 555 | Ga0207652_11096986 | 3300025921 | Unclassified | 696 |
| 556 | Ga0207652_11228525 | 3300025921 | Unclassified | 651 |
| 557 | Ga0207652_11286640 | 3300025921 | Unclassified | 634 |
| 558 | Ga0207646_10000332 | 3300025922 | Bacteria | 64190 |
| 559 | Ga0207646_10124875 | 3300025922 | Bacteria | 2314 |
| 560 | Ga0207646_10129566 | 3300025922 | Bacteria | 2270 |
| 561 | Ga0207646_10421806 | 3300025922 | Bacteria | 1204 |
| 562 | Ga0207646_10719702 | 3300025922 | Unclassified | 892 |
| 563 | Ga0207646_10826557 | 3300025922 | Bacteria | 824 |
| 564 | Ga0207694_10000722 | 3300025924 | Bacteria | 29682 |
| 565 | Ga0207694_10209983 | 3300025924 | Bacteria | 1586 |
| 566 | Ga0207694_10319482 | 3300025924 | Bacteria | 1281 |
| 567 | Ga0207694_10367243 | 3300025924 | Bacteria | 1193 |
| 568 | Ga0207694_10434452 | 3300025924 | Bacteria | 1095 |
| 569 | Ga0207694_11207955 | 3300025924 | Unclassified | 640 |
| 570 | Ga0207694_11679204 | 3300025924 | Unclassified | 535 |
| 571 | Ga0207650_10022032 | 3300025925 | Bacteria | 4509 |
| 572 | Ga0207650_10167627 | 3300025925 | Bacteria | 1744 |
| 573 | Ga0207687_10004632 | 3300025927 | Bacteria | 9149 |
| 574 | Ga0207687_10205345 | 3300025927 | Bacteria | 1542 |
| 575 | Ga0207687_10319869 | 3300025927 | Bacteria | 1256 |
| 576 | Ga0207700_10000056 | 3300025928 | Bacteria | 71553 |
| 577 | Ga0207700_10002505 | 3300025928 | Bacteria | 10530 |
| 578 | Ga0207700_10002969 | 3300025928 | Bacteria | 9782 |
| 579 | Ga0207700_10008231 | 3300025928 | Bacteria | 6444 |
| 580 | Ga0207700_10023517 | 3300025928 | Bacteria | 4250 |
| 581 | Ga0207700_10122768 | 3300025928 | Bacteria | 2108 |
| 582 | Ga0207700_10133720 | 3300025928 | Bacteria | 2029 |
| 583 | Ga0207700_10205979 | 3300025928 | Unclassified | 1660 |
| 584 | Ga0207700_10233400 | 3300025928 | Bacteria | 1565 |
| 585 | Ga0207700_10301062 | 3300025928 | Unclassified | 1385 |
| 586 | Ga0207700_10445806 | 3300025928 | Bacteria | 1140 |
| 587 | Ga0207700_10561502 | 3300025928 | Unclassified | 1014 |
| 588 | Ga0207700_10674488 | 3300025928 | Unclassified | 922 |
| 589 | Ga0207700_11015603 | 3300025928 | Bacteria | 742 |
| 590 | Ga0207700_11032128 | 3300025928 | Unclassified | 736 |
| 591 | Ga0207700_11494429 | 3300025928 | Bacteria | 599 |
| 592 | Ga0207664_10000143 | 3300025929 | Bacteria | 58667 |
| 593 | Ga0207664_10002694 | 3300025929 | Bacteria | 11783 |
| 594 | Ga0207664_10006310 | 3300025929 | Bacteria | 8148 |
| 595 | Ga0207664_10058116 | 3300025929 | Bacteria | 3076 |
| 596 | Ga0207664_10062318 | 3300025929 | Bacteria | 2978 |
| 597 | Ga0207664_10092432 | 3300025929 | Bacteria | 2483 |
| 598 | Ga0207664_10233448 | 3300025929 | Unclassified | 1599 |
| 599 | Ga0207664_10591222 | 3300025929 | Bacteria | 997 |
| 600 | Ga0207664_10754918 | 3300025929 | Bacteria | 875 |
| 601 | Ga0207664_10880446 | 3300025929 | Bacteria | 804 |
| 602 | Ga0207664_10951437 | 3300025929 | Unclassified | 770 |
| 603 | Ga0207664_10951685 | 3300025929 | Bacteria | 770 |
| 604 | Ga0207664_11090869 | 3300025929 | Bacteria | 714 |
| 605 | Ga0207664_11122512 | 3300025929 | Unclassified | 702 |
| 606 | Ga0207664_11457714 | 3300025929 | Bacteria | 606 |
| 607 | Ga0207644_10627549 | 3300025931 | Unclassified | 893 |
| 608 | Ga0207644_10917472 | 3300025931 | Unclassified | 734 |
| 609 | Ga0207690_10027935 | 3300025932 | Bacteria | 3571 |
| 610 | Ga0207690_10284908 | 3300025932 | Unclassified | 1288 |
| 611 | Ga0207704_10016830 | 3300025938 | Bacteria | 3770 |
| 612 | Ga0207704_10037395 | 3300025938 | Bacteria | 2804 |
| 613 | Ga0207665_10003243 | 3300025939 | Bacteria | 10897 |
| 614 | Ga0207665_10012455 | 3300025939 | Bacteria | 5586 |
| 615 | Ga0207665_10023801 | 3300025939 | Bacteria | 4033 |
| 616 | Ga0207665_10029343 | 3300025939 | Bacteria | 3636 |
| 617 | Ga0207665_10037952 | 3300025939 | Bacteria | 3206 |
| 618 | Ga0207665_10126198 | 3300025939 | Bacteria | 1812 |
| 619 | Ga0207665_10216591 | 3300025939 | Bacteria | 1401 |
| 620 | Ga0207665_10330875 | 3300025939 | Bacteria | 1146 |
| 621 | Ga0207665_10338969 | 3300025939 | Unclassified | 1132 |
| 622 | Ga0207665_10427054 | 3300025939 | Bacteria | 1013 |
| 623 | Ga0207665_10607563 | 3300025939 | Bacteria | 854 |
| 624 | Ga0207665_10849103 | 3300025939 | Bacteria | 723 |
| 625 | Ga0207665_11448757 | 3300025939 | Unclassified | 546 |
| 626 | Ga0207711_10040765 | 3300025941 | Unclassified | 3951 |
| 627 | Ga0207711_10178762 | 3300025941 | Bacteria | 1928 |
| 628 | Ga0207689_10096804 | 3300025942 | Bacteria | 2424 |
| 629 | Ga0207661_10020975 | 3300025944 | Bacteria | 4893 |
| 630 | Ga0207661_10139192 | 3300025944 | Bacteria | 2087 |
| 631 | Ga0207679_10001953 | 3300025945 | Bacteria | 12799 |
| 632 | Ga0207679_10156552 | 3300025945 | Bacteria | 1861 |
| 633 | Ga0207679_10500874 | 3300025945 | Unclassified | 1084 |
| 634 | Ga0207679_10932731 | 3300025945 | Bacteria | 795 |
| 635 | Ga0207679_11031610 | 3300025945 | Unclassified | 754 |
| 636 | Ga0207667_10002755 | 3300025949 | Bacteria | 21728 |
| 637 | Ga0207667_10003317 | 3300025949 | Bacteria | 19862 |
| 638 | Ga0207667_10054522 | 3300025949 | Bacteria | 4205 |
| 639 | Ga0207667_10745127 | 3300025949 | Unclassified | 979 |
| 640 | Ga0207667_10788137 | 3300025949 | Unclassified | 948 |
| 641 | Ga0207667_11802424 | 3300025949 | Unclassified | 576 |
| 642 | Ga0207651_10206832 | 3300025960 | Bacteria | 1577 |
| 643 | Ga0207640_10017610 | 3300025981 | Bacteria | 4184 |
| 644 | Ga0207640_10144889 | 3300025981 | Unclassified | 1737 |
| 645 | Ga0207640_10199445 | 3300025981 | Bacteria | 1515 |
| 646 | Ga0207640_10383377 | 3300025981 | Unclassified | 1140 |
| 647 | Ga0207640_11373165 | 3300025981 | Unclassified | 632 |
| 648 | Ga0207640_11616205 | 3300025981 | Unclassified | 584 |
| 649 | Ga0207677_10054258 | 3300026023 | Bacteria | 2734 |
| 650 | Ga0207677_10471857 | 3300026023 | Unclassified | 1079 |
| 651 | Ga0207677_10474766 | 3300026023 | Bacteria | 1076 |
| 652 | Ga0207677_10669469 | 3300026023 | Unclassified | 918 |
| 653 | Ga0207703_10004306 | 3300026035 | Bacteria | 11702 |
| 654 | Ga0207703_10547565 | 3300026035 | Bacteria | 1091 |
| 655 | Ga0207639_10064001 | 3300026041 | Bacteria | 2850 |
| 656 | Ga0207639_10184246 | 3300026041 | Unclassified | 1778 |
| 657 | Ga0207639_10244891 | 3300026041 | Bacteria | 1561 |
| 658 | Ga0207678_10408916 | 3300026067 | Unclassified | 1176 |
| 659 | Ga0207702_10000171 | 3300026078 | Bacteria | 77495 |
| 660 | Ga0207702_10004667 | 3300026078 | Bacteria | 12106 |
| 661 | Ga0207702_10005214 | 3300026078 | Bacteria | 11411 |
| 662 | Ga0207702_10018480 | 3300026078 | Bacteria | 5768 |
| 663 | Ga0207702_10033096 | 3300026078 | Bacteria | 4316 |
| 664 | Ga0207702_10067499 | 3300026078 | Bacteria | 3069 |
| 665 | Ga0207702_11893981 | 3300026078 | Unclassified | 588 |
| 666 | Ga0207641_10013876 | 3300026088 | Bacteria | 6609 |
| 667 | Ga0207641_12201949 | 3300026088 | Unclassified | 551 |
| 668 | Ga0207648_10042480 | 3300026089 | Bacteria | 3991 |
| 669 | Ga0207676_10008218 | 3300026095 | Bacteria | 7427 |
| 670 | Ga0207674_10000126 | 3300026116 | Bacteria | 88965 |
| 671 | Ga0207674_10000230 | 3300026116 | Bacteria | 69765 |
| 672 | Ga0207674_10071474 | 3300026116 | Unclassified | 3486 |
| 673 | Ga0207674_10140862 | 3300026116 | Unclassified | 2371 |
| 674 | Ga0207675_101466147 | 3300026118 | Unclassified | 703 |
| 675 | Ga0207683_10917862 | 3300026121 | Unclassified | 813 |
| 676 | Ga0207698_10104365 | 3300026142 | Unclassified | 2358 |
| 677 | Ga0207698_10213858 | 3300026142 | Bacteria | 1736 |
| 678 | Ga0207698_10338953 | 3300026142 | Unclassified | 1415 |
| 679 | Ga0207698_10923263 | 3300026142 | Unclassified | 881 |
| 680 | Ga0209179_1061338 | 3300027512 | Unclassified | 816 |
| 681 | Ga0209179_1109634 | 3300027512 | Bacteria | 616 |
| 682 | Ga0265354_1001518 | 3300028016 | Bacteria | 3279 |
| 683 | Ga0265356_1005152 | 3300028017 | Bacteria | 1573 |
| 684 | Ga0265356_1005696 | 3300028017 | Bacteria | 1477 |
| 685 | Ga0265355_1009091 | 3300028036 | Bacteria | 801 |
| 686 | Ga0265355_1017696 | 3300028036 | Unclassified | 609 |
| 687 | Ga0268264_10327763 | 3300028381 | Unclassified | 1450 |
| 688 | Ga0265336_10057607 | 3300028666 | Bacteria | 1167 |
| 689 | Ga0265338_10000352 | 3300028800 | Bacteria | 83563 |
| 690 | Ga0265338_10006522 | 3300028800 | Bacteria | 14837 |
| 691 | Ga0265338_10019949 | 3300028800 | Bacteria | 7078 |
| 692 | Ga0265338_10177218 | 3300028800 | Unclassified | 1628 |
| 693 | Ga0265338_10220215 | 3300028800 | Bacteria | 1418 |
| 694 | Ga0265324_10078795 | 3300029957 | Bacteria | 1121 |
| 695 | Ga0265762_1000945 | 3300030760 | Bacteria | 5206 |
| 696 | Ga0265762_1042491 | 3300030760 | Bacteria | 893 |
| 697 | Ga0265763_1026593 | 3300030763 | Unclassified | 637 |
| 698 | Ga0265770_1016019 | 3300030878 | Bacteria | 1146 |
| 699 | Ga0265765_1046549 | 3300030879 | Unclassified | 587 |
| 700 | Ga0265760_10003368 | 3300031090 | Bacteria | 4660 |
| 701 | Ga0265760_10005801 | 3300031090 | Bacteria | 3531 |
| 702 | Ga0265760_10008109 | 3300031090 | Bacteria | 3000 |
| 703 | Ga0265760_10009506 | 3300031090 | Bacteria | 2776 |
| 704 | Ga0265760_10106178 | 3300031090 | Bacteria | 891 |
| 705 | Ga0265328_10028487 | 3300031239 | Bacteria | 2089 |
| 706 | Ga0265325_10019838 | 3300031241 | Bacteria | 3712 |
| 707 | Ga0265325_10204845 | 3300031241 | Bacteria | 908 |
| 708 | Ga0265329_10312938 | 3300031242 | Unclassified | 532 |
| 709 | Ga0265339_10013614 | 3300031249 | Unclassified | 4926 |
| 710 | Ga0265339_10064430 | 3300031249 | Bacteria | 1966 |
| 711 | Ga0265339_10085214 | 3300031249 | Unclassified | 1664 |
| 712 | Ga0265331_10543433 | 3300031250 | Unclassified | 524 |
| 713 | Ga0265316_10013501 | 3300031344 | Bacteria | 7249 |
| 714 | Ga0265316_10119372 | 3300031344 | Bacteria | 1992 |
| 715 | Ga0307408_102339127 | 3300031548 | Unclassified | 518 |
| 716 | Ga0265314_10036059 | 3300031711 | Bacteria | 3598 |
| 717 | Ga0265314_10045866 | 3300031711 | Bacteria | 3087 |
| 718 | Ga0265314_10080354 | 3300031711 | Bacteria | 2153 |
| 719 | Ga0265342_10531585 | 3300031712 | Unclassified | 598 |
| 720 | Ga0307412_12290455 | 3300031911 | Unclassified | 504 |
| 721 | Ga0373926_0001236 | 3300035083 | Bacteria | 7690 |
| 722 | Ga0373926_0025756 | 3300035083 | Bacteria | 2054 |
| 723 | Ga0373926_0106830 | 3300035083 | Bacteria | 1050 |
| 724 | Ga0373926_0123847 | 3300035083 | Bacteria | 976 |
| 725 | Ga0373926_0193208 | 3300035083 | Unclassified | 782 |
| 726 | Ga0373934_0011542 | 3300035086 | Bacteria | 3323 |
| 727 | Ga0373934_0054809 | 3300035086 | Bacteria | 1583 |
| 728 | Ga0373944_0045162 | 3300035089 | Unclassified | 1374 |
| 729 | Ga0373944_0288575 | 3300035089 | Unclassified | 613 |
| 730 | Ga0373952_0221025 | 3300035092 | Bacteria | 563 |
| 731 | Ga0373923_0026086 | 3300035111 | Bacteria | 2322 |
| 732 | Ga0373923_0129846 | 3300035111 | Bacteria | 1131 |
| 733 | Ga0373923_0135719 | 3300035111 | Unclassified | 1109 |
| 734 | Ga0373923_0326499 | 3300035111 | Bacteria | 729 |
| 735 | Ga0373932_0305078 | 3300035112 | Unclassified | 595 |
| 736 | Ga0373936_0006487 | 3300035113 | Bacteria | 4412 |
| 737 | Ga0373936_0022692 | 3300035113 | Bacteria | 2443 |
| 738 | Ga0373936_0155606 | 3300035113 | Bacteria | 993 |
| 739 | Ga0373936_0262399 | 3300035113 | Unclassified | 773 |
| 740 | Ga0373945_0004750 | 3300035116 | Bacteria | 4328 |
| 741 | Ga0373945_0006937 | 3300035116 | Bacteria | 3662 |
| 742 | Ga0373945_0096911 | 3300035116 | Unclassified | 1149 |
| 743 | Ga0373953_0012461 | 3300035117 | Unclassified | 3012 |
| 744 | Ga0373953_0110008 | 3300035117 | Bacteria | 1165 |
| 745 | Ga0373954_0013500 | 3300035118 | Bacteria | 3641 |
| 746 | Ga0373954_0120039 | 3300035118 | Unclassified | 1276 |
| 747 | Ga0373954_0136327 | 3300035118 | Unclassified | 1196 |
| 748 | Ga0373956_0016495 | 3300035119 | Bacteria | 3103 |
| 749 | Ga0373956_0069808 | 3300035119 | Bacteria | 1602 |
| 750 | Ga0373956_0559702 | 3300035119 | Unclassified | 546 |
| 751 | Ga0373957_0083717 | 3300035120 | Bacteria | 1261 |
| 752 | Ga0373957_0449661 | 3300035120 | Unclassified | 557 |
| 753 | Ga0373943_0000116 | 3300035170 | Bacteria | 29820 |
| 754 | Ga0373943_0099992 | 3300035170 | Bacteria | 1515 |
| 755 | Ga0373943_0539532 | 3300035170 | Unclassified | 684 |
| 756 | Ga0373946_0003133 | 3300035171 | Bacteria | 5859 |
| 757 | Ga0373946_0034039 | 3300035171 | Unclassified | 2054 |
| 758 | Ga0373946_0261240 | 3300035171 | Bacteria | 847 |
| 759 | Ga0373946_0720521 | 3300035171 | Unclassified | 522 |
| 760 | Ga0373955_0163711 | 3300035172 | Bacteria | 1314 |
| 761 | Ga0373955_0348418 | 3300035172 | Unclassified | 897 |
| 762 | Ga0373955_0430828 | 3300035172 | Unclassified | 803 |
| 763 | Ga0373955_0498738 | 3300035172 | Bacteria | 743 |
| 764 | Ga0373955_0720616 | 3300035172 | Unclassified | 612 |
| 765 | Ga0373962_0269731 | 3300035242 | Unclassified | 596 |
| 766 | Ga0373924_0000483 | 3300035410 | Bacteria | 12180 |
| 767 | Ga0373931_0443140 | 3300035691 | Unclassified | 829 |
| 768 | Ga0373935_0001975 | 3300035692 | Bacteria | 11546 |
| 769 | Ga0373935_0003523 | 3300035692 | Bacteria | 9108 |
| 770 | Ga0373935_0005149 | 3300035692 | Bacteria | 7696 |
| 771 | Ga0373935_0027330 | 3300035692 | Bacteria | 3526 |
| 772 | Ga0373935_0062488 | 3300035692 | Bacteria | 2385 |
| 773 | Ga0373935_0105724 | 3300035692 | Bacteria | 1861 |
| 774 | Ga0373935_0131229 | 3300035692 | Bacteria | 1684 |
| 775 | Ga0373935_0562204 | 3300035692 | Bacteria | 832 |
| 776 | Ga0373935_1003184 | 3300035692 | Bacteria | 620 |
| 777 | Ga0373935_1252308 | 3300035692 | Unclassified | 553 |
| 778 | Ga0373927_0000118 | 3300035695 | Bacteria | 59794 |
| 779 | Ga0373927_0022021 | 3300035695 | Bacteria | 4176 |
| 780 | Ga0373927_0082888 | 3300035695 | Bacteria | 2079 |
| 781 | Ga0373927_0303687 | 3300035695 | Bacteria | 1050 |
| 782 | Ga0373927_0421912 | 3300035695 | Unclassified | 880 |
| 783 | Ga0373927_0588628 | 3300035695 | Unclassified | 735 |
| 784 | Ga0373933_0005233 | 3300035724 | Bacteria | 7078 |
| 785 | Ga0373933_0045132 | 3300035724 | Bacteria | 2613 |
| 786 | Ga0373933_0062768 | 3300035724 | Bacteria | 2245 |
| 787 | Ga0373933_0112538 | 3300035724 | Bacteria | 1699 |
| 788 | Ga0373933_0494507 | 3300035724 | Unclassified | 801 |
| 789 | Ga0373933_0695753 | 3300035724 | Unclassified | 668 |
| 790 | Ga0373933_0812244 | 3300035724 | Bacteria | 615 |
| 791 | Ga0373947_0004767 | 3300035725 | Bacteria | 7941 |
| 792 | Ga0373947_0005481 | 3300035725 | Bacteria | 7405 |
| 793 | Ga0373947_0006908 | 3300035725 | Bacteria | 6580 |
| 794 | Ga0373947_0042147 | 3300035725 | Bacteria | 2724 |
| 795 | Ga0373947_0097000 | 3300035725 | Bacteria | 1847 |
| 796 | Ga0373947_0718345 | 3300035725 | Unclassified | 682 |
| 797 | Ga0373947_0928620 | 3300035725 | Unclassified | 594 |
| 798 | Ga0373937_0008419 | 3300036401 | Bacteria | 8967 |
| 799 | Ga0373937_0242943 | 3300036401 | Bacteria | 1696 |
| 800 | Ga0373937_0578759 | 3300036401 | Bacteria | 1066 |
| 801 | Ga0373937_1051076 | 3300036401 | Unclassified | 763 |
| 802 | Ga0373937_1099843 | 3300036401 | Unclassified | 743 |
| 803 | Ga0373937_1461194 | 3300036401 | Unclassified | 631 |
| 804 | Ga0265778_007379 | 3300036457 | Bacteria | 1203 |
| 805 | Ga0265778_014072 | 3300036457 | Unclassified | 943 |
| 806 | Ga0373925_0002638 | 3300037068 | Bacteria | 14224 |
| 807 | Ga0373925_0059363 | 3300037068 | Bacteria | 2869 |
| 808 | Ga0373925_0101439 | 3300037068 | Bacteria | 2213 |
| 809 | Ga0373925_0101695 | 3300037068 | Bacteria | 2210 |
| 810 | Ga0373925_0341080 | 3300037068 | Unclassified | 1215 |
| 811 | Ga0373925_0395553 | 3300037068 | Bacteria | 1126 |
| 812 | Ga0373925_0424803 | 3300037068 | Unclassified | 1086 |
| 813 | Ga0373925_0819043 | 3300037068 | Bacteria | 767 |
| 814 | Ga0373925_1077903 | 3300037068 | Bacteria | 661 |
| 815 | Ga0373925_1209380 | 3300037068 | Unclassified | 621 |
| 816 | Ga0395900_0497151 | 3300037418 | Bacteria | 1170 |
| 817 | Ga0395900_0646194 | 3300037418 | Bacteria | 995 |
| 818 | Ga0395905_0014337 | 3300037471 | Bacteria | 7575 |
| 819 | Ga0395905_0425490 | 3300037471 | Bacteria | 1224 |
| 820 | Ga0395905_0429496 | 3300037471 | Bacteria | 1218 |
| 821 | Ga0395905_0585323 | 3300037471 | Unclassified | 1018 |
| 822 | Ga0395905_1154890 | 3300037471 | Unclassified | 678 |
| 823 | Ga0395905_1195284 | 3300037471 | Unclassified | 664 |
| 824 | Ga0436364_0718644 | 3300037853 | Bacteria | 590 |
| 825 | Ga0436364_1209441 | 3300037853 | Bacteria | 1672 |
| 826 | Ga0395901_1229128 | 3300038443 | Bacteria | 714 |
| 827 | Ga0395901_1330092 | 3300038443 | Unclassified | 679 |
| 828 | Ga0436365_1285273 | 3300039437 | Bacteria | 1128 |
| 829 | Ga0436361_0473294 | 3300039447 | Unclassified | 667 |
| 830 | Ga0436363_0339936 | 3300039450 | Bacteria | 1845 |
| 831 | Ga0436363_0644164 | 3300039450 | Unclassified | 776 |
| 832 | Ga0436363_1175243 | 3300039450 | Bacteria | 728 |
| 833 | Ga0436363_1451564 | 3300039450 | Bacteria | 1457 |
| 834 | Ga0436362_0380443 | 3300039453 | Unclassified | 522 |
| 835 | Ga0436362_0484552 | 3300039453 | Unclassified | 552 |
| 836 | Ga0451839_0359763 | 3300041496 | Unclassified | 891 |
| 837 | Ga0451577_0529712 | 3300042876 | Bacteria | 1070 |
| 838 | Ga0466963_0103799 | 3300044694 | Bacteria | 1947 |
| 839 | Ga0466963_0172440 | 3300044694 | Bacteria | 1508 |
| 840 | Ga0466964_0161003 | 3300044706 | Unclassified | 1049 |
| 841 | Ga0466964_0500467 | 3300044706 | Unclassified | 652 |
| 842 | Ga0466971_0024151 | 3300044719 | Bacteria | 2712 |
| 843 | Ga0466968_0305491 | 3300044735 | Bacteria | 766 |
| 844 | Ga0466970_0397342 | 3300044765 | Unclassified | 786 |
| 845 | Ga0466957_0191541 | 3300044842 | Bacteria | 1340 |
| 846 | Ga0466959_0807034 | 3300045049 | Bacteria | 627 |
| 847 | Ga0451576_0054004 | 3300045051 | Bacteria | 4207 |
| 848 | Ga0451576_0386136 | 3300045051 | Bacteria | 1468 |
| 849 | Ga0451576_0471234 | 3300045051 | Unclassified | 1319 |
| 850 | Ga0451576_0780898 | 3300045051 | Bacteria | 1003 |
| 851 | Ga0466967_0007474 | 3300045976 | Bacteria | 7884 |
| 852 | Ga0466967_0016737 | 3300045976 | Bacteria | 5794 |
| 853 | Ga0466967_0611165 | 3300045976 | Unclassified | 1076 |
| 854 | Ga0466967_1704533 | 3300045976 | Bacteria | 628 |
| 855 | Ga0466967_2485015 | 3300045976 | Unclassified | 513 |
| 856 | Ga0495592_0235602 | 3300046454 | Bacteria | 1217 |
| 857 | Ga0495629_0003956 | 3300046459 | Bacteria | 11142 |
| 858 | Ga0495629_1134695 | 3300046459 | Bacteria | 504 |
| 859 | Ga0495641_0357020 | 3300046461 | Unclassified | 661 |
| 860 | Ga0495651_0431524 | 3300046462 | Unclassified | 855 |
| 861 | Ga0495651_0879568 | 3300046462 | Bacteria | 549 |
| 862 | Ga0495653_0428294 | 3300046463 | Bacteria | 836 |
| 863 | Ga0495580_0000255 | 3300046472 | Bacteria | 42406 |
| 864 | Ga0495580_0001135 | 3300046472 | Bacteria | 23464 |
| 865 | Ga0495580_0001634 | 3300046472 | Bacteria | 19724 |
| 866 | Ga0495580_0010770 | 3300046472 | Bacteria | 7102 |
| 867 | Ga0495580_0033759 | 3300046472 | Bacteria | 3685 |
| 868 | Ga0495580_0062917 | 3300046472 | Unclassified | 2603 |
| 869 | Ga0495580_0306287 | 3300046472 | Bacteria | 1081 |
| 870 | Ga0495580_0326981 | 3300046472 | Unclassified | 1041 |
| 871 | Ga0495580_0368086 | 3300046472 | Bacteria | 972 |
| 872 | Ga0495580_0435194 | 3300046472 | Unclassified | 881 |
| 873 | Ga0495580_0518614 | 3300046472 | Bacteria | 794 |
| 874 | Ga0495580_0581816 | 3300046472 | Bacteria | 741 |
| 875 | Ga0495580_0736943 | 3300046472 | Unclassified | 643 |
| 876 | Ga0495582_0001022 | 3300046473 | Bacteria | 15658 |
| 877 | Ga0495582_0001816 | 3300046473 | Bacteria | 12068 |
| 878 | Ga0495582_0226426 | 3300046473 | Unclassified | 1070 |
| 879 | Ga0495582_0759083 | 3300046473 | Unclassified | 561 |
| 880 | Ga0495639_0251700 | 3300046475 | Unclassified | 873 |
| 881 | Ga0495662_0398782 | 3300046476 | Bacteria | 676 |
| 882 | Ga0495664_0020430 | 3300046477 | Bacteria | 3820 |
| 883 | Ga0495608_0025414 | 3300046511 | Bacteria | 4043 |
| 884 | Ga0495618_0260908 | 3300046514 | Bacteria | 1085 |
| 885 | Ga0495628_0414596 | 3300046516 | Unclassified | 982 |
| 886 | Ga0495630_0030815 | 3300046517 | Unclassified | 3992 |
| 887 | Ga0495630_0076895 | 3300046517 | Bacteria | 2516 |
| 888 | Ga0495630_0096649 | 3300046517 | Bacteria | 2233 |
| 889 | Ga0495630_0342821 | 3300046517 | Bacteria | 1143 |
| 890 | Ga0495630_0387194 | 3300046517 | Unclassified | 1071 |
| 891 | Ga0495630_0524083 | 3300046517 | Unclassified | 909 |
| 892 | Ga0495666_0048033 | 3300046526 | Bacteria | 2056 |
| 893 | Ga0495652_0715787 | 3300046529 | Unclassified | 672 |
| 894 | Ga0495665_0005508 | 3300046531 | Bacteria | 6820 |
| 895 | Ga0495665_0098371 | 3300046531 | Unclassified | 1536 |
| 896 | Ga0495665_0252979 | 3300046531 | Bacteria | 907 |
| 897 | Ga0495665_0266815 | 3300046531 | Unclassified | 880 |
| 898 | Ga0495665_0407163 | 3300046531 | Unclassified | 690 |
| 899 | Ga0495587_0281053 | 3300046536 | Bacteria | 933 |
| 900 | Ga0495645_0304571 | 3300046543 | Unclassified | 1040 |
| 901 | Ga0495667_0174953 | 3300046559 | Bacteria | 1379 |
| 902 | Ga0495634_0277964 | 3300046642 | Bacteria | 1018 |
| 903 | Ga0495635_0273787 | 3300046663 | Unclassified | 1135 |
| 904 | Ga0495635_0375526 | 3300046663 | Bacteria | 946 |
| 905 | Ga0495588_0250991 | 3300046674 | Bacteria | 933 |
| 906 | Ga0495599_0178262 | 3300046678 | Unclassified | 1310 |
| 907 | Ga0495623_0341322 | 3300046679 | Unclassified | 818 |
| 908 | Ga0495646_0464353 | 3300046680 | Unclassified | 653 |
| 909 | Ga0495647_0235750 | 3300046681 | Bacteria | 811 |
| 910 | Ga0495658_0062032 | 3300046683 | Bacteria | 2148 |
| 911 | Ga0495658_0075217 | 3300046683 | Unclassified | 1970 |
| 912 | Ga0495669_0010544 | 3300046684 | Bacteria | 3908 |
| 913 | Ga0495669_0059144 | 3300046684 | Bacteria | 1730 |
| 914 | Ga0495669_0387493 | 3300046684 | Unclassified | 677 |
| 915 | Ga0495613_1094769 | 3300046689 | Unclassified | 509 |
| 916 | Ga0495624_0475268 | 3300046690 | Bacteria | 748 |
| 917 | Ga0495581_0019223 | 3300047315 | Bacteria | 3965 |
| 918 | Ga0495581_0530835 | 3300047315 | Unclassified | 683 |
| 919 | Ga0495604_0049079 | 3300047317 | Bacteria | 3281 |
| 920 | Ga0495604_0504684 | 3300047317 | Unclassified | 784 |
| 921 | Ga0495674_0004353 | 3300047319 | Bacteria | 13610 |
| 922 | Ga0495674_0006067 | 3300047319 | Bacteria | 11596 |
| 923 | Ga0495674_0105039 | 3300047319 | Bacteria | 2401 |
| 924 | Ga0495674_0389182 | 3300047319 | Bacteria | 1127 |
| 925 | Ga0495674_1381332 | 3300047319 | Unclassified | 525 |
| 926 | Ga0495675_0249749 | 3300047444 | Bacteria | 1066 |
| 927 | Ga0495675_0407349 | 3300047444 | Bacteria | 792 |
| 928 | Ga0495684_0307611 | 3300047471 | Bacteria | 1137 |
| 929 | Ga0495684_0634418 | 3300047471 | Unclassified | 716 |
| 930 | Ga0495593_0368187 | 3300047673 | Unclassified | 718 |
| 931 | Ga0495602_0081476 | 3300048088 | Bacteria | 2721 |
| 932 | Ga0495602_0112020 | 3300048088 | Bacteria | 2215 |
| 933 | Ga0495602_0143062 | 3300048088 | Bacteria | 1891 |
| 934 | Ga0495602_0343977 | 3300048088 | Bacteria | 1078 |
| 935 | Ga0495602_0368486 | 3300048088 | Bacteria | 1032 |
| 936 | Ga0495614_0061167 | 3300048089 | Unclassified | 1618 |
| 937 | Ga0495614_0106381 | 3300048089 | Bacteria | 1230 |
| 938 | Ga0495614_0427314 | 3300048089 | Unclassified | 625 |
| 939 | Ga0495615_0113748 | 3300048090 | Bacteria | 777 |
| 940 | Ga0496100_0937086 | 3300048903 | Unclassified | 681 |
| 941 | Ga0496101_0408315 | 3300048904 | Bacteria | 1070 |
| 942 | Ga0496102_0031359 | 3300048905 | Bacteria | 4768 |
| 943 | Ga0496102_0095643 | 3300048905 | Bacteria | 2753 |
| 944 | Ga0496102_0214053 | 3300048905 | Bacteria | 1816 |
| 945 | Ga0496102_0542778 | 3300048905 | Unclassified | 1085 |
| 946 | Ga0496103_0073409 | 3300048906 | Unclassified | 2143 |
| 947 | Ga0496104_0080282 | 3300048907 | Bacteria | 3110 |
| 948 | Ga0496104_0085102 | 3300048907 | Bacteria | 3018 |
| 949 | Ga0496104_0089105 | 3300048907 | Unclassified | 2948 |
| 950 | Ga0496104_0156736 | 3300048907 | Bacteria | 2185 |
| 951 | Ga0496104_0518680 | 3300048907 | Bacteria | 1103 |
| 952 | Ga0496104_1774138 | 3300048907 | Unclassified | 519 |
| 953 | Ga0496105_0015430 | 3300048908 | Bacteria | 6088 |
| 954 | Ga0496106_0185479 | 3300048909 | Unclassified | 1653 |
| 955 | Ga0496106_0792120 | 3300048909 | Unclassified | 752 |
| 956 | Ga0496108_1149981 | 3300048911 | Unclassified | 658 |
| 957 | Ga0496109_0346838 | 3300048912 | Bacteria | 1402 |
| 958 | Ga0496110_0188264 | 3300048913 | Bacteria | 1874 |
| 959 | Ga0496110_0640156 | 3300048913 | Bacteria | 963 |
| 960 | Ga0496111_0010026 | 3300048914 | Bacteria | 6339 |
| 961 | Ga0496111_0091884 | 3300048914 | Bacteria | 2224 |
| 962 | Ga0496112_0004567 | 3300048915 | Bacteria | 11765 |
| 963 | Ga0496112_0007155 | 3300048915 | Bacteria | 9880 |
| 964 | Ga0496112_0013968 | 3300048915 | Bacteria | 7432 |
| 965 | Ga0496112_0041580 | 3300048915 | Unclassified | 4498 |
| 966 | Ga0496112_0137029 | 3300048915 | Bacteria | 2417 |
| 967 | Ga0496112_0249350 | 3300048915 | Bacteria | 1727 |
| 968 | Ga0496112_0348844 | 3300048915 | Bacteria | 1423 |
| 969 | Ga0496112_0350265 | 3300048915 | Bacteria | 1419 |
| 970 | Ga0496112_0380131 | 3300048915 | Bacteria | 1353 |
| 971 | Ga0496113_0509075 | 3300048916 | Unclassified | 966 |
| 972 | Ga0496113_0510042 | 3300048916 | Bacteria | 965 |
| 973 | Ga0496113_1108204 | 3300048916 | Unclassified | 621 |
| 974 | Ga0496113_1163118 | 3300048916 | Unclassified | 603 |
| 975 | Ga0496114_0058677 | 3300048917 | Unclassified | 3214 |
| 976 | Ga0496115_0050088 | 3300048918 | Bacteria | 3345 |
| 977 | Ga0496115_0052541 | 3300048918 | Unclassified | 3269 |
| 978 | Ga0501067_0282572 | 3300049583 | Archaea | 924 |
| 979 | nmdc:mga05p37_302135_c2 | 3300050507 | Bacteria | 1504 |
| 980 | nmdc:mga0n895_125_c1 | 3300050512 | Bacteria | 45661 |
| 981 | nmdc:mga0n895_2069452_c1 | 3300050512 | Unclassified | 526 |
| 982 | nmdc:mga0n895_275082_c1 | 3300050512 | Bacteria | 1708 |
| 983 | nmdc:mga0n895_304338_c1 | 3300050512 | Bacteria | 1616 |
| 984 | nmdc:mga0rr50_1046767_c1 | 3300050513 | Unclassified | 695 |
| 985 | nmdc:mga0rr50_1357_c1 | 3300050513 | Bacteria | 13378 |
| 986 | nmdc:mga0rr50_248633_c1 | 3300050513 | Bacteria | 1476 |
| 987 | nmdc:mga0rr50_43383_c1 | 3300050513 | Bacteria | 3291 |
| 988 | nmdc:mga08x19_1090877_c1 | 3300050514 | Unclassified | 566 |
| 989 | nmdc:mga08x19_16026_c1 | 3300050514 | Bacteria | 4567 |
| 990 | nmdc:mga08x19_404993_c1 | 3300050514 | Unclassified | 957 |
| 991 | nmdc:mga08x19_8698_c1 | 3300050514 | Bacteria | 6054 |
| 992 | nmdc:mga08x19_930998_c1 | 3300050514 | Bacteria | 617 |
| 993 | nmdc:mga0a205_5864_c2 | 3300050515 | Bacteria | 10037 |
| 994 | Ga0495601_0013413 | 3300053077 | Bacteria | 4928 |
| 995 | Ga0495612_0208189 | 3300053078 | Unclassified | 864 |
| 996 | Ga0495619_0300888 | 3300053085 | Bacteria | 1111 |
| 997 | Ga0495619_0994372 | 3300053085 | Unclassified | 561 |
| 998 | Ga0587084_098213 | 3300059477 | Unclassified | 590 |
| 999 | Ga0587084_113935 | 3300059477 | Bacteria | 562 |
| 1000 | Ga0587084_133480 | 3300059477 | Unclassified | 533 |
| 1001 | Ga0587093_028989 | 3300059478 | Unclassified | 786 |
| 1002 | Ga0587093_046910 | 3300059478 | Unclassified | 671 |
| 1003 | Ga0587093_068845 | 3300059478 | Unclassified | 591 |
| 1004 | Ga0587093_070759 | 3300059478 | Unclassified | 586 |
| 1005 | Ga0587066_079374 | 3300059490 | Unclassified | 708 |
| 1006 | Ga0587066_130047 | 3300059490 | Unclassified | 604 |
| 1007 | Ga0587066_149219 | 3300059490 | Unclassified | 578 |
| 1008 | Ga0587070_139553 | 3300059491 | Unclassified | 597 |
| 1009 | Ga0587070_143576 | 3300059491 | Bacteria | 592 |
| 1010 | Ga0587070_169979 | 3300059491 | Unclassified | 560 |
| 1011 | Ga0587073_0007548 | 3300059492 | Bacteria | 1724 |
| 1012 | Ga0587073_0129917 | 3300059492 | Unclassified | 690 |
| 1013 | Ga0587073_0160074 | 3300059492 | Unclassified | 644 |
| 1014 | Ga0587073_0180238 | 3300059492 | Unclassified | 619 |
| 1015 | Ga0587073_0191234 | 3300059492 | Unclassified | 607 |
| 1016 | Ga0587077_050473 | 3300059493 | Unclassified | 869 |
| 1017 | Ga0587077_121989 | 3300059493 | Unclassified | 651 |
| 1018 | Ga0587077_143784 | 3300059493 | Bacteria | 617 |
| 1019 | Ga0587077_164388 | 3300059493 | Unclassified | 590 |
| 1020 | Ga0587080_065871 | 3300059503 | Unclassified | 715 |
| 1021 | Ga0587080_076606 | 3300059503 | Unclassified | 679 |
| 1022 | Ga0587080_096507 | 3300059503 | Bacteria | 627 |
| 1023 | Ga0587082_113382 | 3300059504 | Unclassified | 605 |
| 1024 | Ga0587082_123510 | 3300059504 | Unclassified | 587 |
| 1025 | Ga0587083_0014707 | 3300059505 | Bacteria | 1353 |
| 1026 | Ga0587083_0156400 | 3300059505 | Unclassified | 620 |
| 1027 | Ga0587083_0163281 | 3300059505 | Unclassified | 611 |
| 1028 | Ga0587083_0183023 | 3300059505 | Bacteria | 588 |
| 1029 | Ga0587085_037629 | 3300059506 | Unclassified | 828 |
| 1030 | Ga0587085_105429 | 3300059506 | Unclassified | 601 |
| 1031 | Ga0587085_143427 | 3300059506 | Unclassified | 545 |
| 1032 | Ga0587089_096014 | 3300059509 | Unclassified | 533 |
| 1033 | Ga0587090_085290 | 3300059510 | Unclassified | 639 |
| 1034 | Ga0587090_145262 | 3300059510 | Unclassified | 533 |
| 1035 | Ga0587091_149355 | 3300059511 | Unclassified | 592 |
| 1036 | Ga0587091_168689 | 3300059511 | Unclassified | 568 |
| 1037 | Ga0587091_171792 | 3300059511 | Unclassified | 564 |
| 1038 | Ga0587092_033196 | 3300059512 | Unclassified | 865 |
| 1039 | Ga0587094_084308 | 3300059513 | Unclassified | 592 |
| 1040 | Ga0587094_120556 | 3300059513 | Unclassified | 525 |
| 1041 | Ga0587106_106111 | 3300059605 | Unclassified | 580 |
| 1042 | Ga0587101_025561 | 3300059623 | Unclassified | 886 |
| 1043 | Ga0587109_114410 | 3300059624 | Unclassified | 634 |
| 1044 | Ga0587109_207847 | 3300059624 | Unclassified | 513 |
| 1045 | Ga0587115_068359 | 3300059626 | Unclassified | 609 |
| 1046 | Ga0587117_088028 | 3300059627 | Unclassified | 575 |
| 1047 | Ga0587128_067268 | 3300059630 | Unclassified | 690 |
| 1048 | Ga0587128_082072 | 3300059630 | Unclassified | 647 |
| 1049 | Ga0587062_084764 | 3300059639 | Bacteria | 594 |
| 1050 | Ga0587067_035591 | 3300059640 | Unclassified | 943 |
| 1051 | Ga0587067_135907 | 3300059640 | Unclassified | 604 |
| 1052 | Ga0587067_166785 | 3300059640 | Unclassified | 564 |
| 1053 | Ga0587068_099892 | 3300059641 | Unclassified | 608 |
| 1054 | Ga0587069_037866 | 3300059642 | Unclassified | 811 |
| 1055 | Ga0587069_060283 | 3300059642 | Unclassified | 697 |
| 1056 | Ga0587075_044054 | 3300059644 | Unclassified | 758 |
| 1057 | Ga0587075_068044 | 3300059644 | Bacteria | 656 |
| 1058 | Ga0587075_098467 | 3300059644 | Unclassified | 581 |
| 1059 | Ga0587076_077715 | 3300059645 | Unclassified | 702 |
| 1060 | Ga0587076_087046 | 3300059645 | Unclassified | 676 |
| 1061 | Ga0587076_095291 | 3300059645 | Unclassified | 657 |
| 1062 | Ga0587078_033426 | 3300059646 | Unclassified | 702 |
| 1063 | Ga0587078_046621 | 3300059646 | Unclassified | 626 |
| 1064 | Ga0587078_051963 | 3300059646 | Unclassified | 603 |
| 1065 | Ga0587078_052777 | 3300059646 | Unclassified | 599 |
| 1066 | Ga0587079_033473 | 3300059647 | Unclassified | 1001 |
| 1067 | Ga0587079_062609 | 3300059647 | Unclassified | 810 |
| 1068 | Ga0587079_185899 | 3300059647 | Unclassified | 559 |
| 1069 | Ga0587102_044607 | 3300059649 | Unclassified | 582 |
| 1070 | Ga0587102_045586 | 3300059649 | Unclassified | 578 |
| 1071 | Ga0587107_029582 | 3300059652 | Unclassified | 825 |
| 1072 | Ga0587119_055081 | 3300059658 | Unclassified | 602 |
| 1073 | Ga0587119_065862 | 3300059658 | Unclassified | 567 |
| 1074 | Ga0587060_036802 | 3300060243 | Unclassified | 514 |
| 1075 | Ga0587071_046728 | 3300060344 | Unclassified | 884 |
| 1076 | Ga0587071_144394 | 3300060344 | Unclassified | 587 |
| 1077 | Ga0587071_179176 | 3300060344 | Unclassified | 543 |
| 1078 | Ga0587111_0064732 | 3300060346 | Unclassified | 840 |
| 1079 | Ga0587111_0141020 | 3300060346 | Unclassified | 639 |
| 1080 | Ga0466962_0037678 | 3300061719 | Bacteria | 2316 |
| 1081 | Ga0070712_101019267 | |||
| 1082 | LJNas_1000562 | |||
| 1083 | rootH1_10275960 | |||
| 1084 | Ga0058863_10047664 | |||
| 1085 | Ga0058863_10173066 | |||
| 1086 | Ga0058863_11654109 | |||
| 1087 | Ga0058863_11662177 | |||
| 1088 | Ga0058861_11644902 | |||
| 1089 | Ga0058861_11680532 | |||
| 1090 | Ga0058861_11905019 | |||
| 1091 | Ga0058862_10184300 | |||
| 1092 | Ga0058862_12590030 | |||
| 1093 | Ga0058862_12648726 | |||
| 1094 | Ga0058862_12829145 | |||
| 1095 | Ga0058862_12890471 | |||
| 1096 | Ga0065712_10004477 | |||
| 1097 | Ga0065715_10927599 | |||
| 1098 | Ga0070658_10454785 | |||
| 1099 | Ga0070683_100029028 | |||
| 1100 | Ga0070683_100032910 | |||
| 1101 | Ga0070683_100050518 | |||
| 1102 | Ga0070683_100063058 | |||
| 1103 | Ga0070683_100099292 | |||
| 1104 | Ga0070670_100033268 | |||
| 1105 | Ga0070670_100200266 | |||
| 1106 | Ga0070680_100068634 | |||
| 1107 | Ga0070680_100185584 | |||
| 1108 | Ga0070680_100550338 | |||
| 1109 | Ga0070682_100021501 | |||
| 1110 | Ga0068868_100023580 | |||
| 1111 | Ga0068868_100608172 | |||
| 1112 | Ga0068868_102010386 | |||
| 1113 | Ga0070687_100010047 | |||
| 1114 | Ga0070661_100050659 | |||
| 1115 | Ga0070661_100482584 | |||
| 1116 | Ga0070661_100741363 | |||
| 1117 | Ga0070661_101083988 | |||
| 1118 | Ga0070668_101081230 | |||
| 1119 | Ga0070671_100138283 | |||
| 1120 | Ga0070659_100325710 | |||
| 1121 | Ga0070709_10001568 | |||
| 1122 | Ga0070709_10004307 | |||
| 1123 | Ga0070709_10010600 | |||
| 1124 | Ga0070709_10058936 | |||
| 1125 | Ga0070709_10077265 | |||
| 1126 | Ga0070709_10085018 | |||
| 1127 | Ga0070709_10093598 | |||
| 1128 | Ga0070709_10208008 | |||
| 1129 | Ga0070709_10255407 | |||
| 1130 | Ga0070709_10282023 | |||
| 1131 | Ga0070709_10623534 | |||
| 1132 | Ga0070709_10817046 | |||
| 1133 | Ga0070714_100000134 | |||
| 1134 | Ga0070714_100007313 | |||
| 1135 | Ga0070714_100019452 | |||
| 1136 | Ga0070714_100071760 | |||
| 1137 | Ga0070714_100107153 | |||
| 1138 | Ga0070714_100153055 | |||
| 1139 | Ga0070714_100245381 | |||
| 1140 | Ga0070714_100282903 | |||
| 1141 | Ga0070714_100367742 | |||
| 1142 | Ga0070714_100369358 | |||
| 1143 | Ga0070714_100394007 | |||
| 1144 | Ga0070714_100480672 | |||
| 1145 | Ga0070714_100698186 | |||
| 1146 | Ga0070714_100841585 | |||
| 1147 | Ga0070714_101104924 | |||
| 1148 | Ga0070713_100000455 | |||
| 1149 | Ga0070713_100000888 | |||
| 1150 | Ga0070713_100004293 | |||
| 1151 | Ga0070713_100010694 | |||
| 1152 | Ga0070713_100015714 | |||
| 1153 | Ga0070713_100035462 | |||
| 1154 | Ga0070713_100065497 | |||
| 1155 | Ga0070713_100083953 | |||
| 1156 | Ga0070713_100187746 | |||
| 1157 | Ga0070713_100195717 | |||
| 1158 | Ga0070713_100276405 | |||
| 1159 | Ga0070713_100330686 | |||
| 1160 | Ga0070713_100499520 | |||
| 1161 | Ga0070713_100824393 | |||
| 1162 | Ga0070713_101414648 | |||
| 1163 | Ga0070713_101925698 | |||
| 1164 | Ga0070710_10001659 | |||
| 1165 | Ga0070710_10017404 | |||
| 1166 | Ga0070710_10024604 | |||
| 1167 | Ga0070710_10064137 | |||
| 1168 | Ga0070710_10115498 | |||
| 1169 | Ga0070710_10128616 | |||
| 1170 | Ga0070710_10183812 | |||
| 1171 | Ga0070710_10195594 | |||
| 1172 | Ga0070710_10216030 | |||
| 1173 | Ga0070710_10668814 | |||
| 1174 | Ga0070710_11239588 | |||
| 1175 | Ga0070711_100000138 | |||
| 1176 | Ga0070711_100004490 | |||
| 1177 | Ga0070711_100023588 | |||
| 1178 | Ga0070711_100028885 | |||
| 1179 | Ga0070711_100054633 | |||
| 1180 | Ga0070711_100069874 | |||
| 1181 | Ga0070711_100135018 | |||
| 1182 | Ga0070711_100165446 | |||
| 1183 | Ga0070711_100189613 | |||
| 1184 | Ga0070711_100703940 | |||
| 1185 | Ga0070711_100741329 | |||
| 1186 | Ga0070711_100842998 | |||
| 1187 | Ga0070711_101635656 | |||
| 1188 | Ga0070705_100167271 | |||
| 1189 | Ga0070708_100006623 | |||
| 1190 | Ga0070708_100010321 | |||
| 1191 | Ga0070708_100021434 | |||
| 1192 | Ga0070708_100031007 | |||
| 1193 | Ga0070708_100050095 | |||
| 1194 | Ga0070708_100062000 | |||
| 1195 | Ga0070708_100068032 | |||
| 1196 | Ga0070708_100070254 | |||
| 1197 | Ga0070708_100190957 | |||
| 1198 | Ga0070708_100191442 | |||
| 1199 | Ga0070708_101524092 | |||
| 1200 | Ga0070663_100083459 | |||
| 1201 | Ga0070678_101081542 | |||
| 1202 | Ga0070662_100028600 | |||
| 1203 | Ga0070662_100124696 | |||
| 1204 | Ga0070681_10000655 | |||
| 1205 | Ga0070681_10003758 | |||
| 1206 | Ga0070681_10292972 | |||
| 1207 | Ga0070681_10361054 | |||
| 1208 | Ga0070681_10402307 | |||
| 1209 | Ga0070681_10679901 | |||
| 1210 | Ga0068867_100029267 | |||
| 1211 | Ga0070706_100012946 | |||
| 1212 | Ga0070706_100015992 | |||
| 1213 | Ga0070706_100162768 | |||
| 1214 | Ga0070706_100180543 | |||
| 1215 | Ga0070706_100335935 | |||
| 1216 | Ga0070706_100509367 | |||
| 1217 | Ga0070706_100729331 | |||
| 1218 | Ga0070706_101050171 | |||
| 1219 | Ga0070707_100017410 | |||
| 1220 | Ga0070707_100040648 | |||
| 1221 | Ga0070707_100068858 | |||
| 1222 | Ga0070707_100074091 | |||
| 1223 | Ga0070707_100311287 | |||
| 1224 | Ga0070707_100311658 | |||
| 1225 | Ga0070707_100342791 | |||
| 1226 | Ga0070707_101526208 | |||
| 1227 | Ga0070707_101882275 | |||
| 1228 | Ga0070698_100010229 | |||
| 1229 | Ga0070698_100037918 | |||
| 1230 | Ga0070698_100067029 | |||
| 1231 | Ga0070698_100291962 | |||
| 1232 | Ga0070698_100378630 | |||
| 1233 | Ga0070699_100001209 | |||
| 1234 | Ga0070699_100065797 | |||
| 1235 | Ga0070699_100711848 | |||
| 1236 | Ga0070699_101070868 | |||
| 1237 | Ga0070699_102080663 | |||
| 1238 | Ga0070679_100021754 | |||
| 1239 | Ga0070679_100098891 | |||
| 1240 | Ga0070679_100145619 | |||
| 1241 | Ga0070679_100161015 | |||
| 1242 | Ga0070679_100386596 | |||
| 1243 | Ga0070684_100093821 | |||
| 1244 | Ga0070684_100324002 | |||
| 1245 | Ga0070684_101672998 | |||
| 1246 | Ga0070697_100000111 | |||
| 1247 | Ga0070697_100007335 | |||
| 1248 | Ga0070697_100198645 | |||
| 1249 | Ga0070697_100925975 | |||
| 1250 | Ga0070697_101901485 | |||
| 1251 | Ga0068853_100012877 | |||
| 1252 | Ga0068853_100073401 | |||
| 1253 | Ga0068853_100561934 | |||
| 1254 | Ga0068853_100603069 | |||
| 1255 | Ga0070686_100298523 | |||
| 1256 | Ga0070696_100032477 | |||
| 1257 | Ga0070693_100022502 | |||
| 1258 | Ga0070693_100036808 | |||
| 1259 | Ga0070693_100037041 | |||
| 1260 | Ga0070693_101151163 | |||
| 1261 | Ga0068855_100000427 | |||
| 1262 | Ga0068855_100000507 | |||
| 1263 | Ga0068855_100005274 | |||
| 1264 | Ga0068855_100125696 | |||
| 1265 | Ga0068855_100612126 | |||
| 1266 | Ga0068855_100683584 | |||
| 1267 | Ga0070664_100001749 | |||
| 1268 | Ga0070664_100014977 | |||
| 1269 | Ga0070664_100452660 | |||
| 1270 | Ga0070664_100686694 | |||
| 1271 | Ga0068857_100000136 | |||
| 1272 | Ga0068857_100000352 | |||
| 1273 | Ga0068857_100259667 | |||
| 1274 | Ga0068857_100432766 | |||
| 1275 | Ga0068857_101543254 | |||
| 1276 | Ga0068854_100043260 | |||
| 1277 | Ga0068854_100246553 | |||
| 1278 | Ga0068854_100541277 | |||
| 1279 | Ga0068854_100552916 | |||
| 1280 | Ga0068856_100000493 | |||
| 1281 | Ga0068856_100013453 | |||
| 1282 | Ga0068856_100013498 | |||
| 1283 | Ga0068856_100021235 | |||
| 1284 | Ga0068856_100041989 | |||
| 1285 | Ga0068856_100053931 | |||
| 1286 | Ga0068856_100081009 | |||
| 1287 | Ga0068856_100131834 | |||
| 1288 | Ga0068856_100313320 | |||
| 1289 | Ga0068856_100752297 | |||
| 1290 | Ga0068856_101641806 | |||
| 1291 | Ga0070702_100030070 | |||
| 1292 | Ga0068852_100019189 | |||
| 1293 | Ga0068852_100039271 | |||
| 1294 | Ga0068852_100872568 | |||
| 1295 | Ga0068859_100010398 | |||
| 1296 | Ga0068864_100003365 | |||
| 1297 | Ga0068866_10026082 | |||
| 1298 | Ga0068866_10844471 | |||
| 1299 | Ga0068861_100348592 | |||
| 1300 | Ga0068861_100562321 | |||
| 1301 | Ga0068851_10039955 | |||
| 1302 | Ga0068851_10191675 | |||
| 1303 | Ga0068851_10453029 | |||
| 1304 | Ga0068870_10557119 | |||
| 1305 | Ga0068870_11226646 | |||
| 1306 | Ga0068863_100019241 | |||
| 1307 | Ga0068863_100084407 | |||
| 1308 | Ga0068863_100712758 | |||
| 1309 | Ga0068858_100006486 | |||
| 1310 | Ga0068858_100230516 | |||
| 1311 | Ga0068858_100246567 | |||
| 1312 | Ga0068860_100129134 | |||
| 1313 | Ga0068860_101010496 | |||
| 1314 | Ga0070717_10001333 | |||
| 1315 | Ga0070717_10001426 | |||
| 1316 | Ga0070717_10003705 | |||
| 1317 | Ga0070717_10008299 | |||
| 1318 | Ga0070717_10046652 | |||
| 1319 | Ga0070717_10049446 | |||
| 1320 | Ga0070717_10056923 | |||
| 1321 | Ga0070717_10088709 | |||
| 1322 | Ga0070717_10128957 | |||
| 1323 | Ga0070717_10132507 | |||
| 1324 | Ga0070717_10179465 | |||
| 1325 | Ga0070717_10211283 | |||
| 1326 | Ga0070717_10222163 | |||
| 1327 | Ga0070717_10284389 | |||
| 1328 | Ga0070717_10527251 | |||
| 1329 | Ga0070717_10695823 | |||
| 1330 | Ga0070717_10834496 | |||
| 1331 | Ga0070717_11860083 | |||
| 1332 | Ga0070715_10006489 | |||
| 1333 | Ga0070715_10085035 | |||
| 1334 | Ga0070715_10179960 | |||
| 1335 | Ga0070715_10221726 | |||
| 1336 | Ga0070716_100001005 | |||
| 1337 | Ga0070716_100037181 | |||
| 1338 | Ga0070716_100069884 | |||
| 1339 | Ga0070716_100078149 | |||
| 1340 | Ga0070716_100090519 | |||
| 1341 | Ga0070716_100105744 | |||
| 1342 | Ga0070716_100291682 | |||
| 1343 | Ga0070716_100345165 | |||
| 1344 | Ga0070716_100454433 | |||
| 1345 | Ga0070716_101062924 | |||
| 1346 | Ga0070716_101381015 | |||
| 1347 | Ga0070716_101493943 | |||
| 1348 | Ga0070712_100000484 | |||
| 1349 | Ga0070712_100001333 | |||
| 1350 | Ga0070712_100003916 | |||
| 1351 | Ga0070712_100005530 | |||
| 1352 | Ga0070712_100033370 | |||
| 1353 | Ga0070712_100046838 | |||
| 1354 | Ga0070712_100058391 | |||
| 1355 | Ga0070712_100121120 | |||
| 1356 | Ga0070712_100345353 | |||
| 1357 | Ga0097621_100000419 | |||
| 1358 | Ga0097621_100012574 | |||
| 1359 | Ga0097621_100098359 | |||
| 1360 | Ga0097621_100217927 | |||
| 1361 | Ga0068871_100000048 | |||
| 1362 | Ga0068871_100009029 | |||
| 1363 | Ga0068871_100442566 | |||
| 1364 | Ga0068871_101371423 | |||
| 1365 | Ga0068871_101483405 | |||
| 1366 | Ga0075433_10000909 | |||
| 1367 | Ga0075434_100000080 | |||
| 1368 | Ga0075434_100126946 | |||
| 1369 | Ga0075434_100674098 | |||
| 1370 | Ga0075434_102523806 | |||
| 1371 | Ga0075434_102590415 | |||
| 1372 | Ga0068865_100012958 | |||
| 1373 | Ga0068865_100027893 | |||
| 1374 | Ga0075436_100011564 | |||
| 1375 | Ga0075436_100030810 | |||
| 1376 | Ga0075436_100160688 | |||
| 1377 | Ga0075436_100164357 | |||
| 1378 | Ga0075436_100284314 | |||
| 1379 | Ga0075436_100411372 | |||
| 1380 | Ga0075436_100620095 | |||
| 1381 | Ga0097620_100010398 | |||
| 1382 | Ga0075435_100000142 | |||
| 1383 | Ga0075435_100035077 | |||
| 1384 | Ga0075435_100275162 | |||
| 1385 | Ga0075435_100611079 | |||
| 1386 | Ga0099794_10072326 | |||
| 1387 | Ga0099794_10785165 | |||
| 1388 | Ga0099795_10020473 | |||
| 1389 | Ga0099795_10051874 | |||
| 1390 | Ga0099795_10085923 | |||
| 1391 | Ga0099795_10600825 | |||
| 1392 | Ga0105240_10010692 | |||
| 1393 | Ga0105240_10034008 | |||
| 1394 | Ga0105240_10049650 | |||
| 1395 | Ga0105240_10076934 | |||
| 1396 | Ga0105240_10078613 | |||
| 1397 | Ga0105240_10104179 | |||
| 1398 | Ga0105240_10316011 | |||
| 1399 | Ga0105240_10316666 | |||
| 1400 | Ga0105240_10433691 | |||
| 1401 | Ga0105240_10489548 | |||
| 1402 | Ga0105240_11095868 | |||
| 1403 | Ga0105240_11233274 | |||
| 1404 | Ga0105245_10011029 | |||
| 1405 | Ga0105245_10013122 | |||
| 1406 | Ga0105245_10275573 | |||
| 1407 | Ga0105247_11178814 | |||
| 1408 | Ga0105247_11263125 | |||
| 1409 | Ga0114129_10446350 | |||
| 1410 | Ga0105241_10000878 | |||
| 1411 | Ga0105241_10015193 | |||
| 1412 | Ga0105241_10021165 | |||
| 1413 | Ga0105241_10045725 | |||
| 1414 | Ga0105241_10120354 | |||
| 1415 | Ga0105241_10184033 | |||
| 1416 | Ga0105241_10437936 | |||
| 1417 | Ga0105242_10265572 | |||
| 1418 | Ga0105242_10482920 | |||
| 1419 | Ga0105248_10034039 | |||
| 1420 | Ga0105248_10038402 | |||
| 1421 | Ga0105237_10060500 | |||
| 1422 | Ga0105237_10063320 | |||
| 1423 | Ga0105237_10077509 | |||
| 1424 | Ga0105237_10140681 | |||
| 1425 | Ga0105237_10181653 | |||
| 1426 | Ga0105237_11869011 | |||
| 1427 | Ga0105237_12444295 | |||
| 1428 | Ga0105237_12708944 | |||
| 1429 | Ga0105238_10000135 | |||
| 1430 | Ga0105238_10024741 | |||
| 1431 | Ga0105238_10256265 | |||
| 1432 | Ga0105238_10268289 | |||
| 1433 | Ga0105238_10630861 | |||
| 1434 | Ga0105238_10713395 | |||
| 1435 | Ga0105238_10733544 | |||
| 1436 | Ga0105238_11474565 | |||
| 1437 | Ga0105238_12192816 | |||
| 1438 | Ga0105249_10711375 | |||
| 1439 | Ga0099796_10090133 | |||
| 1440 | Ga0099796_10202795 | |||
| 1441 | Ga0099796_10303038 | |||
| 1442 | Ga0105239_10013061 | |||
| 1443 | Ga0105239_10025069 | |||
| 1444 | Ga0105239_10080657 | |||
| 1445 | Ga0105239_10086009 | |||
| 1446 | Ga0105239_10185996 | |||
| 1447 | Ga0105239_10254453 | |||
| 1448 | Ga0105239_10911621 | |||
| 1449 | Ga0105239_11070573 | |||
| 1450 | Ga0157326_1099490 | |||
| 1451 | Ga0157373_10001908 | |||
| 1452 | Ga0157373_10100205 | |||
| 1453 | Ga0157373_10182718 | |||
| 1454 | Ga0157373_10224199 | |||
| 1455 | Ga0157373_10278848 | |||
| 1456 | Ga0157373_10283303 | |||
| 1457 | Ga0157373_10529691 | |||
| 1458 | Ga0157371_10062056 | |||
| 1459 | Ga0157371_10873761 | |||
| 1460 | Ga0157370_10018270 | |||
| 1461 | Ga0157370_10096135 | |||
| 1462 | Ga0157370_10232465 | |||
| 1463 | Ga0157369_10000034 | |||
| 1464 | Ga0157369_10020521 | |||
| 1465 | Ga0157369_10028231 | |||
| 1466 | Ga0157369_10075478 | |||
| 1467 | Ga0157369_10095983 | |||
| 1468 | Ga0157369_10103642 | |||
| 1469 | Ga0157369_10107201 | |||
| 1470 | Ga0157369_10207016 | |||
| 1471 | Ga0157369_10244530 | |||
| 1472 | Ga0157369_10496461 | |||
| 1473 | Ga0157369_10672993 | |||
| 1474 | Ga0157369_10906248 | |||
| 1475 | Ga0157374_10000112 | |||
| 1476 | Ga0157374_10000183 | |||
| 1477 | Ga0157374_10000210 | |||
| 1478 | Ga0157374_10175254 | |||
| 1479 | Ga0157374_10277523 | |||
| 1480 | Ga0157374_10383774 | |||
| 1481 | Ga0157374_10641844 | |||
| 1482 | Ga0157378_10000107 | |||
| 1483 | Ga0157378_10000127 | |||
| 1484 | Ga0157378_10007947 | |||
| 1485 | Ga0157378_10026030 | |||
| 1486 | Ga0157378_10460498 | |||
| 1487 | Ga0157378_12347859 | |||
| 1488 | Ga0163162_10194520 | |||
| 1489 | Ga0163162_10247648 | |||
| 1490 | Ga0163162_10370841 | |||
| 1491 | Ga0163162_10382194 | |||
| 1492 | Ga0163162_11244368 | |||
| 1493 | Ga0157372_10000059 | |||
| 1494 | Ga0157372_10000153 | |||
| 1495 | Ga0157372_10002821 | |||
| 1496 | Ga0157372_10003843 | |||
| 1497 | Ga0157372_10010295 | |||
| 1498 | Ga0157372_10025802 | |||
| 1499 | Ga0157372_10042214 | |||
| 1500 | Ga0157372_10124432 | |||
| 1501 | Ga0157372_10213178 | |||
| 1502 | Ga0157372_10242206 | |||
| 1503 | Ga0157372_10268689 | |||
| 1504 | Ga0157372_10897677 | |||
| 1505 | Ga0157372_10938583 | |||
| 1506 | Ga0157372_10951001 | |||
| 1507 | Ga0157372_11406346 | |||
| 1508 | Ga0157372_11677067 | |||
| 1509 | Ga0157372_11698172 | |||
| 1510 | Ga0157372_12251814 | |||
| 1511 | Ga0157375_11180935 | |||
| 1512 | Ga0163163_10214386 | |||
| 1513 | Ga0182008_10432526 | |||
| 1514 | Ga0182008_10931855 | |||
| 1515 | Ga0157379_10857964 | |||
| 1516 | Ga0157376_10004651 | |||
| 1517 | Ga0157376_10346892 | |||
| 1518 | Ga0157376_10360164 | |||
| 1519 | Ga0157376_12845185 | |||
| 1520 | Ga0182006_1247657 | |||
| 1521 | Ga0182007_10006797 | |||
| 1522 | Ga0182007_10064398 | |||
| 1523 | Ga0182007_10208001 | |||
| 1524 | Ga0182005_1148284 | |||
| 1525 | Ga0197907_10258267 | |||
| 1526 | Ga0197907_10489849 | |||
| 1527 | Ga0197907_11396651 | |||
| 1528 | Ga0206356_10111165 | |||
| 1529 | Ga0206356_10630039 | |||
| 1530 | Ga0206356_10808840 | |||
| 1531 | Ga0206356_11024997 | |||
| 1532 | Ga0206356_11223647 | |||
| 1533 | Ga0206356_11349120 | |||
| 1534 | Ga0206349_1972346 | |||
| 1535 | Ga0206355_1392844 | |||
| 1536 | Ga0206352_10041766 | |||
| 1537 | Ga0206352_10267634 | |||
| 1538 | Ga0206352_10724634 | |||
| 1539 | Ga0206352_10859100 | |||
| 1540 | Ga0206352_11112670 | |||
| 1541 | Ga0206352_11299062 | |||
| 1542 | Ga0206350_10726275 | |||
| 1543 | Ga0206354_10857068 | |||
| 1544 | Ga0206353_10196849 | |||
| 1545 | Ga0213874_10334747 | |||
| 1546 | Ga0213875_10132854 | |||
| 1547 | Ga0224712_10367311 | |||
| 1548 | Ga0224712_10483769 | |||
| 1549 | Ga0228598_1120632 | |||
| 1550 | Ga0207656_10146100 | |||
| 1551 | Ga0207656_10207127 | |||
| 1552 | Ga0207692_10001123 | |||
| 1553 | Ga0207692_10176941 | |||
| 1554 | Ga0207692_10212072 | |||
| 1555 | Ga0207692_10275268 | |||
| 1556 | Ga0207692_10288771 | |||
| 1557 | Ga0207692_10290612 | |||
| 1558 | Ga0207692_10338443 | |||
| 1559 | Ga0207692_10796099 | |||
| 1560 | Ga0207647_10146704 | |||
| 1561 | Ga0207685_10013877 | |||
| 1562 | Ga0207685_10114675 | |||
| 1563 | Ga0207685_10164635 | |||
| 1564 | Ga0207685_10176975 | |||
| 1565 | Ga0207685_10375131 | |||
| 1566 | Ga0207699_10001179 | |||
| 1567 | Ga0207699_10013292 | |||
| 1568 | Ga0207699_10022387 | |||
| 1569 | Ga0207699_10036546 | |||
| 1570 | Ga0207699_10057913 | |||
| 1571 | Ga0207699_10130776 | |||
| 1572 | Ga0207699_10286630 | |||
| 1573 | Ga0207699_10545593 | |||
| 1574 | Ga0207699_11235177 | |||
| 1575 | Ga0207643_10033887 | |||
| 1576 | Ga0207643_10363483 | |||
| 1577 | Ga0207684_10000623 | |||
| 1578 | Ga0207684_10166148 | |||
| 1579 | Ga0207684_10274061 | |||
| 1580 | Ga0207684_10425921 | |||
| 1581 | Ga0207684_10473655 | |||
| 1582 | Ga0207684_10510815 | |||
| 1583 | Ga0207684_10617137 | |||
| 1584 | Ga0207684_11221622 | |||
| 1585 | Ga0207654_10078313 | |||
| 1586 | Ga0207654_10105154 | |||
| 1587 | Ga0207654_10485364 | |||
| 1588 | Ga0207707_10025137 | |||
| 1589 | Ga0207707_10035225 | |||
| 1590 | Ga0207707_10164179 | |||
| 1591 | Ga0207707_11017558 | |||
| 1592 | Ga0207707_11267719 | |||
| 1593 | Ga0207695_10044785 | |||
| 1594 | Ga0207695_10072295 | |||
| 1595 | Ga0207695_10108054 | |||
| 1596 | Ga0207695_10277788 | |||
| 1597 | Ga0207695_10497888 | |||
| 1598 | Ga0207695_10772142 | |||
| 1599 | Ga0207695_11114694 | |||
| 1600 | Ga0207671_10051401 | |||
| 1601 | Ga0207671_10492317 | |||
| 1602 | Ga0207693_10000022 | |||
| 1603 | Ga0207693_10000820 | |||
| 1604 | Ga0207693_10006127 | |||
| 1605 | Ga0207693_10010331 | |||
| 1606 | Ga0207693_10067882 | |||
| 1607 | Ga0207693_10081325 | |||
| 1608 | Ga0207693_10083803 | |||
| 1609 | Ga0207693_10114030 | |||
| 1610 | Ga0207693_10156541 | |||
| 1611 | Ga0207693_10541419 | |||
| 1612 | Ga0207693_11086680 | |||
| 1613 | Ga0207663_10003426 | |||
| 1614 | Ga0207663_10007954 | |||
| 1615 | Ga0207663_10017744 | |||
| 1616 | Ga0207663_10048932 | |||
| 1617 | Ga0207663_10069246 | |||
| 1618 | Ga0207663_10078040 | |||
| 1619 | Ga0207663_10106865 | |||
| 1620 | Ga0207663_10204076 | |||
| 1621 | Ga0207663_10270004 | |||
| 1622 | Ga0207663_10411491 | |||
| 1623 | Ga0207663_10879285 | |||
| 1624 | Ga0207663_11081640 | |||
| 1625 | Ga0207660_10050113 | |||
| 1626 | Ga0207660_10108862 | |||
| 1627 | Ga0207657_10003709 | |||
| 1628 | Ga0207649_10016068 | |||
| 1629 | Ga0207649_10668435 | |||
| 1630 | Ga0207652_10090651 | |||
| 1631 | Ga0207652_10159047 | |||
| 1632 | Ga0207652_10309414 | |||
| 1633 | Ga0207652_10444118 | |||
| 1634 | Ga0207652_10453034 | |||
| 1635 | Ga0207652_11096986 | |||
| 1636 | Ga0207652_11228525 | |||
| 1637 | Ga0207652_11286640 | |||
| 1638 | Ga0207646_10000332 | |||
| 1639 | Ga0207646_10124875 | |||
| 1640 | Ga0207646_10129566 | |||
| 1641 | Ga0207646_10421806 | |||
| 1642 | Ga0207646_10719702 | |||
| 1643 | Ga0207646_10826557 | |||
| 1644 | Ga0207694_10000722 | |||
| 1645 | Ga0207694_10209983 | |||
| 1646 | Ga0207694_10319482 | |||
| 1647 | Ga0207694_10367243 | |||
| 1648 | Ga0207694_10434452 | |||
| 1649 | Ga0207694_11207955 | |||
| 1650 | Ga0207694_11679204 | |||
| 1651 | Ga0207650_10022032 | |||
| 1652 | Ga0207650_10167627 | |||
| 1653 | Ga0207687_10004632 | |||
| 1654 | Ga0207687_10205345 | |||
| 1655 | Ga0207687_10319869 | |||
| 1656 | Ga0207700_10000056 | |||
| 1657 | Ga0207700_10002505 | |||
| 1658 | Ga0207700_10002969 | |||
| 1659 | Ga0207700_10008231 | |||
| 1660 | Ga0207700_10023517 | |||
| 1661 | Ga0207700_10122768 | |||
| 1662 | Ga0207700_10133720 | |||
| 1663 | Ga0207700_10205979 | |||
| 1664 | Ga0207700_10233400 | |||
| 1665 | Ga0207700_10301062 | |||
| 1666 | Ga0207700_10445806 | |||
| 1667 | Ga0207700_10561502 | |||
| 1668 | Ga0207700_10674488 | |||
| 1669 | Ga0207700_11015603 | |||
| 1670 | Ga0207700_11032128 | |||
| 1671 | Ga0207700_11494429 | |||
| 1672 | Ga0207664_10000143 | |||
| 1673 | Ga0207664_10002694 | |||
| 1674 | Ga0207664_10006310 | |||
| 1675 | Ga0207664_10058116 | |||
| 1676 | Ga0207664_10062318 | |||
| 1677 | Ga0207664_10092432 | |||
| 1678 | Ga0207664_10233448 | |||
| 1679 | Ga0207664_10591222 | |||
| 1680 | Ga0207664_10754918 | |||
| 1681 | Ga0207664_10880446 | |||
| 1682 | Ga0207664_10951437 | |||
| 1683 | Ga0207664_10951685 | |||
| 1684 | Ga0207664_11090869 | |||
| 1685 | Ga0207664_11122512 | |||
| 1686 | Ga0207664_11457714 | |||
| 1687 | Ga0207644_10627549 | |||
| 1688 | Ga0207644_10917472 | |||
| 1689 | Ga0207690_10027935 | |||
| 1690 | Ga0207690_10284908 | |||
| 1691 | Ga0207704_10016830 | |||
| 1692 | Ga0207704_10037395 | |||
| 1693 | Ga0207665_10003243 | |||
| 1694 | Ga0207665_10012455 | |||
| 1695 | Ga0207665_10023801 | |||
| 1696 | Ga0207665_10029343 | |||
| 1697 | Ga0207665_10037952 | |||
| 1698 | Ga0207665_10126198 | |||
| 1699 | Ga0207665_10216591 | |||
| 1700 | Ga0207665_10330875 | |||
| 1701 | Ga0207665_10338969 | |||
| 1702 | Ga0207665_10427054 | |||
| 1703 | Ga0207665_10607563 | |||
| 1704 | Ga0207665_10849103 | |||
| 1705 | Ga0207665_11448757 | |||
| 1706 | Ga0207711_10040765 | |||
| 1707 | Ga0207711_10178762 | |||
| 1708 | Ga0207689_10096804 | |||
| 1709 | Ga0207661_10020975 | |||
| 1710 | Ga0207661_10139192 | |||
| 1711 | Ga0207679_10001953 | |||
| 1712 | Ga0207679_10156552 | |||
| 1713 | Ga0207679_10500874 | |||
| 1714 | Ga0207679_10932731 | |||
| 1715 | Ga0207679_11031610 | |||
| 1716 | Ga0207667_10002755 | |||
| 1717 | Ga0207667_10003317 | |||
| 1718 | Ga0207667_10054522 | |||
| 1719 | Ga0207667_10745127 | |||
| 1720 | Ga0207667_10788137 | |||
| 1721 | Ga0207667_11802424 | |||
| 1722 | Ga0207651_10206832 | |||
| 1723 | Ga0207640_10017610 | |||
| 1724 | Ga0207640_10144889 | |||
| 1725 | Ga0207640_10199445 | |||
| 1726 | Ga0207640_10383377 | |||
| 1727 | Ga0207640_11373165 | |||
| 1728 | Ga0207640_11616205 | |||
| 1729 | Ga0207677_10054258 | |||
| 1730 | Ga0207677_10471857 | |||
| 1731 | Ga0207677_10474766 | |||
| 1732 | Ga0207677_10669469 | |||
| 1733 | Ga0207703_10004306 | |||
| 1734 | Ga0207703_10547565 | |||
| 1735 | Ga0207639_10064001 | |||
| 1736 | Ga0207639_10184246 | |||
| 1737 | Ga0207639_10244891 | |||
| 1738 | Ga0207678_10408916 | |||
| 1739 | Ga0207702_10000171 | |||
| 1740 | Ga0207702_10004667 | |||
| 1741 | Ga0207702_10005214 | |||
| 1742 | Ga0207702_10018480 | |||
| 1743 | Ga0207702_10033096 | |||
| 1744 | Ga0207702_10067499 | |||
| 1745 | Ga0207702_11893981 | |||
| 1746 | Ga0207641_10013876 | |||
| 1747 | Ga0207641_12201949 | |||
| 1748 | Ga0207648_10042480 | |||
| 1749 | Ga0207676_10008218 | |||
| 1750 | Ga0207674_10000126 | |||
| 1751 | Ga0207674_10000230 | |||
| 1752 | Ga0207674_10071474 | |||
| 1753 | Ga0207674_10140862 | |||
| 1754 | Ga0207675_101466147 | |||
| 1755 | Ga0207683_10917862 | |||
| 1756 | Ga0207698_10104365 | |||
| 1757 | Ga0207698_10213858 | |||
| 1758 | Ga0207698_10338953 | |||
| 1759 | Ga0207698_10923263 | |||
| 1760 | Ga0209179_1061338 | |||
| 1761 | Ga0209179_1109634 | |||
| 1762 | Ga0265354_1001518 | |||
| 1763 | Ga0265356_1005152 | |||
| 1764 | Ga0265356_1005696 | |||
| 1765 | Ga0265355_1009091 | |||
| 1766 | Ga0265355_1017696 | |||
| 1767 | Ga0268264_10327763 | |||
| 1768 | Ga0265336_10057607 | |||
| 1769 | Ga0265338_10000352 | |||
| 1770 | Ga0265338_10006522 | |||
| 1771 | Ga0265338_10019949 | |||
| 1772 | Ga0265338_10177218 | |||
| 1773 | Ga0265338_10220215 | |||
| 1774 | Ga0265324_10078795 | |||
| 1775 | Ga0265762_1000945 | |||
| 1776 | Ga0265762_1042491 | |||
| 1777 | Ga0265763_1026593 | |||
| 1778 | Ga0265770_1016019 | |||
| 1779 | Ga0265765_1046549 | |||
| 1780 | Ga0265760_10003368 | |||
| 1781 | Ga0265760_10005801 | |||
| 1782 | Ga0265760_10008109 | |||
| 1783 | Ga0265760_10009506 | |||
| 1784 | Ga0265760_10106178 | |||
| 1785 | Ga0265328_10028487 | |||
| 1786 | Ga0265325_10019838 | |||
| 1787 | Ga0265325_10204845 | |||
| 1788 | Ga0265329_10312938 | |||
| 1789 | Ga0265339_10013614 | |||
| 1790 | Ga0265339_10064430 | |||
| 1791 | Ga0265339_10085214 | |||
| 1792 | Ga0265331_10543433 | |||
| 1793 | Ga0265316_10013501 | |||
| 1794 | Ga0265316_10119372 | |||
| 1795 | Ga0307408_102339127 | |||
| 1796 | Ga0265314_10036059 | |||
| 1797 | Ga0265314_10045866 | |||
| 1798 | Ga0265314_10080354 | |||
| 1799 | Ga0265342_10531585 | |||
| 1800 | Ga0307412_12290455 | |||
| 1801 | Ga0373926_0001236 | |||
| 1802 | Ga0373926_0025756 | |||
| 1803 | Ga0373926_0106830 | |||
| 1804 | Ga0373926_0123847 | |||
| 1805 | Ga0373926_0193208 | |||
| 1806 | Ga0373934_0011542 | |||
| 1807 | Ga0373934_0054809 | |||
| 1808 | Ga0373944_0045162 | |||
| 1809 | Ga0373944_0288575 | |||
| 1810 | Ga0373952_0221025 | |||
| 1811 | Ga0373923_0026086 | |||
| 1812 | Ga0373923_0129846 | |||
| 1813 | Ga0373923_0135719 | |||
| 1814 | Ga0373923_0326499 | |||
| 1815 | Ga0373932_0305078 | |||
| 1816 | Ga0373936_0006487 | |||
| 1817 | Ga0373936_0022692 | |||
| 1818 | Ga0373936_0155606 | |||
| 1819 | Ga0373936_0262399 | |||
| 1820 | Ga0373945_0004750 | |||
| 1821 | Ga0373945_0006937 | |||
| 1822 | Ga0373945_0096911 | |||
| 1823 | Ga0373953_0012461 | |||
| 1824 | Ga0373953_0110008 | |||
| 1825 | Ga0373954_0013500 | |||
| 1826 | Ga0373954_0120039 | |||
| 1827 | Ga0373954_0136327 | |||
| 1828 | Ga0373956_0016495 | |||
| 1829 | Ga0373956_0069808 | |||
| 1830 | Ga0373956_0559702 | |||
| 1831 | Ga0373957_0083717 | |||
| 1832 | Ga0373957_0449661 | |||
| 1833 | Ga0373943_0000116 | |||
| 1834 | Ga0373943_0099992 | |||
| 1835 | Ga0373943_0539532 | |||
| 1836 | Ga0373946_0003133 | |||
| 1837 | Ga0373946_0034039 | |||
| 1838 | Ga0373946_0261240 | |||
| 1839 | Ga0373946_0720521 | |||
| 1840 | Ga0373955_0163711 | |||
| 1841 | Ga0373955_0348418 | |||
| 1842 | Ga0373955_0430828 | |||
| 1843 | Ga0373955_0498738 | |||
| 1844 | Ga0373955_0720616 | |||
| 1845 | Ga0373962_0269731 | |||
| 1846 | Ga0373924_0000483 | |||
| 1847 | Ga0373931_0443140 | |||
| 1848 | Ga0373935_0001975 | |||
| 1849 | Ga0373935_0003523 | |||
| 1850 | Ga0373935_0005149 | |||
| 1851 | Ga0373935_0027330 | |||
| 1852 | Ga0373935_0062488 | |||
| 1853 | Ga0373935_0105724 | |||
| 1854 | Ga0373935_0131229 | |||
| 1855 | Ga0373935_0562204 | |||
| 1856 | Ga0373935_1003184 | |||
| 1857 | Ga0373935_1252308 | |||
| 1858 | Ga0373927_0000118 | |||
| 1859 | Ga0373927_0022021 | |||
| 1860 | Ga0373927_0082888 | |||
| 1861 | Ga0373927_0303687 | |||
| 1862 | Ga0373927_0421912 | |||
| 1863 | Ga0373927_0588628 | |||
| 1864 | Ga0373933_0005233 | |||
| 1865 | Ga0373933_0045132 | |||
| 1866 | Ga0373933_0062768 | |||
| 1867 | Ga0373933_0112538 | |||
| 1868 | Ga0373933_0494507 | |||
| 1869 | Ga0373933_0695753 | |||
| 1870 | Ga0373933_0812244 | |||
| 1871 | Ga0373947_0004767 | |||
| 1872 | Ga0373947_0005481 | |||
| 1873 | Ga0373947_0006908 | |||
| 1874 | Ga0373947_0042147 | |||
| 1875 | Ga0373947_0097000 | |||
| 1876 | Ga0373947_0718345 | |||
| 1877 | Ga0373947_0928620 | |||
| 1878 | Ga0373937_0008419 | |||
| 1879 | Ga0373937_0242943 | |||
| 1880 | Ga0373937_0578759 | |||
| 1881 | Ga0373937_1051076 | |||
| 1882 | Ga0373937_1099843 | |||
| 1883 | Ga0373937_1461194 | |||
| 1884 | Ga0265778_007379 | |||
| 1885 | Ga0265778_014072 | |||
| 1886 | Ga0373925_0002638 | |||
| 1887 | Ga0373925_0059363 | |||
| 1888 | Ga0373925_0101439 | |||
| 1889 | Ga0373925_0101695 | |||
| 1890 | Ga0373925_0341080 | |||
| 1891 | Ga0373925_0395553 | |||
| 1892 | Ga0373925_0424803 | |||
| 1893 | Ga0373925_0819043 | |||
| 1894 | Ga0373925_1077903 | |||
| 1895 | Ga0373925_1209380 | |||
| 1896 | Ga0395900_0497151 | |||
| 1897 | Ga0395900_0646194 | |||
| 1898 | Ga0395905_0014337 | |||
| 1899 | Ga0395905_0425490 | |||
| 1900 | Ga0395905_0429496 | |||
| 1901 | Ga0395905_0585323 | |||
| 1902 | Ga0395905_1154890 | |||
| 1903 | Ga0395905_1195284 | |||
| 1904 | Ga0436364_0718644 | |||
| 1905 | Ga0436364_1209441 | |||
| 1906 | Ga0395901_1229128 | |||
| 1907 | Ga0395901_1330092 | |||
| 1908 | Ga0436365_1285273 | |||
| 1909 | Ga0436361_0473294 | |||
| 1910 | Ga0436363_0339936 | |||
| 1911 | Ga0436363_0644164 | |||
| 1912 | Ga0436363_1175243 | |||
| 1913 | Ga0436363_1451564 | |||
| 1914 | Ga0436362_0380443 | |||
| 1915 | Ga0436362_0484552 | |||
| 1916 | Ga0451839_0359763 | |||
| 1917 | Ga0451577_0529712 | |||
| 1918 | Ga0466963_0103799 | |||
| 1919 | Ga0466963_0172440 | |||
| 1920 | Ga0466964_0161003 | |||
| 1921 | Ga0466964_0500467 | |||
| 1922 | Ga0466971_0024151 | |||
| 1923 | Ga0466968_0305491 | |||
| 1924 | Ga0466970_0397342 | |||
| 1925 | Ga0466957_0191541 | |||
| 1926 | Ga0466959_0807034 | |||
| 1927 | Ga0451576_0054004 | |||
| 1928 | Ga0451576_0386136 | |||
| 1929 | Ga0451576_0471234 | |||
| 1930 | Ga0451576_0780898 | |||
| 1931 | Ga0466967_0007474 | |||
| 1932 | Ga0466967_0016737 | |||
| 1933 | Ga0466967_0611165 | |||
| 1934 | Ga0466967_1704533 | |||
| 1935 | Ga0466967_2485015 | |||
| 1936 | Ga0495592_0235602 | |||
| 1937 | Ga0495629_0003956 | |||
| 1938 | Ga0495629_1134695 | |||
| 1939 | Ga0495641_0357020 | |||
| 1940 | Ga0495651_0431524 | |||
| 1941 | Ga0495651_0879568 | |||
| 1942 | Ga0495653_0428294 | |||
| 1943 | Ga0495580_0000255 | |||
| 1944 | Ga0495580_0001135 | |||
| 1945 | Ga0495580_0001634 | |||
| 1946 | Ga0495580_0010770 | |||
| 1947 | Ga0495580_0033759 | |||
| 1948 | Ga0495580_0062917 | |||
| 1949 | Ga0495580_0306287 | |||
| 1950 | Ga0495580_0326981 | |||
| 1951 | Ga0495580_0368086 | |||
| 1952 | Ga0495580_0435194 | |||
| 1953 | Ga0495580_0518614 | |||
| 1954 | Ga0495580_0581816 | |||
| 1955 | Ga0495580_0736943 | |||
| 1956 | Ga0495582_0001022 | |||
| 1957 | Ga0495582_0001816 | |||
| 1958 | Ga0495582_0226426 | |||
| 1959 | Ga0495582_0759083 | |||
| 1960 | Ga0495639_0251700 | |||
| 1961 | Ga0495662_0398782 | |||
| 1962 | Ga0495664_0020430 | |||
| 1963 | Ga0495608_0025414 | |||
| 1964 | Ga0495618_0260908 | |||
| 1965 | Ga0495628_0414596 | |||
| 1966 | Ga0495630_0030815 | |||
| 1967 | Ga0495630_0076895 | |||
| 1968 | Ga0495630_0096649 | |||
| 1969 | Ga0495630_0342821 | |||
| 1970 | Ga0495630_0387194 | |||
| 1971 | Ga0495630_0524083 | |||
| 1972 | Ga0495666_0048033 | |||
| 1973 | Ga0495652_0715787 | |||
| 1974 | Ga0495665_0005508 | |||
| 1975 | Ga0495665_0098371 | |||
| 1976 | Ga0495665_0252979 | |||
| 1977 | Ga0495665_0266815 | |||
| 1978 | Ga0495665_0407163 | |||
| 1979 | Ga0495587_0281053 | |||
| 1980 | Ga0495645_0304571 | |||
| 1981 | Ga0495667_0174953 | |||
| 1982 | Ga0495634_0277964 | |||
| 1983 | Ga0495635_0273787 | |||
| 1984 | Ga0495635_0375526 | |||
| 1985 | Ga0495588_0250991 | |||
| 1986 | Ga0495599_0178262 | |||
| 1987 | Ga0495623_0341322 | |||
| 1988 | Ga0495646_0464353 | |||
| 1989 | Ga0495647_0235750 | |||
| 1990 | Ga0495658_0062032 | |||
| 1991 | Ga0495658_0075217 | |||
| 1992 | Ga0495669_0010544 | |||
| 1993 | Ga0495669_0059144 | |||
| 1994 | Ga0495669_0387493 | |||
| 1995 | Ga0495613_1094769 | |||
| 1996 | Ga0495624_0475268 | |||
| 1997 | Ga0495581_0019223 | |||
| 1998 | Ga0495581_0530835 | |||
| 1999 | Ga0495604_0049079 | |||
| 2000 | Ga0495604_0504684 | |||
| 2001 | Ga0495674_0004353 | |||
| 2002 | Ga0495674_0006067 | |||
| 2003 | Ga0495674_0105039 | |||
| 2004 | Ga0495674_0389182 | |||
| 2005 | Ga0495674_1381332 | |||
| 2006 | Ga0495675_0249749 | |||
| 2007 | Ga0495675_0407349 | |||
| 2008 | Ga0495684_0307611 | |||
| 2009 | Ga0495684_0634418 | |||
| 2010 | Ga0495593_0368187 | |||
| 2011 | Ga0495602_0081476 | |||
| 2012 | Ga0495602_0112020 | |||
| 2013 | Ga0495602_0143062 | |||
| 2014 | Ga0495602_0343977 | |||
| 2015 | Ga0495602_0368486 | |||
| 2016 | Ga0495614_0061167 | |||
| 2017 | Ga0495614_0106381 | |||
| 2018 | Ga0495614_0427314 | |||
| 2019 | Ga0495615_0113748 | |||
| 2020 | Ga0496100_0937086 | |||
| 2021 | Ga0496101_0408315 | |||
| 2022 | Ga0496102_0031359 | |||
| 2023 | Ga0496102_0095643 | |||
| 2024 | Ga0496102_0214053 | |||
| 2025 | Ga0496102_0542778 | |||
| 2026 | Ga0496103_0073409 | |||
| 2027 | Ga0496104_0080282 | |||
| 2028 | Ga0496104_0085102 | |||
| 2029 | Ga0496104_0089105 | |||
| 2030 | Ga0496104_0156736 | |||
| 2031 | Ga0496104_0518680 | |||
| 2032 | Ga0496104_1774138 | |||
| 2033 | Ga0496105_0015430 | |||
| 2034 | Ga0496106_0185479 | |||
| 2035 | Ga0496106_0792120 | |||
| 2036 | Ga0496108_1149981 | |||
| 2037 | Ga0496109_0346838 | |||
| 2038 | Ga0496110_0188264 | |||
| 2039 | Ga0496110_0640156 | |||
| 2040 | Ga0496111_0010026 | |||
| 2041 | Ga0496111_0091884 | |||
| 2042 | Ga0496112_0004567 | |||
| 2043 | Ga0496112_0007155 | |||
| 2044 | Ga0496112_0013968 | |||
| 2045 | Ga0496112_0041580 | |||
| 2046 | Ga0496112_0137029 | |||
| 2047 | Ga0496112_0249350 | |||
| 2048 | Ga0496112_0348844 | |||
| 2049 | Ga0496112_0350265 | |||
| 2050 | Ga0496112_0380131 | |||
| 2051 | Ga0496113_0509075 | |||
| 2052 | Ga0496113_0510042 | |||
| 2053 | Ga0496113_1108204 | |||
| 2054 | Ga0496113_1163118 | |||
| 2055 | Ga0496114_0058677 | |||
| 2056 | Ga0496115_0050088 | |||
| 2057 | Ga0496115_0052541 | |||
| 2058 | Ga0501067_0282572 | |||
| 2059 | nmdc:mga05p37_302135_c2 | |||
| 2060 | nmdc:mga0n895_125_c1 | |||
| 2061 | nmdc:mga0n895_2069452_c1 | |||
| 2062 | nmdc:mga0n895_275082_c1 | |||
| 2063 | nmdc:mga0n895_304338_c1 | |||
| 2064 | nmdc:mga0rr50_1046767_c1 | |||
| 2065 | nmdc:mga0rr50_1357_c1 | |||
| 2066 | nmdc:mga0rr50_248633_c1 | |||
| 2067 | nmdc:mga0rr50_43383_c1 | |||
| 2068 | nmdc:mga08x19_1090877_c1 | |||
| 2069 | nmdc:mga08x19_16026_c1 | |||
| 2070 | nmdc:mga08x19_404993_c1 | |||
| 2071 | nmdc:mga08x19_8698_c1 | |||
| 2072 | nmdc:mga08x19_930998_c1 | |||
| 2073 | nmdc:mga0a205_5864_c2 | |||
| 2074 | Ga0495601_0013413 | |||
| 2075 | Ga0495612_0208189 | |||
| 2076 | Ga0495619_0300888 | |||
| 2077 | Ga0495619_0994372 | |||
| 2078 | Ga0587084_098213 | |||
| 2079 | Ga0587084_113935 | |||
| 2080 | Ga0587084_133480 | |||
| 2081 | Ga0587093_028989 | |||
| 2082 | Ga0587093_046910 | |||
| 2083 | Ga0587093_068845 | |||
| 2084 | Ga0587093_070759 | |||
| 2085 | Ga0587066_079374 | |||
| 2086 | Ga0587066_130047 | |||
| 2087 | Ga0587066_149219 | |||
| 2088 | Ga0587070_139553 | |||
| 2089 | Ga0587070_143576 | |||
| 2090 | Ga0587070_169979 | |||
| 2091 | Ga0587073_0007548 | |||
| 2092 | Ga0587073_0129917 | |||
| 2093 | Ga0587073_0160074 | |||
| 2094 | Ga0587073_0180238 | |||
| 2095 | Ga0587073_0191234 | |||
| 2096 | Ga0587077_050473 | |||
| 2097 | Ga0587077_121989 | |||
| 2098 | Ga0587077_143784 | |||
| 2099 | Ga0587077_164388 | |||
| 2100 | Ga0587080_065871 | |||
| 2101 | Ga0587080_076606 | |||
| 2102 | Ga0587080_096507 | |||
| 2103 | Ga0587082_113382 | |||
| 2104 | Ga0587082_123510 | |||
| 2105 | Ga0587083_0014707 | |||
| 2106 | Ga0587083_0156400 | |||
| 2107 | Ga0587083_0163281 | |||
| 2108 | Ga0587083_0183023 | |||
| 2109 | Ga0587085_037629 | |||
| 2110 | Ga0587085_105429 | |||
| 2111 | Ga0587085_143427 | |||
| 2112 | Ga0587089_096014 | |||
| 2113 | Ga0587090_085290 | |||
| 2114 | Ga0587090_145262 | |||
| 2115 | Ga0587091_149355 | |||
| 2116 | Ga0587091_168689 | |||
| 2117 | Ga0587091_171792 | |||
| 2118 | Ga0587092_033196 | |||
| 2119 | Ga0587094_084308 | |||
| 2120 | Ga0587094_120556 | |||
| 2121 | Ga0587106_106111 | |||
| 2122 | Ga0587101_025561 | |||
| 2123 | Ga0587109_114410 | |||
| 2124 | Ga0587109_207847 | |||
| 2125 | Ga0587115_068359 | |||
| 2126 | Ga0587117_088028 | |||
| 2127 | Ga0587128_067268 | |||
| 2128 | Ga0587128_082072 | |||
| 2129 | Ga0587062_084764 | |||
| 2130 | Ga0587067_035591 | |||
| 2131 | Ga0587067_135907 | |||
| 2132 | Ga0587067_166785 | |||
| 2133 | Ga0587068_099892 | |||
| 2134 | Ga0587069_037866 | |||
| 2135 | Ga0587069_060283 | |||
| 2136 | Ga0587075_044054 | |||
| 2137 | Ga0587075_068044 | |||
| 2138 | Ga0587075_098467 | |||
| 2139 | Ga0587076_077715 | |||
| 2140 | Ga0587076_087046 | |||
| 2141 | Ga0587076_095291 | |||
| 2142 | Ga0587078_033426 | |||
| 2143 | Ga0587078_046621 | |||
| 2144 | Ga0587078_051963 | |||
| 2145 | Ga0587078_052777 | |||
| 2146 | Ga0587079_033473 | |||
| 2147 | Ga0587079_062609 | |||
| 2148 | Ga0587079_185899 | |||
| 2149 | Ga0587102_044607 | |||
| 2150 | Ga0587102_045586 | |||
| 2151 | Ga0587107_029582 | |||
| 2152 | Ga0587119_055081 | |||
| 2153 | Ga0587119_065862 | |||
| 2154 | Ga0587060_036802 | |||
| 2155 | Ga0587071_046728 | |||
| 2156 | Ga0587071_144394 | |||
| 2157 | Ga0587071_179176 | |||
| 2158 | Ga0587111_0064732 | |||
| 2159 | Ga0587111_0141020 | |||
| 2160 | Ga0466962_0037678 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy