F489646

General Info

Members Datasets Scaffolds Average Seq Length
1079 676 822 289

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0036611|Ga0373927_0036611_1951_3030
Length 345
Sequence MRRLSWLVVLALVAMAPRAQADDRLNVVASFSILGDFVRNVGGDRVNVTTLVGPNSDAHVYEPTPADARKIADATRVIVNGLGLEGWLPRLVKAAGGKAIIITATSGIAPLKLGSGADPHAWQSVVNAKTYVTNIRDALIAADSAGAEAFRANAQNYLARLDALDREVHEAVGKIPAAHRKVISTHRAFGYFAAAYGIEFIAPLGVSTESEPSARDVAGIITQIRQAKIPAIFLENISDPRLIQRIAADTGARIGGTLYSDSLTAEKGEAPTYIDMVRHNIKALTSALAKQGPPCRVECLPSSARSCYARSFCLKNPRDRADGLSRRRQDHAAQPHPVGKPRQEQ

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
9 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
10 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
11 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
12 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
13 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
14 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
15 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
16 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
17 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
18 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
19 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
20 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
21 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
22 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
23 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
24 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
25 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
26 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
27 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
28 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
29 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
30 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
31 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
32 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
33 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
34 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
35 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
36 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
37 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
38 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
39 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
40 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
41 2643221651 Afipia sp. Root123D2 Isolate Unclassified
42 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
43 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
44 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
45 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
46 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
47 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
48 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
49 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
50 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
51 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
52 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
53 2791355199
54 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
55 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
56 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
57 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
58 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
59 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
60 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
61 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
62 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
63 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
64 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
65 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
66 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
67 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
68 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
69 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
70 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
71 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
72 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
73 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
74 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
75 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
76 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
77 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
78 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
79 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
80 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
81 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
82 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
83 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
84 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
85 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
86 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
87 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
88 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
89 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
90 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
91 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
92 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
93 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
94 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
95 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
96 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
97 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
98 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
99 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
100 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
101 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
102 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
103 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
104 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
105 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
106 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
107 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
108 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
109 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
110 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
111 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
112 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
113 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
114 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
115 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
116 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
117 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
118 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
119 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
120 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
121 2904456579 Variovorax sp. 2002 Isolate Unclassified
122 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
123 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
124 2904699407
125 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
126 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
127 2906610324
128 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
129 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
130 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
131 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
132 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
133 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
134 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
135 2922368715
136 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
137 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
138 2922425934
139 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
140 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
141 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
142 2929520902 Variovorax beijingensis 502 Isolate Unclassified
143 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
144 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
145 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
146 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
147 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
148 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
149 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
150 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
151 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
152 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
153 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
154 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
155 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
156 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
157 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
158 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
159 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
160 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
161 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
162 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
163 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
164 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
165 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
166 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
167 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
168 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
169 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
170 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
171 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
172 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
173 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
174 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
175 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
176 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
177 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
178 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
179 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
180 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
181 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
182 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
183 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
184 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
185 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
186 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
187 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
188 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
189 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
190 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
191 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
192 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
193 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
194 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
195 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
196 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
197 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
198 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
199 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
200 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
201 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
202 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
203 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
204 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
205 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
206 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
207 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
208 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
209 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
210 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
211 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
212 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
213 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
214 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
215 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
216 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
217 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
218 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
219 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
220 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
221 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
222 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
223 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
224 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
225 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
226 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
227 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
228 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
229 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
230 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
231 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
232 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
233 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
234 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
235 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
236 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
237 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
238 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
239 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
240 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
241 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
242 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
243 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
244 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
245 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
246 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
247 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
248 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
249 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
250 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
251 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
252 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
253 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
254 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
255 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
256 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
257 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
258 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
259 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
260 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
261 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
262 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
263 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
264 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
265 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
266 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
267 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
268 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
269 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
270 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
271 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
272 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
273 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
274 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
275 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
276 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
277 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
278 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
279 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
280 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
281 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
282 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
283 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
284 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
285 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
286 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
287 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
288 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
289 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
290 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
291 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
292 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
293 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
294 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
295 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
296 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
297 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
298 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
299 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
300 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
301 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
302 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
303 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
304 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
305 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
306 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
307 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
308 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
309 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
310 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
311 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
312 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
313 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
314 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
315 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
316 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
317 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
318 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
319 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
320 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
321 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
322 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
323 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
324 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
325 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
326 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
327 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
328 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
329 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
330 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
331 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
332 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
333 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
334 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
335 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
336 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
337 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
338 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
339 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
340 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
341 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
342 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
343 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
344 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
345 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
346 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
351 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
352 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
354 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
356 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
357 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
358 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
359 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
411 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
412 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
413 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
414 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
415 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
419 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
420 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
421 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
422 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
423 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
424 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
425 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
426 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
427 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
428 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
429 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
430 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
431 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
432 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
433 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
434 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
435 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
436 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
437 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
438 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
439 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
440 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
441 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
442 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
443 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
444 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
445 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
446 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
447 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
448 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
449 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
450 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
451 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
452 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
453 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
454 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
455 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
456 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
457 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
458 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
459 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
460 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
461 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
462 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
463 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
464 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
465 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
466 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
467 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
468 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
469 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
470 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
471 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
472 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
473 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
474 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
475 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
476 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
477 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
478 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
479 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
480 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
481 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
482 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
483 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
484 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
485 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
486 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
487 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
488 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
489 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
490 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
491 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
492 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
493 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
494 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
495 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
496 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
497 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
498 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
499 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
500 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
501 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
502 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
503 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
504 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
505 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
506 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
507 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
508 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
509 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
510 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
511 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
512 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
513 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
514 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
515 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
516 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
517 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
518 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
519 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
520 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
521 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
522 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
523 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
524 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
525 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
526 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
527 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
528 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
529 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
530 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
531 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
532 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
533 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
534 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
535 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
536 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
537 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
538 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
539 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
540 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
541 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
542 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
543 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
544 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
545 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
546 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
547 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
548 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
549 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
550 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
551 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
552 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
553 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
554 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
555 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
556 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
557 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
558 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
559 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
560 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
561 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
562 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
563 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
564 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
565 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
566 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
567 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
568 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
569 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
570 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
571 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
572 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
573 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
574 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
575 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
576 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
577 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
578 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
579 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
580 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
581 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
582 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
583 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
584 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
585 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
586 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
587 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
588 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
589 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
590 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
591 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
592 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
593 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
594 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
595 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
596 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
597 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
598 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
599 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
600 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
601 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
602 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
603 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
604 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
605 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
606 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
607 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
608 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
609 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
610 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
611 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
612 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
613 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
614 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
615 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
616 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
617 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
618 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
619 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
620 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
621 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
622 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
623 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
624 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
625 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
626 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
627 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
628 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
629 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
630 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
631 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
632 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
633 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
634 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
635 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
636 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
637 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
638 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
639 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
640 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
641 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
642 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
643 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
644 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
645 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
646 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
647 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
648 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
649 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
650 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
651 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
652 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
653 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
654 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
655 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
656 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
657 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
658 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
659 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
660 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
661 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
662 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
663 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
664 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
665 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
666 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
667 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
668 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
669 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
670 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
671 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
672 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
673 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
674 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
675 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
676 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.44
Metatranscriptomes 0.09
Isolates 23.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.42
Nodule 16.13
Rhizoplane 6.49
Rhizosphere 51.07
Stem 0
Stem Tuber 0.09
Unclassified 13.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1005484 3300001915 Bacteria 2642
2 JGI24739J22299_10004386 3300001989 Bacteria 5402
3 JGI24737J22298_10026694 3300001990 Bacteria 1823
4 JGI24735J21928_10029987 3300002067 Bacteria 1617
5 JGI25154J39366_1004166 3300002738 Bacteria 2689
6 JGI25165J46597_1008266 3300003214 Bacteria 1646
7 JGI25165J46597_1009827 3300003214 Bacteria 1420
8 JGI25165J46597_1009894 3300003214 Bacteria 1411
9 JGI25153J46596_10009118 3300003215 Bacteria 4652
10 JGI25153J46596_10013220 3300003215 Bacteria 3505
11 JGI25153J46596_10029846 3300003215 Bacteria 1865
12 rootH2_10345235 3300003320 Bacteria 1331
13 rootL2_10124449 3300003322 Bacteria 1124
14 Ga0006562J51391_1119272 3300003578 Bacteria 1834
15 JGI25404J52841_10010825 3300003659 Bacteria 1962
16 Ga0055538_1000012 3300003751 Bacteria 353826
17 Ga0055539_1000017 3300003752 Bacteria 353873
18 Ga0055533_1000021 3300003756 Bacteria 353826
19 Ga0055532_1000020 3300003758 Bacteria 270853
20 Ga0055525_1000078 3300003759 Bacteria 165788
21 Ga0055540_1001304 3300003792 Bacteria 15079
22 Ga0055541_1000012 3300003841 Bacteria 353826
23 Ga0065165_1003123 3300005262 Bacteria 12280
24 Ga0065165_1007216 3300005262 Bacteria 5539
25 Ga0065165_1010731 3300005262 Bacteria 3914
26 Ga0065165_1033623 3300005262 Bacteria 1594
27 Ga0065714_10004573 3300005288 Bacteria 4748
28 Ga0065704_10088231 3300005289 Bacteria 2956
29 Ga0070658_10145326 3300005327 Bacteria 1983
30 Ga0070683_100058153 3300005329 Bacteria 3592
31 Ga0070670_100000141 3300005331 Bacteria 67499
32 Ga0070670_100223142 3300005331 Bacteria 1640
33 Ga0068869_100177413 3300005334 Bacteria 1668
34 Ga0070666_10116344 3300005335 Bacteria 1852
35 Ga0070680_100007323 3300005336 Bacteria 8416
36 Ga0070680_100251951 3300005336 Bacteria 1493
37 Ga0070682_100101303 3300005337 Bacteria 1902
38 Ga0068868_100219698 3300005338 Bacteria 1590
39 Ga0070660_100003353 3300005339 Bacteria 11009
40 Ga0070689_100017936 3300005340 Bacteria 5204
41 Ga0070689_100397977 3300005340 Bacteria 1163
42 Ga0070661_100029726 3300005344 Bacteria 3945
43 Ga0070668_100103430 3300005347 Bacteria 2259
44 Ga0070668_100116316 3300005347 Bacteria 2132
45 Ga0070668_100399295 3300005347 Bacteria 1173
46 Ga0070668_100448652 3300005347 Bacteria 1108
47 Ga0070669_100238436 3300005353 Bacteria 1444
48 Ga0070675_100309043 3300005354 Bacteria 1394
49 Ga0070671_100241802 3300005355 Bacteria 1532
50 Ga0070671_100387593 3300005355 Bacteria 1194
51 Ga0070688_100145669 3300005365 Bacteria 1613
52 Ga0070659_100043428 3300005366 Bacteria 3515
53 Ga0070659_100349769 3300005366 Bacteria 1240
54 Ga0070667_100163338 3300005367 Bacteria 1963
55 Ga0070709_10004499 3300005434 Bacteria 7521
56 Ga0070709_10016287 3300005434 Bacteria 4242
57 Ga0070714_100032403 3300005435 Bacteria 4361
58 Ga0070713_100024272 3300005436 Bacteria 4721
59 Ga0070713_100097488 3300005436 Bacteria 2540
60 Ga0070713_100228196 3300005436 Bacteria 1692
61 Ga0070710_10003046 3300005437 Bacteria 7964
62 Ga0070710_10039645 3300005437 Bacteria 2592
63 Ga0070711_100010406 3300005439 Bacteria 5756
64 Ga0070663_100007241 3300005455 Bacteria 6742
65 Ga0070663_100160637 3300005455 Bacteria 1729
66 Ga0070663_100166983 3300005455 Bacteria 1698
67 Ga0070663_100174728 3300005455 Bacteria 1662
68 Ga0070678_100202136 3300005456 Bacteria 1640
69 Ga0070678_100255989 3300005456 Bacteria 1470
70 Ga0070662_100026265 3300005457 Bacteria 4031
71 Ga0070662_100121049 3300005457 Bacteria 2006
72 Ga0070681_10033490 3300005458 Bacteria 5158
73 Ga0070685_10175818 3300005466 Bacteria 1375
74 Ga0070699_100382184 3300005518 Bacteria 1271
75 Ga0070679_100075614 3300005530 Bacteria 3357
76 Ga0070679_100377415 3300005530 Bacteria 1364
77 Ga0070679_100613690 3300005530 Bacteria 1031
78 Ga0070684_100006286 3300005535 Bacteria 9176
79 Ga0070684_100025288 3300005535 Bacteria 4989
80 Ga0068853_100001496 3300005539 Bacteria 16976
81 Ga0068853_100026288 3300005539 Bacteria 4887
82 Ga0068853_100269755 3300005539 Bacteria 1567
83 Ga0068853_100368008 3300005539 Bacteria 1340
84 Ga0070665_100105477 3300005548 Bacteria 2820
85 Ga0070665_100155549 3300005548 Bacteria 2288
86 Ga0070665_100367819 3300005548 Bacteria 1444
87 Ga0070665_100499631 3300005548 Bacteria 1227
88 Ga0070704_100192822 3300005549 Bacteria 1639
89 Ga0070704_100241846 3300005549 Bacteria 1477
90 Ga0068855_100031854 3300005563 Bacteria 6294
91 Ga0068855_100256651 3300005563 Bacteria 1949
92 Ga0068855_100300260 3300005563 Bacteria 1778
93 Ga0068855_100376434 3300005563 Bacteria 1560
94 Ga0070664_100503876 3300005564 Bacteria 1116
95 Ga0068857_100004210 3300005577 Bacteria 12119
96 Ga0068857_100056749 3300005577 Bacteria 3475
97 Ga0068857_100060787 3300005577 Bacteria 3356
98 Ga0068854_100008298 3300005578 Bacteria 6670
99 Ga0068854_100017829 3300005578 Bacteria 4758
100 Ga0068854_100061411 3300005578 Bacteria 2722
101 Ga0068856_100006410 3300005614 Bacteria 11545
102 Ga0068856_100019463 3300005614 Bacteria 6589
103 Ga0068856_100077437 3300005614 Bacteria 3295
104 Ga0068856_100547953 3300005614 Bacteria 1178
105 Ga0070702_100275930 3300005615 Bacteria 1152
106 Ga0068852_100016237 3300005616 Bacteria 5800
107 Ga0068852_100326120 3300005616 Bacteria 1492
108 Ga0068852_100448092 3300005616 Bacteria 1277
109 Ga0068859_100135138 3300005617 Bacteria 2539
110 Ga0068859_100164271 3300005617 Bacteria 2299
111 Ga0068859_100178873 3300005617 Bacteria 2203
112 Ga0068864_100133624 3300005618 Bacteria 2232
113 Ga0068864_100487779 3300005618 Bacteria 1184
114 Ga0068866_10093974 3300005718 Bacteria 1639
115 Ga0068861_100170496 3300005719 Bacteria 1803
116 Ga0068861_100489562 3300005719 Bacteria 1109
117 Ga0068851_10011168 3300005834 Bacteria 4206
118 Ga0068863_100406296 3300005841 Bacteria 1332
119 Ga0068858_100334100 3300005842 Bacteria 1449
120 Ga0068858_100400955 3300005842 Bacteria 1318
121 Ga0068858_100511700 3300005842 Bacteria 1160
122 Ga0068860_100003385 3300005843 Bacteria 16406
123 Ga0068862_100145350 3300005844 Bacteria 2107
124 Ga0081538_10036555 3300005981 Bacteria 3202
125 Ga0081540_1004705 3300005983 Bacteria 10327
126 Ga0081540_1005016 3300005983 Bacteria 9944
127 Ga0081540_1005578 3300005983 Bacteria 9373
128 Ga0081540_1005788 3300005983 Bacteria 9148
129 Ga0081540_1006936 3300005983 Bacteria 8165
130 Ga0081540_1010271 3300005983 Bacteria 6356
131 Ga0081540_1015887 3300005983 Bacteria 4745
132 Ga0081540_1031359 3300005983 Bacteria 2924
133 Ga0081540_1041746 3300005983 Bacteria 2375
134 Ga0081540_1066406 3300005983 Bacteria 1691
135 Ga0081539_10039667 3300005985 Bacteria 2775
136 Ga0070717_10023806 3300006028 Bacteria 4857
137 Ga0070717_10105321 3300006028 Bacteria 2401
138 Ga0070717_10119675 3300006028 Bacteria 2255
139 Ga0075365_10146416 3300006038 Bacteria 1641
140 Ga0075365_10151624 3300006038 Bacteria 1612
141 Ga0075365_10184513 3300006038 Bacteria 1459
142 Ga0075368_10012299 3300006042 Bacteria 3125
143 Ga0075368_10041629 3300006042 Bacteria 1805
144 Ga0075368_10068758 3300006042 Bacteria 1427
145 Ga0075363_100004089 3300006048 Bacteria 6322
146 Ga0075364_10253173 3300006051 Bacteria 1197
147 Ga0070716_100010967 3300006173 Bacteria 4559
148 Ga0070716_100079528 3300006173 Bacteria 1952
149 Ga0070716_100081468 3300006173 Bacteria 1933
150 Ga0070712_100028666 3300006175 Bacteria 3726
151 Ga0070712_100248704 3300006175 Bacteria 1419
152 Ga0070712_100405837 3300006175 Bacteria 1126
153 Ga0075367_10022959 3300006178 Bacteria 3505
154 Ga0075367_10051061 3300006178 Bacteria 2443
155 Ga0075367_10113608 3300006178 Bacteria 1664
156 Ga0075367_10131776 3300006178 Bacteria 1545
157 Ga0075367_10202456 3300006178 Bacteria 1240
158 Ga0075366_10112604 3300006195 Bacteria 1637
159 Ga0075434_100244652 3300006871 Bacteria 1814
160 Ga0068865_100057630 3300006881 Bacteria 2711
161 Ga0097620_100135137 3300006931 Bacteria 2539
162 Ga0097620_100164286 3300006931 Bacteria 2299
163 Ga0097620_100178880 3300006931 Bacteria 2203
164 Ga0099824_1008875 3300006942 Bacteria 12635
165 Ga0099824_1023890 3300006942 Bacteria 3695
166 Ga0099822_1017500 3300006943 Bacteria 7646
167 Ga0099794_10043155 3300007265 Bacteria 2152
168 Ga0105244_10003428 3300009036 Bacteria 11304
169 Ga0105240_10009125 3300009093 Bacteria 14079
170 Ga0105240_10014685 3300009093 Bacteria 10686
171 Ga0105240_10046064 3300009093 Bacteria 5528
172 Ga0105240_10095537 3300009093 Bacteria 3624
173 Ga0105240_10538244 3300009093 Bacteria 1294
174 Ga0105245_10071302 3300009098 Bacteria 3156
175 Ga0105245_10216132 3300009098 Bacteria 1847
176 Ga0105245_10260089 3300009098 Bacteria 1689
177 Ga0105247_10104696 3300009101 Bacteria 1813
178 Ga0105247_10173183 3300009101 Bacteria 1436
179 Ga0105247_10187173 3300009101 Bacteria 1384
180 Ga0114129_10004595 3300009147 Bacteria 19485
181 Ga0114129_10157307 3300009147 Bacteria 3107
182 Ga0105243_10075279 3300009148 Bacteria 2740
183 Ga0105243_10231134 3300009148 Bacteria 1641
184 Ga0105243_10485191 3300009148 Bacteria 1167
185 Ga0105241_10015112 3300009174 Bacteria 5655
186 Ga0105241_10111550 3300009174 Bacteria 2190
187 Ga0105241_10197931 3300009174 Bacteria 1676
188 Ga0105241_10240858 3300009174 Bacteria 1529
189 Ga0105241_10529071 3300009174 Bacteria 1055
190 Ga0105242_10184248 3300009176 Bacteria 1844
191 Ga0105242_10205972 3300009176 Bacteria 1749
192 Ga0105248_10080990 3300009177 Bacteria 3650
193 Ga0105248_10170279 3300009177 Bacteria 2454
194 Ga0105248_10496096 3300009177 Bacteria 1376
195 Ga0105248_10579251 3300009177 Bacteria 1266
196 Ga0105248_11011862 3300009177 Bacteria 939
197 Ga0105237_10008895 3300009545 Bacteria 10820
198 Ga0105237_10044886 3300009545 Bacteria 4450
199 Ga0105237_10069051 3300009545 Bacteria 3528
200 Ga0105237_10183321 3300009545 Bacteria 2093
201 Ga0105237_10356681 3300009545 Bacteria 1466
202 Ga0105237_10408045 3300009545 Bacteria 1363
203 Ga0105238_10025742 3300009551 Bacteria 5999
204 Ga0105238_10026375 3300009551 Bacteria 5924
205 Ga0105238_10028483 3300009551 Bacteria 5691
206 Ga0105238_10462551 3300009551 Bacteria 1266
207 Ga0105238_10572317 3300009551 Bacteria 1135
208 Ga0105249_10692538 3300009553 Bacteria 1079
209 Ga0099796_10016875 3300010159 Bacteria 2164
210 Ga0099796_10096508 3300010159 Bacteria 1106
211 Ga0105239_10008167 3300010375 Bacteria 11943
212 Ga0105239_10074854 3300010375 Bacteria 3723
213 Ga0105239_10084315 3300010375 Bacteria 3500
214 Ga0105239_10169114 3300010375 Bacteria 2444
215 Ga0105239_10271446 3300010375 Bacteria 1908
216 Ga0105239_10414628 3300010375 Bacteria 1525
217 Ga0105239_10694216 3300010375 Bacteria 1163
218 Ga0105246_10067767 3300011119 Bacteria 2501
219 Ga0157373_10011474 3300013100 Bacteria 6515
220 Ga0157373_10037722 3300013100 Bacteria 3463
221 Ga0157373_10047172 3300013100 Bacteria 3074
222 Ga0157373_10096002 3300013100 Bacteria 2087
223 Ga0157370_10054683 3300013104 Bacteria 3805
224 Ga0157369_10006096 3300013105 Bacteria 13996
225 Ga0157374_10199007 3300013296 Bacteria 1961
226 Ga0157374_10482983 3300013296 Bacteria 1242
227 Ga0157378_10222202 3300013297 Bacteria 1796
228 Ga0157378_10391905 3300013297 Bacteria 1366
229 Ga0157378_10543889 3300013297 Bacteria 1166
230 Ga0163162_10064929 3300013306 Bacteria 3696
231 Ga0163162_10586244 3300013306 Bacteria 1242
232 Ga0163162_10773871 3300013306 Bacteria 1078
233 Ga0157372_10149868 3300013307 Bacteria 2691
234 Ga0157375_10010583 3300013308 Bacteria 8121
235 Ga0163163_10513828 3300014325 Bacteria 1260
236 Ga0157380_10538360 3300014326 Bacteria 1143
237 Ga0157380_10835908 3300014326 Bacteria 941
238 Ga0182008_10000581 3300014497 Bacteria 26916
239 Ga0182008_10000904 3300014497 Bacteria 20630
240 Ga0157379_10107304 3300014968 Bacteria 2507
241 Ga0157376_10042518 3300014969 Bacteria 3724
242 Ga0157376_10436292 3300014969 Bacteria 1274
243 Ga0182006_1000467 3300015261 Bacteria 31644
244 Ga0182006_1092731 3300015261 Bacteria 1084
245 Ga0182007_10002786 3300015262 Bacteria 8522
246 Ga0214542_1000009 3300021321 Bacteria 262861
247 Ga0214542_1033238 3300021321 Bacteria 1754
248 Ga0214545_1000007 3300021324 Bacteria 262984
249 Ga0214545_1039271 3300021324 Bacteria 1337
250 Ga0214543_1000020 3300021327 Bacteria 262861
251 Ga0214543_1040577 3300021327 Bacteria 1235
252 Ga0213873_10002858 3300021358 Bacteria 3043
253 Ga0213872_10021501 3300021361 Bacteria 2971
254 Ga0213876_10001108 3300021384 Bacteria 17232
255 Ga0209435_100606 3300025206 Bacteria 6586
256 Ga0209784_100007 3300025224 Bacteria 747715
257 Ga0209566_100009 3300025225 Bacteria 554018
258 Ga0209674_100021 3300025226 Bacteria 629811
259 Ga0209147_100009 3300025229 Bacteria 747409
260 Ga0209563_100018 3300025230 Bacteria 747850
261 Ga0209563_101581 3300025230 Bacteria 5915
262 Ga0209258_100347 3300025242 Bacteria 66549
263 Ga0209646_1001318 3300025246 Bacteria 6908
264 Ga0209677_100012 3300025253 Bacteria 554018
265 Ga0209677_102936 3300025253 Bacteria 5960
266 Ga0209148_1000707 3300025254 Bacteria 26803
267 Ga0209233_1001624 3300025261 Bacteria 8741
268 Ga0209233_1010411 3300025261 Bacteria 2787
269 Ga0209455_1004030 3300025272 Bacteria 4969
270 Ga0209455_1005738 3300025272 Bacteria 3779
271 Ga0209455_1007958 3300025272 Bacteria 2934
272 Ga0209455_1012768 3300025272 Bacteria 1989
273 Ga0209564_1000503 3300025295 Bacteria 64437
274 Ga0209564_1009431 3300025295 Bacteria 4647
275 Ga0209758_1000106 3300025297 Bacteria 218450
276 Ga0209758_1002009 3300025297 Bacteria 21878
277 Ga0209758_1002765 3300025297 Bacteria 17179
278 Ga0209758_1003053 3300025297 Bacteria 15935
279 Ga0209758_1006390 3300025297 Bacteria 8493
280 Ga0209758_1011674 3300025297 Bacteria 5048
281 Ga0209758_1011887 3300025297 Bacteria 4961
282 Ga0209758_1069464 3300025297 Bacteria 1116
283 Ga0209256_1008328 3300025299 Bacteria 4835
284 Ga0207426_1000337 3300025302 Bacteria 88200
285 Ga0207426_1007201 3300025302 Bacteria 4691
286 Ga0207426_1009271 3300025302 Bacteria 3909
287 Ga0209051_1000298 3300025303 Bacteria 78777
288 Ga0209257_1000684 3300025304 Bacteria 52769
289 Ga0207656_10035984 3300025321 Bacteria 2076
290 Ga0207656_10046534 3300025321 Bacteria 1862
291 Ga0207655_1000534 3300025728 Bacteria 48119
292 Ga0207692_10001396 3300025898 Bacteria 9039
293 Ga0207692_10070024 3300025898 Bacteria 1845
294 Ga0207688_10048296 3300025901 Bacteria 2378
295 Ga0207688_10098160 3300025901 Bacteria 1688
296 Ga0207680_10165964 3300025903 Bacteria 1484
297 Ga0207680_10269037 3300025903 Bacteria 1181
298 Ga0207647_10009009 3300025904 Bacteria 7112
299 Ga0207647_10053238 3300025904 Bacteria 2495
300 Ga0207685_10004095 3300025905 Bacteria 3652
301 Ga0207699_10038984 3300025906 Bacteria 2727
302 Ga0207645_10133078 3300025907 Bacteria 1619
303 Ga0207645_10282096 3300025907 Bacteria 1103
304 Ga0207643_10027690 3300025908 Bacteria 3144
305 Ga0207705_10080452 3300025909 Bacteria 2374
306 Ga0207705_10418436 3300025909 Bacteria 1037
307 Ga0207707_10001933 3300025912 Bacteria 18846
308 Ga0207695_10000478 3300025913 Bacteria 86076
309 Ga0207695_10034396 3300025913 Bacteria 5512
310 Ga0207695_10142598 3300025913 Bacteria 2343
311 Ga0207671_10037028 3300025914 Bacteria 3618
312 Ga0207671_10047710 3300025914 Bacteria 3170
313 Ga0207671_10057143 3300025914 Bacteria 2892
314 Ga0207671_10063710 3300025914 Bacteria 2740
315 Ga0207671_10203488 3300025914 Bacteria 1547
316 Ga0207693_10020323 3300025915 Bacteria 5283
317 Ga0207693_10027576 3300025915 Bacteria 4489
318 Ga0207693_10293797 3300025915 Bacteria 1273
319 Ga0207663_10001112 3300025916 Bacteria 12359
320 Ga0207663_10023479 3300025916 Bacteria 3539
321 Ga0207663_10067343 3300025916 Bacteria 2296
322 Ga0207660_10009206 3300025917 Bacteria 6389
323 Ga0207660_10232901 3300025917 Bacteria 1449
324 Ga0207662_10078044 3300025918 Bacteria 2015
325 Ga0207657_10005821 3300025919 Bacteria 12839
326 Ga0207657_10113450 3300025919 Bacteria 2236
327 Ga0207657_10121119 3300025919 Bacteria 2152
328 Ga0207652_10070273 3300025921 Bacteria 3040
329 Ga0207652_10198291 3300025921 Bacteria 1806
330 Ga0207694_10001415 3300025924 Bacteria 20567
331 Ga0207694_10022943 3300025924 Bacteria 4735
332 Ga0207694_10177181 3300025924 Bacteria 1728
333 Ga0207694_10205787 3300025924 Bacteria 1602
334 Ga0207650_10000089 3300025925 Bacteria 120962
335 Ga0207687_10149563 3300025927 Bacteria 1780
336 Ga0207700_10064270 3300025928 Bacteria 2794
337 Ga0207700_10214960 3300025928 Bacteria 1627
338 Ga0207664_10313407 3300025929 Bacteria 1383
339 Ga0207690_10074010 3300025932 Bacteria 2358
340 Ga0207706_10154120 3300025933 Bacteria 2021
341 Ga0207706_10251531 3300025933 Bacteria 1543
342 Ga0207706_10262690 3300025933 Bacteria 1507
343 Ga0207686_10295937 3300025934 Bacteria 1200
344 Ga0207709_10042337 3300025935 Bacteria 2738
345 Ga0207709_10251506 3300025935 Bacteria 1291
346 Ga0207709_10256222 3300025935 Bacteria 1281
347 Ga0207669_10224931 3300025937 Bacteria 1380
348 Ga0207704_10244042 3300025938 Bacteria 1344
349 Ga0207665_10000703 3300025939 Bacteria 22673
350 Ga0207665_10091630 3300025939 Bacteria 2108
351 Ga0207665_10156926 3300025939 Bacteria 1634
352 Ga0207711_10108494 3300025941 Bacteria 2466
353 Ga0207711_10195442 3300025941 Bacteria 1845
354 Ga0207711_10644284 3300025941 Bacteria 988
355 Ga0207689_10038013 3300025942 Bacteria 3988
356 Ga0207689_10304900 3300025942 Bacteria 1320
357 Ga0207661_10000171 3300025944 Bacteria 41708
358 Ga0207661_10030341 3300025944 Bacteria 4164
359 Ga0207679_10384077 3300025945 Bacteria 1232
360 Ga0207667_10011741 3300025949 Bacteria 10158
361 Ga0207667_10013826 3300025949 Bacteria 9221
362 Ga0207667_10348678 3300025949 Bacteria 1510
363 Ga0207667_10387248 3300025949 Bacteria 1424
364 Ga0207668_10042480 3300025972 Bacteria 3079
365 Ga0207668_10129694 3300025972 Bacteria 1923
366 Ga0207640_10060359 3300025981 Bacteria 2506
367 Ga0207640_10368608 3300025981 Bacteria 1160
368 Ga0207677_10061516 3300026023 Bacteria 2601
369 Ga0207703_10345982 3300026035 Bacteria 1368
370 Ga0207703_10554506 3300026035 Bacteria 1084
371 Ga0207639_10008009 3300026041 Bacteria 7220
372 Ga0207678_10014592 3300026067 Bacteria 6914
373 Ga0207678_10027182 3300026067 Bacteria 4990
374 Ga0207678_10079253 3300026067 Bacteria 2813
375 Ga0207678_10125020 3300026067 Bacteria 2194
376 Ga0207678_10279947 3300026067 Bacteria 1431
377 Ga0207678_10329627 3300026067 Bacteria 1314
378 Ga0207702_10000003 3300026078 Bacteria 434196
379 Ga0207702_10000014 3300026078 Bacteria 253304
380 Ga0207702_10033457 3300026078 Bacteria 4294
381 Ga0207702_10106532 3300026078 Bacteria 2484
382 Ga0207702_10211921 3300026078 Bacteria 1802
383 Ga0207702_10319646 3300026078 Bacteria 1478
384 Ga0207702_10420068 3300026078 Bacteria 1293
385 Ga0207641_10249261 3300026088 Bacteria 1658
386 Ga0207676_10208596 3300026095 Bacteria 1732
387 Ga0207674_10004961 3300026116 Bacteria 15902
388 Ga0207674_10009035 3300026116 Bacteria 11446
389 Ga0207674_10044466 3300026116 Bacteria 4574
390 Ga0207674_10175694 3300026116 Bacteria 2094
391 Ga0207683_10018023 3300026121 Bacteria 6021
392 Ga0207683_10223320 3300026121 Bacteria 1717
393 Ga0207698_10088283 3300026142 Bacteria 2528
394 Ga0207698_10120408 3300026142 Bacteria 2220
395 Ga0207698_10268969 3300026142 Bacteria 1570
396 Ga0207698_10275638 3300026142 Bacteria 1553
397 Ga0207698_10406542 3300026142 Bacteria 1302
398 Ga0207698_10623316 3300026142 Bacteria 1066
399 Ga0209389_1000016 3300027296 Bacteria 184844
400 Ga0209389_1000027 3300027296 Bacteria 146917
401 Ga0209371_1001354 3300027312 Bacteria 16977
402 Ga0209589_1000005 3300027357 Bacteria 530958
403 Ga0209589_1000031 3300027357 Bacteria 147054
404 Ga0209489_100005 3300027361 Bacteria 530958
405 Ga0209489_100057 3300027361 Bacteria 147398
406 Ga0209489_100063 3300027361 Bacteria 144408
407 Ga0209700_100006 3300027363 Bacteria 530958
408 Ga0209700_100012 3300027363 Bacteria 357892
409 Ga0268266_10004322 3300028379 Bacteria 13666
410 Ga0268266_10006723 3300028379 Bacteria 10484
411 Ga0268266_10086610 3300028379 Bacteria 2739
412 Ga0268266_10359651 3300028379 Bacteria 1369
413 Ga0268266_10676159 3300028379 Bacteria 994
414 Ga0268265_10043874 3300028380 Bacteria 3326
415 Ga0268264_10000042 3300028381 Bacteria 372069
416 Ga0268264_10380313 3300028381 Bacteria 1352
417 Ga0265337_1009916 3300028556 Bacteria 3365
418 Ga0265319_1005843 3300028563 Bacteria 5806
419 Ga0265334_10011705 3300028573 Bacteria 3688
420 Ga0265323_10009578 3300028653 Bacteria 3950
421 Ga0265336_10000395 3300028666 Bacteria 27433
422 Ga0307517_10176129 3300028786 Bacteria 1392
423 Ga0265338_10000018 3300028800 Bacteria 338910
424 Ga0268256_1001153 3300030500 Bacteria 17056
425 Ga0316183_1201524 3300030742 Bacteria 3062
426 Ga0316181_1259633 3300030744 Bacteria 3339
427 Ga0265330_10056386 3300031235 Bacteria 1715
428 Ga0265339_10004193 3300031249 Bacteria 9881
429 Ga0265331_10092294 3300031250 Bacteria 1398
430 Ga0265327_10029833 3300031251 Bacteria 3095
431 Ga0307513_10072122 3300031456 Bacteria 3601
432 Ga0307509_10006260 3300031507 Bacteria 16085
433 Ga0307509_10070980 3300031507 Bacteria 3635
434 Ga0307509_10137057 3300031507 Bacteria 2391
435 Ga0307509_10337852 3300031507 Bacteria 1235
436 Ga0307408_100014308 3300031548 Bacteria 5271
437 Ga0307508_10000125 3300031616 Bacteria 91829
438 Ga0307508_10054061 3300031616 Bacteria 3561
439 Ga0307508_10221869 3300031616 Bacteria 1490
440 Ga0307508_10332828 3300031616 Bacteria 1110
441 Ga0307508_10343203 3300031616 Bacteria 1085
442 Ga0307514_10003203 3300031649 Bacteria 15988
443 Ga0265314_10022030 3300031711 Bacteria 4886
444 Ga0265314_10022428 3300031711 Bacteria 4836
445 Ga0265342_10013040 3300031712 Bacteria 5600
446 Ga0307516_10077415 3300031730 Bacteria 3175
447 Ga0307516_10113165 3300031730 Bacteria 2512
448 Ga0307516_10117287 3300031730 Bacteria 2456
449 Ga0307516_10199918 3300031730 Bacteria 1719
450 Ga0307405_10236767 3300031731 Bacteria 1349
451 Ga0307406_10000052 3300031901 Bacteria 64031
452 Ga0307406_10366718 3300031901 Bacteria 1131
453 Ga0307412_10349797 3300031911 Bacteria 1186
454 Ga0307414_10237263 3300032004 Bacteria 1507
455 Ga0307507_10062098 3300033179 Bacteria 3474
456 Ga0307510_10007708 3300033180 Bacteria 12837
457 Ga0307510_10015767 3300033180 Bacteria 8935
458 Ga0307510_10087981 3300033180 Bacteria 2969
459 Ga0307510_10204610 3300033180 Bacteria 1504
460 Ga0307510_10206472 3300033180 Bacteria 1492
461 Ga0315911_1000005 3300033442 Bacteria 426255
462 Ga0373934_0004936 3300035086 Bacteria 4940
463 Ga0373932_0016069 3300035112 Bacteria 1906
464 Ga0373954_0002374 3300035118 Bacteria 7874
465 Ga0373956_0038676 3300035119 Bacteria 2111
466 Ga0373957_0008219 3300035120 Bacteria 3371
467 Ga0373943_0018713 3300035170 Bacteria 3184
468 Ga0373946_0059032 3300035171 Bacteria 1627
469 Ga0373955_0000590 3300035172 Bacteria 15443
470 Ga0373961_0027281 3300035241 Bacteria 1567
471 Ga0373924_0042035 3300035410 Bacteria 1874
472 Ga0373931_0016534 3300035691 Bacteria 3633
473 Ga0373927_0014600 3300035695 Bacteria 5195
474 Ga0373927_0036611 3300035695 Bacteria 3191
475 Ga0373933_0044344 3300035724 Bacteria 2634
476 Ga0373947_0083172 3300035725 Bacteria 1985
477 Ga0373947_0162647 3300035725 Bacteria 1444
478 Ga0373925_0284792 3300037068 Bacteria 1332
479 Ga0373925_0393303 3300037068 Bacteria 1130
480 Ga0395900_0000753 3300037418 Bacteria 43021
481 Ga0395900_0034589 3300037418 Bacteria 5205
482 Ga0395900_0570067 3300037418 Bacteria 1075
483 Ga0395898_0005579 3300037466 Bacteria 13568
484 Ga0395898_0029509 3300037466 Bacteria 5494
485 Ga0395905_0058930 3300037471 Bacteria 3590
486 Ga0395905_0095802 3300037471 Bacteria 2786
487 Ga0395901_0092860 3300038443 Bacteria 3159
488 Ga0395901_0290360 3300038443 Bacteria 1697
489 Ga0436365_0122301 3300039437 Bacteria 13111
490 Ga0436365_0816185 3300039437 Bacteria 1576
491 Ga0436360_0121399 3300039438 Bacteria 4193
492 Ga0436361_0897018 3300039447 Bacteria 3253
493 Ga0436361_1132428 3300039447 Bacteria 4403
494 Ga0436363_1250187 3300039450 Bacteria 2190
495 Ga0436362_0972873 3300039453 Bacteria 4993
496 Ga0436362_1029662 3300039453 Bacteria 2783
497 Ga0451791_0675706 3300041451 Bacteria 1153
498 Ga0451843_0000168 3300041509 Bacteria 1133
499 Ga0439432_000047 3300042006 Bacteria 37317
500 Ga0450891_000878 3300042129 Bacteria 3142
501 Ga0466969_0016241 3300044656 Bacteria 3899
502 Ga0466972_0000585 3300044658 Bacteria 17722
503 Ga0466966_0000720 3300044684 Bacteria 20983
504 Ga0466961_0000136 3300044693 Bacteria 49049
505 Ga0466963_0047541 3300044694 Bacteria 2832
506 Ga0466964_0018290 3300044706 Bacteria 2688
507 Ga0466970_0091748 3300044765 Bacteria 1649
508 Ga0466957_0070496 3300044842 Bacteria 2160
509 Ga0466957_0198439 3300044842 Bacteria 1317
510 Ga0466959_0030496 3300045049 Bacteria 3992
511 Ga0466959_0132374 3300045049 Bacteria 1767
512 Ga0466967_0049868 3300045976 Bacteria 3664
513 Ga0466967_0090376 3300045976 Bacteria 2781
514 Ga0466967_0118618 3300045976 Bacteria 2441
515 Ga0466967_0257117 3300045976 Bacteria 1670
516 Ga0495592_0007391 3300046454 Bacteria 8221
517 Ga0495603_0017965 3300046455 Bacteria 4280
518 Ga0495603_0036375 3300046455 Bacteria 2956
519 Ga0495603_0046931 3300046455 Bacteria 2573
520 Ga0495603_0060530 3300046455 Bacteria 2237
521 Ga0495603_0114087 3300046455 Bacteria 1576
522 Ga0495629_0021300 3300046459 Bacteria 4625
523 Ga0495638_0016562 3300046460 Bacteria 4934
524 Ga0495638_0025345 3300046460 Bacteria 3856
525 Ga0495641_0077094 3300046461 Bacteria 1494
526 Ga0495651_0009620 3300046462 Bacteria 7427
527 Ga0495651_0058439 3300046462 Bacteria 2959
528 Ga0495651_0065835 3300046462 Bacteria 2767
529 Ga0495651_0177628 3300046462 Bacteria 1510
530 Ga0495653_0017260 3300046463 Bacteria 5871
531 Ga0495605_0072285 3300046474 Bacteria 1627
532 Ga0495605_0145814 3300046474 Bacteria 1059
533 Ga0495639_0105919 3300046475 Bacteria 1331
534 Ga0495639_0179251 3300046475 Bacteria 1031
535 Ga0495664_0009047 3300046477 Bacteria 5568
536 Ga0495664_0011721 3300046477 Bacteria 4949
537 Ga0495664_0018996 3300046477 Bacteria 3947
538 Ga0495664_0271384 3300046477 Bacteria 1025
539 Ga0495585_0136242 3300046492 Bacteria 1289
540 Ga0495596_0104938 3300046500 Bacteria 1097
541 Ga0495583_0093806 3300046506 Bacteria 1289
542 Ga0495606_0012721 3300046507 Bacteria 6710
543 Ga0495606_0024749 3300046507 Bacteria 4318
544 Ga0495606_0181991 3300046507 Bacteria 1211
545 Ga0495606_0196889 3300046507 Bacteria 1151
546 Ga0495608_0019083 3300046511 Bacteria 4727
547 Ga0495608_0048870 3300046511 Bacteria 2810
548 Ga0495608_0068933 3300046511 Bacteria 2312
549 Ga0495610_0055778 3300046512 Bacteria 1903
550 Ga0495610_0144162 3300046512 Bacteria 1022
551 Ga0495616_0149186 3300046513 Bacteria 1059
552 Ga0495618_0035324 3300046514 Bacteria 3138
553 Ga0495620_0089680 3300046515 Bacteria 1235
554 Ga0495628_0011834 3300046516 Bacteria 7362
555 Ga0495631_0119821 3300046518 Bacteria 1132
556 Ga0495632_0178900 3300046519 Bacteria 972
557 Ga0495643_0021450 3300046522 Bacteria 3705
558 Ga0495648_0056224 3300046524 Bacteria 2368
559 Ga0495648_0118424 3300046524 Bacteria 1428
560 Ga0495652_0004325 3300046529 Bacteria 13603
561 Ga0495652_0033670 3300046529 Bacteria 4470
562 Ga0495640_0009547 3300046533 Bacteria 7547
563 Ga0495640_0028702 3300046533 Bacteria 4003
564 Ga0495587_0027506 3300046536 Bacteria 3462
565 Ga0495587_0058603 3300046536 Bacteria 2262
566 Ga0495598_0033166 3300046537 Bacteria 1464
567 Ga0495609_0094911 3300046538 Bacteria 1295
568 Ga0495609_0126024 3300046538 Bacteria 1099
569 Ga0495645_0007861 3300046543 Bacteria 7418
570 Ga0495645_0009133 3300046543 Bacteria 6926
571 Ga0495622_0006001 3300046557 Bacteria 5644
572 Ga0495622_0009820 3300046557 Bacteria 4425
573 Ga0495622_0061671 3300046557 Bacteria 1736
574 Ga0495622_0076200 3300046557 Bacteria 1545
575 Ga0495633_0052517 3300046558 Bacteria 1920
576 Ga0495667_0026445 3300046559 Bacteria 3911
577 Ga0495667_0035440 3300046559 Bacteria 3334
578 Ga0495656_0042832 3300046615 Bacteria 1897
579 Ga0495668_0024106 3300046616 Bacteria 3462
580 Ga0495668_0067864 3300046616 Bacteria 1962
581 Ga0495668_0098762 3300046616 Bacteria 1597
582 Ga0495634_0009379 3300046642 Bacteria 7219
583 Ga0495634_0034428 3300046642 Bacteria 3476
584 Ga0495625_0236326 3300046660 Bacteria 1191
585 Ga0495635_0007423 3300046663 Bacteria 7651
586 Ga0495635_0012284 3300046663 Bacteria 5998
587 Ga0495635_0093517 3300046663 Bacteria 2056
588 Ga0495659_0081824 3300046664 Bacteria 1226
589 Ga0495588_0004335 3300046674 Bacteria 6264
590 Ga0495657_0001308 3300046675 Bacteria 21681
591 Ga0495657_0007247 3300046675 Bacteria 8593
592 Ga0495657_0016949 3300046675 Bacteria 5295
593 Ga0495599_0019799 3300046678 Bacteria 4191
594 Ga0495599_0025698 3300046678 Bacteria 3688
595 Ga0495599_0051324 3300046678 Bacteria 2584
596 Ga0495623_0021928 3300046679 Bacteria 4125
597 Ga0495623_0120808 3300046679 Bacteria 1577
598 Ga0495646_0046922 3300046680 Bacteria 2631
599 Ga0495646_0081177 3300046680 Bacteria 1890
600 Ga0495669_0108507 3300046684 Bacteria 1294
601 Ga0495669_0139417 3300046684 Bacteria 1144
602 Ga0495613_0119691 3300046689 Bacteria 1891
603 Ga0495624_0074817 3300046690 Bacteria 2103
604 Ga0495671_0100551 3300046692 Bacteria 1414
605 Ga0495649_0119963 3300046694 Bacteria 1391
606 Ga0495589_0136929 3300046794 Bacteria 1174
607 Ga0495600_0007966 3300046809 Bacteria 6491
608 Ga0495600_0020140 3300046809 Bacteria 4267
609 Ga0495600_0031062 3300046809 Bacteria 3459
610 Ga0495581_0167462 3300047315 Bacteria 1285
611 Ga0495604_0006128 3300047317 Bacteria 9545
612 Ga0495604_0020133 3300047317 Bacteria 5331
613 Ga0495604_0244404 3300047317 Bacteria 1226
614 Ga0495674_0011175 3300047319 Bacteria 8479
615 Ga0495674_0044585 3300047319 Bacteria 3942
616 Ga0495674_0121079 3300047319 Bacteria 2210
617 Ga0495672_0005618 3300047320 Bacteria 9900
618 Ga0495676_0162888 3300047321 Bacteria 1576
619 Ga0495676_0224246 3300047321 Bacteria 1294
620 Ga0495680_0001053 3300047322 Bacteria 30524
621 Ga0495680_0014448 3300047322 Bacteria 6836
622 Ga0495687_016734 3300047443 Bacteria 3679
623 Ga0495679_007969 3300047446 Bacteria 4356
624 Ga0495684_0073127 3300047471 Bacteria 2604
625 Ga0495686_0213485 3300047472 Bacteria 1101
626 Ga0495602_0021411 3300048088 Bacteria 6366
627 Ga0495602_0074922 3300048088 Bacteria 2874
628 Ga0496100_0012991 3300048903 Bacteria 4792
629 Ga0496101_0003670 3300048904 Bacteria 9579
630 Ga0496101_0130902 3300048904 Bacteria 1905
631 Ga0496101_0203088 3300048904 Bacteria 1533
632 Ga0496101_0250297 3300048904 Bacteria 1380
633 Ga0496102_0001403 3300048905 Bacteria 21391
634 Ga0496102_0051154 3300048905 Bacteria 3764
635 Ga0496102_0067221 3300048905 Bacteria 3287
636 Ga0496102_0719152 3300048905 Bacteria 921
637 Ga0496103_0116426 3300048906 Bacteria 1700
638 Ga0496103_0276307 3300048906 Bacteria 1081
639 Ga0496104_0002112 3300048907 Bacteria 17255
640 Ga0496104_0014912 3300048907 Bacteria 7025
641 Ga0496104_0029597 3300048907 Bacteria 5080
642 Ga0496104_0108179 3300048907 Bacteria 2664
643 Ga0496104_0126288 3300048907 Bacteria 2456
644 Ga0496104_0301812 3300048907 Bacteria 1513
645 Ga0496105_0046798 3300048908 Bacteria 3570
646 Ga0496105_0076936 3300048908 Bacteria 2756
647 Ga0496105_0087969 3300048908 Bacteria 2566
648 Ga0496105_0123081 3300048908 Bacteria 2138
649 Ga0496106_0001280 3300048909 Bacteria 18862
650 Ga0496106_0011375 3300048909 Bacteria 6586
651 Ga0496106_0066732 3300048909 Bacteria 2741
652 Ga0496106_0234646 3300048909 Bacteria 1465
653 Ga0496107_0027212 3300048910 Bacteria 4060
654 Ga0496107_0202501 3300048910 Bacteria 1475
655 Ga0496107_0226803 3300048910 Bacteria 1390
656 Ga0496108_0031333 3300048911 Bacteria 4412
657 Ga0496108_0173496 3300048911 Bacteria 1866
658 Ga0496108_0399302 3300048911 Bacteria 1201
659 Ga0496109_0010437 3300048912 Bacteria 7934
660 Ga0496109_0240372 3300048912 Bacteria 1704
661 Ga0496109_0284205 3300048912 Bacteria 1559
662 Ga0496110_0056755 3300048913 Bacteria 3446
663 Ga0496110_0078391 3300048913 Bacteria 2941
664 Ga0496110_0133066 3300048913 Bacteria 2246
665 Ga0496110_0146918 3300048913 Bacteria 2133
666 Ga0496110_0186033 3300048913 Bacteria 1886
667 Ga0496110_0245272 3300048913 Bacteria 1630
668 Ga0496110_0611197 3300048913 Bacteria 988
669 Ga0496111_0004711 3300048914 Bacteria 8653
670 Ga0496111_0057198 3300048914 Bacteria 2823
671 Ga0496111_0208005 3300048914 Bacteria 1454
672 Ga0496111_0369052 3300048914 Bacteria 1062
673 Ga0496112_0027302 3300048915 Bacteria 5504
674 Ga0496112_0036649 3300048915 Bacteria 4785
675 Ga0496112_0144708 3300048915 Bacteria 2345
676 Ga0496112_0199695 3300048915 Bacteria 1959
677 Ga0496112_0503338 3300048915 Bacteria 1147
678 Ga0496113_0006206 3300048916 Bacteria 7551
679 Ga0496113_0035660 3300048916 Bacteria 3639
680 Ga0496113_0093556 3300048916 Bacteria 2320
681 Ga0496114_0069047 3300048917 Bacteria 2967
682 Ga0496114_0346237 3300048917 Bacteria 1314
683 Ga0496115_0004202 3300048918 Bacteria 10415
684 Ga0496115_0049654 3300048918 Bacteria 3359
685 Ga0496115_0263750 3300048918 Bacteria 1416
686 Ga0496116_0127078 3300048919 Bacteria 1462
687 Ga0496117_0028354 3300048920 Bacteria 4339
688 Ga0496117_0089657 3300048920 Bacteria 1985
689 Ga0496118_0001458 3300048921 Bacteria 35562
690 Ga0496118_0031386 3300048921 Bacteria 4405
691 Ga0496119_0003138 3300048922 Bacteria 17407
692 Ga0496119_0197794 3300048922 Bacteria 1042
693 Ga0496120_0015858 3300048923 Bacteria 4949
694 Ga0496120_0042462 3300048923 Bacteria 2655
695 Ga0496121_0000146 3300048924 Bacteria 154459
696 Ga0496121_0001525 3300048924 Bacteria 38839
697 Ga0496121_0039521 3300048924 Bacteria 4155
698 Ga0496121_0073560 3300048924 Bacteria 2738
699 Ga0496121_0079535 3300048924 Bacteria 2602
700 Ga0496121_0109129 3300048924 Bacteria 2115
701 Ga0496121_0141995 3300048924 Bacteria 1780
702 Ga0496121_0173220 3300048924 Bacteria 1565
703 Ga0496121_0221500 3300048924 Bacteria 1332
704 Ga0496121_0261049 3300048924 Bacteria 1196
705 Ga0496122_0013345 3300048925 Bacteria 8048
706 Ga0496122_0078087 3300048925 Bacteria 2321
707 Ga0496123_0115156 3300048926 Bacteria 1526
708 Ga0496124_0002217 3300048927 Bacteria 25870
709 Ga0496124_0012006 3300048927 Bacteria 8611
710 Ga0496124_0074509 3300048927 Bacteria 2805
711 Ga0496124_0330131 3300048927 Bacteria 1088
712 Ga0496125_0000099 3300048928 Bacteria 203333
713 Ga0496125_0003103 3300048928 Bacteria 20706
714 Ga0496125_0003676 3300048928 Bacteria 18328
715 Ga0496125_0056870 3300048928 Bacteria 3173
716 Ga0496125_0098349 3300048928 Bacteria 2165
717 Ga0496125_0101350 3300048928 Bacteria 2119
718 Ga0496125_0171374 3300048928 Bacteria 1458
719 Ga0496125_0255755 3300048928 Bacteria 1101
720 Ga0496126_0003212 3300048929 Bacteria 20945
721 Ga0496126_0004243 3300048929 Bacteria 17254
722 Ga0496126_0010429 3300048929 Bacteria 9736
723 Ga0496126_0016652 3300048929 Bacteria 7346
724 Ga0496126_0058992 3300048929 Bacteria 3457
725 Ga0496126_0124221 3300048929 Bacteria 2235
726 Ga0496126_0142660 3300048929 Bacteria 2060
727 Ga0496126_0236367 3300048929 Bacteria 1528
728 Ga0496126_0252657 3300048929 Bacteria 1468
729 Ga0496126_0316293 3300048929 Bacteria 1284
730 Ga0496126_0398518 3300048929 Bacteria 1117
731 Ga0501033_0020903 3300049570 Bacteria 4940
732 Ga0501034_0168820 3300049571 Bacteria 2156
733 Ga0501037_0087480 3300049573 Bacteria 2255
734 Ga0501038_0113748 3300049574 Bacteria 2239
735 Ga0501039_0187577 3300049575 Bacteria 1626
736 Ga0501047_0257069 3300049581 Bacteria 1594
737 Ga0501068_0139925 3300049584 Bacteria 1517
738 Ga0501073_0151635 3300049589 Bacteria 1607
739 Ga0501235_019739 3300049669 Bacteria 1496
740 Ga0501080_0097775 3300049742 Bacteria 2726
741 nmdc:mga03683_3300_c1 3300050489 Bacteria 4493
742 nmdc:mga03n38_1503_c1 3300050490 Bacteria 6729
743 nmdc:mga03n38_74501_c1 3300050490 Bacteria 1579
744 nmdc:mga00v17_270674_c1 3300050491 Bacteria 1102
745 nmdc:mga0yw44_186447_c1 3300050492 Bacteria 1367
746 nmdc:mga0yw44_238276_c1 3300050492 Bacteria 1209
747 nmdc:mga0yw44_88455_c1 3300050492 Bacteria 1953
748 nmdc:mga0k408_23297_c1 3300050493 Bacteria 3491
749 nmdc:mga06z11_172489_c1 3300050494 Bacteria 1243
750 nmdc:mga06z11_185854_c1 3300050494 Bacteria 1201
751 nmdc:mga06z11_64715_c1 3300050494 Bacteria 1917
752 nmdc:mga06z11_7051_c1 3300050494 Bacteria 4608
753 nmdc:mga04h51_45459_c1 3300050495 Bacteria 1452
754 nmdc:mga07m45_168319_c1 3300050496 Bacteria 1273
755 nmdc:mga07m45_180195_c1 3300050496 Bacteria 1229
756 nmdc:mga07m45_20736_c1 3300050496 Bacteria 3572
757 nmdc:mga05p37_15155_c1 3300050507 Bacteria 9257
758 nmdc:mga05p37_75724_c1 3300050507 Bacteria 4142
759 nmdc:mga0n895_236471_c1 3300050512 Bacteria 1854
760 nmdc:mga0sz30_43399_c1 3300050516 Bacteria 1893
761 nmdc:mga0sz30_93211_c1 3300050516 Bacteria 1312
762 nmdc:mga0sz30_93948_c1 3300050516 Bacteria 1307
763 Ga0495601_0032293 3300053077 Bacteria 3258
764 Ga0495601_0108477 3300053077 Bacteria 1796
765 Ga0495612_0097656 3300053078 Bacteria 1248
766 Ga0500635_0055288 3300053080 Bacteria 1370
767 Ga0495655_0007769 3300053083 Bacteria 2010
768 Ga0495595_0061912 3300053084 Bacteria 1753
769 Ga0495619_0077752 3300053085 Bacteria 2229
770 Ga0500643_000052 3300053087 Bacteria 144656
771 Ga0500643_023418 3300053087 Bacteria 1973
772 Ga0500647_0020775 3300053091 Bacteria 3059
773 Ga0500651_0018968 3300053093 Bacteria 4265
774 Ga0500566_0039993 3300053094 Bacteria 2710
775 Ga0500566_0077548 3300053094 Bacteria 1855
776 Ga0500554_028832 3300053102 Bacteria 1617
777 Ga0500554_067935 3300053102 Bacteria 1155
778 Ga0500555_001634 3300053103 Bacteria 6773
779 Ga0500556_0003305 3300053104 Bacteria 4778
780 Ga0500556_0094648 3300053104 Bacteria 1144
781 Ga0500557_000096 3300053105 Bacteria 28838
782 Ga0500569_001480 3300053109 Bacteria 4446
783 Ga0500572_000335 3300053111 Bacteria 16881
784 Ga0500572_012239 3300053111 Bacteria 2098
785 Ga0500594_0083366 3300053118 Bacteria 960
786 Ga0500595_000728 3300053119 Bacteria 19571
787 Ga0500595_012442 3300053119 Bacteria 3292
788 Ga0500595_021655 3300053119 Bacteria 2291
789 Ga0500595_059971 3300053119 Bacteria 1152
790 Ga0500642_0000083 3300053130 Bacteria 50718
791 Ga0500658_0026515 3300053134 Bacteria 2233
792 Ga0500658_0051892 3300053134 Bacteria 1678
793 Ga0500559_0003196 3300053136 Bacteria 8145
794 Ga0500559_0037151 3300053136 Bacteria 2110
795 Ga0500564_067301 3300053138 Bacteria 1619
796 Ga0500568_0027187 3300053139 Bacteria 2394
797 Ga0500573_0144985 3300053140 Bacteria 1304
798 Ga0500577_0050831 3300053142 Bacteria 1556
799 Ga0500590_075347 3300053148 Bacteria 1669
800 Ga0500603_003284 3300053150 Bacteria 3475
801 Ga0500616_0015671 3300053153 Bacteria 4327
802 Ga0500616_0060448 3300053153 Bacteria 1964
803 Ga0500622_0012122 3300053156 Bacteria 4678
804 Ga0500638_007140 3300053162 Bacteria 4643
805 Ga0500639_161605 3300053163 Bacteria 1018
806 Ga0500636_0000232 3300053177 Bacteria 30484
807 Ga0500636_0024967 3300053177 Bacteria 3532
808 Ga0500636_0035062 3300053177 Bacteria 2970
809 Ga0500636_0175110 3300053177 Bacteria 1157
810 Ga0500637_0000080 3300053178 Bacteria 34464
811 Ga0500637_0188357 3300053178 Bacteria 1179
812 Ga0500625_026577 3300053729 Bacteria 2742
813 Ga0500645_004073 3300053730 Bacteria 5727
814 Ga0500645_052144 3300053730 Bacteria 1192
815 Ga0500645_052415 3300053730 Bacteria 1189
816 Ga0500609_000805 3300053731 Bacteria 4710
817 Ga0500596_002066 3300053735 Bacteria 4000
818 Ga0500599_002446 3300053736 Bacteria 2228
819 Ga0500601_000108 3300053737 Bacteria 17177
820 Ga0501084_0016246 3300054114 Bacteria 6181
821 Ga0500661_011701 3300055283 Bacteria 1586
822 Ga0501082_0193577 3300060353 Bacteria 1769

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049669 Ga0501235_019739 Ga0501235_019739_122_871 249
2 3300014326 Ga0157380_10538360 Ga0157380_105383601 251
3 3300048926 Ga0496123_0115156 Ga0496123_0115156_509_1393 257
4 3300006051 Ga0075364_10253173 Ga0075364_102531731 265
5 3300005455 Ga0070663_100174728 Ga0070663_1001747282 267
6 3300005456 Ga0070678_100202136 Ga0070678_1002021362 267
7 3300026067 Ga0207678_10279947 Ga0207678_102799472 267
8 3300026121 Ga0207683_10018023 Ga0207683_100180234 267
9 3300005365 Ga0070688_100145669 Ga0070688_1001456692 270
10 3300025908 Ga0207643_10027690 Ga0207643_100276903 270
11 3300027312 Ga0209371_1001354 Ga0209371_10013546 271
12 3300030500 Ga0268256_1001153 Ga0268256_10011536 271
13 3300047320 Ga0495672_0005618 Ga0495672_0005618_5389_6261 271
14 3300009093 Ga0105240_10009125 Ga0105240_100091255 272
15 iso_pu_bacteria 2893066018 2893070664 272
16 3300010159 Ga0099796_10096508 Ga0099796_100965082 273
17 3300053139 Ga0500568_0027187 Ga0500568_0027187_1215_2117 273
18 3300053140 Ga0500573_0144985 Ga0500573_0144985_175_1008 273
19 3300013297 Ga0157378_10222202 Ga0157378_102222021 274
20 3300037471 Ga0395905_0058930 Ga0395905_0058930_318_1187 274
21 3300038443 Ga0395901_0092860 Ga0395901_0092860_109_978 274
22 3300041509 Ga0451843_0000168 Ga0451843_0000168_122_1006 274
23 3300046462 Ga0495651_0177628 Ga0495651_0177628_29_868 274
24 3300053118 Ga0500594_0083366 Ga0500594_0083366_22_879 274
25 3300005347 Ga0070668_100103430 Ga0070668_1001034303 275
26 3300005455 Ga0070663_100166983 Ga0070663_1001669832 275
27 3300005466 Ga0070685_10175818 Ga0070685_101758181 275
28 3300005617 Ga0068859_100164271 Ga0068859_1001642712 275
29 3300005719 Ga0068861_100170496 Ga0068861_1001704962 275
30 3300006195 Ga0075366_10112604 Ga0075366_101126042 275
31 3300006931 Ga0097620_100164286 Ga0097620_1001642862 275
32 3300009148 Ga0105243_10231134 Ga0105243_102311342 275
33 3300013297 Ga0157378_10391905 Ga0157378_103919052 275
34 3300014325 Ga0163163_10513828 Ga0163163_105138282 275
35 3300025903 Ga0207680_10269037 Ga0207680_102690372 275
36 3300025935 Ga0207709_10251506 Ga0207709_102515062 275
37 3300025942 Ga0207689_10304900 Ga0207689_103049002 275
38 3300026095 Ga0207676_10208596 Ga0207676_102085962 275
39 3300028379 Ga0268266_10004322 Ga0268266_1000432213 275
40 3300046462 Ga0495651_0058439 Ga0495651_0058439_1839_2681 275
41 3300046537 Ga0495598_0033166 Ga0495598_0033166_436_1281 275
42 3300048924 Ga0496121_0221500 Ga0496121_0221500_322_1167 275
43 3300050490 nmdc:mga03n38_74501_c1 nmdc:mga03n38_74501_c1_330_1199 275
44 3300050494 nmdc:mga06z11_172489_c1 nmdc:mga06z11_172489_c1_164_1009 275
45 3300050496 nmdc:mga07m45_168319_c1 nmdc:mga07m45_168319_c1_277_1122 275
46 3300050516 nmdc:mga0sz30_93211_c1 nmdc:mga0sz30_93211_c1_293_1162 275
47 3300005455 Ga0070663_100007241 Ga0070663_1000072413 276
48 3300005548 Ga0070665_100105477 Ga0070665_1001054773 276
49 3300006048 Ga0075363_100004089 Ga0075363_10000408910 276
50 3300009101 Ga0105247_10173183 Ga0105247_101731832 276
51 3300028379 Ga0268266_10006723 Ga0268266_100067232 276
52 3300031616 Ga0307508_10054061 Ga0307508_100540613 276
53 3300037068 Ga0373925_0393303 Ga0373925_0393303_185_1054 276
54 3300046455 Ga0495603_0060530 Ga0495603_0060530_799_1668 276
55 3300046674 Ga0495588_0004335 Ga0495588_0004335_3257_4126 276
56 3300048928 Ga0496125_0101350 Ga0496125_0101350_239_1102 276
57 3300048929 Ga0496126_0236367 Ga0496126_0236367_17_880 276
58 3300050490 nmdc:mga03n38_1503_c1 nmdc:mga03n38_1503_c1_3944_4813 276
59 3300050491 nmdc:mga00v17_270674_c1 nmdc:mga00v17_270674_c1_165_1007 276
60 3300050492 nmdc:mga0yw44_88455_c1 nmdc:mga0yw44_88455_c1_940_1782 276
61 3300050493 nmdc:mga0k408_23297_c1 nmdc:mga0k408_23297_c1_1733_2575 276
62 3300050494 nmdc:mga06z11_7051_c1 nmdc:mga06z11_7051_c1_1502_2371 276
63 3300050496 nmdc:mga07m45_20736_c1 nmdc:mga07m45_20736_c1_448_1290 276
64 3300046475 Ga0495639_0105919 Ga0495639_0105919_291_1145 277
65 3300046507 Ga0495606_0196889 Ga0495606_0196889_167_1036 277
66 iso_pu_bacteria 2906660503 2906663433 277
67 3300009551 Ga0105238_10572317 Ga0105238_105723172 278
68 3300048088 Ga0495602_0074922 Ga0495602_0074922_1727_2602 278
69 iso_pu_bacteria 2513237096 2513655384 278
70 iso_pu_bacteria 2513237137 2513860052 278
71 iso_pu_bacteria 2513237145 2513916538 278
72 iso_pu_bacteria 2517093001 2517104618 278
73 iso_pu_bacteria 2517572143 2517889871 278
74 iso_pu_bacteria 2524023228 2524532941 278
75 iso_pu_bacteria 2667528175 2671121105 278
76 iso_pu_bacteria 2728368998 2728751734 278
77 iso_pu_bacteria 2791355197 2793073399 278
78 iso_pu_bacteria 2791355199 2793078591 278
79 iso_pu_bacteria 2885374607 2885376198 278
80 iso_pu_bacteria 2903748898 2903749013 278
81 iso_pu_bacteria 2904690495 2904692692 278
82 iso_pu_bacteria 2904699407 2904711208 278
83 iso_pu_bacteria 2906635258 2906637844 278
84 iso_pu_bacteria 2908739725 2908739734 278
85 iso_pu_bacteria 2908756301 2908757668 278
86 iso_pu_bacteria 2922386360 2922391544 278
87 iso_pu_bacteria 2922425934 2922426901 278
88 iso_pu_bacteria 2935630451 2935633062 278
89 iso_pu_bacteria 2941507105 2941509636 278
90 iso_pu_bacteria 2941515067 2941517465 278
91 iso_pu_bacteria 2941523033 2941526582 278
92 iso_pu_bacteria 3005474847 3005476087 278
93 iso_pu_bacteria 8006933436 8006937400 278
94 iso_pu_bacteria 8006973647 8006977429 278
95 iso_pu_bacteria 8006984368 8006986159 278
96 iso_pu_bacteria 8019555841 8019561226 278
97 iso_pu_bacteria 8019565922 8019571316 278
98 iso_pu_bacteria 8056673599 8056678901 278
99 iso_pu_bacteria 8056689827 8056692021 278
100 3300005340 Ga0070689_100017936 Ga0070689_1000179362 279
101 3300009093 Ga0105240_10095537 Ga0105240_100955372 279
102 3300009177 Ga0105248_11011862 Ga0105248_110118621 279
103 3300009551 Ga0105238_10028483 Ga0105238_100284835 279
104 3300010375 Ga0105239_10084315 Ga0105239_100843152 279
105 3300013297 Ga0157378_10543889 Ga0157378_105438891 279
106 3300025918 Ga0207662_10078044 Ga0207662_100780442 279
107 3300031251 Ga0265327_10029833 Ga0265327_100298332 279
108 3300039450 Ga0436363_1250187 Ga0436363_1250187_1315_2169 279
109 3300049742 Ga0501080_0097775 Ga0501080_0097775_589_1518 279
110 3300060353 Ga0501082_0193577 Ga0501082_0193577_328_1260 279
111 iso_pu_bacteria 2508501009 2508545792 279
112 iso_pu_bacteria 2508501042 2508694618 279
113 iso_pu_bacteria 2511231028 2511398380 279
114 iso_pu_bacteria 2513237092 2513624470 279
115 iso_pu_bacteria 2513237094 2513638665 279
116 iso_pu_bacteria 2513237095 2513649944 279
117 iso_pu_bacteria 2513237098 2513672529 279
118 iso_pu_bacteria 2513237102 2513702473 279
119 iso_pu_bacteria 2513237139 2513874239 279
120 iso_pu_bacteria 2513237161 2514009995 279
121 iso_pu_bacteria 2515154112 2515624455 279
122 iso_pu_bacteria 2524023205 2524438570 279
123 iso_pu_bacteria 2524023210 2524466687 279
124 iso_pu_bacteria 2528768022 2528850423 279
125 iso_pu_bacteria 2617270735 2617353864 279
126 iso_pu_bacteria 2617270741 2617374641 279
127 iso_pu_bacteria 2744054633 2745077204 279
128 iso_pu_bacteria 2791355196 2793059373 279
129 iso_pu_bacteria 2802429603 2805922129 279
130 iso_pu_bacteria 2816332527 2818240944 279
131 iso_pu_bacteria 2824600985 2824604622 279
132 iso_pu_bacteria 2824609381 2824616170 279
133 iso_pu_bacteria 2824653114 2824658371 279
134 iso_pu_bacteria 2824661429 2824667379 279
135 iso_pu_bacteria 2824671348 2824675542 279
136 iso_pu_bacteria 2824679649 2824686559 279
137 iso_pu_bacteria 2824687955 2824691764 279
138 iso_pu_bacteria 2824696289 2824698993 279
139 iso_pu_bacteria 2824704595 2824711685 279
140 iso_pu_bacteria 2824753945 2824761083 279
141 iso_pu_bacteria 2824763712 2824771800 279
142 iso_pu_bacteria 2824773399 2824779758 279
143 iso_pu_bacteria 2838122688 2838126100 279
144 iso_pu_bacteria 2841941048 2841942507 279
145 iso_pu_bacteria 2841949485 2841953143 279
146 iso_pu_bacteria 2841957949 2841960651 279
147 iso_pu_bacteria 2841966195 2841970833 279
148 iso_pu_bacteria 2841974524 2841977908 279
149 iso_pu_bacteria 2841983080 2841984527 279
150 iso_pu_bacteria 2842038055 2842041752 279
151 iso_pu_bacteria 2842045827 2842049794 279
152 iso_pu_bacteria 2844315083 2844321366 279
153 iso_pu_bacteria 2847930680 2847932047 279
154 iso_pu_bacteria 2847939898 2847943284 279
155 iso_pu_bacteria 2857509624 2857514715 279
156 iso_pu_bacteria 2874590934 2874595687 279
157 iso_pu_bacteria 2874612657 2874620313 279
158 iso_pu_bacteria 2874628541 2874630276 279
159 iso_pu_bacteria 2874645413 2874651681 279
160 iso_pu_bacteria 2876761206 2876767692 279
161 iso_pu_bacteria 2876771140 2876775882 279
162 iso_pu_bacteria 2876818435 2876821576 279
163 iso_pu_bacteria 2879074833 2879079973 279
164 iso_pu_bacteria 2879083081 2879085723 279
165 iso_pu_bacteria 2879099564 2879100892 279
166 iso_pu_bacteria 2879127579 2879134056 279
167 iso_pu_bacteria 2879142872 2879148541 279
168 iso_pu_bacteria 2881665667 2881669343 279
169 iso_pu_bacteria 2885192300 2885193860 279
170 iso_pu_bacteria 2885366525 2885374456 279
171 iso_pu_bacteria 2885383462 2885385887 279
172 iso_pu_bacteria 2888378607 2888387662 279
173 iso_pu_bacteria 2888388044 2888391501 279
174 iso_pu_bacteria 2888419890 2888426879 279
175 iso_pu_bacteria 2903727486 2903731444 279
176 iso_pu_bacteria 2903768456 2903775929 279
177 iso_pu_bacteria 2904711408 2904713583 279
178 iso_pu_bacteria 2906602504 2906607980 279
179 iso_pu_bacteria 2906610324 2906612392 279
180 iso_pu_bacteria 2906626472 2906633050 279
181 iso_pu_bacteria 2922368715 2922376649 279
182 iso_pu_bacteria 2922393267 2922398596 279
183 iso_pu_bacteria 2929615660 2929619848 279
184 iso_pu_bacteria 2929624759 2929629159 279
185 iso_pu_bacteria 2932784394 2932789709 279
186 iso_pu_bacteria 2932794094 2932796625 279
187 iso_pu_bacteria 2932801729 2932802593 279
188 iso_pu_bacteria 2932809354 2932817779 279
189 iso_pu_bacteria 2932818245 2932827110 279
190 iso_pu_bacteria 2932828146 2932835634 279
191 iso_pu_bacteria 2933577622 2933581766 279
192 iso_pu_bacteria 2935608549 2935613228 279
193 iso_pu_bacteria 2935616580 2935624592 279
194 iso_pu_bacteria 2935638405 2935647181 279
195 iso_pu_bacteria 2935648319 2935655598 279
196 iso_pu_bacteria 2935656913 2935664498 279
197 iso_pu_bacteria 2935665750 2935674356 279
198 iso_pu_bacteria 2935675223 2935684237 279
199 iso_pu_bacteria 2935684952 2935689108 279
200 iso_pu_bacteria 2935694250 2935697631 279
201 iso_pu_bacteria 2935703347 2935711345 279
202 iso_pu_bacteria 2935713505 2935720054 279
203 iso_pu_bacteria 2935722832 2935728329 279
204 iso_pu_bacteria 2935732158 2935737074 279
205 iso_pu_bacteria 2935741537 2935746865 279
206 iso_pu_bacteria 2935750917 2935757832 279
207 iso_pu_bacteria 2935760218 2935764210 279
208 iso_pu_bacteria 2935769743 2935775167 279
209 iso_pu_bacteria 2935777560 2935780069 279
210 iso_pu_bacteria 2935785616 2935790191 279
211 iso_pu_bacteria 2935793552 2935798767 279
212 iso_pu_bacteria 2935801545 2935809869 279
213 iso_pu_bacteria 2935810662 2935819350 279
214 iso_pu_bacteria 2935819856 2935824918 279
215 iso_pu_bacteria 2935827899 2935836605 279
216 iso_pu_bacteria 2935837841 2935846815 279
217 iso_pu_bacteria 2935847175 2935852138 279
218 iso_pu_bacteria 2935855204 2935863198 279
219 iso_pu_bacteria 2935864058 2935868667 279
220 iso_pu_bacteria 2935873716 2935879441 279
221 iso_pu_bacteria 2935883170 2935883596 279
222 iso_pu_bacteria 2935908558 2935911485 279
223 iso_pu_bacteria 2935916978 2935925402 279
224 iso_pu_bacteria 2935926038 2935928514 279
225 iso_pu_bacteria 2935934488 2935938159 279
226 iso_pu_bacteria 2935942939 2935945441 279
227 iso_pu_bacteria 2935951376 2935954053 279
228 iso_pu_bacteria 2935959822 2935965432 279
229 iso_pu_bacteria 2935967501 2935971679 279
230 iso_pu_bacteria 2935975950 2935980083 279
231 iso_pu_bacteria 2935984226 2935984244 279
232 iso_pu_bacteria 2935992306 2936000235 279
233 iso_pu_bacteria 2936002035 2936010277 279
234 iso_pu_bacteria 2936011229 2936018548 279
235 iso_pu_bacteria 2936019824 2936027066 279
236 iso_pu_bacteria 2936028420 2936035967 279
237 iso_pu_bacteria 2936037263 2936045973 279
238 iso_pu_bacteria 2936046547 2936054046 279
239 iso_pu_bacteria 2936055302 2936055324 279
240 iso_pu_bacteria 2940556831 2940563346 279
241 iso_pu_bacteria 2941531003 2941531936 279
242 iso_pu_bacteria 2941538514 2941547259 279
243 iso_pu_bacteria 3005483717 3005485978 279
244 iso_pu_bacteria 3005506211 3005506642 279
245 iso_pu_bacteria 3005594810 3005601718 279
246 iso_pu_bacteria 3005710791 3005717458 279
247 iso_pu_bacteria 3005718088 3005724399 279
248 iso_pu_bacteria 8016511872 8016519182 279
249 iso_pu_bacteria 8016530956 8016538711 279
250 iso_pu_bacteria 8016539877 8016542999 279
251 iso_pu_bacteria 8016548790 8016550291 279
252 iso_pu_bacteria 8016557553 8016558700 279
253 iso_pu_bacteria 8016575299 8016581056 279
254 iso_pu_bacteria 8016583857 8016587660 279
255 iso_pu_bacteria 8016595262 8016596677 279
256 iso_pu_bacteria 8016603502 8016607552 279
257 iso_pu_bacteria 8016613128 8016619342 279
258 iso_pu_bacteria 8016630954 8016636903 279
259 iso_pu_bacteria 8017057580 8017066322 279
260 iso_pu_bacteria 8019530166 8019538384 279
261 iso_pu_bacteria 8019538911 8019541438 279
262 iso_pu_bacteria 8019547302 8019549187 279
263 iso_pu_bacteria 8019576017 8019578296 279
264 iso_pu_bacteria 8019597564 8019605368 279
265 iso_pu_bacteria 8019608314 8019613175 279
266 iso_pu_bacteria 8019619141 8019623865 279
267 iso_pu_bacteria 8019629233 8019638179 279
268 iso_pu_bacteria 8019648815 8019651584 279
269 iso_pu_bacteria 8019659431 8019666096 279
270 iso_pu_bacteria 8019668869 8019675607 279
271 iso_pu_bacteria 8019678201 8019680492 279
272 iso_pu_bacteria 8019687851 8019695266 279
273 iso_pu_bacteria 8055742211 8055750400 279
274 iso_pu_bacteria 8056681323 8056685483 279
275 iso_pu_bacteria 8056967851 8056971819 279
276 3300009174 Ga0105241_10529071 Ga0105241_105290712 280
277 iso_pu_bacteria 2513237104 2513716789 280
278 iso_pu_bacteria 2824732956 2824739303 280
279 iso_pu_bacteria 2824746037 2824750387 280
280 iso_pu_bacteria 2874620515 2874624251 280
281 iso_pu_bacteria 2904666416 2904670962 280
282 iso_pu_bacteria 2908775508 2908777122 280
283 iso_pu_bacteria 3005587118 3005591800 280
284 3300003792 Ga0055540_1001304 Ga0055540_100130417 281
285 3300005289 Ga0065704_10088231 Ga0065704_100882313 281
286 3300005327 Ga0070658_10145326 Ga0070658_101453262 281
287 3300005336 Ga0070680_100251951 Ga0070680_1002519512 281
288 3300005366 Ga0070659_100043428 Ga0070659_1000434283 281
289 3300005563 Ga0068855_100256651 Ga0068855_1002566512 281
290 3300005616 Ga0068852_100016237 Ga0068852_1000162378 281
291 3300005983 Ga0081540_1015887 Ga0081540_10158874 281
292 3300005983 Ga0081540_1031359 Ga0081540_10313591 281
293 3300005983 Ga0081540_1041746 Ga0081540_10417463 281
294 3300007265 Ga0099794_10043155 Ga0099794_100431552 281
295 3300009147 Ga0114129_10157307 Ga0114129_101573072 281
296 3300009177 Ga0105248_10496096 Ga0105248_104960961 281
297 3300010375 Ga0105239_10169114 Ga0105239_101691142 281
298 3300013307 Ga0157372_10149868 Ga0157372_101498683 281
299 3300025303 Ga0209051_1000298 Ga0209051_100029819 281
300 3300025917 Ga0207660_10232901 Ga0207660_102329012 281
301 3300025932 Ga0207690_10074010 Ga0207690_100740103 281
302 3300025939 Ga0207665_10156926 Ga0207665_101569262 281
303 3300026142 Ga0207698_10268969 Ga0207698_102689692 281
304 3300031731 Ga0307405_10236767 Ga0307405_102367672 281
305 3300031911 Ga0307412_10349797 Ga0307412_103497972 281
306 3300033180 Ga0307510_10087981 Ga0307510_100879812 281
307 3300046455 Ga0495603_0017965 Ga0495603_0017965_1677_2552 281
308 3300046455 Ga0495603_0114087 Ga0495603_0114087_263_1129 281
309 3300047317 Ga0495604_0244404 Ga0495604_0244404_165_1034 281
310 3300047446 Ga0495679_007969 Ga0495679_007969_3496_4341 281
311 3300050507 nmdc:mga05p37_75724_c1 nmdc:mga05p37_75724_c1_1995_2876 281
312 3300053080 Ga0500635_0055288 Ga0500635_0055288_204_1079 281
313 3300053102 Ga0500554_067935 Ga0500554_067935_180_1055 281
314 3300053150 Ga0500603_003284 Ga0500603_003284_13_888 281
315 3300053153 Ga0500616_0015671 Ga0500616_0015671_1937_2830 281
316 iso_pu_bacteria 2508501128 2509146538 281
317 iso_pu_bacteria 2513237141 2513892408 281
318 iso_pu_bacteria 2738543031 2739349328 281
319 iso_pu_bacteria 2857524615 2857525612 281
320 iso_pu_bacteria 2919073203 2919074580 281
321 3300001989 JGI24739J22299_10004386 JGI24739J22299_100043865 282
322 3300001990 JGI24737J22298_10026694 JGI24737J22298_100266942 282
323 3300002067 JGI24735J21928_10029987 JGI24735J21928_100299872 282
324 3300003214 JGI25165J46597_1008266 JGI25165J46597_10082662 282
325 3300003214 JGI25165J46597_1009827 JGI25165J46597_10098272 282
326 3300003214 JGI25165J46597_1009894 JGI25165J46597_10098942 282
327 3300003215 JGI25153J46596_10009118 JGI25153J46596_100091187 282
328 3300003215 JGI25153J46596_10029846 JGI25153J46596_100298462 282
329 3300003322 rootL2_10124449 rootL2_101244492 282
330 3300003659 JGI25404J52841_10010825 JGI25404J52841_100108252 282
331 3300005262 Ga0065165_1003123 Ga0065165_10031237 282
332 3300005262 Ga0065165_1007216 Ga0065165_10072167 282
333 3300005262 Ga0065165_1010731 Ga0065165_10107314 282
334 3300005262 Ga0065165_1033623 Ga0065165_10336232 282
335 3300005331 Ga0070670_100223142 Ga0070670_1002231422 282
336 3300005347 Ga0070668_100116316 Ga0070668_1001163162 282
337 3300005347 Ga0070668_100448652 Ga0070668_1004486521 282
338 3300005353 Ga0070669_100238436 Ga0070669_1002384362 282
339 3300005354 Ga0070675_100309043 Ga0070675_1003090432 282
340 3300005355 Ga0070671_100241802 Ga0070671_1002418022 282
341 3300005367 Ga0070667_100163338 Ga0070667_1001633381 282
342 3300005436 Ga0070713_100228196 Ga0070713_1002281962 282
343 3300005439 Ga0070711_100010406 Ga0070711_1000104066 282
344 3300005455 Ga0070663_100160637 Ga0070663_1001606372 282
345 3300005457 Ga0070662_100121049 Ga0070662_1001210492 282
346 3300005518 Ga0070699_100382184 Ga0070699_1003821842 282
347 3300005530 Ga0070679_100613690 Ga0070679_1006136901 282
348 3300005539 Ga0068853_100026288 Ga0068853_1000262885 282
349 3300005539 Ga0068853_100269755 Ga0068853_1002697552 282
350 3300005539 Ga0068853_100368008 Ga0068853_1003680081 282
351 3300005548 Ga0070665_100155549 Ga0070665_1001555492 282
352 3300005548 Ga0070665_100499631 Ga0070665_1004996312 282
353 3300005549 Ga0070704_100241846 Ga0070704_1002418461 282
354 3300005563 Ga0068855_100300260 Ga0068855_1003002602 282
355 3300005577 Ga0068857_100056749 Ga0068857_1000567493 282
356 3300005577 Ga0068857_100060787 Ga0068857_1000607873 282
357 3300005578 Ga0068854_100008298 Ga0068854_1000082984 282
358 3300005578 Ga0068854_100017829 Ga0068854_1000178295 282
359 3300005614 Ga0068856_100019463 Ga0068856_1000194634 282
360 3300005616 Ga0068852_100326120 Ga0068852_1003261201 282
361 3300005616 Ga0068852_100448092 Ga0068852_1004480921 282
362 3300005618 Ga0068864_100487779 Ga0068864_1004877792 282
363 3300005718 Ga0068866_10093974 Ga0068866_100939742 282
364 3300005834 Ga0068851_10011168 Ga0068851_100111683 282
365 3300005841 Ga0068863_100406296 Ga0068863_1004062962 282
366 3300005842 Ga0068858_100511700 Ga0068858_1005117002 282
367 3300005981 Ga0081538_10036555 Ga0081538_100365552 282
368 3300005983 Ga0081540_1006936 Ga0081540_10069363 282
369 3300005983 Ga0081540_1010271 Ga0081540_101027111 282
370 3300005983 Ga0081540_1066406 Ga0081540_10664062 282
371 3300005985 Ga0081539_10039667 Ga0081539_100396672 282
372 3300006028 Ga0070717_10119675 Ga0070717_101196752 282
373 3300006038 Ga0075365_10146416 Ga0075365_101464162 282
374 3300006038 Ga0075365_10151624 Ga0075365_101516242 282
375 3300006038 Ga0075365_10184513 Ga0075365_101845132 282
376 3300006042 Ga0075368_10041629 Ga0075368_100416292 282
377 3300006042 Ga0075368_10068758 Ga0075368_100687582 282
378 3300006173 Ga0070716_100081468 Ga0070716_1000814682 282
379 3300006175 Ga0070712_100248704 Ga0070712_1002487042 282
380 3300006175 Ga0070712_100405837 Ga0070712_1004058372 282
381 3300006178 Ga0075367_10022959 Ga0075367_100229593 282
382 3300006178 Ga0075367_10051061 Ga0075367_100510612 282
383 3300006178 Ga0075367_10113608 Ga0075367_101136082 282
384 3300006178 Ga0075367_10131776 Ga0075367_101317762 282
385 3300006178 Ga0075367_10202456 Ga0075367_102024562 282
386 3300006942 Ga0099824_1008875 Ga0099824_100887515 282
387 3300006942 Ga0099824_1023890 Ga0099824_10238901 282
388 3300006943 Ga0099822_1017500 Ga0099822_10175007 282
389 3300009093 Ga0105240_10046064 Ga0105240_100460644 282
390 3300009093 Ga0105240_10538244 Ga0105240_105382442 282
391 3300009101 Ga0105247_10104696 Ga0105247_101046962 282
392 3300009148 Ga0105243_10485191 Ga0105243_104851911 282
393 3300009174 Ga0105241_10015112 Ga0105241_100151124 282
394 3300009176 Ga0105242_10205972 Ga0105242_102059722 282
395 3300009177 Ga0105248_10080990 Ga0105248_100809901 282
396 3300009545 Ga0105237_10044886 Ga0105237_100448864 282
397 3300009545 Ga0105237_10408045 Ga0105237_104080452 282
398 3300009551 Ga0105238_10025742 Ga0105238_100257425 282
399 3300009551 Ga0105238_10462551 Ga0105238_104625512 282
400 3300009553 Ga0105249_10692538 Ga0105249_106925381 282
401 3300010159 Ga0099796_10016875 Ga0099796_100168752 282
402 3300010375 Ga0105239_10271446 Ga0105239_102714462 282
403 3300010375 Ga0105239_10694216 Ga0105239_106942162 282
404 3300013306 Ga0163162_10773871 Ga0163162_107738712 282
405 3300014326 Ga0157380_10835908 Ga0157380_108359081 282
406 3300014968 Ga0157379_10107304 Ga0157379_101073043 282
407 3300021321 Ga0214542_1033238 Ga0214542_10332382 282
408 3300025230 Ga0209563_101581 Ga0209563_1015816 282
409 3300025253 Ga0209677_102936 Ga0209677_1029363 282
410 3300025254 Ga0209148_1000707 Ga0209148_10007075 282
411 3300025261 Ga0209233_1001624 Ga0209233_10016247 282
412 3300025261 Ga0209233_1010411 Ga0209233_10104112 282
413 3300025272 Ga0209455_1004030 Ga0209455_10040304 282
414 3300025272 Ga0209455_1005738 Ga0209455_10057385 282
415 3300025272 Ga0209455_1007958 Ga0209455_10079583 282
416 3300025272 Ga0209455_1012768 Ga0209455_10127682 282
417 3300025295 Ga0209564_1009431 Ga0209564_10094312 282
418 3300025297 Ga0209758_1000106 Ga0209758_1000106161 282
419 3300025297 Ga0209758_1002765 Ga0209758_100276515 282
420 3300025297 Ga0209758_1003053 Ga0209758_10030537 282
421 3300025297 Ga0209758_1011674 Ga0209758_10116747 282
422 3300025297 Ga0209758_1011887 Ga0209758_10118875 282
423 3300025297 Ga0209758_1069464 Ga0209758_10694641 282
424 3300025299 Ga0209256_1008328 Ga0209256_10083282 282
425 3300025302 Ga0207426_1000337 Ga0207426_100033727 282
426 3300025302 Ga0207426_1007201 Ga0207426_10072012 282
427 3300025302 Ga0207426_1009271 Ga0207426_10092713 282
428 3300025304 Ga0209257_1000684 Ga0209257_100068429 282
429 3300025321 Ga0207656_10035984 Ga0207656_100359842 282
430 3300025321 Ga0207656_10046534 Ga0207656_100465341 282
431 3300025898 Ga0207692_10070024 Ga0207692_100700242 282
432 3300025901 Ga0207688_10098160 Ga0207688_100981602 282
433 3300025904 Ga0207647_10009009 Ga0207647_100090097 282
434 3300025904 Ga0207647_10053238 Ga0207647_100532383 282
435 3300025907 Ga0207645_10133078 Ga0207645_101330782 282
436 3300025913 Ga0207695_10000478 Ga0207695_1000047815 282
437 3300025913 Ga0207695_10034396 Ga0207695_100343963 282
438 3300025913 Ga0207695_10142598 Ga0207695_101425983 282
439 3300025914 Ga0207671_10057143 Ga0207671_100571432 282
440 3300025914 Ga0207671_10063710 Ga0207671_100637103 282
441 3300025914 Ga0207671_10203488 Ga0207671_102034882 282
442 3300025915 Ga0207693_10293797 Ga0207693_102937972 282
443 3300025916 Ga0207663_10023479 Ga0207663_100234794 282
444 3300025919 Ga0207657_10113450 Ga0207657_101134501 282
445 3300025924 Ga0207694_10001415 Ga0207694_100014159 282
446 3300025924 Ga0207694_10177181 Ga0207694_101771812 282
447 3300025927 Ga0207687_10149563 Ga0207687_101495632 282
448 3300025933 Ga0207706_10251531 Ga0207706_102515312 282
449 3300025933 Ga0207706_10262690 Ga0207706_102626902 282
450 3300025934 Ga0207686_10295937 Ga0207686_102959371 282
451 3300025935 Ga0207709_10256222 Ga0207709_102562222 282
452 3300025937 Ga0207669_10224931 Ga0207669_102249312 282
453 3300025941 Ga0207711_10108494 Ga0207711_101084942 282
454 3300025941 Ga0207711_10195442 Ga0207711_101954422 282
455 3300025941 Ga0207711_10644284 Ga0207711_106442841 282
456 3300025949 Ga0207667_10011741 Ga0207667_100117413 282
457 3300025949 Ga0207667_10387248 Ga0207667_103872482 282
458 3300025972 Ga0207668_10042480 Ga0207668_100424803 282
459 3300025972 Ga0207668_10129694 Ga0207668_101296942 282
460 3300025981 Ga0207640_10060359 Ga0207640_100603592 282
461 3300025981 Ga0207640_10368608 Ga0207640_103686082 282
462 3300026067 Ga0207678_10079253 Ga0207678_100792532 282
463 3300026067 Ga0207678_10125020 Ga0207678_101250202 282
464 3300026067 Ga0207678_10329627 Ga0207678_103296271 282
465 3300026078 Ga0207702_10000003 Ga0207702_1000000320 282
466 3300026078 Ga0207702_10033457 Ga0207702_100334572 282
467 3300026078 Ga0207702_10211921 Ga0207702_102119212 282
468 3300026088 Ga0207641_10249261 Ga0207641_102492612 282
469 3300026116 Ga0207674_10009035 Ga0207674_100090356 282
470 3300026116 Ga0207674_10044466 Ga0207674_100444662 282
471 3300026116 Ga0207674_10175694 Ga0207674_101756941 282
472 3300026142 Ga0207698_10088283 Ga0207698_100882833 282
473 3300026142 Ga0207698_10406542 Ga0207698_104065422 282
474 3300026142 Ga0207698_10623316 Ga0207698_106233162 282
475 3300027296 Ga0209389_1000016 Ga0209389_100001649 282
476 3300027296 Ga0209389_1000027 Ga0209389_100002796 282
477 3300027357 Ga0209589_1000005 Ga0209589_1000005307 282
478 3300027357 Ga0209589_1000031 Ga0209589_1000031108 282
479 3300027361 Ga0209489_100005 Ga0209489_100005307 282
480 3300027361 Ga0209489_100057 Ga0209489_10005739 282
481 3300027361 Ga0209489_100063 Ga0209489_1000637 282
482 3300027363 Ga0209700_100006 Ga0209700_100006307 282
483 3300027363 Ga0209700_100012 Ga0209700_10001250 282
484 3300028379 Ga0268266_10086610 Ga0268266_100866102 282
485 3300028379 Ga0268266_10676159 Ga0268266_106761591 282
486 3300031235 Ga0265330_10056386 Ga0265330_100563862 282
487 3300031250 Ga0265331_10092294 Ga0265331_100922942 282
488 3300031616 Ga0307508_10221869 Ga0307508_102218691 282
489 3300031616 Ga0307508_10332828 Ga0307508_103328281 282
490 3300031711 Ga0265314_10022030 Ga0265314_100220303 282
491 3300031712 Ga0265342_10013040 Ga0265342_100130404 282
492 3300031730 Ga0307516_10077415 Ga0307516_100774154 282
493 3300031730 Ga0307516_10117287 Ga0307516_101172872 282
494 3300031730 Ga0307516_10199918 Ga0307516_101999183 282
495 3300031901 Ga0307406_10366718 Ga0307406_103667182 282
496 3300033179 Ga0307507_10062098 Ga0307507_100620984 282
497 3300033180 Ga0307510_10007708 Ga0307510_1000770810 282
498 3300033180 Ga0307510_10015767 Ga0307510_100157673 282
499 3300033180 Ga0307510_10204610 Ga0307510_102046102 282
500 3300033442 Ga0315911_1000005 Ga0315911_1000005269 282
501 3300035112 Ga0373932_0016069 Ga0373932_0016069_1009_1878 282
502 3300035171 Ga0373946_0059032 Ga0373946_0059032_191_1063 282
503 3300035241 Ga0373961_0027281 Ga0373961_0027281_24_893 282
504 3300035691 Ga0373931_0016534 Ga0373931_0016534_634_1503 282
505 3300035725 Ga0373947_0083172 Ga0373947_0083172_248_1120 282
506 3300039437 Ga0436365_0816185 Ga0436365_0816185_80_952 282
507 3300041451 Ga0451791_0675706 Ga0451791_0675706_111_974 282
508 3300044656 Ga0466969_0016241 Ga0466969_0016241_979_1842 282
509 3300044658 Ga0466972_0000585 Ga0466972_0000585_16594_17457 282
510 3300044684 Ga0466966_0000720 Ga0466966_0000720_11731_12594 282
511 3300044693 Ga0466961_0000136 Ga0466961_0000136_27305_28168 282
512 3300044694 Ga0466963_0047541 Ga0466963_0047541_351_1214 282
513 3300044765 Ga0466970_0091748 Ga0466970_0091748_259_1131 282
514 3300044842 Ga0466957_0070496 Ga0466957_0070496_128_1000 282
515 3300044842 Ga0466957_0198439 Ga0466957_0198439_82_954 282
516 3300045049 Ga0466959_0030496 Ga0466959_0030496_859_1722 282
517 3300045049 Ga0466959_0132374 Ga0466959_0132374_770_1642 282
518 3300045976 Ga0466967_0090376 Ga0466967_0090376_12_875 282
519 3300045976 Ga0466967_0118618 Ga0466967_0118618_991_1863 282
520 3300045976 Ga0466967_0257117 Ga0466967_0257117_239_1114 282
521 3300046455 Ga0495603_0036375 Ga0495603_0036375_1861_2724 282
522 3300046460 Ga0495638_0016562 Ga0495638_0016562_3165_4028 282
523 3300046460 Ga0495638_0025345 Ga0495638_0025345_2667_3536 282
524 3300046461 Ga0495641_0077094 Ga0495641_0077094_273_1142 282
525 3300046474 Ga0495605_0072285 Ga0495605_0072285_709_1572 282
526 3300046477 Ga0495664_0271384 Ga0495664_0271384_99_971 282
527 3300046492 Ga0495585_0136242 Ga0495585_0136242_215_1078 282
528 3300046500 Ga0495596_0104938 Ga0495596_0104938_48_917 282
529 3300046507 Ga0495606_0024749 Ga0495606_0024749_2671_3534 282
530 3300046512 Ga0495610_0055778 Ga0495610_0055778_236_1099 282
531 3300046515 Ga0495620_0089680 Ga0495620_0089680_312_1175 282
532 3300046518 Ga0495631_0119821 Ga0495631_0119821_60_932 282
533 3300046519 Ga0495632_0178900 Ga0495632_0178900_35_901 282
534 3300046522 Ga0495643_0021450 Ga0495643_0021450_1353_2216 282
535 3300046524 Ga0495648_0118424 Ga0495648_0118424_334_1197 282
536 3300046538 Ga0495609_0094911 Ga0495609_0094911_313_1176 282
537 3300046538 Ga0495609_0126024 Ga0495609_0126024_79_942 282
538 3300046557 Ga0495622_0009820 Ga0495622_0009820_260_1123 282
539 3300046557 Ga0495622_0061671 Ga0495622_0061671_166_1029 282
540 3300046557 Ga0495622_0076200 Ga0495622_0076200_265_1134 282
541 3300046616 Ga0495668_0024106 Ga0495668_0024106_2402_3265 282
542 3300046616 Ga0495668_0067864 Ga0495668_0067864_1049_1915 282
543 3300046616 Ga0495668_0098762 Ga0495668_0098762_324_1193 282
544 3300046660 Ga0495625_0236326 Ga0495625_0236326_16_885 282
545 3300046663 Ga0495635_0093517 Ga0495635_0093517_556_1425 282
546 3300046684 Ga0495669_0139417 Ga0495669_0139417_205_1074 282
547 3300047315 Ga0495581_0167462 Ga0495581_0167462_391_1260 282
548 3300047321 Ga0495676_0224246 Ga0495676_0224246_246_1118 282
549 3300047443 Ga0495687_016734 Ga0495687_016734_2439_3302 282
550 3300048903 Ga0496100_0012991 Ga0496100_0012991_767_1630 282
551 3300048904 Ga0496101_0130902 Ga0496101_0130902_174_1043 282
552 3300048904 Ga0496101_0203088 Ga0496101_0203088_173_1036 282
553 3300048904 Ga0496101_0250297 Ga0496101_0250297_260_1123 282
554 3300048905 Ga0496102_0051154 Ga0496102_0051154_2206_3069 282
555 3300048905 Ga0496102_0067221 Ga0496102_0067221_478_1347 282
556 3300048905 Ga0496102_0719152 Ga0496102_0719152_31_900 282
557 3300048906 Ga0496103_0116426 Ga0496103_0116426_778_1641 282
558 3300048906 Ga0496103_0276307 Ga0496103_0276307_180_1049 282
559 3300048907 Ga0496104_0029597 Ga0496104_0029597_667_1530 282
560 3300048907 Ga0496104_0108179 Ga0496104_0108179_1596_2465 282
561 3300048907 Ga0496104_0126288 Ga0496104_0126288_1135_2004 282
562 3300048908 Ga0496105_0087969 Ga0496105_0087969_722_1585 282
563 3300048908 Ga0496105_0123081 Ga0496105_0123081_943_1806 282
564 3300048909 Ga0496106_0001280 Ga0496106_0001280_3331_4194 282
565 3300048909 Ga0496106_0066732 Ga0496106_0066732_1440_2303 282
566 3300048909 Ga0496106_0234646 Ga0496106_0234646_527_1390 282
567 3300048910 Ga0496107_0202501 Ga0496107_0202501_250_1113 282
568 3300048910 Ga0496107_0226803 Ga0496107_0226803_323_1195 282
569 3300048911 Ga0496108_0031333 Ga0496108_0031333_65_928 282
570 3300048912 Ga0496109_0240372 Ga0496109_0240372_382_1245 282
571 3300048912 Ga0496109_0284205 Ga0496109_0284205_52_921 282
572 3300048913 Ga0496110_0056755 Ga0496110_0056755_1135_2004 282
573 3300048913 Ga0496110_0186033 Ga0496110_0186033_253_1116 282
574 3300048913 Ga0496110_0245272 Ga0496110_0245272_263_1126 282
575 3300048913 Ga0496110_0611197 Ga0496110_0611197_46_909 282
576 3300048914 Ga0496111_0057198 Ga0496111_0057198_1449_2318 282
577 3300048914 Ga0496111_0208005 Ga0496111_0208005_534_1397 282
578 3300048915 Ga0496112_0027302 Ga0496112_0027302_2713_3576 282
579 3300048915 Ga0496112_0144708 Ga0496112_0144708_781_1650 282
580 3300048915 Ga0496112_0503338 Ga0496112_0503338_30_893 282
581 3300048918 Ga0496115_0263750 Ga0496115_0263750_137_1000 282
582 3300048919 Ga0496116_0127078 Ga0496116_0127078_320_1183 282
583 3300048920 Ga0496117_0028354 Ga0496117_0028354_686_1549 282
584 3300048920 Ga0496117_0089657 Ga0496117_0089657_36_899 282
585 3300048921 Ga0496118_0001458 Ga0496118_0001458_19360_20223 282
586 3300048921 Ga0496118_0031386 Ga0496118_0031386_3468_4331 282
587 3300048922 Ga0496119_0197794 Ga0496119_0197794_11_874 282
588 3300048923 Ga0496120_0042462 Ga0496120_0042462_1645_2508 282
589 3300048924 Ga0496121_0000146 Ga0496121_0000146_63222_64085 282
590 3300048924 Ga0496121_0039521 Ga0496121_0039521_2943_3815 282
591 3300048924 Ga0496121_0073560 Ga0496121_0073560_247_1119 282
592 3300048924 Ga0496121_0079535 Ga0496121_0079535_1549_2418 282
593 3300048924 Ga0496121_0109129 Ga0496121_0109129_938_1801 282
594 3300048924 Ga0496121_0261049 Ga0496121_0261049_149_1021 282
595 3300048927 Ga0496124_0002217 Ga0496124_0002217_21259_22122 282
596 3300048927 Ga0496124_0330131 Ga0496124_0330131_77_940 282
597 3300048928 Ga0496125_0056870 Ga0496125_0056870_2070_2933 282
598 3300048929 Ga0496126_0003212 Ga0496126_0003212_2934_3803 282
599 3300048929 Ga0496126_0004243 Ga0496126_0004243_1260_2144 282
600 3300048929 Ga0496126_0010429 Ga0496126_0010429_1254_2126 282
601 3300048929 Ga0496126_0016652 Ga0496126_0016652_1351_2214 282
602 3300048929 Ga0496126_0142660 Ga0496126_0142660_258_1121 282
603 3300048929 Ga0496126_0252657 Ga0496126_0252657_29_892 282
604 3300048929 Ga0496126_0316293 Ga0496126_0316293_204_1076 282
605 3300050492 nmdc:mga0yw44_186447_c1 nmdc:mga0yw44_186447_c1_440_1303 282
606 3300050492 nmdc:mga0yw44_238276_c1 nmdc:mga0yw44_238276_c1_283_1155 282
607 3300050494 nmdc:mga06z11_185854_c1 nmdc:mga06z11_185854_c1_66_929 282
608 3300050494 nmdc:mga06z11_64715_c1 nmdc:mga06z11_64715_c1_158_1030 282
609 3300050516 nmdc:mga0sz30_43399_c1 nmdc:mga0sz30_43399_c1_700_1563 282
610 3300053087 Ga0500643_000052 Ga0500643_000052_88274_89137 282
611 3300053091 Ga0500647_0020775 Ga0500647_0020775_1562_2425 282
612 3300053093 Ga0500651_0018968 Ga0500651_0018968_1470_2333 282
613 3300053094 Ga0500566_0039993 Ga0500566_0039993_921_1793 282
614 3300053102 Ga0500554_028832 Ga0500554_028832_567_1439 282
615 3300053103 Ga0500555_001634 Ga0500555_001634_2593_3456 282
616 3300053104 Ga0500556_0003305 Ga0500556_0003305_602_1465 282
617 3300053104 Ga0500556_0094648 Ga0500556_0094648_188_1057 282
618 3300053105 Ga0500557_000096 Ga0500557_000096_294_1157 282
619 3300053109 Ga0500569_001480 Ga0500569_001480_1601_2464 282
620 3300053111 Ga0500572_012239 Ga0500572_012239_1025_1888 282
621 3300053119 Ga0500595_000728 Ga0500595_000728_8355_9227 282
622 3300053119 Ga0500595_012442 Ga0500595_012442_478_1347 282
623 3300053130 Ga0500642_0000083 Ga0500642_0000083_49618_50481 282
624 3300053134 Ga0500658_0026515 Ga0500658_0026515_273_1136 282
625 3300053136 Ga0500559_0037151 Ga0500559_0037151_1164_2027 282
626 3300053138 Ga0500564_067301 Ga0500564_067301_310_1173 282
627 3300053142 Ga0500577_0050831 Ga0500577_0050831_160_1023 282
628 3300053153 Ga0500616_0060448 Ga0500616_0060448_795_1658 282
629 3300053156 Ga0500622_0012122 Ga0500622_0012122_1598_2461 282
630 3300053162 Ga0500638_007140 Ga0500638_007140_131_1003 282
631 3300053177 Ga0500636_0000232 Ga0500636_0000232_21100_21963 282
632 3300053177 Ga0500636_0024967 Ga0500636_0024967_2475_3347 282
633 3300053177 Ga0500636_0175110 Ga0500636_0175110_261_1124 282
634 3300053178 Ga0500637_0000080 Ga0500637_0000080_14112_14984 282
635 3300053178 Ga0500637_0188357 Ga0500637_0188357_282_1145 282
636 3300053729 Ga0500625_026577 Ga0500625_026577_138_1001 282
637 3300053730 Ga0500645_004073 Ga0500645_004073_4663_5535 282
638 3300053730 Ga0500645_052144 Ga0500645_052144_138_1001 282
639 3300053730 Ga0500645_052415 Ga0500645_052415_109_981 282
640 3300053731 Ga0500609_000805 Ga0500609_000805_1942_2805 282
641 3300053736 Ga0500599_002446 Ga0500599_002446_1006_1869 282
642 3300053737 Ga0500601_000108 Ga0500601_000108_12903_13766 282
643 3300054114 Ga0501084_0016246 Ga0501084_0016246_2302_3222 282
644 iso_pu_bacteria 2523231067 2523467875 282
645 3300003215 JGI25153J46596_10013220 JGI25153J46596_100132205 283
646 3300005329 Ga0070683_100058153 Ga0070683_1000581533 283
647 3300005334 Ga0068869_100177413 Ga0068869_1001774131 283
648 3300005336 Ga0070680_100007323 Ga0070680_10000732311 283
649 3300005337 Ga0070682_100101303 Ga0070682_1001013032 283
650 3300005338 Ga0068868_100219698 Ga0068868_1002196981 283
651 3300005339 Ga0070660_100003353 Ga0070660_10000335311 283
652 3300005340 Ga0070689_100397977 Ga0070689_1003979771 283
653 3300005344 Ga0070661_100029726 Ga0070661_1000297266 283
654 3300005347 Ga0070668_100399295 Ga0070668_1003992952 283
655 3300005355 Ga0070671_100387593 Ga0070671_1003875932 283
656 3300005434 Ga0070709_10016287 Ga0070709_100162874 283
657 3300005436 Ga0070713_100024272 Ga0070713_1000242724 283
658 3300005437 Ga0070710_10039645 Ga0070710_100396452 283
659 3300005456 Ga0070678_100255989 Ga0070678_1002559892 283
660 3300005458 Ga0070681_10033490 Ga0070681_100334904 283
661 3300005530 Ga0070679_100075614 Ga0070679_1000756141 283
662 3300005535 Ga0070684_100006286 Ga0070684_1000062865 283
663 3300005535 Ga0070684_100025288 Ga0070684_1000252883 283
664 3300005539 Ga0068853_100001496 Ga0068853_10000149617 283
665 3300005549 Ga0070704_100192822 Ga0070704_1001928222 283
666 3300005563 Ga0068855_100031854 Ga0068855_1000318549 283
667 3300005564 Ga0070664_100503876 Ga0070664_1005038762 283
668 3300005577 Ga0068857_100004210 Ga0068857_10000421013 283
669 3300005578 Ga0068854_100061411 Ga0068854_1000614114 283
670 3300005614 Ga0068856_100006410 Ga0068856_1000064106 283
671 3300005614 Ga0068856_100077437 Ga0068856_1000774372 283
672 3300005614 Ga0068856_100547953 Ga0068856_1005479532 283
673 3300005615 Ga0070702_100275930 Ga0070702_1002759301 283
674 3300005617 Ga0068859_100178873 Ga0068859_1001788733 283
675 3300005618 Ga0068864_100133624 Ga0068864_1001336241 283
676 3300005719 Ga0068861_100489562 Ga0068861_1004895622 283
677 3300005842 Ga0068858_100334100 Ga0068858_1003341002 283
678 3300005842 Ga0068858_100400955 Ga0068858_1004009551 283
679 3300005844 Ga0068862_100145350 Ga0068862_1001453502 283
680 3300005983 Ga0081540_1005016 Ga0081540_10050163 283
681 3300005983 Ga0081540_1005578 Ga0081540_10055785 283
682 3300005983 Ga0081540_1005788 Ga0081540_10057888 283
683 3300006028 Ga0070717_10105321 Ga0070717_101053212 283
684 3300006173 Ga0070716_100010967 Ga0070716_1000109676 283
685 3300006175 Ga0070712_100028666 Ga0070712_1000286663 283
686 3300006881 Ga0068865_100057630 Ga0068865_1000576302 283
687 3300006931 Ga0097620_100178880 Ga0097620_1001788803 283
688 3300009098 Ga0105245_10071302 Ga0105245_100713024 283
689 3300009176 Ga0105242_10184248 Ga0105242_101842482 283
690 3300009545 Ga0105237_10008895 Ga0105237_1000889511 283
691 3300009545 Ga0105237_10356681 Ga0105237_103566812 283
692 3300009551 Ga0105238_10026375 Ga0105238_100263755 283
693 3300010375 Ga0105239_10008167 Ga0105239_1000816710 283
694 3300010375 Ga0105239_10414628 Ga0105239_104146281 283
695 3300011119 Ga0105246_10067767 Ga0105246_100677672 283
696 3300013104 Ga0157370_10054683 Ga0157370_100546834 283
697 3300013105 Ga0157369_10006096 Ga0157369_1000609616 283
698 3300013296 Ga0157374_10199007 Ga0157374_101990072 283
699 3300013306 Ga0163162_10064929 Ga0163162_100649292 283
700 3300013306 Ga0163162_10586244 Ga0163162_105862441 283
701 3300014969 Ga0157376_10042518 Ga0157376_100425183 283
702 3300025297 Ga0209758_1002009 Ga0209758_100200922 283
703 3300025297 Ga0209758_1006390 Ga0209758_10063906 283
704 3300025898 Ga0207692_10001396 Ga0207692_100013969 283
705 3300025901 Ga0207688_10048296 Ga0207688_100482963 283
706 3300025905 Ga0207685_10004095 Ga0207685_100040953 283
707 3300025906 Ga0207699_10038984 Ga0207699_100389843 283
708 3300025907 Ga0207645_10282096 Ga0207645_102820962 283
709 3300025909 Ga0207705_10080452 Ga0207705_100804522 283
710 3300025912 Ga0207707_10001933 Ga0207707_1000193317 283
711 3300025914 Ga0207671_10037028 Ga0207671_100370283 283
712 3300025914 Ga0207671_10047710 Ga0207671_100477103 283
713 3300025915 Ga0207693_10020323 Ga0207693_100203232 283
714 3300025916 Ga0207663_10001112 Ga0207663_100011129 283
715 3300025917 Ga0207660_10009206 Ga0207660_100092062 283
716 3300025919 Ga0207657_10005821 Ga0207657_100058211 283
717 3300025921 Ga0207652_10070273 Ga0207652_100702733 283
718 3300025924 Ga0207694_10022943 Ga0207694_100229433 283
719 3300025928 Ga0207700_10214960 Ga0207700_102149601 283
720 3300025938 Ga0207704_10244042 Ga0207704_102440422 283
721 3300025939 Ga0207665_10000703 Ga0207665_1000070311 283
722 3300025942 Ga0207689_10038013 Ga0207689_100380135 283
723 3300025944 Ga0207661_10000171 Ga0207661_1000017139 283
724 3300025944 Ga0207661_10030341 Ga0207661_100303413 283
725 3300025945 Ga0207679_10384077 Ga0207679_103840772 283
726 3300025949 Ga0207667_10013826 Ga0207667_1001382611 283
727 3300026023 Ga0207677_10061516 Ga0207677_100615162 283
728 3300026035 Ga0207703_10345982 Ga0207703_103459822 283
729 3300026041 Ga0207639_10008009 Ga0207639_100080093 283
730 3300026067 Ga0207678_10014592 Ga0207678_100145927 283
731 3300026067 Ga0207678_10027182 Ga0207678_100271822 283
732 3300026078 Ga0207702_10000014 Ga0207702_10000014254 283
733 3300026078 Ga0207702_10106532 Ga0207702_101065322 283
734 3300026078 Ga0207702_10420068 Ga0207702_104200681 283
735 3300026116 Ga0207674_10004961 Ga0207674_1000496113 283
736 3300026121 Ga0207683_10223320 Ga0207683_102233202 283
737 3300026142 Ga0207698_10120408 Ga0207698_101204082 283
738 3300028380 Ga0268265_10043874 Ga0268265_100438743 283
739 3300028556 Ga0265337_1009916 Ga0265337_10099163 283
740 3300028563 Ga0265319_1005843 Ga0265319_10058435 283
741 3300028573 Ga0265334_10011705 Ga0265334_100117053 283
742 3300028653 Ga0265323_10009578 Ga0265323_100095784 283
743 3300028666 Ga0265336_10000395 Ga0265336_1000039526 283
744 3300028800 Ga0265338_10000018 Ga0265338_10000018267 283
745 3300031507 Ga0307509_10337852 Ga0307509_103378522 283
746 3300031711 Ga0265314_10022428 Ga0265314_100224286 283
747 3300035086 Ga0373934_0004936 Ga0373934_0004936_2784_3665 283
748 3300035118 Ga0373954_0002374 Ga0373954_0002374_5264_6145 283
749 3300035119 Ga0373956_0038676 Ga0373956_0038676_598_1479 283
750 3300035120 Ga0373957_0008219 Ga0373957_0008219_60_941 283
751 3300035170 Ga0373943_0018713 Ga0373943_0018713_1580_2455 283
752 3300035172 Ga0373955_0000590 Ga0373955_0000590_11933_12814 283
753 3300035410 Ga0373924_0042035 Ga0373924_0042035_711_1592 283
754 3300035695 Ga0373927_0036611 Ga0373927_0036611_1951_3030 283
755 3300035724 Ga0373933_0044344 Ga0373933_0044344_1282_2163 283
756 3300035725 Ga0373947_0162647 Ga0373947_0162647_367_1242 283
757 3300037418 Ga0395900_0000753 Ga0395900_0000753_34793_35659 283
758 3300037418 Ga0395900_0034589 Ga0395900_0034589_3600_4475 283
759 3300037466 Ga0395898_0005579 Ga0395898_0005579_2956_3822 283
760 3300037471 Ga0395905_0095802 Ga0395905_0095802_734_1600 283
761 3300038443 Ga0395901_0290360 Ga0395901_0290360_478_1344 283
762 3300045976 Ga0466967_0049868 Ga0466967_0049868_1277_2152 283
763 3300046454 Ga0495592_0007391 Ga0495592_0007391_3921_4802 283
764 3300046455 Ga0495603_0046931 Ga0495603_0046931_1494_2369 283
765 3300046462 Ga0495651_0009620 Ga0495651_0009620_3157_4038 283
766 3300046463 Ga0495653_0017260 Ga0495653_0017260_62_943 283
767 3300046475 Ga0495639_0179251 Ga0495639_0179251_67_942 283
768 3300046477 Ga0495664_0009047 Ga0495664_0009047_145_1014 283
769 3300046477 Ga0495664_0011721 Ga0495664_0011721_2709_3590 283
770 3300046511 Ga0495608_0048870 Ga0495608_0048870_426_1307 283
771 3300046512 Ga0495610_0144162 Ga0495610_0144162_76_963 283
772 3300046513 Ga0495616_0149186 Ga0495616_0149186_49_936 283
773 3300046516 Ga0495628_0011834 Ga0495628_0011834_3222_4103 283
774 3300046529 Ga0495652_0033670 Ga0495652_0033670_3472_4353 283
775 3300046533 Ga0495640_0009547 Ga0495640_0009547_5707_6588 283
776 3300046536 Ga0495587_0027506 Ga0495587_0027506_26_907 283
777 3300046543 Ga0495645_0007861 Ga0495645_0007861_4031_4900 283
778 3300046543 Ga0495645_0009133 Ga0495645_0009133_3482_4363 283
779 3300046558 Ga0495633_0052517 Ga0495633_0052517_650_1537 283
780 3300046559 Ga0495667_0035440 Ga0495667_0035440_1095_1976 283
781 3300046615 Ga0495656_0042832 Ga0495656_0042832_333_1220 283
782 3300046642 Ga0495634_0009379 Ga0495634_0009379_1203_2084 283
783 3300046663 Ga0495635_0007423 Ga0495635_0007423_973_1854 283
784 3300046664 Ga0495659_0081824 Ga0495659_0081824_264_1151 283
785 3300046675 Ga0495657_0016949 Ga0495657_0016949_3957_4838 283
786 3300046678 Ga0495599_0019799 Ga0495599_0019799_3194_4075 283
787 3300046678 Ga0495599_0051324 Ga0495599_0051324_548_1417 283
788 3300046679 Ga0495623_0021928 Ga0495623_0021928_118_999 283
789 3300046680 Ga0495646_0046922 Ga0495646_0046922_711_1592 283
790 3300046684 Ga0495669_0108507 Ga0495669_0108507_75_962 283
791 3300046692 Ga0495671_0100551 Ga0495671_0100551_342_1229 283
792 3300046794 Ga0495589_0136929 Ga0495589_0136929_213_1100 283
793 3300046809 Ga0495600_0031062 Ga0495600_0031062_2489_3370 283
794 3300047317 Ga0495604_0020133 Ga0495604_0020133_2425_3306 283
795 3300047319 Ga0495674_0121079 Ga0495674_0121079_1231_2112 283
796 3300047322 Ga0495680_0014448 Ga0495680_0014448_26_907 283
797 3300047471 Ga0495684_0073127 Ga0495684_0073127_781_1662 283
798 3300048904 Ga0496101_0003670 Ga0496101_0003670_1992_2867 283
799 3300048905 Ga0496102_0001403 Ga0496102_0001403_9202_10077 283
800 3300048907 Ga0496104_0301812 Ga0496104_0301812_107_982 283
801 3300048908 Ga0496105_0076936 Ga0496105_0076936_430_1305 283
802 3300048909 Ga0496106_0011375 Ga0496106_0011375_5222_6097 283
803 3300048913 Ga0496110_0078391 Ga0496110_0078391_1110_1985 283
804 3300048913 Ga0496110_0146918 Ga0496110_0146918_1208_2083 283
805 3300048914 Ga0496111_0004711 Ga0496111_0004711_2701_3576 283
806 3300048914 Ga0496111_0369052 Ga0496111_0369052_60_929 283
807 3300048915 Ga0496112_0199695 Ga0496112_0199695_831_1706 283
808 3300048916 Ga0496113_0093556 Ga0496113_0093556_44_919 283
809 3300048917 Ga0496114_0069047 Ga0496114_0069047_220_1095 283
810 3300048918 Ga0496115_0004202 Ga0496115_0004202_8859_9734 283
811 3300048928 Ga0496125_0255755 Ga0496125_0255755_57_932 283
812 3300048929 Ga0496126_0398518 Ga0496126_0398518_213_1088 283
813 3300053077 Ga0495601_0032293 Ga0495601_0032293_1483_2364 283
814 3300053077 Ga0495601_0108477 Ga0495601_0108477_273_1142 283
815 3300053078 Ga0495612_0097656 Ga0495612_0097656_308_1177 283
816 3300053083 Ga0495655_0007769 Ga0495655_0007769_841_1716 283
817 3300053084 Ga0495595_0061912 Ga0495595_0061912_90_971 283
818 3300053085 Ga0495619_0077752 Ga0495619_0077752_118_999 283
819 iso_pu_bacteria 2602042107 2603860653 283
820 iso_pu_bacteria 2871282230 2871286099 283
821 iso_pu_bacteria 8006926726 8006927298 283
822 3300005335 Ga0070666_10116344 Ga0070666_101163442 284
823 3300005434 Ga0070709_10004499 Ga0070709_100044998 284
824 3300005435 Ga0070714_100032403 Ga0070714_1000324035 284
825 3300005436 Ga0070713_100097488 Ga0070713_1000974882 284
826 3300005437 Ga0070710_10003046 Ga0070710_100030469 284
827 3300005457 Ga0070662_100026265 Ga0070662_1000262654 284
828 3300005548 Ga0070665_100367819 Ga0070665_1003678192 284
829 3300005617 Ga0068859_100135138 Ga0068859_1001351383 284
830 3300005843 Ga0068860_100003385 Ga0068860_1000033859 284
831 3300005983 Ga0081540_1004705 Ga0081540_10047052 284
832 3300006173 Ga0070716_100079528 Ga0070716_1000795282 284
833 3300006931 Ga0097620_100135137 Ga0097620_1001351372 284
834 3300009174 Ga0105241_10240858 Ga0105241_102408582 284
835 3300009177 Ga0105248_10579251 Ga0105248_105792512 284
836 3300009545 Ga0105237_10183321 Ga0105237_101833212 284
837 3300014969 Ga0157376_10436292 Ga0157376_104362922 284
838 3300021321 Ga0214542_1000009 Ga0214542_1000009214 284
839 3300021324 Ga0214545_1000007 Ga0214545_100000728 284
840 3300021324 Ga0214545_1039271 Ga0214545_10392712 284
841 3300021327 Ga0214543_1000020 Ga0214543_1000020214 284
842 3300021327 Ga0214543_1040577 Ga0214543_10405772 284
843 3300021358 Ga0213873_10002858 Ga0213873_100028584 284
844 3300021384 Ga0213876_10001108 Ga0213876_100011084 284
845 3300025903 Ga0207680_10165964 Ga0207680_101659642 284
846 3300025915 Ga0207693_10027576 Ga0207693_100275766 284
847 3300025916 Ga0207663_10067343 Ga0207663_100673432 284
848 3300025928 Ga0207700_10064270 Ga0207700_100642702 284
849 3300025929 Ga0207664_10313407 Ga0207664_103134072 284
850 3300025933 Ga0207706_10154120 Ga0207706_101541202 284
851 3300025939 Ga0207665_10091630 Ga0207665_100916302 284
852 3300026035 Ga0207703_10554506 Ga0207703_105545061 284
853 3300026078 Ga0207702_10319646 Ga0207702_103196462 284
854 3300026142 Ga0207698_10275638 Ga0207698_102756382 284
855 3300028379 Ga0268266_10359651 Ga0268266_103596512 284
856 3300028381 Ga0268264_10000042 Ga0268264_1000004214 284
857 3300028381 Ga0268264_10380313 Ga0268264_103803132 284
858 3300031249 Ga0265339_10004193 Ga0265339_100041939 284
859 3300031456 Ga0307513_10072122 Ga0307513_100721222 284
860 3300031507 Ga0307509_10006260 Ga0307509_1000626015 284
861 3300031507 Ga0307509_10137057 Ga0307509_101370572 284
862 3300031616 Ga0307508_10000125 Ga0307508_1000012565 284
863 3300031616 Ga0307508_10343203 Ga0307508_103432031 284
864 3300031730 Ga0307516_10113165 Ga0307516_101131654 284
865 3300033180 Ga0307510_10206472 Ga0307510_102064722 284
866 3300035695 Ga0373927_0014600 Ga0373927_0014600_534_1403 284
867 3300037068 Ga0373925_0284792 Ga0373925_0284792_380_1249 284
868 3300044706 Ga0466964_0018290 Ga0466964_0018290_1037_1906 284
869 3300046459 Ga0495629_0021300 Ga0495629_0021300_1197_2066 284
870 3300046462 Ga0495651_0065835 Ga0495651_0065835_342_1211 284
871 3300046474 Ga0495605_0145814 Ga0495605_0145814_105_974 284
872 3300046477 Ga0495664_0018996 Ga0495664_0018996_2408_3277 284
873 3300046506 Ga0495583_0093806 Ga0495583_0093806_102_971 284
874 3300046507 Ga0495606_0012721 Ga0495606_0012721_1749_2618 284
875 3300046507 Ga0495606_0181991 Ga0495606_0181991_108_977 284
876 3300046511 Ga0495608_0019083 Ga0495608_0019083_2093_2962 284
877 3300046511 Ga0495608_0068933 Ga0495608_0068933_240_1109 284
878 3300046514 Ga0495618_0035324 Ga0495618_0035324_1772_2641 284
879 3300046524 Ga0495648_0056224 Ga0495648_0056224_162_1031 284
880 3300046529 Ga0495652_0004325 Ga0495652_0004325_11155_12024 284
881 3300046533 Ga0495640_0028702 Ga0495640_0028702_1144_2013 284
882 3300046536 Ga0495587_0058603 Ga0495587_0058603_64_933 284
883 3300046557 Ga0495622_0006001 Ga0495622_0006001_3230_4099 284
884 3300046559 Ga0495667_0026445 Ga0495667_0026445_1302_2171 284
885 3300046642 Ga0495634_0034428 Ga0495634_0034428_407_1276 284
886 3300046663 Ga0495635_0012284 Ga0495635_0012284_2872_3741 284
887 3300046675 Ga0495657_0001308 Ga0495657_0001308_120_989 284
888 3300046675 Ga0495657_0007247 Ga0495657_0007247_6783_7652 284
889 3300046678 Ga0495599_0025698 Ga0495599_0025698_744_1613 284
890 3300046679 Ga0495623_0120808 Ga0495623_0120808_680_1549 284
891 3300046680 Ga0495646_0081177 Ga0495646_0081177_647_1516 284
892 3300046689 Ga0495613_0119691 Ga0495613_0119691_791_1660 284
893 3300046690 Ga0495624_0074817 Ga0495624_0074817_528_1397 284
894 3300046694 Ga0495649_0119963 Ga0495649_0119963_253_1122 284
895 3300046809 Ga0495600_0007966 Ga0495600_0007966_789_1658 284
896 3300046809 Ga0495600_0020140 Ga0495600_0020140_2549_3418 284
897 3300047317 Ga0495604_0006128 Ga0495604_0006128_1700_2569 284
898 3300047319 Ga0495674_0011175 Ga0495674_0011175_268_1137 284
899 3300047319 Ga0495674_0044585 Ga0495674_0044585_3003_3872 284
900 3300047321 Ga0495676_0162888 Ga0495676_0162888_74_943 284
901 3300047322 Ga0495680_0001053 Ga0495680_0001053_4240_5109 284
902 3300047472 Ga0495686_0213485 Ga0495686_0213485_217_1086 284
903 3300048088 Ga0495602_0021411 Ga0495602_0021411_2307_3176 284
904 3300048907 Ga0496104_0014912 Ga0496104_0014912_3433_4302 284
905 3300048908 Ga0496105_0046798 Ga0496105_0046798_1700_2569 284
906 3300048911 Ga0496108_0399302 Ga0496108_0399302_21_908 284
907 3300048915 Ga0496112_0036649 Ga0496112_0036649_1363_2250 284
908 3300048916 Ga0496113_0035660 Ga0496113_0035660_2280_3167 284
909 3300048917 Ga0496114_0346237 Ga0496114_0346237_384_1253 284
910 3300048918 Ga0496115_0049654 Ga0496115_0049654_609_1478 284
911 3300048922 Ga0496119_0003138 Ga0496119_0003138_15129_15998 284
912 3300048923 Ga0496120_0015858 Ga0496120_0015858_1497_2366 284
913 3300048924 Ga0496121_0173220 Ga0496121_0173220_630_1499 284
914 3300048925 Ga0496122_0078087 Ga0496122_0078087_1373_2254 284
915 3300048928 Ga0496125_0000099 Ga0496125_0000099_95860_96741 284
916 3300048928 Ga0496125_0003103 Ga0496125_0003103_11341_12222 284
917 3300048928 Ga0496125_0098349 Ga0496125_0098349_45_914 284
918 3300048929 Ga0496126_0058992 Ga0496126_0058992_1468_2337 284
919 3300049570 Ga0501033_0020903 Ga0501033_0020903_2207_3109 284
920 3300053094 Ga0500566_0077548 Ga0500566_0077548_230_1099 284
921 3300053119 Ga0500595_021655 Ga0500595_021655_1332_2201 284
922 3300053134 Ga0500658_0051892 Ga0500658_0051892_699_1580 284
923 3300053148 Ga0500590_075347 Ga0500590_075347_526_1395 284
924 3300053163 Ga0500639_161605 Ga0500639_161605_132_1001 284
925 3300055283 Ga0500661_011701 Ga0500661_011701_580_1449 284
926 iso_pu_bacteria 2904449895 2904454323 284
927 iso_pu_bacteria 2904456579 2904462681 284
928 iso_pu_bacteria 2929520902 2929527132 284
929 iso_pu_bacteria 2945972063 2945977277 284
930 3300003578 Ga0006562J51391_1119272 Ga0006562J51391_11192722 285
931 3300006028 Ga0070717_10023806 Ga0070717_100238063 285
932 3300006871 Ga0075434_100244652 Ga0075434_1002446522 285
933 3300009093 Ga0105240_10014685 Ga0105240_100146852 285
934 3300009098 Ga0105245_10260089 Ga0105245_102600892 285
935 3300009174 Ga0105241_10111550 Ga0105241_101115501 285
936 3300009174 Ga0105241_10197931 Ga0105241_101979312 285
937 3300009177 Ga0105248_10170279 Ga0105248_101702793 285
938 3300009545 Ga0105237_10069051 Ga0105237_100690513 285
939 3300013100 Ga0157373_10096002 Ga0157373_100960022 285
940 3300013296 Ga0157374_10482983 Ga0157374_104829832 285
941 3300014497 Ga0182008_10000904 Ga0182008_1000090419 285
942 3300015261 Ga0182006_1092731 Ga0182006_10927311 285
943 3300021361 Ga0213872_10021501 Ga0213872_100215013 285
944 3300031548 Ga0307408_100014308 Ga0307408_1000143082 285
945 3300031649 Ga0307514_10003203 Ga0307514_100032032 285
946 3300031901 Ga0307406_10000052 Ga0307406_1000005259 285
947 3300032004 Ga0307414_10237263 Ga0307414_102372632 285
948 3300037418 Ga0395900_0570067 Ga0395900_0570067_122_997 285
949 3300037466 Ga0395898_0029509 Ga0395898_0029509_3518_4393 285
950 3300039438 Ga0436360_0121399 Ga0436360_0121399_2225_3100 285
951 3300039447 Ga0436361_0897018 Ga0436361_0897018_979_1854 285
952 3300039447 Ga0436361_1132428 Ga0436361_1132428_1921_2796 285
953 3300039453 Ga0436362_1029662 Ga0436362_1029662_991_1866 285
954 3300048925 Ga0496122_0013345 Ga0496122_0013345_5955_6878 285
955 3300049571 Ga0501034_0168820 Ga0501034_0168820_765_1667 285
956 3300049573 Ga0501037_0087480 Ga0501037_0087480_1012_1914 285
957 3300049574 Ga0501038_0113748 Ga0501038_0113748_377_1279 285
958 3300049575 Ga0501039_0187577 Ga0501039_0187577_85_987 285
959 3300049581 Ga0501047_0257069 Ga0501047_0257069_257_1159 285
960 3300049584 Ga0501068_0139925 Ga0501068_0139925_490_1392 285
961 3300049589 Ga0501073_0151635 Ga0501073_0151635_507_1409 285
962 3300050489 nmdc:mga03683_3300_c1 nmdc:mga03683_3300_c1_3562_4476 285
963 3300050512 nmdc:mga0n895_236471_c1 nmdc:mga0n895_236471_c1_312_1208 285
964 3300053111 Ga0500572_000335 Ga0500572_000335_6615_7496 285
965 3300053136 Ga0500559_0003196 Ga0500559_0003196_522_1403 285
966 3300053735 Ga0500596_002066 Ga0500596_002066_2505_3386 285
967 3300006042 Ga0075368_10012299 Ga0075368_100122992 286
968 3300009101 Ga0105247_10187173 Ga0105247_101871732 286
969 3300009147 Ga0114129_10004595 Ga0114129_1000459513 286
970 3300010375 Ga0105239_10074854 Ga0105239_100748543 286
971 3300025924 Ga0207694_10205787 Ga0207694_102057872 286
972 3300048924 Ga0496121_0001525 Ga0496121_0001525_21803_22687 286
973 3300048927 Ga0496124_0012006 Ga0496124_0012006_1663_2547 286
974 3300048928 Ga0496125_0171374 Ga0496125_0171374_126_1010 286
975 3300050507 nmdc:mga05p37_15155_c1 nmdc:mga05p37_15155_c1_5496_6398 286
976 3300053087 Ga0500643_023418 Ga0500643_023418_413_1309 286
977 3300053119 Ga0500595_059971 Ga0500595_059971_140_1024 286
978 3300053177 Ga0500636_0035062 Ga0500636_0035062_265_1152 286
979 iso_pu_bacteria 2643221651 2644290240 286
980 3300009098 Ga0105245_10216132 Ga0105245_102161322 287
981 3300025295 Ga0209564_1000503 Ga0209564_100050321 287
982 3300039437 Ga0436365_0122301 Ga0436365_0122301_11135_12064 287
983 3300039453 Ga0436362_0972873 Ga0436362_0972873_3556_4485 287
984 3300048929 Ga0496126_0124221 Ga0496126_0124221_573_1490 287
985 iso_pu_bacteria 2599185188 2599503704 287
986 iso_pu_bacteria 2599185302 2599942115 287
987 iso_pu_bacteria 2599185304 2599955096 287
988 iso_pu_bacteria 2599185309 2599984511 287
989 iso_pu_bacteria 2599185310 2599990793 287
990 iso_pu_bacteria 2599185312 2600000715 287
991 iso_pu_bacteria 2599185320 2600049690 287
992 iso_pu_bacteria 2811994881 2812370627 287
993 iso_pu_bacteria 2923519811 2923524727 287
994 iso_pu_bacteria 2928115317 2928118629 287
995 iso_pu_bacteria 3007419365 3007419521 287
996 3300005366 Ga0070659_100349769 Ga0070659_1003497691 288
997 3300005530 Ga0070679_100377415 Ga0070679_1003774152 288
998 3300005563 Ga0068855_100376434 Ga0068855_1003764342 288
999 3300013100 Ga0157373_10037722 Ga0157373_100377223 288
1000 3300025909 Ga0207705_10418436 Ga0207705_104184362 288
1001 3300025919 Ga0207657_10121119 Ga0207657_101211192 288
1002 3300025921 Ga0207652_10198291 Ga0207652_101982912 288
1003 3300025949 Ga0207667_10348678 Ga0207667_103486782 288
1004 3300048907 Ga0496104_0002112 Ga0496104_0002112_15898_16872 288
1005 3300048910 Ga0496107_0027212 Ga0496107_0027212_1282_2256 288
1006 3300048911 Ga0496108_0173496 Ga0496108_0173496_128_1102 288
1007 3300048912 Ga0496109_0010437 Ga0496109_0010437_5481_6455 288
1008 3300048913 Ga0496110_0133066 Ga0496110_0133066_46_1020 288
1009 3300048916 Ga0496113_0006206 Ga0496113_0006206_1000_1974 288
1010 3300050496 nmdc:mga07m45_180195_c1 nmdc:mga07m45_180195_c1_180_1091 288
1011 iso_pu_bacteria 2597489888 2597866882 288
1012 iso_pu_bacteria 2597489889 2597872721 288
1013 iso_pu_bacteria 2599185189 2599505979 288
1014 iso_pu_bacteria 2600255296 2601693227 288
1015 iso_pu_bacteria 2619619299 2621296615 288
1016 iso_pu_bacteria 2643221571 2643873445 288
1017 iso_pu_bacteria 2643221713 2644624540 288
1018 iso_pu_bacteria 2721755607 2723251594 288
1019 iso_pu_bacteria 2738541265 2738673548 288
1020 iso_pu_bacteria 2738541282 2738751941 288
1021 iso_pu_bacteria 2738541303 2738860982 288
1022 iso_pu_bacteria 2808606385 2808976386 288
1023 iso_pu_bacteria 2808606388 2808994154 288
1024 iso_pu_bacteria 2816332298 2817494274 288
1025 iso_pu_bacteria 2834028612 2834031180 288
1026 iso_pu_bacteria 2842826826 2842828518 288
1027 iso_pu_bacteria 2842837860 2842838129 288
1028 iso_pu_bacteria 2852612431 2852616581 288
1029 iso_pu_bacteria 2852667396 2852671549 288
1030 iso_pu_bacteria 2860867994 2860873252 288
1031 iso_pu_bacteria 2929189879 2929195381 288
1032 iso_pu_bacteria 2946027586 2946028131 288
1033 iso_pu_bacteria 2947233263 2947234664 288
1034 iso_pu_bacteria 8054285046 8054290203 288
1035 iso_pu_bacteria 8054347763 8054349356 288
1036 iso_pu_bacteria 8055817908 8055824139 288
1037 iso_pu_bacteria 8056148874 8056151265 288
1038 3300048924 Ga0496121_0141995 Ga0496121_0141995_649_1581 289
1039 3300050495 nmdc:mga04h51_45459_c1 nmdc:mga04h51_45459_c1_376_1287 289
1040 3300050516 nmdc:mga0sz30_93948_c1 nmdc:mga0sz30_93948_c1_61_975 289
1041 3300003320 rootH2_10345235 rootH2_103452352 290
1042 3300005288 Ga0065714_10004573 Ga0065714_100045732 291
1043 3300013100 Ga0157373_10047172 Ga0157373_100471722 291
1044 3300030744 Ga0316181_1259633 Ga0316181_12596333 291
1045 3300042129 Ga0450891_000878 Ga0450891_000878_2169_3044 291
1046 3300002738 JGI25154J39366_1004166 JGI25154J39366_10041663 292
1047 3300003751 Ga0055538_1000012 Ga0055538_1000012156 292
1048 3300003752 Ga0055539_1000017 Ga0055539_1000017156 292
1049 3300003756 Ga0055533_1000021 Ga0055533_1000021156 292
1050 3300003758 Ga0055532_1000020 Ga0055532_100002086 292
1051 3300003759 Ga0055525_1000078 Ga0055525_100007827 292
1052 3300003841 Ga0055541_1000012 Ga0055541_1000012156 292
1053 3300005331 Ga0070670_100000141 Ga0070670_10000014146 292
1054 3300009036 Ga0105244_10003428 Ga0105244_1000342811 292
1055 3300009148 Ga0105243_10075279 Ga0105243_100752794 292
1056 3300013100 Ga0157373_10011474 Ga0157373_100114747 292
1057 3300013308 Ga0157375_10010583 Ga0157375_100105838 292
1058 3300014497 Ga0182008_10000581 Ga0182008_1000058115 292
1059 3300015261 Ga0182006_1000467 Ga0182006_10004673 292
1060 3300015262 Ga0182007_10002786 Ga0182007_100027864 292
1061 3300025206 Ga0209435_100606 Ga0209435_1006065 292
1062 3300025224 Ga0209784_100007 Ga0209784_100007156 292
1063 3300025225 Ga0209566_100009 Ga0209566_100009156 292
1064 3300025226 Ga0209674_100021 Ga0209674_100021156 292
1065 3300025229 Ga0209147_100009 Ga0209147_100009156 292
1066 3300025230 Ga0209563_100018 Ga0209563_100018156 292
1067 3300025242 Ga0209258_100347 Ga0209258_1003475 292
1068 3300025246 Ga0209646_1001318 Ga0209646_10013185 292
1069 3300025253 Ga0209677_100012 Ga0209677_100012156 292
1070 3300025728 Ga0207655_1000534 Ga0207655_100053427 292
1071 3300025925 Ga0207650_10000089 Ga0207650_1000008947 292
1072 3300025935 Ga0207709_10042337 Ga0207709_100423374 292
1073 3300028786 Ga0307517_10176129 Ga0307517_101761292 292
1074 3300030742 Ga0316183_1201524 Ga0316183_12015242 292
1075 3300031507 Ga0307509_10070980 Ga0307509_100709801 292
1076 3300042006 Ga0439432_000047 Ga0439432_000047_23909_24787 292
1077 3300048927 Ga0496124_0074509 Ga0496124_0074509_1741_2619 292
1078 3300048928 Ga0496125_0003676 Ga0496125_0003676_9552_10430 292
1079 3300001915 JGI24741J21665_1005484 JGI24741J21665_10054842 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01297

ZnuA

Zinc-uptake complex component A periplasmic

27

287

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hx7-assembly1.cif.gz_A metal abc transporter from listeria monocytogenes 0.9012 27 296
6xpn-assembly2.cif.gz_A z-loop deletion mutant of aztc from paracoccus denitrificans 0.8983 28 295
3zk9-assembly2.cif.gz_B crystal structure of pneumococcal surface antigen psaa d280n in the metal-free, open state 0.8943 27 296
6q1c-assembly1.cif.gz_A apo yfea extracted from the e. coli periplasm 0.8893 26 296
3zk8-assembly2.cif.gz_B crystal structure of pneumococcal surface antigen psaa e205q in the metal-free, open state 0.8873 27 296
ID Description Score Start End Superfamily
4irmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9561 30 177 3.40.50.1980
4udnA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9333 30 178 3.40.50.1980
4oxrA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9322 27 165 3.40.50.1980
1pq4A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9205 26 174 3.40.50.1980
4irmB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain 0.9187 30 177 3.40.50.1980
ID Description Score Start End GO Terms
AF-A0A2A2Q068-F1-model_v4 Metal ABC transporter substrate-binding protein 0.9537 27 162 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A3S5ES28-F1-model_v4 Periplasmic iron-binding protein 0.9512 23 169 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A369FT21-F1-model_v4 Metal ABC transporter substrate-binding protein 0.9453 22 158 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A7W1NBS9-F1-model_v4 Zinc ABC transporter substrate-binding protein 0.9441 25 171 GO:0007155
GO:0030001
GO:0030313
GO:0046872
AF-A0A524KIM7-F1-model_v4 Metal ABC transporter substrate-binding protein 0.9392 86 296 GO:0007155
GO:0030001
GO:0030313
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.24 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map