F489646
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1079 | 676 | 822 | 289 |
Family's Representative Sequence
| Representative Sequence | 3300035695|Ga0373927_0036611|Ga0373927_0036611_1951_3030 |
| Length | 345 |
| Sequence | MRRLSWLVVLALVAMAPRAQADDRLNVVASFSILGDFVRNVGGDRVNVTTLVGPNSDAHVYEPTPADARKIADATRVIVNGLGLEGWLPRLVKAAGGKAIIITATSGIAPLKLGSGADPHAWQSVVNAKTYVTNIRDALIAADSAGAEAFRANAQNYLARLDALDREVHEAVGKIPAAHRKVISTHRAFGYFAAAYGIEFIAPLGVSTESEPSARDVAGIITQIRQAKIPAIFLENISDPRLIQRIAADTGARIGGTLYSDSLTAEKGEAPTYIDMVRHNIKALTSALAKQGPPCRVECLPSSARSCYARSFCLKNPRDRADGLSRRRQDHAAQPHPVGKPRQEQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 4 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 5 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 11 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 12 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 13 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 14 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 21 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 22 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 23 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 24 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 25 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 26 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 27 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 28 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 29 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 30 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 31 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 32 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 33 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 34 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 35 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 36 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 37 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 38 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 39 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 40 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 41 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 42 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 43 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 44 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 45 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 46 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 47 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 48 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 49 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 50 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 51 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 52 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 53 | 2791355199 | |||
| 54 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 55 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 56 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 57 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 58 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 59 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 60 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 61 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 62 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 63 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 64 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 65 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 66 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 67 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 68 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 69 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 70 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 71 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 72 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 73 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 74 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 75 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 76 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 77 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 78 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 79 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 80 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 81 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 82 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 83 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 84 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 85 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 86 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 87 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 88 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 89 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 90 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 91 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 92 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 93 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 94 | 2871282230 | Pectobacterium parmentieri SS90 | Isolate | Stem Tuber |
| 95 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 96 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 97 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 98 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 99 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 100 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 101 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 102 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 103 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 104 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 105 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 106 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 107 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 108 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 109 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 110 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 111 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 112 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 113 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 114 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 115 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 116 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 117 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 118 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 119 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 120 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 121 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 122 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 123 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 124 | 2904699407 | |||
| 125 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 126 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 127 | 2906610324 | |||
| 128 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 129 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 130 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 131 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 132 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 133 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 134 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 135 | 2922368715 | |||
| 136 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 137 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 138 | 2922425934 | |||
| 139 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 140 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 141 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 142 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 143 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 144 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 145 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 146 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 147 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 148 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 149 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 150 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 151 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 152 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 153 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 154 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 155 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 156 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 157 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 158 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 159 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 160 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 161 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 162 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 163 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 164 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 165 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 166 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 167 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 168 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 169 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 170 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 171 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 172 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 173 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 174 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 175 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 176 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 177 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 178 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 179 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 180 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 181 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 182 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 183 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 184 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 185 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 186 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 187 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 188 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 189 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 190 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 191 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 192 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 193 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 194 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 195 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 196 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 197 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 198 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 199 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 200 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 201 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 202 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 203 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 204 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 205 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 206 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 207 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 208 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 209 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 210 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 211 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 212 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 213 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 214 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 215 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 216 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 217 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 218 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 219 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 220 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 221 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 222 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 223 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 224 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 225 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 226 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 227 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 228 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 229 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 230 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 231 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 232 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 233 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 234 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 235 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 236 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 237 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 238 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 239 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 241 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 243 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 245 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 246 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 247 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 249 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 255 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 258 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 260 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 261 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 266 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 267 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 269 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 270 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 271 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 273 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 274 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 275 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 276 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 277 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 278 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 279 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 280 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 281 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 282 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 283 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 284 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 285 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 286 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 287 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 288 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 289 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 290 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 291 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 292 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 293 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 294 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 295 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 296 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 297 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 298 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 299 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 300 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 301 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 302 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 303 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 304 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 305 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 306 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 307 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 314 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 315 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 318 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 320 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 321 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 325 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 326 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 329 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 333 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 336 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 337 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 338 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 339 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 340 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 341 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 342 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 343 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 344 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 345 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 346 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 348 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 351 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 352 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 353 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 355 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 356 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 357 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 358 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 411 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 413 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 414 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 415 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 419 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 420 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 421 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 422 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 423 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 424 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 425 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 426 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 427 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 428 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 429 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 430 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 431 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 432 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 433 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 434 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 435 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 436 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 437 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 438 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 439 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 440 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 441 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 442 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 443 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 444 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 445 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 446 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 447 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 448 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 449 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 450 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 451 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 452 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 453 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 454 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 455 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 456 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 457 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 458 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 459 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 460 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 461 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 462 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 463 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 464 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 465 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 466 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 467 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 468 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 469 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 470 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 471 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 472 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 473 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 474 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 475 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 476 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 477 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 478 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 479 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 480 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 481 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 482 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 483 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 484 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 485 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 486 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 487 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 488 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 489 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 490 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 491 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 492 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 493 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 494 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 495 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 496 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 497 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 498 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 499 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 500 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 501 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 502 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 503 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 504 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 505 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 548 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 549 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 550 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 551 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 552 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 553 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 554 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 555 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 556 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 557 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 558 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 559 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 560 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 561 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 562 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 563 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 564 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 565 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 566 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 567 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 568 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 569 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 570 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 571 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 572 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 573 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 574 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 575 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 576 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 577 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 578 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 579 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 580 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 581 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 582 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 583 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 584 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 585 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 586 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 587 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 588 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 589 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 590 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 591 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 592 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 593 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 594 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 595 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 598 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 602 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 603 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 604 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 605 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 606 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 607 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 608 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 609 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 610 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 611 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 612 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 613 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 614 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 615 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 616 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 617 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 618 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 619 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 620 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 621 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 622 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 623 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 624 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 625 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 626 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 627 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 628 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 629 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 630 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 631 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 632 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 633 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 634 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 635 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 636 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 637 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 638 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 639 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 640 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 641 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 642 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 643 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 644 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 645 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 646 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 647 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 648 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 649 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 650 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 651 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 652 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 653 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 654 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 655 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 656 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 657 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 658 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 659 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 660 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 661 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 662 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 663 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 664 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 665 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 666 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 667 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 668 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 669 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 670 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 671 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 672 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 673 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 674 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 675 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 676 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.44 |
| Metatranscriptomes | 0.09 |
| Isolates | 23.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.42 |
| Nodule | 16.13 |
| Rhizoplane | 6.49 |
| Rhizosphere | 51.07 |
| Stem | 0 |
| Stem Tuber | 0.09 |
| Unclassified | 13.81 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1005484 | 3300001915 | Bacteria | 2642 |
| 2 | JGI24739J22299_10004386 | 3300001989 | Bacteria | 5402 |
| 3 | JGI24737J22298_10026694 | 3300001990 | Bacteria | 1823 |
| 4 | JGI24735J21928_10029987 | 3300002067 | Bacteria | 1617 |
| 5 | JGI25154J39366_1004166 | 3300002738 | Bacteria | 2689 |
| 6 | JGI25165J46597_1008266 | 3300003214 | Bacteria | 1646 |
| 7 | JGI25165J46597_1009827 | 3300003214 | Bacteria | 1420 |
| 8 | JGI25165J46597_1009894 | 3300003214 | Bacteria | 1411 |
| 9 | JGI25153J46596_10009118 | 3300003215 | Bacteria | 4652 |
| 10 | JGI25153J46596_10013220 | 3300003215 | Bacteria | 3505 |
| 11 | JGI25153J46596_10029846 | 3300003215 | Bacteria | 1865 |
| 12 | rootH2_10345235 | 3300003320 | Bacteria | 1331 |
| 13 | rootL2_10124449 | 3300003322 | Bacteria | 1124 |
| 14 | Ga0006562J51391_1119272 | 3300003578 | Bacteria | 1834 |
| 15 | JGI25404J52841_10010825 | 3300003659 | Bacteria | 1962 |
| 16 | Ga0055538_1000012 | 3300003751 | Bacteria | 353826 |
| 17 | Ga0055539_1000017 | 3300003752 | Bacteria | 353873 |
| 18 | Ga0055533_1000021 | 3300003756 | Bacteria | 353826 |
| 19 | Ga0055532_1000020 | 3300003758 | Bacteria | 270853 |
| 20 | Ga0055525_1000078 | 3300003759 | Bacteria | 165788 |
| 21 | Ga0055540_1001304 | 3300003792 | Bacteria | 15079 |
| 22 | Ga0055541_1000012 | 3300003841 | Bacteria | 353826 |
| 23 | Ga0065165_1003123 | 3300005262 | Bacteria | 12280 |
| 24 | Ga0065165_1007216 | 3300005262 | Bacteria | 5539 |
| 25 | Ga0065165_1010731 | 3300005262 | Bacteria | 3914 |
| 26 | Ga0065165_1033623 | 3300005262 | Bacteria | 1594 |
| 27 | Ga0065714_10004573 | 3300005288 | Bacteria | 4748 |
| 28 | Ga0065704_10088231 | 3300005289 | Bacteria | 2956 |
| 29 | Ga0070658_10145326 | 3300005327 | Bacteria | 1983 |
| 30 | Ga0070683_100058153 | 3300005329 | Bacteria | 3592 |
| 31 | Ga0070670_100000141 | 3300005331 | Bacteria | 67499 |
| 32 | Ga0070670_100223142 | 3300005331 | Bacteria | 1640 |
| 33 | Ga0068869_100177413 | 3300005334 | Bacteria | 1668 |
| 34 | Ga0070666_10116344 | 3300005335 | Bacteria | 1852 |
| 35 | Ga0070680_100007323 | 3300005336 | Bacteria | 8416 |
| 36 | Ga0070680_100251951 | 3300005336 | Bacteria | 1493 |
| 37 | Ga0070682_100101303 | 3300005337 | Bacteria | 1902 |
| 38 | Ga0068868_100219698 | 3300005338 | Bacteria | 1590 |
| 39 | Ga0070660_100003353 | 3300005339 | Bacteria | 11009 |
| 40 | Ga0070689_100017936 | 3300005340 | Bacteria | 5204 |
| 41 | Ga0070689_100397977 | 3300005340 | Bacteria | 1163 |
| 42 | Ga0070661_100029726 | 3300005344 | Bacteria | 3945 |
| 43 | Ga0070668_100103430 | 3300005347 | Bacteria | 2259 |
| 44 | Ga0070668_100116316 | 3300005347 | Bacteria | 2132 |
| 45 | Ga0070668_100399295 | 3300005347 | Bacteria | 1173 |
| 46 | Ga0070668_100448652 | 3300005347 | Bacteria | 1108 |
| 47 | Ga0070669_100238436 | 3300005353 | Bacteria | 1444 |
| 48 | Ga0070675_100309043 | 3300005354 | Bacteria | 1394 |
| 49 | Ga0070671_100241802 | 3300005355 | Bacteria | 1532 |
| 50 | Ga0070671_100387593 | 3300005355 | Bacteria | 1194 |
| 51 | Ga0070688_100145669 | 3300005365 | Bacteria | 1613 |
| 52 | Ga0070659_100043428 | 3300005366 | Bacteria | 3515 |
| 53 | Ga0070659_100349769 | 3300005366 | Bacteria | 1240 |
| 54 | Ga0070667_100163338 | 3300005367 | Bacteria | 1963 |
| 55 | Ga0070709_10004499 | 3300005434 | Bacteria | 7521 |
| 56 | Ga0070709_10016287 | 3300005434 | Bacteria | 4242 |
| 57 | Ga0070714_100032403 | 3300005435 | Bacteria | 4361 |
| 58 | Ga0070713_100024272 | 3300005436 | Bacteria | 4721 |
| 59 | Ga0070713_100097488 | 3300005436 | Bacteria | 2540 |
| 60 | Ga0070713_100228196 | 3300005436 | Bacteria | 1692 |
| 61 | Ga0070710_10003046 | 3300005437 | Bacteria | 7964 |
| 62 | Ga0070710_10039645 | 3300005437 | Bacteria | 2592 |
| 63 | Ga0070711_100010406 | 3300005439 | Bacteria | 5756 |
| 64 | Ga0070663_100007241 | 3300005455 | Bacteria | 6742 |
| 65 | Ga0070663_100160637 | 3300005455 | Bacteria | 1729 |
| 66 | Ga0070663_100166983 | 3300005455 | Bacteria | 1698 |
| 67 | Ga0070663_100174728 | 3300005455 | Bacteria | 1662 |
| 68 | Ga0070678_100202136 | 3300005456 | Bacteria | 1640 |
| 69 | Ga0070678_100255989 | 3300005456 | Bacteria | 1470 |
| 70 | Ga0070662_100026265 | 3300005457 | Bacteria | 4031 |
| 71 | Ga0070662_100121049 | 3300005457 | Bacteria | 2006 |
| 72 | Ga0070681_10033490 | 3300005458 | Bacteria | 5158 |
| 73 | Ga0070685_10175818 | 3300005466 | Bacteria | 1375 |
| 74 | Ga0070699_100382184 | 3300005518 | Bacteria | 1271 |
| 75 | Ga0070679_100075614 | 3300005530 | Bacteria | 3357 |
| 76 | Ga0070679_100377415 | 3300005530 | Bacteria | 1364 |
| 77 | Ga0070679_100613690 | 3300005530 | Bacteria | 1031 |
| 78 | Ga0070684_100006286 | 3300005535 | Bacteria | 9176 |
| 79 | Ga0070684_100025288 | 3300005535 | Bacteria | 4989 |
| 80 | Ga0068853_100001496 | 3300005539 | Bacteria | 16976 |
| 81 | Ga0068853_100026288 | 3300005539 | Bacteria | 4887 |
| 82 | Ga0068853_100269755 | 3300005539 | Bacteria | 1567 |
| 83 | Ga0068853_100368008 | 3300005539 | Bacteria | 1340 |
| 84 | Ga0070665_100105477 | 3300005548 | Bacteria | 2820 |
| 85 | Ga0070665_100155549 | 3300005548 | Bacteria | 2288 |
| 86 | Ga0070665_100367819 | 3300005548 | Bacteria | 1444 |
| 87 | Ga0070665_100499631 | 3300005548 | Bacteria | 1227 |
| 88 | Ga0070704_100192822 | 3300005549 | Bacteria | 1639 |
| 89 | Ga0070704_100241846 | 3300005549 | Bacteria | 1477 |
| 90 | Ga0068855_100031854 | 3300005563 | Bacteria | 6294 |
| 91 | Ga0068855_100256651 | 3300005563 | Bacteria | 1949 |
| 92 | Ga0068855_100300260 | 3300005563 | Bacteria | 1778 |
| 93 | Ga0068855_100376434 | 3300005563 | Bacteria | 1560 |
| 94 | Ga0070664_100503876 | 3300005564 | Bacteria | 1116 |
| 95 | Ga0068857_100004210 | 3300005577 | Bacteria | 12119 |
| 96 | Ga0068857_100056749 | 3300005577 | Bacteria | 3475 |
| 97 | Ga0068857_100060787 | 3300005577 | Bacteria | 3356 |
| 98 | Ga0068854_100008298 | 3300005578 | Bacteria | 6670 |
| 99 | Ga0068854_100017829 | 3300005578 | Bacteria | 4758 |
| 100 | Ga0068854_100061411 | 3300005578 | Bacteria | 2722 |
| 101 | Ga0068856_100006410 | 3300005614 | Bacteria | 11545 |
| 102 | Ga0068856_100019463 | 3300005614 | Bacteria | 6589 |
| 103 | Ga0068856_100077437 | 3300005614 | Bacteria | 3295 |
| 104 | Ga0068856_100547953 | 3300005614 | Bacteria | 1178 |
| 105 | Ga0070702_100275930 | 3300005615 | Bacteria | 1152 |
| 106 | Ga0068852_100016237 | 3300005616 | Bacteria | 5800 |
| 107 | Ga0068852_100326120 | 3300005616 | Bacteria | 1492 |
| 108 | Ga0068852_100448092 | 3300005616 | Bacteria | 1277 |
| 109 | Ga0068859_100135138 | 3300005617 | Bacteria | 2539 |
| 110 | Ga0068859_100164271 | 3300005617 | Bacteria | 2299 |
| 111 | Ga0068859_100178873 | 3300005617 | Bacteria | 2203 |
| 112 | Ga0068864_100133624 | 3300005618 | Bacteria | 2232 |
| 113 | Ga0068864_100487779 | 3300005618 | Bacteria | 1184 |
| 114 | Ga0068866_10093974 | 3300005718 | Bacteria | 1639 |
| 115 | Ga0068861_100170496 | 3300005719 | Bacteria | 1803 |
| 116 | Ga0068861_100489562 | 3300005719 | Bacteria | 1109 |
| 117 | Ga0068851_10011168 | 3300005834 | Bacteria | 4206 |
| 118 | Ga0068863_100406296 | 3300005841 | Bacteria | 1332 |
| 119 | Ga0068858_100334100 | 3300005842 | Bacteria | 1449 |
| 120 | Ga0068858_100400955 | 3300005842 | Bacteria | 1318 |
| 121 | Ga0068858_100511700 | 3300005842 | Bacteria | 1160 |
| 122 | Ga0068860_100003385 | 3300005843 | Bacteria | 16406 |
| 123 | Ga0068862_100145350 | 3300005844 | Bacteria | 2107 |
| 124 | Ga0081538_10036555 | 3300005981 | Bacteria | 3202 |
| 125 | Ga0081540_1004705 | 3300005983 | Bacteria | 10327 |
| 126 | Ga0081540_1005016 | 3300005983 | Bacteria | 9944 |
| 127 | Ga0081540_1005578 | 3300005983 | Bacteria | 9373 |
| 128 | Ga0081540_1005788 | 3300005983 | Bacteria | 9148 |
| 129 | Ga0081540_1006936 | 3300005983 | Bacteria | 8165 |
| 130 | Ga0081540_1010271 | 3300005983 | Bacteria | 6356 |
| 131 | Ga0081540_1015887 | 3300005983 | Bacteria | 4745 |
| 132 | Ga0081540_1031359 | 3300005983 | Bacteria | 2924 |
| 133 | Ga0081540_1041746 | 3300005983 | Bacteria | 2375 |
| 134 | Ga0081540_1066406 | 3300005983 | Bacteria | 1691 |
| 135 | Ga0081539_10039667 | 3300005985 | Bacteria | 2775 |
| 136 | Ga0070717_10023806 | 3300006028 | Bacteria | 4857 |
| 137 | Ga0070717_10105321 | 3300006028 | Bacteria | 2401 |
| 138 | Ga0070717_10119675 | 3300006028 | Bacteria | 2255 |
| 139 | Ga0075365_10146416 | 3300006038 | Bacteria | 1641 |
| 140 | Ga0075365_10151624 | 3300006038 | Bacteria | 1612 |
| 141 | Ga0075365_10184513 | 3300006038 | Bacteria | 1459 |
| 142 | Ga0075368_10012299 | 3300006042 | Bacteria | 3125 |
| 143 | Ga0075368_10041629 | 3300006042 | Bacteria | 1805 |
| 144 | Ga0075368_10068758 | 3300006042 | Bacteria | 1427 |
| 145 | Ga0075363_100004089 | 3300006048 | Bacteria | 6322 |
| 146 | Ga0075364_10253173 | 3300006051 | Bacteria | 1197 |
| 147 | Ga0070716_100010967 | 3300006173 | Bacteria | 4559 |
| 148 | Ga0070716_100079528 | 3300006173 | Bacteria | 1952 |
| 149 | Ga0070716_100081468 | 3300006173 | Bacteria | 1933 |
| 150 | Ga0070712_100028666 | 3300006175 | Bacteria | 3726 |
| 151 | Ga0070712_100248704 | 3300006175 | Bacteria | 1419 |
| 152 | Ga0070712_100405837 | 3300006175 | Bacteria | 1126 |
| 153 | Ga0075367_10022959 | 3300006178 | Bacteria | 3505 |
| 154 | Ga0075367_10051061 | 3300006178 | Bacteria | 2443 |
| 155 | Ga0075367_10113608 | 3300006178 | Bacteria | 1664 |
| 156 | Ga0075367_10131776 | 3300006178 | Bacteria | 1545 |
| 157 | Ga0075367_10202456 | 3300006178 | Bacteria | 1240 |
| 158 | Ga0075366_10112604 | 3300006195 | Bacteria | 1637 |
| 159 | Ga0075434_100244652 | 3300006871 | Bacteria | 1814 |
| 160 | Ga0068865_100057630 | 3300006881 | Bacteria | 2711 |
| 161 | Ga0097620_100135137 | 3300006931 | Bacteria | 2539 |
| 162 | Ga0097620_100164286 | 3300006931 | Bacteria | 2299 |
| 163 | Ga0097620_100178880 | 3300006931 | Bacteria | 2203 |
| 164 | Ga0099824_1008875 | 3300006942 | Bacteria | 12635 |
| 165 | Ga0099824_1023890 | 3300006942 | Bacteria | 3695 |
| 166 | Ga0099822_1017500 | 3300006943 | Bacteria | 7646 |
| 167 | Ga0099794_10043155 | 3300007265 | Bacteria | 2152 |
| 168 | Ga0105244_10003428 | 3300009036 | Bacteria | 11304 |
| 169 | Ga0105240_10009125 | 3300009093 | Bacteria | 14079 |
| 170 | Ga0105240_10014685 | 3300009093 | Bacteria | 10686 |
| 171 | Ga0105240_10046064 | 3300009093 | Bacteria | 5528 |
| 172 | Ga0105240_10095537 | 3300009093 | Bacteria | 3624 |
| 173 | Ga0105240_10538244 | 3300009093 | Bacteria | 1294 |
| 174 | Ga0105245_10071302 | 3300009098 | Bacteria | 3156 |
| 175 | Ga0105245_10216132 | 3300009098 | Bacteria | 1847 |
| 176 | Ga0105245_10260089 | 3300009098 | Bacteria | 1689 |
| 177 | Ga0105247_10104696 | 3300009101 | Bacteria | 1813 |
| 178 | Ga0105247_10173183 | 3300009101 | Bacteria | 1436 |
| 179 | Ga0105247_10187173 | 3300009101 | Bacteria | 1384 |
| 180 | Ga0114129_10004595 | 3300009147 | Bacteria | 19485 |
| 181 | Ga0114129_10157307 | 3300009147 | Bacteria | 3107 |
| 182 | Ga0105243_10075279 | 3300009148 | Bacteria | 2740 |
| 183 | Ga0105243_10231134 | 3300009148 | Bacteria | 1641 |
| 184 | Ga0105243_10485191 | 3300009148 | Bacteria | 1167 |
| 185 | Ga0105241_10015112 | 3300009174 | Bacteria | 5655 |
| 186 | Ga0105241_10111550 | 3300009174 | Bacteria | 2190 |
| 187 | Ga0105241_10197931 | 3300009174 | Bacteria | 1676 |
| 188 | Ga0105241_10240858 | 3300009174 | Bacteria | 1529 |
| 189 | Ga0105241_10529071 | 3300009174 | Bacteria | 1055 |
| 190 | Ga0105242_10184248 | 3300009176 | Bacteria | 1844 |
| 191 | Ga0105242_10205972 | 3300009176 | Bacteria | 1749 |
| 192 | Ga0105248_10080990 | 3300009177 | Bacteria | 3650 |
| 193 | Ga0105248_10170279 | 3300009177 | Bacteria | 2454 |
| 194 | Ga0105248_10496096 | 3300009177 | Bacteria | 1376 |
| 195 | Ga0105248_10579251 | 3300009177 | Bacteria | 1266 |
| 196 | Ga0105248_11011862 | 3300009177 | Bacteria | 939 |
| 197 | Ga0105237_10008895 | 3300009545 | Bacteria | 10820 |
| 198 | Ga0105237_10044886 | 3300009545 | Bacteria | 4450 |
| 199 | Ga0105237_10069051 | 3300009545 | Bacteria | 3528 |
| 200 | Ga0105237_10183321 | 3300009545 | Bacteria | 2093 |
| 201 | Ga0105237_10356681 | 3300009545 | Bacteria | 1466 |
| 202 | Ga0105237_10408045 | 3300009545 | Bacteria | 1363 |
| 203 | Ga0105238_10025742 | 3300009551 | Bacteria | 5999 |
| 204 | Ga0105238_10026375 | 3300009551 | Bacteria | 5924 |
| 205 | Ga0105238_10028483 | 3300009551 | Bacteria | 5691 |
| 206 | Ga0105238_10462551 | 3300009551 | Bacteria | 1266 |
| 207 | Ga0105238_10572317 | 3300009551 | Bacteria | 1135 |
| 208 | Ga0105249_10692538 | 3300009553 | Bacteria | 1079 |
| 209 | Ga0099796_10016875 | 3300010159 | Bacteria | 2164 |
| 210 | Ga0099796_10096508 | 3300010159 | Bacteria | 1106 |
| 211 | Ga0105239_10008167 | 3300010375 | Bacteria | 11943 |
| 212 | Ga0105239_10074854 | 3300010375 | Bacteria | 3723 |
| 213 | Ga0105239_10084315 | 3300010375 | Bacteria | 3500 |
| 214 | Ga0105239_10169114 | 3300010375 | Bacteria | 2444 |
| 215 | Ga0105239_10271446 | 3300010375 | Bacteria | 1908 |
| 216 | Ga0105239_10414628 | 3300010375 | Bacteria | 1525 |
| 217 | Ga0105239_10694216 | 3300010375 | Bacteria | 1163 |
| 218 | Ga0105246_10067767 | 3300011119 | Bacteria | 2501 |
| 219 | Ga0157373_10011474 | 3300013100 | Bacteria | 6515 |
| 220 | Ga0157373_10037722 | 3300013100 | Bacteria | 3463 |
| 221 | Ga0157373_10047172 | 3300013100 | Bacteria | 3074 |
| 222 | Ga0157373_10096002 | 3300013100 | Bacteria | 2087 |
| 223 | Ga0157370_10054683 | 3300013104 | Bacteria | 3805 |
| 224 | Ga0157369_10006096 | 3300013105 | Bacteria | 13996 |
| 225 | Ga0157374_10199007 | 3300013296 | Bacteria | 1961 |
| 226 | Ga0157374_10482983 | 3300013296 | Bacteria | 1242 |
| 227 | Ga0157378_10222202 | 3300013297 | Bacteria | 1796 |
| 228 | Ga0157378_10391905 | 3300013297 | Bacteria | 1366 |
| 229 | Ga0157378_10543889 | 3300013297 | Bacteria | 1166 |
| 230 | Ga0163162_10064929 | 3300013306 | Bacteria | 3696 |
| 231 | Ga0163162_10586244 | 3300013306 | Bacteria | 1242 |
| 232 | Ga0163162_10773871 | 3300013306 | Bacteria | 1078 |
| 233 | Ga0157372_10149868 | 3300013307 | Bacteria | 2691 |
| 234 | Ga0157375_10010583 | 3300013308 | Bacteria | 8121 |
| 235 | Ga0163163_10513828 | 3300014325 | Bacteria | 1260 |
| 236 | Ga0157380_10538360 | 3300014326 | Bacteria | 1143 |
| 237 | Ga0157380_10835908 | 3300014326 | Bacteria | 941 |
| 238 | Ga0182008_10000581 | 3300014497 | Bacteria | 26916 |
| 239 | Ga0182008_10000904 | 3300014497 | Bacteria | 20630 |
| 240 | Ga0157379_10107304 | 3300014968 | Bacteria | 2507 |
| 241 | Ga0157376_10042518 | 3300014969 | Bacteria | 3724 |
| 242 | Ga0157376_10436292 | 3300014969 | Bacteria | 1274 |
| 243 | Ga0182006_1000467 | 3300015261 | Bacteria | 31644 |
| 244 | Ga0182006_1092731 | 3300015261 | Bacteria | 1084 |
| 245 | Ga0182007_10002786 | 3300015262 | Bacteria | 8522 |
| 246 | Ga0214542_1000009 | 3300021321 | Bacteria | 262861 |
| 247 | Ga0214542_1033238 | 3300021321 | Bacteria | 1754 |
| 248 | Ga0214545_1000007 | 3300021324 | Bacteria | 262984 |
| 249 | Ga0214545_1039271 | 3300021324 | Bacteria | 1337 |
| 250 | Ga0214543_1000020 | 3300021327 | Bacteria | 262861 |
| 251 | Ga0214543_1040577 | 3300021327 | Bacteria | 1235 |
| 252 | Ga0213873_10002858 | 3300021358 | Bacteria | 3043 |
| 253 | Ga0213872_10021501 | 3300021361 | Bacteria | 2971 |
| 254 | Ga0213876_10001108 | 3300021384 | Bacteria | 17232 |
| 255 | Ga0209435_100606 | 3300025206 | Bacteria | 6586 |
| 256 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 257 | Ga0209566_100009 | 3300025225 | Bacteria | 554018 |
| 258 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 259 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 260 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 261 | Ga0209563_101581 | 3300025230 | Bacteria | 5915 |
| 262 | Ga0209258_100347 | 3300025242 | Bacteria | 66549 |
| 263 | Ga0209646_1001318 | 3300025246 | Bacteria | 6908 |
| 264 | Ga0209677_100012 | 3300025253 | Bacteria | 554018 |
| 265 | Ga0209677_102936 | 3300025253 | Bacteria | 5960 |
| 266 | Ga0209148_1000707 | 3300025254 | Bacteria | 26803 |
| 267 | Ga0209233_1001624 | 3300025261 | Bacteria | 8741 |
| 268 | Ga0209233_1010411 | 3300025261 | Bacteria | 2787 |
| 269 | Ga0209455_1004030 | 3300025272 | Bacteria | 4969 |
| 270 | Ga0209455_1005738 | 3300025272 | Bacteria | 3779 |
| 271 | Ga0209455_1007958 | 3300025272 | Bacteria | 2934 |
| 272 | Ga0209455_1012768 | 3300025272 | Bacteria | 1989 |
| 273 | Ga0209564_1000503 | 3300025295 | Bacteria | 64437 |
| 274 | Ga0209564_1009431 | 3300025295 | Bacteria | 4647 |
| 275 | Ga0209758_1000106 | 3300025297 | Bacteria | 218450 |
| 276 | Ga0209758_1002009 | 3300025297 | Bacteria | 21878 |
| 277 | Ga0209758_1002765 | 3300025297 | Bacteria | 17179 |
| 278 | Ga0209758_1003053 | 3300025297 | Bacteria | 15935 |
| 279 | Ga0209758_1006390 | 3300025297 | Bacteria | 8493 |
| 280 | Ga0209758_1011674 | 3300025297 | Bacteria | 5048 |
| 281 | Ga0209758_1011887 | 3300025297 | Bacteria | 4961 |
| 282 | Ga0209758_1069464 | 3300025297 | Bacteria | 1116 |
| 283 | Ga0209256_1008328 | 3300025299 | Bacteria | 4835 |
| 284 | Ga0207426_1000337 | 3300025302 | Bacteria | 88200 |
| 285 | Ga0207426_1007201 | 3300025302 | Bacteria | 4691 |
| 286 | Ga0207426_1009271 | 3300025302 | Bacteria | 3909 |
| 287 | Ga0209051_1000298 | 3300025303 | Bacteria | 78777 |
| 288 | Ga0209257_1000684 | 3300025304 | Bacteria | 52769 |
| 289 | Ga0207656_10035984 | 3300025321 | Bacteria | 2076 |
| 290 | Ga0207656_10046534 | 3300025321 | Bacteria | 1862 |
| 291 | Ga0207655_1000534 | 3300025728 | Bacteria | 48119 |
| 292 | Ga0207692_10001396 | 3300025898 | Bacteria | 9039 |
| 293 | Ga0207692_10070024 | 3300025898 | Bacteria | 1845 |
| 294 | Ga0207688_10048296 | 3300025901 | Bacteria | 2378 |
| 295 | Ga0207688_10098160 | 3300025901 | Bacteria | 1688 |
| 296 | Ga0207680_10165964 | 3300025903 | Bacteria | 1484 |
| 297 | Ga0207680_10269037 | 3300025903 | Bacteria | 1181 |
| 298 | Ga0207647_10009009 | 3300025904 | Bacteria | 7112 |
| 299 | Ga0207647_10053238 | 3300025904 | Bacteria | 2495 |
| 300 | Ga0207685_10004095 | 3300025905 | Bacteria | 3652 |
| 301 | Ga0207699_10038984 | 3300025906 | Bacteria | 2727 |
| 302 | Ga0207645_10133078 | 3300025907 | Bacteria | 1619 |
| 303 | Ga0207645_10282096 | 3300025907 | Bacteria | 1103 |
| 304 | Ga0207643_10027690 | 3300025908 | Bacteria | 3144 |
| 305 | Ga0207705_10080452 | 3300025909 | Bacteria | 2374 |
| 306 | Ga0207705_10418436 | 3300025909 | Bacteria | 1037 |
| 307 | Ga0207707_10001933 | 3300025912 | Bacteria | 18846 |
| 308 | Ga0207695_10000478 | 3300025913 | Bacteria | 86076 |
| 309 | Ga0207695_10034396 | 3300025913 | Bacteria | 5512 |
| 310 | Ga0207695_10142598 | 3300025913 | Bacteria | 2343 |
| 311 | Ga0207671_10037028 | 3300025914 | Bacteria | 3618 |
| 312 | Ga0207671_10047710 | 3300025914 | Bacteria | 3170 |
| 313 | Ga0207671_10057143 | 3300025914 | Bacteria | 2892 |
| 314 | Ga0207671_10063710 | 3300025914 | Bacteria | 2740 |
| 315 | Ga0207671_10203488 | 3300025914 | Bacteria | 1547 |
| 316 | Ga0207693_10020323 | 3300025915 | Bacteria | 5283 |
| 317 | Ga0207693_10027576 | 3300025915 | Bacteria | 4489 |
| 318 | Ga0207693_10293797 | 3300025915 | Bacteria | 1273 |
| 319 | Ga0207663_10001112 | 3300025916 | Bacteria | 12359 |
| 320 | Ga0207663_10023479 | 3300025916 | Bacteria | 3539 |
| 321 | Ga0207663_10067343 | 3300025916 | Bacteria | 2296 |
| 322 | Ga0207660_10009206 | 3300025917 | Bacteria | 6389 |
| 323 | Ga0207660_10232901 | 3300025917 | Bacteria | 1449 |
| 324 | Ga0207662_10078044 | 3300025918 | Bacteria | 2015 |
| 325 | Ga0207657_10005821 | 3300025919 | Bacteria | 12839 |
| 326 | Ga0207657_10113450 | 3300025919 | Bacteria | 2236 |
| 327 | Ga0207657_10121119 | 3300025919 | Bacteria | 2152 |
| 328 | Ga0207652_10070273 | 3300025921 | Bacteria | 3040 |
| 329 | Ga0207652_10198291 | 3300025921 | Bacteria | 1806 |
| 330 | Ga0207694_10001415 | 3300025924 | Bacteria | 20567 |
| 331 | Ga0207694_10022943 | 3300025924 | Bacteria | 4735 |
| 332 | Ga0207694_10177181 | 3300025924 | Bacteria | 1728 |
| 333 | Ga0207694_10205787 | 3300025924 | Bacteria | 1602 |
| 334 | Ga0207650_10000089 | 3300025925 | Bacteria | 120962 |
| 335 | Ga0207687_10149563 | 3300025927 | Bacteria | 1780 |
| 336 | Ga0207700_10064270 | 3300025928 | Bacteria | 2794 |
| 337 | Ga0207700_10214960 | 3300025928 | Bacteria | 1627 |
| 338 | Ga0207664_10313407 | 3300025929 | Bacteria | 1383 |
| 339 | Ga0207690_10074010 | 3300025932 | Bacteria | 2358 |
| 340 | Ga0207706_10154120 | 3300025933 | Bacteria | 2021 |
| 341 | Ga0207706_10251531 | 3300025933 | Bacteria | 1543 |
| 342 | Ga0207706_10262690 | 3300025933 | Bacteria | 1507 |
| 343 | Ga0207686_10295937 | 3300025934 | Bacteria | 1200 |
| 344 | Ga0207709_10042337 | 3300025935 | Bacteria | 2738 |
| 345 | Ga0207709_10251506 | 3300025935 | Bacteria | 1291 |
| 346 | Ga0207709_10256222 | 3300025935 | Bacteria | 1281 |
| 347 | Ga0207669_10224931 | 3300025937 | Bacteria | 1380 |
| 348 | Ga0207704_10244042 | 3300025938 | Bacteria | 1344 |
| 349 | Ga0207665_10000703 | 3300025939 | Bacteria | 22673 |
| 350 | Ga0207665_10091630 | 3300025939 | Bacteria | 2108 |
| 351 | Ga0207665_10156926 | 3300025939 | Bacteria | 1634 |
| 352 | Ga0207711_10108494 | 3300025941 | Bacteria | 2466 |
| 353 | Ga0207711_10195442 | 3300025941 | Bacteria | 1845 |
| 354 | Ga0207711_10644284 | 3300025941 | Bacteria | 988 |
| 355 | Ga0207689_10038013 | 3300025942 | Bacteria | 3988 |
| 356 | Ga0207689_10304900 | 3300025942 | Bacteria | 1320 |
| 357 | Ga0207661_10000171 | 3300025944 | Bacteria | 41708 |
| 358 | Ga0207661_10030341 | 3300025944 | Bacteria | 4164 |
| 359 | Ga0207679_10384077 | 3300025945 | Bacteria | 1232 |
| 360 | Ga0207667_10011741 | 3300025949 | Bacteria | 10158 |
| 361 | Ga0207667_10013826 | 3300025949 | Bacteria | 9221 |
| 362 | Ga0207667_10348678 | 3300025949 | Bacteria | 1510 |
| 363 | Ga0207667_10387248 | 3300025949 | Bacteria | 1424 |
| 364 | Ga0207668_10042480 | 3300025972 | Bacteria | 3079 |
| 365 | Ga0207668_10129694 | 3300025972 | Bacteria | 1923 |
| 366 | Ga0207640_10060359 | 3300025981 | Bacteria | 2506 |
| 367 | Ga0207640_10368608 | 3300025981 | Bacteria | 1160 |
| 368 | Ga0207677_10061516 | 3300026023 | Bacteria | 2601 |
| 369 | Ga0207703_10345982 | 3300026035 | Bacteria | 1368 |
| 370 | Ga0207703_10554506 | 3300026035 | Bacteria | 1084 |
| 371 | Ga0207639_10008009 | 3300026041 | Bacteria | 7220 |
| 372 | Ga0207678_10014592 | 3300026067 | Bacteria | 6914 |
| 373 | Ga0207678_10027182 | 3300026067 | Bacteria | 4990 |
| 374 | Ga0207678_10079253 | 3300026067 | Bacteria | 2813 |
| 375 | Ga0207678_10125020 | 3300026067 | Bacteria | 2194 |
| 376 | Ga0207678_10279947 | 3300026067 | Bacteria | 1431 |
| 377 | Ga0207678_10329627 | 3300026067 | Bacteria | 1314 |
| 378 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 379 | Ga0207702_10000014 | 3300026078 | Bacteria | 253304 |
| 380 | Ga0207702_10033457 | 3300026078 | Bacteria | 4294 |
| 381 | Ga0207702_10106532 | 3300026078 | Bacteria | 2484 |
| 382 | Ga0207702_10211921 | 3300026078 | Bacteria | 1802 |
| 383 | Ga0207702_10319646 | 3300026078 | Bacteria | 1478 |
| 384 | Ga0207702_10420068 | 3300026078 | Bacteria | 1293 |
| 385 | Ga0207641_10249261 | 3300026088 | Bacteria | 1658 |
| 386 | Ga0207676_10208596 | 3300026095 | Bacteria | 1732 |
| 387 | Ga0207674_10004961 | 3300026116 | Bacteria | 15902 |
| 388 | Ga0207674_10009035 | 3300026116 | Bacteria | 11446 |
| 389 | Ga0207674_10044466 | 3300026116 | Bacteria | 4574 |
| 390 | Ga0207674_10175694 | 3300026116 | Bacteria | 2094 |
| 391 | Ga0207683_10018023 | 3300026121 | Bacteria | 6021 |
| 392 | Ga0207683_10223320 | 3300026121 | Bacteria | 1717 |
| 393 | Ga0207698_10088283 | 3300026142 | Bacteria | 2528 |
| 394 | Ga0207698_10120408 | 3300026142 | Bacteria | 2220 |
| 395 | Ga0207698_10268969 | 3300026142 | Bacteria | 1570 |
| 396 | Ga0207698_10275638 | 3300026142 | Bacteria | 1553 |
| 397 | Ga0207698_10406542 | 3300026142 | Bacteria | 1302 |
| 398 | Ga0207698_10623316 | 3300026142 | Bacteria | 1066 |
| 399 | Ga0209389_1000016 | 3300027296 | Bacteria | 184844 |
| 400 | Ga0209389_1000027 | 3300027296 | Bacteria | 146917 |
| 401 | Ga0209371_1001354 | 3300027312 | Bacteria | 16977 |
| 402 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 403 | Ga0209589_1000031 | 3300027357 | Bacteria | 147054 |
| 404 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 405 | Ga0209489_100057 | 3300027361 | Bacteria | 147398 |
| 406 | Ga0209489_100063 | 3300027361 | Bacteria | 144408 |
| 407 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 408 | Ga0209700_100012 | 3300027363 | Bacteria | 357892 |
| 409 | Ga0268266_10004322 | 3300028379 | Bacteria | 13666 |
| 410 | Ga0268266_10006723 | 3300028379 | Bacteria | 10484 |
| 411 | Ga0268266_10086610 | 3300028379 | Bacteria | 2739 |
| 412 | Ga0268266_10359651 | 3300028379 | Bacteria | 1369 |
| 413 | Ga0268266_10676159 | 3300028379 | Bacteria | 994 |
| 414 | Ga0268265_10043874 | 3300028380 | Bacteria | 3326 |
| 415 | Ga0268264_10000042 | 3300028381 | Bacteria | 372069 |
| 416 | Ga0268264_10380313 | 3300028381 | Bacteria | 1352 |
| 417 | Ga0265337_1009916 | 3300028556 | Bacteria | 3365 |
| 418 | Ga0265319_1005843 | 3300028563 | Bacteria | 5806 |
| 419 | Ga0265334_10011705 | 3300028573 | Bacteria | 3688 |
| 420 | Ga0265323_10009578 | 3300028653 | Bacteria | 3950 |
| 421 | Ga0265336_10000395 | 3300028666 | Bacteria | 27433 |
| 422 | Ga0307517_10176129 | 3300028786 | Bacteria | 1392 |
| 423 | Ga0265338_10000018 | 3300028800 | Bacteria | 338910 |
| 424 | Ga0268256_1001153 | 3300030500 | Bacteria | 17056 |
| 425 | Ga0316183_1201524 | 3300030742 | Bacteria | 3062 |
| 426 | Ga0316181_1259633 | 3300030744 | Bacteria | 3339 |
| 427 | Ga0265330_10056386 | 3300031235 | Bacteria | 1715 |
| 428 | Ga0265339_10004193 | 3300031249 | Bacteria | 9881 |
| 429 | Ga0265331_10092294 | 3300031250 | Bacteria | 1398 |
| 430 | Ga0265327_10029833 | 3300031251 | Bacteria | 3095 |
| 431 | Ga0307513_10072122 | 3300031456 | Bacteria | 3601 |
| 432 | Ga0307509_10006260 | 3300031507 | Bacteria | 16085 |
| 433 | Ga0307509_10070980 | 3300031507 | Bacteria | 3635 |
| 434 | Ga0307509_10137057 | 3300031507 | Bacteria | 2391 |
| 435 | Ga0307509_10337852 | 3300031507 | Bacteria | 1235 |
| 436 | Ga0307408_100014308 | 3300031548 | Bacteria | 5271 |
| 437 | Ga0307508_10000125 | 3300031616 | Bacteria | 91829 |
| 438 | Ga0307508_10054061 | 3300031616 | Bacteria | 3561 |
| 439 | Ga0307508_10221869 | 3300031616 | Bacteria | 1490 |
| 440 | Ga0307508_10332828 | 3300031616 | Bacteria | 1110 |
| 441 | Ga0307508_10343203 | 3300031616 | Bacteria | 1085 |
| 442 | Ga0307514_10003203 | 3300031649 | Bacteria | 15988 |
| 443 | Ga0265314_10022030 | 3300031711 | Bacteria | 4886 |
| 444 | Ga0265314_10022428 | 3300031711 | Bacteria | 4836 |
| 445 | Ga0265342_10013040 | 3300031712 | Bacteria | 5600 |
| 446 | Ga0307516_10077415 | 3300031730 | Bacteria | 3175 |
| 447 | Ga0307516_10113165 | 3300031730 | Bacteria | 2512 |
| 448 | Ga0307516_10117287 | 3300031730 | Bacteria | 2456 |
| 449 | Ga0307516_10199918 | 3300031730 | Bacteria | 1719 |
| 450 | Ga0307405_10236767 | 3300031731 | Bacteria | 1349 |
| 451 | Ga0307406_10000052 | 3300031901 | Bacteria | 64031 |
| 452 | Ga0307406_10366718 | 3300031901 | Bacteria | 1131 |
| 453 | Ga0307412_10349797 | 3300031911 | Bacteria | 1186 |
| 454 | Ga0307414_10237263 | 3300032004 | Bacteria | 1507 |
| 455 | Ga0307507_10062098 | 3300033179 | Bacteria | 3474 |
| 456 | Ga0307510_10007708 | 3300033180 | Bacteria | 12837 |
| 457 | Ga0307510_10015767 | 3300033180 | Bacteria | 8935 |
| 458 | Ga0307510_10087981 | 3300033180 | Bacteria | 2969 |
| 459 | Ga0307510_10204610 | 3300033180 | Bacteria | 1504 |
| 460 | Ga0307510_10206472 | 3300033180 | Bacteria | 1492 |
| 461 | Ga0315911_1000005 | 3300033442 | Bacteria | 426255 |
| 462 | Ga0373934_0004936 | 3300035086 | Bacteria | 4940 |
| 463 | Ga0373932_0016069 | 3300035112 | Bacteria | 1906 |
| 464 | Ga0373954_0002374 | 3300035118 | Bacteria | 7874 |
| 465 | Ga0373956_0038676 | 3300035119 | Bacteria | 2111 |
| 466 | Ga0373957_0008219 | 3300035120 | Bacteria | 3371 |
| 467 | Ga0373943_0018713 | 3300035170 | Bacteria | 3184 |
| 468 | Ga0373946_0059032 | 3300035171 | Bacteria | 1627 |
| 469 | Ga0373955_0000590 | 3300035172 | Bacteria | 15443 |
| 470 | Ga0373961_0027281 | 3300035241 | Bacteria | 1567 |
| 471 | Ga0373924_0042035 | 3300035410 | Bacteria | 1874 |
| 472 | Ga0373931_0016534 | 3300035691 | Bacteria | 3633 |
| 473 | Ga0373927_0014600 | 3300035695 | Bacteria | 5195 |
| 474 | Ga0373927_0036611 | 3300035695 | Bacteria | 3191 |
| 475 | Ga0373933_0044344 | 3300035724 | Bacteria | 2634 |
| 476 | Ga0373947_0083172 | 3300035725 | Bacteria | 1985 |
| 477 | Ga0373947_0162647 | 3300035725 | Bacteria | 1444 |
| 478 | Ga0373925_0284792 | 3300037068 | Bacteria | 1332 |
| 479 | Ga0373925_0393303 | 3300037068 | Bacteria | 1130 |
| 480 | Ga0395900_0000753 | 3300037418 | Bacteria | 43021 |
| 481 | Ga0395900_0034589 | 3300037418 | Bacteria | 5205 |
| 482 | Ga0395900_0570067 | 3300037418 | Bacteria | 1075 |
| 483 | Ga0395898_0005579 | 3300037466 | Bacteria | 13568 |
| 484 | Ga0395898_0029509 | 3300037466 | Bacteria | 5494 |
| 485 | Ga0395905_0058930 | 3300037471 | Bacteria | 3590 |
| 486 | Ga0395905_0095802 | 3300037471 | Bacteria | 2786 |
| 487 | Ga0395901_0092860 | 3300038443 | Bacteria | 3159 |
| 488 | Ga0395901_0290360 | 3300038443 | Bacteria | 1697 |
| 489 | Ga0436365_0122301 | 3300039437 | Bacteria | 13111 |
| 490 | Ga0436365_0816185 | 3300039437 | Bacteria | 1576 |
| 491 | Ga0436360_0121399 | 3300039438 | Bacteria | 4193 |
| 492 | Ga0436361_0897018 | 3300039447 | Bacteria | 3253 |
| 493 | Ga0436361_1132428 | 3300039447 | Bacteria | 4403 |
| 494 | Ga0436363_1250187 | 3300039450 | Bacteria | 2190 |
| 495 | Ga0436362_0972873 | 3300039453 | Bacteria | 4993 |
| 496 | Ga0436362_1029662 | 3300039453 | Bacteria | 2783 |
| 497 | Ga0451791_0675706 | 3300041451 | Bacteria | 1153 |
| 498 | Ga0451843_0000168 | 3300041509 | Bacteria | 1133 |
| 499 | Ga0439432_000047 | 3300042006 | Bacteria | 37317 |
| 500 | Ga0450891_000878 | 3300042129 | Bacteria | 3142 |
| 501 | Ga0466969_0016241 | 3300044656 | Bacteria | 3899 |
| 502 | Ga0466972_0000585 | 3300044658 | Bacteria | 17722 |
| 503 | Ga0466966_0000720 | 3300044684 | Bacteria | 20983 |
| 504 | Ga0466961_0000136 | 3300044693 | Bacteria | 49049 |
| 505 | Ga0466963_0047541 | 3300044694 | Bacteria | 2832 |
| 506 | Ga0466964_0018290 | 3300044706 | Bacteria | 2688 |
| 507 | Ga0466970_0091748 | 3300044765 | Bacteria | 1649 |
| 508 | Ga0466957_0070496 | 3300044842 | Bacteria | 2160 |
| 509 | Ga0466957_0198439 | 3300044842 | Bacteria | 1317 |
| 510 | Ga0466959_0030496 | 3300045049 | Bacteria | 3992 |
| 511 | Ga0466959_0132374 | 3300045049 | Bacteria | 1767 |
| 512 | Ga0466967_0049868 | 3300045976 | Bacteria | 3664 |
| 513 | Ga0466967_0090376 | 3300045976 | Bacteria | 2781 |
| 514 | Ga0466967_0118618 | 3300045976 | Bacteria | 2441 |
| 515 | Ga0466967_0257117 | 3300045976 | Bacteria | 1670 |
| 516 | Ga0495592_0007391 | 3300046454 | Bacteria | 8221 |
| 517 | Ga0495603_0017965 | 3300046455 | Bacteria | 4280 |
| 518 | Ga0495603_0036375 | 3300046455 | Bacteria | 2956 |
| 519 | Ga0495603_0046931 | 3300046455 | Bacteria | 2573 |
| 520 | Ga0495603_0060530 | 3300046455 | Bacteria | 2237 |
| 521 | Ga0495603_0114087 | 3300046455 | Bacteria | 1576 |
| 522 | Ga0495629_0021300 | 3300046459 | Bacteria | 4625 |
| 523 | Ga0495638_0016562 | 3300046460 | Bacteria | 4934 |
| 524 | Ga0495638_0025345 | 3300046460 | Bacteria | 3856 |
| 525 | Ga0495641_0077094 | 3300046461 | Bacteria | 1494 |
| 526 | Ga0495651_0009620 | 3300046462 | Bacteria | 7427 |
| 527 | Ga0495651_0058439 | 3300046462 | Bacteria | 2959 |
| 528 | Ga0495651_0065835 | 3300046462 | Bacteria | 2767 |
| 529 | Ga0495651_0177628 | 3300046462 | Bacteria | 1510 |
| 530 | Ga0495653_0017260 | 3300046463 | Bacteria | 5871 |
| 531 | Ga0495605_0072285 | 3300046474 | Bacteria | 1627 |
| 532 | Ga0495605_0145814 | 3300046474 | Bacteria | 1059 |
| 533 | Ga0495639_0105919 | 3300046475 | Bacteria | 1331 |
| 534 | Ga0495639_0179251 | 3300046475 | Bacteria | 1031 |
| 535 | Ga0495664_0009047 | 3300046477 | Bacteria | 5568 |
| 536 | Ga0495664_0011721 | 3300046477 | Bacteria | 4949 |
| 537 | Ga0495664_0018996 | 3300046477 | Bacteria | 3947 |
| 538 | Ga0495664_0271384 | 3300046477 | Bacteria | 1025 |
| 539 | Ga0495585_0136242 | 3300046492 | Bacteria | 1289 |
| 540 | Ga0495596_0104938 | 3300046500 | Bacteria | 1097 |
| 541 | Ga0495583_0093806 | 3300046506 | Bacteria | 1289 |
| 542 | Ga0495606_0012721 | 3300046507 | Bacteria | 6710 |
| 543 | Ga0495606_0024749 | 3300046507 | Bacteria | 4318 |
| 544 | Ga0495606_0181991 | 3300046507 | Bacteria | 1211 |
| 545 | Ga0495606_0196889 | 3300046507 | Bacteria | 1151 |
| 546 | Ga0495608_0019083 | 3300046511 | Bacteria | 4727 |
| 547 | Ga0495608_0048870 | 3300046511 | Bacteria | 2810 |
| 548 | Ga0495608_0068933 | 3300046511 | Bacteria | 2312 |
| 549 | Ga0495610_0055778 | 3300046512 | Bacteria | 1903 |
| 550 | Ga0495610_0144162 | 3300046512 | Bacteria | 1022 |
| 551 | Ga0495616_0149186 | 3300046513 | Bacteria | 1059 |
| 552 | Ga0495618_0035324 | 3300046514 | Bacteria | 3138 |
| 553 | Ga0495620_0089680 | 3300046515 | Bacteria | 1235 |
| 554 | Ga0495628_0011834 | 3300046516 | Bacteria | 7362 |
| 555 | Ga0495631_0119821 | 3300046518 | Bacteria | 1132 |
| 556 | Ga0495632_0178900 | 3300046519 | Bacteria | 972 |
| 557 | Ga0495643_0021450 | 3300046522 | Bacteria | 3705 |
| 558 | Ga0495648_0056224 | 3300046524 | Bacteria | 2368 |
| 559 | Ga0495648_0118424 | 3300046524 | Bacteria | 1428 |
| 560 | Ga0495652_0004325 | 3300046529 | Bacteria | 13603 |
| 561 | Ga0495652_0033670 | 3300046529 | Bacteria | 4470 |
| 562 | Ga0495640_0009547 | 3300046533 | Bacteria | 7547 |
| 563 | Ga0495640_0028702 | 3300046533 | Bacteria | 4003 |
| 564 | Ga0495587_0027506 | 3300046536 | Bacteria | 3462 |
| 565 | Ga0495587_0058603 | 3300046536 | Bacteria | 2262 |
| 566 | Ga0495598_0033166 | 3300046537 | Bacteria | 1464 |
| 567 | Ga0495609_0094911 | 3300046538 | Bacteria | 1295 |
| 568 | Ga0495609_0126024 | 3300046538 | Bacteria | 1099 |
| 569 | Ga0495645_0007861 | 3300046543 | Bacteria | 7418 |
| 570 | Ga0495645_0009133 | 3300046543 | Bacteria | 6926 |
| 571 | Ga0495622_0006001 | 3300046557 | Bacteria | 5644 |
| 572 | Ga0495622_0009820 | 3300046557 | Bacteria | 4425 |
| 573 | Ga0495622_0061671 | 3300046557 | Bacteria | 1736 |
| 574 | Ga0495622_0076200 | 3300046557 | Bacteria | 1545 |
| 575 | Ga0495633_0052517 | 3300046558 | Bacteria | 1920 |
| 576 | Ga0495667_0026445 | 3300046559 | Bacteria | 3911 |
| 577 | Ga0495667_0035440 | 3300046559 | Bacteria | 3334 |
| 578 | Ga0495656_0042832 | 3300046615 | Bacteria | 1897 |
| 579 | Ga0495668_0024106 | 3300046616 | Bacteria | 3462 |
| 580 | Ga0495668_0067864 | 3300046616 | Bacteria | 1962 |
| 581 | Ga0495668_0098762 | 3300046616 | Bacteria | 1597 |
| 582 | Ga0495634_0009379 | 3300046642 | Bacteria | 7219 |
| 583 | Ga0495634_0034428 | 3300046642 | Bacteria | 3476 |
| 584 | Ga0495625_0236326 | 3300046660 | Bacteria | 1191 |
| 585 | Ga0495635_0007423 | 3300046663 | Bacteria | 7651 |
| 586 | Ga0495635_0012284 | 3300046663 | Bacteria | 5998 |
| 587 | Ga0495635_0093517 | 3300046663 | Bacteria | 2056 |
| 588 | Ga0495659_0081824 | 3300046664 | Bacteria | 1226 |
| 589 | Ga0495588_0004335 | 3300046674 | Bacteria | 6264 |
| 590 | Ga0495657_0001308 | 3300046675 | Bacteria | 21681 |
| 591 | Ga0495657_0007247 | 3300046675 | Bacteria | 8593 |
| 592 | Ga0495657_0016949 | 3300046675 | Bacteria | 5295 |
| 593 | Ga0495599_0019799 | 3300046678 | Bacteria | 4191 |
| 594 | Ga0495599_0025698 | 3300046678 | Bacteria | 3688 |
| 595 | Ga0495599_0051324 | 3300046678 | Bacteria | 2584 |
| 596 | Ga0495623_0021928 | 3300046679 | Bacteria | 4125 |
| 597 | Ga0495623_0120808 | 3300046679 | Bacteria | 1577 |
| 598 | Ga0495646_0046922 | 3300046680 | Bacteria | 2631 |
| 599 | Ga0495646_0081177 | 3300046680 | Bacteria | 1890 |
| 600 | Ga0495669_0108507 | 3300046684 | Bacteria | 1294 |
| 601 | Ga0495669_0139417 | 3300046684 | Bacteria | 1144 |
| 602 | Ga0495613_0119691 | 3300046689 | Bacteria | 1891 |
| 603 | Ga0495624_0074817 | 3300046690 | Bacteria | 2103 |
| 604 | Ga0495671_0100551 | 3300046692 | Bacteria | 1414 |
| 605 | Ga0495649_0119963 | 3300046694 | Bacteria | 1391 |
| 606 | Ga0495589_0136929 | 3300046794 | Bacteria | 1174 |
| 607 | Ga0495600_0007966 | 3300046809 | Bacteria | 6491 |
| 608 | Ga0495600_0020140 | 3300046809 | Bacteria | 4267 |
| 609 | Ga0495600_0031062 | 3300046809 | Bacteria | 3459 |
| 610 | Ga0495581_0167462 | 3300047315 | Bacteria | 1285 |
| 611 | Ga0495604_0006128 | 3300047317 | Bacteria | 9545 |
| 612 | Ga0495604_0020133 | 3300047317 | Bacteria | 5331 |
| 613 | Ga0495604_0244404 | 3300047317 | Bacteria | 1226 |
| 614 | Ga0495674_0011175 | 3300047319 | Bacteria | 8479 |
| 615 | Ga0495674_0044585 | 3300047319 | Bacteria | 3942 |
| 616 | Ga0495674_0121079 | 3300047319 | Bacteria | 2210 |
| 617 | Ga0495672_0005618 | 3300047320 | Bacteria | 9900 |
| 618 | Ga0495676_0162888 | 3300047321 | Bacteria | 1576 |
| 619 | Ga0495676_0224246 | 3300047321 | Bacteria | 1294 |
| 620 | Ga0495680_0001053 | 3300047322 | Bacteria | 30524 |
| 621 | Ga0495680_0014448 | 3300047322 | Bacteria | 6836 |
| 622 | Ga0495687_016734 | 3300047443 | Bacteria | 3679 |
| 623 | Ga0495679_007969 | 3300047446 | Bacteria | 4356 |
| 624 | Ga0495684_0073127 | 3300047471 | Bacteria | 2604 |
| 625 | Ga0495686_0213485 | 3300047472 | Bacteria | 1101 |
| 626 | Ga0495602_0021411 | 3300048088 | Bacteria | 6366 |
| 627 | Ga0495602_0074922 | 3300048088 | Bacteria | 2874 |
| 628 | Ga0496100_0012991 | 3300048903 | Bacteria | 4792 |
| 629 | Ga0496101_0003670 | 3300048904 | Bacteria | 9579 |
| 630 | Ga0496101_0130902 | 3300048904 | Bacteria | 1905 |
| 631 | Ga0496101_0203088 | 3300048904 | Bacteria | 1533 |
| 632 | Ga0496101_0250297 | 3300048904 | Bacteria | 1380 |
| 633 | Ga0496102_0001403 | 3300048905 | Bacteria | 21391 |
| 634 | Ga0496102_0051154 | 3300048905 | Bacteria | 3764 |
| 635 | Ga0496102_0067221 | 3300048905 | Bacteria | 3287 |
| 636 | Ga0496102_0719152 | 3300048905 | Bacteria | 921 |
| 637 | Ga0496103_0116426 | 3300048906 | Bacteria | 1700 |
| 638 | Ga0496103_0276307 | 3300048906 | Bacteria | 1081 |
| 639 | Ga0496104_0002112 | 3300048907 | Bacteria | 17255 |
| 640 | Ga0496104_0014912 | 3300048907 | Bacteria | 7025 |
| 641 | Ga0496104_0029597 | 3300048907 | Bacteria | 5080 |
| 642 | Ga0496104_0108179 | 3300048907 | Bacteria | 2664 |
| 643 | Ga0496104_0126288 | 3300048907 | Bacteria | 2456 |
| 644 | Ga0496104_0301812 | 3300048907 | Bacteria | 1513 |
| 645 | Ga0496105_0046798 | 3300048908 | Bacteria | 3570 |
| 646 | Ga0496105_0076936 | 3300048908 | Bacteria | 2756 |
| 647 | Ga0496105_0087969 | 3300048908 | Bacteria | 2566 |
| 648 | Ga0496105_0123081 | 3300048908 | Bacteria | 2138 |
| 649 | Ga0496106_0001280 | 3300048909 | Bacteria | 18862 |
| 650 | Ga0496106_0011375 | 3300048909 | Bacteria | 6586 |
| 651 | Ga0496106_0066732 | 3300048909 | Bacteria | 2741 |
| 652 | Ga0496106_0234646 | 3300048909 | Bacteria | 1465 |
| 653 | Ga0496107_0027212 | 3300048910 | Bacteria | 4060 |
| 654 | Ga0496107_0202501 | 3300048910 | Bacteria | 1475 |
| 655 | Ga0496107_0226803 | 3300048910 | Bacteria | 1390 |
| 656 | Ga0496108_0031333 | 3300048911 | Bacteria | 4412 |
| 657 | Ga0496108_0173496 | 3300048911 | Bacteria | 1866 |
| 658 | Ga0496108_0399302 | 3300048911 | Bacteria | 1201 |
| 659 | Ga0496109_0010437 | 3300048912 | Bacteria | 7934 |
| 660 | Ga0496109_0240372 | 3300048912 | Bacteria | 1704 |
| 661 | Ga0496109_0284205 | 3300048912 | Bacteria | 1559 |
| 662 | Ga0496110_0056755 | 3300048913 | Bacteria | 3446 |
| 663 | Ga0496110_0078391 | 3300048913 | Bacteria | 2941 |
| 664 | Ga0496110_0133066 | 3300048913 | Bacteria | 2246 |
| 665 | Ga0496110_0146918 | 3300048913 | Bacteria | 2133 |
| 666 | Ga0496110_0186033 | 3300048913 | Bacteria | 1886 |
| 667 | Ga0496110_0245272 | 3300048913 | Bacteria | 1630 |
| 668 | Ga0496110_0611197 | 3300048913 | Bacteria | 988 |
| 669 | Ga0496111_0004711 | 3300048914 | Bacteria | 8653 |
| 670 | Ga0496111_0057198 | 3300048914 | Bacteria | 2823 |
| 671 | Ga0496111_0208005 | 3300048914 | Bacteria | 1454 |
| 672 | Ga0496111_0369052 | 3300048914 | Bacteria | 1062 |
| 673 | Ga0496112_0027302 | 3300048915 | Bacteria | 5504 |
| 674 | Ga0496112_0036649 | 3300048915 | Bacteria | 4785 |
| 675 | Ga0496112_0144708 | 3300048915 | Bacteria | 2345 |
| 676 | Ga0496112_0199695 | 3300048915 | Bacteria | 1959 |
| 677 | Ga0496112_0503338 | 3300048915 | Bacteria | 1147 |
| 678 | Ga0496113_0006206 | 3300048916 | Bacteria | 7551 |
| 679 | Ga0496113_0035660 | 3300048916 | Bacteria | 3639 |
| 680 | Ga0496113_0093556 | 3300048916 | Bacteria | 2320 |
| 681 | Ga0496114_0069047 | 3300048917 | Bacteria | 2967 |
| 682 | Ga0496114_0346237 | 3300048917 | Bacteria | 1314 |
| 683 | Ga0496115_0004202 | 3300048918 | Bacteria | 10415 |
| 684 | Ga0496115_0049654 | 3300048918 | Bacteria | 3359 |
| 685 | Ga0496115_0263750 | 3300048918 | Bacteria | 1416 |
| 686 | Ga0496116_0127078 | 3300048919 | Bacteria | 1462 |
| 687 | Ga0496117_0028354 | 3300048920 | Bacteria | 4339 |
| 688 | Ga0496117_0089657 | 3300048920 | Bacteria | 1985 |
| 689 | Ga0496118_0001458 | 3300048921 | Bacteria | 35562 |
| 690 | Ga0496118_0031386 | 3300048921 | Bacteria | 4405 |
| 691 | Ga0496119_0003138 | 3300048922 | Bacteria | 17407 |
| 692 | Ga0496119_0197794 | 3300048922 | Bacteria | 1042 |
| 693 | Ga0496120_0015858 | 3300048923 | Bacteria | 4949 |
| 694 | Ga0496120_0042462 | 3300048923 | Bacteria | 2655 |
| 695 | Ga0496121_0000146 | 3300048924 | Bacteria | 154459 |
| 696 | Ga0496121_0001525 | 3300048924 | Bacteria | 38839 |
| 697 | Ga0496121_0039521 | 3300048924 | Bacteria | 4155 |
| 698 | Ga0496121_0073560 | 3300048924 | Bacteria | 2738 |
| 699 | Ga0496121_0079535 | 3300048924 | Bacteria | 2602 |
| 700 | Ga0496121_0109129 | 3300048924 | Bacteria | 2115 |
| 701 | Ga0496121_0141995 | 3300048924 | Bacteria | 1780 |
| 702 | Ga0496121_0173220 | 3300048924 | Bacteria | 1565 |
| 703 | Ga0496121_0221500 | 3300048924 | Bacteria | 1332 |
| 704 | Ga0496121_0261049 | 3300048924 | Bacteria | 1196 |
| 705 | Ga0496122_0013345 | 3300048925 | Bacteria | 8048 |
| 706 | Ga0496122_0078087 | 3300048925 | Bacteria | 2321 |
| 707 | Ga0496123_0115156 | 3300048926 | Bacteria | 1526 |
| 708 | Ga0496124_0002217 | 3300048927 | Bacteria | 25870 |
| 709 | Ga0496124_0012006 | 3300048927 | Bacteria | 8611 |
| 710 | Ga0496124_0074509 | 3300048927 | Bacteria | 2805 |
| 711 | Ga0496124_0330131 | 3300048927 | Bacteria | 1088 |
| 712 | Ga0496125_0000099 | 3300048928 | Bacteria | 203333 |
| 713 | Ga0496125_0003103 | 3300048928 | Bacteria | 20706 |
| 714 | Ga0496125_0003676 | 3300048928 | Bacteria | 18328 |
| 715 | Ga0496125_0056870 | 3300048928 | Bacteria | 3173 |
| 716 | Ga0496125_0098349 | 3300048928 | Bacteria | 2165 |
| 717 | Ga0496125_0101350 | 3300048928 | Bacteria | 2119 |
| 718 | Ga0496125_0171374 | 3300048928 | Bacteria | 1458 |
| 719 | Ga0496125_0255755 | 3300048928 | Bacteria | 1101 |
| 720 | Ga0496126_0003212 | 3300048929 | Bacteria | 20945 |
| 721 | Ga0496126_0004243 | 3300048929 | Bacteria | 17254 |
| 722 | Ga0496126_0010429 | 3300048929 | Bacteria | 9736 |
| 723 | Ga0496126_0016652 | 3300048929 | Bacteria | 7346 |
| 724 | Ga0496126_0058992 | 3300048929 | Bacteria | 3457 |
| 725 | Ga0496126_0124221 | 3300048929 | Bacteria | 2235 |
| 726 | Ga0496126_0142660 | 3300048929 | Bacteria | 2060 |
| 727 | Ga0496126_0236367 | 3300048929 | Bacteria | 1528 |
| 728 | Ga0496126_0252657 | 3300048929 | Bacteria | 1468 |
| 729 | Ga0496126_0316293 | 3300048929 | Bacteria | 1284 |
| 730 | Ga0496126_0398518 | 3300048929 | Bacteria | 1117 |
| 731 | Ga0501033_0020903 | 3300049570 | Bacteria | 4940 |
| 732 | Ga0501034_0168820 | 3300049571 | Bacteria | 2156 |
| 733 | Ga0501037_0087480 | 3300049573 | Bacteria | 2255 |
| 734 | Ga0501038_0113748 | 3300049574 | Bacteria | 2239 |
| 735 | Ga0501039_0187577 | 3300049575 | Bacteria | 1626 |
| 736 | Ga0501047_0257069 | 3300049581 | Bacteria | 1594 |
| 737 | Ga0501068_0139925 | 3300049584 | Bacteria | 1517 |
| 738 | Ga0501073_0151635 | 3300049589 | Bacteria | 1607 |
| 739 | Ga0501235_019739 | 3300049669 | Bacteria | 1496 |
| 740 | Ga0501080_0097775 | 3300049742 | Bacteria | 2726 |
| 741 | nmdc:mga03683_3300_c1 | 3300050489 | Bacteria | 4493 |
| 742 | nmdc:mga03n38_1503_c1 | 3300050490 | Bacteria | 6729 |
| 743 | nmdc:mga03n38_74501_c1 | 3300050490 | Bacteria | 1579 |
| 744 | nmdc:mga00v17_270674_c1 | 3300050491 | Bacteria | 1102 |
| 745 | nmdc:mga0yw44_186447_c1 | 3300050492 | Bacteria | 1367 |
| 746 | nmdc:mga0yw44_238276_c1 | 3300050492 | Bacteria | 1209 |
| 747 | nmdc:mga0yw44_88455_c1 | 3300050492 | Bacteria | 1953 |
| 748 | nmdc:mga0k408_23297_c1 | 3300050493 | Bacteria | 3491 |
| 749 | nmdc:mga06z11_172489_c1 | 3300050494 | Bacteria | 1243 |
| 750 | nmdc:mga06z11_185854_c1 | 3300050494 | Bacteria | 1201 |
| 751 | nmdc:mga06z11_64715_c1 | 3300050494 | Bacteria | 1917 |
| 752 | nmdc:mga06z11_7051_c1 | 3300050494 | Bacteria | 4608 |
| 753 | nmdc:mga04h51_45459_c1 | 3300050495 | Bacteria | 1452 |
| 754 | nmdc:mga07m45_168319_c1 | 3300050496 | Bacteria | 1273 |
| 755 | nmdc:mga07m45_180195_c1 | 3300050496 | Bacteria | 1229 |
| 756 | nmdc:mga07m45_20736_c1 | 3300050496 | Bacteria | 3572 |
| 757 | nmdc:mga05p37_15155_c1 | 3300050507 | Bacteria | 9257 |
| 758 | nmdc:mga05p37_75724_c1 | 3300050507 | Bacteria | 4142 |
| 759 | nmdc:mga0n895_236471_c1 | 3300050512 | Bacteria | 1854 |
| 760 | nmdc:mga0sz30_43399_c1 | 3300050516 | Bacteria | 1893 |
| 761 | nmdc:mga0sz30_93211_c1 | 3300050516 | Bacteria | 1312 |
| 762 | nmdc:mga0sz30_93948_c1 | 3300050516 | Bacteria | 1307 |
| 763 | Ga0495601_0032293 | 3300053077 | Bacteria | 3258 |
| 764 | Ga0495601_0108477 | 3300053077 | Bacteria | 1796 |
| 765 | Ga0495612_0097656 | 3300053078 | Bacteria | 1248 |
| 766 | Ga0500635_0055288 | 3300053080 | Bacteria | 1370 |
| 767 | Ga0495655_0007769 | 3300053083 | Bacteria | 2010 |
| 768 | Ga0495595_0061912 | 3300053084 | Bacteria | 1753 |
| 769 | Ga0495619_0077752 | 3300053085 | Bacteria | 2229 |
| 770 | Ga0500643_000052 | 3300053087 | Bacteria | 144656 |
| 771 | Ga0500643_023418 | 3300053087 | Bacteria | 1973 |
| 772 | Ga0500647_0020775 | 3300053091 | Bacteria | 3059 |
| 773 | Ga0500651_0018968 | 3300053093 | Bacteria | 4265 |
| 774 | Ga0500566_0039993 | 3300053094 | Bacteria | 2710 |
| 775 | Ga0500566_0077548 | 3300053094 | Bacteria | 1855 |
| 776 | Ga0500554_028832 | 3300053102 | Bacteria | 1617 |
| 777 | Ga0500554_067935 | 3300053102 | Bacteria | 1155 |
| 778 | Ga0500555_001634 | 3300053103 | Bacteria | 6773 |
| 779 | Ga0500556_0003305 | 3300053104 | Bacteria | 4778 |
| 780 | Ga0500556_0094648 | 3300053104 | Bacteria | 1144 |
| 781 | Ga0500557_000096 | 3300053105 | Bacteria | 28838 |
| 782 | Ga0500569_001480 | 3300053109 | Bacteria | 4446 |
| 783 | Ga0500572_000335 | 3300053111 | Bacteria | 16881 |
| 784 | Ga0500572_012239 | 3300053111 | Bacteria | 2098 |
| 785 | Ga0500594_0083366 | 3300053118 | Bacteria | 960 |
| 786 | Ga0500595_000728 | 3300053119 | Bacteria | 19571 |
| 787 | Ga0500595_012442 | 3300053119 | Bacteria | 3292 |
| 788 | Ga0500595_021655 | 3300053119 | Bacteria | 2291 |
| 789 | Ga0500595_059971 | 3300053119 | Bacteria | 1152 |
| 790 | Ga0500642_0000083 | 3300053130 | Bacteria | 50718 |
| 791 | Ga0500658_0026515 | 3300053134 | Bacteria | 2233 |
| 792 | Ga0500658_0051892 | 3300053134 | Bacteria | 1678 |
| 793 | Ga0500559_0003196 | 3300053136 | Bacteria | 8145 |
| 794 | Ga0500559_0037151 | 3300053136 | Bacteria | 2110 |
| 795 | Ga0500564_067301 | 3300053138 | Bacteria | 1619 |
| 796 | Ga0500568_0027187 | 3300053139 | Bacteria | 2394 |
| 797 | Ga0500573_0144985 | 3300053140 | Bacteria | 1304 |
| 798 | Ga0500577_0050831 | 3300053142 | Bacteria | 1556 |
| 799 | Ga0500590_075347 | 3300053148 | Bacteria | 1669 |
| 800 | Ga0500603_003284 | 3300053150 | Bacteria | 3475 |
| 801 | Ga0500616_0015671 | 3300053153 | Bacteria | 4327 |
| 802 | Ga0500616_0060448 | 3300053153 | Bacteria | 1964 |
| 803 | Ga0500622_0012122 | 3300053156 | Bacteria | 4678 |
| 804 | Ga0500638_007140 | 3300053162 | Bacteria | 4643 |
| 805 | Ga0500639_161605 | 3300053163 | Bacteria | 1018 |
| 806 | Ga0500636_0000232 | 3300053177 | Bacteria | 30484 |
| 807 | Ga0500636_0024967 | 3300053177 | Bacteria | 3532 |
| 808 | Ga0500636_0035062 | 3300053177 | Bacteria | 2970 |
| 809 | Ga0500636_0175110 | 3300053177 | Bacteria | 1157 |
| 810 | Ga0500637_0000080 | 3300053178 | Bacteria | 34464 |
| 811 | Ga0500637_0188357 | 3300053178 | Bacteria | 1179 |
| 812 | Ga0500625_026577 | 3300053729 | Bacteria | 2742 |
| 813 | Ga0500645_004073 | 3300053730 | Bacteria | 5727 |
| 814 | Ga0500645_052144 | 3300053730 | Bacteria | 1192 |
| 815 | Ga0500645_052415 | 3300053730 | Bacteria | 1189 |
| 816 | Ga0500609_000805 | 3300053731 | Bacteria | 4710 |
| 817 | Ga0500596_002066 | 3300053735 | Bacteria | 4000 |
| 818 | Ga0500599_002446 | 3300053736 | Bacteria | 2228 |
| 819 | Ga0500601_000108 | 3300053737 | Bacteria | 17177 |
| 820 | Ga0501084_0016246 | 3300054114 | Bacteria | 6181 |
| 821 | Ga0500661_011701 | 3300055283 | Bacteria | 1586 |
| 822 | Ga0501082_0193577 | 3300060353 | Bacteria | 1769 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049669 | Ga0501235_019739 | Ga0501235_019739_122_871 | 249 |
| 2 | 3300014326 | Ga0157380_10538360 | Ga0157380_105383601 | 251 |
| 3 | 3300048926 | Ga0496123_0115156 | Ga0496123_0115156_509_1393 | 257 |
| 4 | 3300006051 | Ga0075364_10253173 | Ga0075364_102531731 | 265 |
| 5 | 3300005455 | Ga0070663_100174728 | Ga0070663_1001747282 | 267 |
| 6 | 3300005456 | Ga0070678_100202136 | Ga0070678_1002021362 | 267 |
| 7 | 3300026067 | Ga0207678_10279947 | Ga0207678_102799472 | 267 |
| 8 | 3300026121 | Ga0207683_10018023 | Ga0207683_100180234 | 267 |
| 9 | 3300005365 | Ga0070688_100145669 | Ga0070688_1001456692 | 270 |
| 10 | 3300025908 | Ga0207643_10027690 | Ga0207643_100276903 | 270 |
| 11 | 3300027312 | Ga0209371_1001354 | Ga0209371_10013546 | 271 |
| 12 | 3300030500 | Ga0268256_1001153 | Ga0268256_10011536 | 271 |
| 13 | 3300047320 | Ga0495672_0005618 | Ga0495672_0005618_5389_6261 | 271 |
| 14 | 3300009093 | Ga0105240_10009125 | Ga0105240_100091255 | 272 |
| 15 | iso_pu_bacteria | 2893066018 | 2893070664 | 272 |
| 16 | 3300010159 | Ga0099796_10096508 | Ga0099796_100965082 | 273 |
| 17 | 3300053139 | Ga0500568_0027187 | Ga0500568_0027187_1215_2117 | 273 |
| 18 | 3300053140 | Ga0500573_0144985 | Ga0500573_0144985_175_1008 | 273 |
| 19 | 3300013297 | Ga0157378_10222202 | Ga0157378_102222021 | 274 |
| 20 | 3300037471 | Ga0395905_0058930 | Ga0395905_0058930_318_1187 | 274 |
| 21 | 3300038443 | Ga0395901_0092860 | Ga0395901_0092860_109_978 | 274 |
| 22 | 3300041509 | Ga0451843_0000168 | Ga0451843_0000168_122_1006 | 274 |
| 23 | 3300046462 | Ga0495651_0177628 | Ga0495651_0177628_29_868 | 274 |
| 24 | 3300053118 | Ga0500594_0083366 | Ga0500594_0083366_22_879 | 274 |
| 25 | 3300005347 | Ga0070668_100103430 | Ga0070668_1001034303 | 275 |
| 26 | 3300005455 | Ga0070663_100166983 | Ga0070663_1001669832 | 275 |
| 27 | 3300005466 | Ga0070685_10175818 | Ga0070685_101758181 | 275 |
| 28 | 3300005617 | Ga0068859_100164271 | Ga0068859_1001642712 | 275 |
| 29 | 3300005719 | Ga0068861_100170496 | Ga0068861_1001704962 | 275 |
| 30 | 3300006195 | Ga0075366_10112604 | Ga0075366_101126042 | 275 |
| 31 | 3300006931 | Ga0097620_100164286 | Ga0097620_1001642862 | 275 |
| 32 | 3300009148 | Ga0105243_10231134 | Ga0105243_102311342 | 275 |
| 33 | 3300013297 | Ga0157378_10391905 | Ga0157378_103919052 | 275 |
| 34 | 3300014325 | Ga0163163_10513828 | Ga0163163_105138282 | 275 |
| 35 | 3300025903 | Ga0207680_10269037 | Ga0207680_102690372 | 275 |
| 36 | 3300025935 | Ga0207709_10251506 | Ga0207709_102515062 | 275 |
| 37 | 3300025942 | Ga0207689_10304900 | Ga0207689_103049002 | 275 |
| 38 | 3300026095 | Ga0207676_10208596 | Ga0207676_102085962 | 275 |
| 39 | 3300028379 | Ga0268266_10004322 | Ga0268266_1000432213 | 275 |
| 40 | 3300046462 | Ga0495651_0058439 | Ga0495651_0058439_1839_2681 | 275 |
| 41 | 3300046537 | Ga0495598_0033166 | Ga0495598_0033166_436_1281 | 275 |
| 42 | 3300048924 | Ga0496121_0221500 | Ga0496121_0221500_322_1167 | 275 |
| 43 | 3300050490 | nmdc:mga03n38_74501_c1 | nmdc:mga03n38_74501_c1_330_1199 | 275 |
| 44 | 3300050494 | nmdc:mga06z11_172489_c1 | nmdc:mga06z11_172489_c1_164_1009 | 275 |
| 45 | 3300050496 | nmdc:mga07m45_168319_c1 | nmdc:mga07m45_168319_c1_277_1122 | 275 |
| 46 | 3300050516 | nmdc:mga0sz30_93211_c1 | nmdc:mga0sz30_93211_c1_293_1162 | 275 |
| 47 | 3300005455 | Ga0070663_100007241 | Ga0070663_1000072413 | 276 |
| 48 | 3300005548 | Ga0070665_100105477 | Ga0070665_1001054773 | 276 |
| 49 | 3300006048 | Ga0075363_100004089 | Ga0075363_10000408910 | 276 |
| 50 | 3300009101 | Ga0105247_10173183 | Ga0105247_101731832 | 276 |
| 51 | 3300028379 | Ga0268266_10006723 | Ga0268266_100067232 | 276 |
| 52 | 3300031616 | Ga0307508_10054061 | Ga0307508_100540613 | 276 |
| 53 | 3300037068 | Ga0373925_0393303 | Ga0373925_0393303_185_1054 | 276 |
| 54 | 3300046455 | Ga0495603_0060530 | Ga0495603_0060530_799_1668 | 276 |
| 55 | 3300046674 | Ga0495588_0004335 | Ga0495588_0004335_3257_4126 | 276 |
| 56 | 3300048928 | Ga0496125_0101350 | Ga0496125_0101350_239_1102 | 276 |
| 57 | 3300048929 | Ga0496126_0236367 | Ga0496126_0236367_17_880 | 276 |
| 58 | 3300050490 | nmdc:mga03n38_1503_c1 | nmdc:mga03n38_1503_c1_3944_4813 | 276 |
| 59 | 3300050491 | nmdc:mga00v17_270674_c1 | nmdc:mga00v17_270674_c1_165_1007 | 276 |
| 60 | 3300050492 | nmdc:mga0yw44_88455_c1 | nmdc:mga0yw44_88455_c1_940_1782 | 276 |
| 61 | 3300050493 | nmdc:mga0k408_23297_c1 | nmdc:mga0k408_23297_c1_1733_2575 | 276 |
| 62 | 3300050494 | nmdc:mga06z11_7051_c1 | nmdc:mga06z11_7051_c1_1502_2371 | 276 |
| 63 | 3300050496 | nmdc:mga07m45_20736_c1 | nmdc:mga07m45_20736_c1_448_1290 | 276 |
| 64 | 3300046475 | Ga0495639_0105919 | Ga0495639_0105919_291_1145 | 277 |
| 65 | 3300046507 | Ga0495606_0196889 | Ga0495606_0196889_167_1036 | 277 |
| 66 | iso_pu_bacteria | 2906660503 | 2906663433 | 277 |
| 67 | 3300009551 | Ga0105238_10572317 | Ga0105238_105723172 | 278 |
| 68 | 3300048088 | Ga0495602_0074922 | Ga0495602_0074922_1727_2602 | 278 |
| 69 | iso_pu_bacteria | 2513237096 | 2513655384 | 278 |
| 70 | iso_pu_bacteria | 2513237137 | 2513860052 | 278 |
| 71 | iso_pu_bacteria | 2513237145 | 2513916538 | 278 |
| 72 | iso_pu_bacteria | 2517093001 | 2517104618 | 278 |
| 73 | iso_pu_bacteria | 2517572143 | 2517889871 | 278 |
| 74 | iso_pu_bacteria | 2524023228 | 2524532941 | 278 |
| 75 | iso_pu_bacteria | 2667528175 | 2671121105 | 278 |
| 76 | iso_pu_bacteria | 2728368998 | 2728751734 | 278 |
| 77 | iso_pu_bacteria | 2791355197 | 2793073399 | 278 |
| 78 | iso_pu_bacteria | 2791355199 | 2793078591 | 278 |
| 79 | iso_pu_bacteria | 2885374607 | 2885376198 | 278 |
| 80 | iso_pu_bacteria | 2903748898 | 2903749013 | 278 |
| 81 | iso_pu_bacteria | 2904690495 | 2904692692 | 278 |
| 82 | iso_pu_bacteria | 2904699407 | 2904711208 | 278 |
| 83 | iso_pu_bacteria | 2906635258 | 2906637844 | 278 |
| 84 | iso_pu_bacteria | 2908739725 | 2908739734 | 278 |
| 85 | iso_pu_bacteria | 2908756301 | 2908757668 | 278 |
| 86 | iso_pu_bacteria | 2922386360 | 2922391544 | 278 |
| 87 | iso_pu_bacteria | 2922425934 | 2922426901 | 278 |
| 88 | iso_pu_bacteria | 2935630451 | 2935633062 | 278 |
| 89 | iso_pu_bacteria | 2941507105 | 2941509636 | 278 |
| 90 | iso_pu_bacteria | 2941515067 | 2941517465 | 278 |
| 91 | iso_pu_bacteria | 2941523033 | 2941526582 | 278 |
| 92 | iso_pu_bacteria | 3005474847 | 3005476087 | 278 |
| 93 | iso_pu_bacteria | 8006933436 | 8006937400 | 278 |
| 94 | iso_pu_bacteria | 8006973647 | 8006977429 | 278 |
| 95 | iso_pu_bacteria | 8006984368 | 8006986159 | 278 |
| 96 | iso_pu_bacteria | 8019555841 | 8019561226 | 278 |
| 97 | iso_pu_bacteria | 8019565922 | 8019571316 | 278 |
| 98 | iso_pu_bacteria | 8056673599 | 8056678901 | 278 |
| 99 | iso_pu_bacteria | 8056689827 | 8056692021 | 278 |
| 100 | 3300005340 | Ga0070689_100017936 | Ga0070689_1000179362 | 279 |
| 101 | 3300009093 | Ga0105240_10095537 | Ga0105240_100955372 | 279 |
| 102 | 3300009177 | Ga0105248_11011862 | Ga0105248_110118621 | 279 |
| 103 | 3300009551 | Ga0105238_10028483 | Ga0105238_100284835 | 279 |
| 104 | 3300010375 | Ga0105239_10084315 | Ga0105239_100843152 | 279 |
| 105 | 3300013297 | Ga0157378_10543889 | Ga0157378_105438891 | 279 |
| 106 | 3300025918 | Ga0207662_10078044 | Ga0207662_100780442 | 279 |
| 107 | 3300031251 | Ga0265327_10029833 | Ga0265327_100298332 | 279 |
| 108 | 3300039450 | Ga0436363_1250187 | Ga0436363_1250187_1315_2169 | 279 |
| 109 | 3300049742 | Ga0501080_0097775 | Ga0501080_0097775_589_1518 | 279 |
| 110 | 3300060353 | Ga0501082_0193577 | Ga0501082_0193577_328_1260 | 279 |
| 111 | iso_pu_bacteria | 2508501009 | 2508545792 | 279 |
| 112 | iso_pu_bacteria | 2508501042 | 2508694618 | 279 |
| 113 | iso_pu_bacteria | 2511231028 | 2511398380 | 279 |
| 114 | iso_pu_bacteria | 2513237092 | 2513624470 | 279 |
| 115 | iso_pu_bacteria | 2513237094 | 2513638665 | 279 |
| 116 | iso_pu_bacteria | 2513237095 | 2513649944 | 279 |
| 117 | iso_pu_bacteria | 2513237098 | 2513672529 | 279 |
| 118 | iso_pu_bacteria | 2513237102 | 2513702473 | 279 |
| 119 | iso_pu_bacteria | 2513237139 | 2513874239 | 279 |
| 120 | iso_pu_bacteria | 2513237161 | 2514009995 | 279 |
| 121 | iso_pu_bacteria | 2515154112 | 2515624455 | 279 |
| 122 | iso_pu_bacteria | 2524023205 | 2524438570 | 279 |
| 123 | iso_pu_bacteria | 2524023210 | 2524466687 | 279 |
| 124 | iso_pu_bacteria | 2528768022 | 2528850423 | 279 |
| 125 | iso_pu_bacteria | 2617270735 | 2617353864 | 279 |
| 126 | iso_pu_bacteria | 2617270741 | 2617374641 | 279 |
| 127 | iso_pu_bacteria | 2744054633 | 2745077204 | 279 |
| 128 | iso_pu_bacteria | 2791355196 | 2793059373 | 279 |
| 129 | iso_pu_bacteria | 2802429603 | 2805922129 | 279 |
| 130 | iso_pu_bacteria | 2816332527 | 2818240944 | 279 |
| 131 | iso_pu_bacteria | 2824600985 | 2824604622 | 279 |
| 132 | iso_pu_bacteria | 2824609381 | 2824616170 | 279 |
| 133 | iso_pu_bacteria | 2824653114 | 2824658371 | 279 |
| 134 | iso_pu_bacteria | 2824661429 | 2824667379 | 279 |
| 135 | iso_pu_bacteria | 2824671348 | 2824675542 | 279 |
| 136 | iso_pu_bacteria | 2824679649 | 2824686559 | 279 |
| 137 | iso_pu_bacteria | 2824687955 | 2824691764 | 279 |
| 138 | iso_pu_bacteria | 2824696289 | 2824698993 | 279 |
| 139 | iso_pu_bacteria | 2824704595 | 2824711685 | 279 |
| 140 | iso_pu_bacteria | 2824753945 | 2824761083 | 279 |
| 141 | iso_pu_bacteria | 2824763712 | 2824771800 | 279 |
| 142 | iso_pu_bacteria | 2824773399 | 2824779758 | 279 |
| 143 | iso_pu_bacteria | 2838122688 | 2838126100 | 279 |
| 144 | iso_pu_bacteria | 2841941048 | 2841942507 | 279 |
| 145 | iso_pu_bacteria | 2841949485 | 2841953143 | 279 |
| 146 | iso_pu_bacteria | 2841957949 | 2841960651 | 279 |
| 147 | iso_pu_bacteria | 2841966195 | 2841970833 | 279 |
| 148 | iso_pu_bacteria | 2841974524 | 2841977908 | 279 |
| 149 | iso_pu_bacteria | 2841983080 | 2841984527 | 279 |
| 150 | iso_pu_bacteria | 2842038055 | 2842041752 | 279 |
| 151 | iso_pu_bacteria | 2842045827 | 2842049794 | 279 |
| 152 | iso_pu_bacteria | 2844315083 | 2844321366 | 279 |
| 153 | iso_pu_bacteria | 2847930680 | 2847932047 | 279 |
| 154 | iso_pu_bacteria | 2847939898 | 2847943284 | 279 |
| 155 | iso_pu_bacteria | 2857509624 | 2857514715 | 279 |
| 156 | iso_pu_bacteria | 2874590934 | 2874595687 | 279 |
| 157 | iso_pu_bacteria | 2874612657 | 2874620313 | 279 |
| 158 | iso_pu_bacteria | 2874628541 | 2874630276 | 279 |
| 159 | iso_pu_bacteria | 2874645413 | 2874651681 | 279 |
| 160 | iso_pu_bacteria | 2876761206 | 2876767692 | 279 |
| 161 | iso_pu_bacteria | 2876771140 | 2876775882 | 279 |
| 162 | iso_pu_bacteria | 2876818435 | 2876821576 | 279 |
| 163 | iso_pu_bacteria | 2879074833 | 2879079973 | 279 |
| 164 | iso_pu_bacteria | 2879083081 | 2879085723 | 279 |
| 165 | iso_pu_bacteria | 2879099564 | 2879100892 | 279 |
| 166 | iso_pu_bacteria | 2879127579 | 2879134056 | 279 |
| 167 | iso_pu_bacteria | 2879142872 | 2879148541 | 279 |
| 168 | iso_pu_bacteria | 2881665667 | 2881669343 | 279 |
| 169 | iso_pu_bacteria | 2885192300 | 2885193860 | 279 |
| 170 | iso_pu_bacteria | 2885366525 | 2885374456 | 279 |
| 171 | iso_pu_bacteria | 2885383462 | 2885385887 | 279 |
| 172 | iso_pu_bacteria | 2888378607 | 2888387662 | 279 |
| 173 | iso_pu_bacteria | 2888388044 | 2888391501 | 279 |
| 174 | iso_pu_bacteria | 2888419890 | 2888426879 | 279 |
| 175 | iso_pu_bacteria | 2903727486 | 2903731444 | 279 |
| 176 | iso_pu_bacteria | 2903768456 | 2903775929 | 279 |
| 177 | iso_pu_bacteria | 2904711408 | 2904713583 | 279 |
| 178 | iso_pu_bacteria | 2906602504 | 2906607980 | 279 |
| 179 | iso_pu_bacteria | 2906610324 | 2906612392 | 279 |
| 180 | iso_pu_bacteria | 2906626472 | 2906633050 | 279 |
| 181 | iso_pu_bacteria | 2922368715 | 2922376649 | 279 |
| 182 | iso_pu_bacteria | 2922393267 | 2922398596 | 279 |
| 183 | iso_pu_bacteria | 2929615660 | 2929619848 | 279 |
| 184 | iso_pu_bacteria | 2929624759 | 2929629159 | 279 |
| 185 | iso_pu_bacteria | 2932784394 | 2932789709 | 279 |
| 186 | iso_pu_bacteria | 2932794094 | 2932796625 | 279 |
| 187 | iso_pu_bacteria | 2932801729 | 2932802593 | 279 |
| 188 | iso_pu_bacteria | 2932809354 | 2932817779 | 279 |
| 189 | iso_pu_bacteria | 2932818245 | 2932827110 | 279 |
| 190 | iso_pu_bacteria | 2932828146 | 2932835634 | 279 |
| 191 | iso_pu_bacteria | 2933577622 | 2933581766 | 279 |
| 192 | iso_pu_bacteria | 2935608549 | 2935613228 | 279 |
| 193 | iso_pu_bacteria | 2935616580 | 2935624592 | 279 |
| 194 | iso_pu_bacteria | 2935638405 | 2935647181 | 279 |
| 195 | iso_pu_bacteria | 2935648319 | 2935655598 | 279 |
| 196 | iso_pu_bacteria | 2935656913 | 2935664498 | 279 |
| 197 | iso_pu_bacteria | 2935665750 | 2935674356 | 279 |
| 198 | iso_pu_bacteria | 2935675223 | 2935684237 | 279 |
| 199 | iso_pu_bacteria | 2935684952 | 2935689108 | 279 |
| 200 | iso_pu_bacteria | 2935694250 | 2935697631 | 279 |
| 201 | iso_pu_bacteria | 2935703347 | 2935711345 | 279 |
| 202 | iso_pu_bacteria | 2935713505 | 2935720054 | 279 |
| 203 | iso_pu_bacteria | 2935722832 | 2935728329 | 279 |
| 204 | iso_pu_bacteria | 2935732158 | 2935737074 | 279 |
| 205 | iso_pu_bacteria | 2935741537 | 2935746865 | 279 |
| 206 | iso_pu_bacteria | 2935750917 | 2935757832 | 279 |
| 207 | iso_pu_bacteria | 2935760218 | 2935764210 | 279 |
| 208 | iso_pu_bacteria | 2935769743 | 2935775167 | 279 |
| 209 | iso_pu_bacteria | 2935777560 | 2935780069 | 279 |
| 210 | iso_pu_bacteria | 2935785616 | 2935790191 | 279 |
| 211 | iso_pu_bacteria | 2935793552 | 2935798767 | 279 |
| 212 | iso_pu_bacteria | 2935801545 | 2935809869 | 279 |
| 213 | iso_pu_bacteria | 2935810662 | 2935819350 | 279 |
| 214 | iso_pu_bacteria | 2935819856 | 2935824918 | 279 |
| 215 | iso_pu_bacteria | 2935827899 | 2935836605 | 279 |
| 216 | iso_pu_bacteria | 2935837841 | 2935846815 | 279 |
| 217 | iso_pu_bacteria | 2935847175 | 2935852138 | 279 |
| 218 | iso_pu_bacteria | 2935855204 | 2935863198 | 279 |
| 219 | iso_pu_bacteria | 2935864058 | 2935868667 | 279 |
| 220 | iso_pu_bacteria | 2935873716 | 2935879441 | 279 |
| 221 | iso_pu_bacteria | 2935883170 | 2935883596 | 279 |
| 222 | iso_pu_bacteria | 2935908558 | 2935911485 | 279 |
| 223 | iso_pu_bacteria | 2935916978 | 2935925402 | 279 |
| 224 | iso_pu_bacteria | 2935926038 | 2935928514 | 279 |
| 225 | iso_pu_bacteria | 2935934488 | 2935938159 | 279 |
| 226 | iso_pu_bacteria | 2935942939 | 2935945441 | 279 |
| 227 | iso_pu_bacteria | 2935951376 | 2935954053 | 279 |
| 228 | iso_pu_bacteria | 2935959822 | 2935965432 | 279 |
| 229 | iso_pu_bacteria | 2935967501 | 2935971679 | 279 |
| 230 | iso_pu_bacteria | 2935975950 | 2935980083 | 279 |
| 231 | iso_pu_bacteria | 2935984226 | 2935984244 | 279 |
| 232 | iso_pu_bacteria | 2935992306 | 2936000235 | 279 |
| 233 | iso_pu_bacteria | 2936002035 | 2936010277 | 279 |
| 234 | iso_pu_bacteria | 2936011229 | 2936018548 | 279 |
| 235 | iso_pu_bacteria | 2936019824 | 2936027066 | 279 |
| 236 | iso_pu_bacteria | 2936028420 | 2936035967 | 279 |
| 237 | iso_pu_bacteria | 2936037263 | 2936045973 | 279 |
| 238 | iso_pu_bacteria | 2936046547 | 2936054046 | 279 |
| 239 | iso_pu_bacteria | 2936055302 | 2936055324 | 279 |
| 240 | iso_pu_bacteria | 2940556831 | 2940563346 | 279 |
| 241 | iso_pu_bacteria | 2941531003 | 2941531936 | 279 |
| 242 | iso_pu_bacteria | 2941538514 | 2941547259 | 279 |
| 243 | iso_pu_bacteria | 3005483717 | 3005485978 | 279 |
| 244 | iso_pu_bacteria | 3005506211 | 3005506642 | 279 |
| 245 | iso_pu_bacteria | 3005594810 | 3005601718 | 279 |
| 246 | iso_pu_bacteria | 3005710791 | 3005717458 | 279 |
| 247 | iso_pu_bacteria | 3005718088 | 3005724399 | 279 |
| 248 | iso_pu_bacteria | 8016511872 | 8016519182 | 279 |
| 249 | iso_pu_bacteria | 8016530956 | 8016538711 | 279 |
| 250 | iso_pu_bacteria | 8016539877 | 8016542999 | 279 |
| 251 | iso_pu_bacteria | 8016548790 | 8016550291 | 279 |
| 252 | iso_pu_bacteria | 8016557553 | 8016558700 | 279 |
| 253 | iso_pu_bacteria | 8016575299 | 8016581056 | 279 |
| 254 | iso_pu_bacteria | 8016583857 | 8016587660 | 279 |
| 255 | iso_pu_bacteria | 8016595262 | 8016596677 | 279 |
| 256 | iso_pu_bacteria | 8016603502 | 8016607552 | 279 |
| 257 | iso_pu_bacteria | 8016613128 | 8016619342 | 279 |
| 258 | iso_pu_bacteria | 8016630954 | 8016636903 | 279 |
| 259 | iso_pu_bacteria | 8017057580 | 8017066322 | 279 |
| 260 | iso_pu_bacteria | 8019530166 | 8019538384 | 279 |
| 261 | iso_pu_bacteria | 8019538911 | 8019541438 | 279 |
| 262 | iso_pu_bacteria | 8019547302 | 8019549187 | 279 |
| 263 | iso_pu_bacteria | 8019576017 | 8019578296 | 279 |
| 264 | iso_pu_bacteria | 8019597564 | 8019605368 | 279 |
| 265 | iso_pu_bacteria | 8019608314 | 8019613175 | 279 |
| 266 | iso_pu_bacteria | 8019619141 | 8019623865 | 279 |
| 267 | iso_pu_bacteria | 8019629233 | 8019638179 | 279 |
| 268 | iso_pu_bacteria | 8019648815 | 8019651584 | 279 |
| 269 | iso_pu_bacteria | 8019659431 | 8019666096 | 279 |
| 270 | iso_pu_bacteria | 8019668869 | 8019675607 | 279 |
| 271 | iso_pu_bacteria | 8019678201 | 8019680492 | 279 |
| 272 | iso_pu_bacteria | 8019687851 | 8019695266 | 279 |
| 273 | iso_pu_bacteria | 8055742211 | 8055750400 | 279 |
| 274 | iso_pu_bacteria | 8056681323 | 8056685483 | 279 |
| 275 | iso_pu_bacteria | 8056967851 | 8056971819 | 279 |
| 276 | 3300009174 | Ga0105241_10529071 | Ga0105241_105290712 | 280 |
| 277 | iso_pu_bacteria | 2513237104 | 2513716789 | 280 |
| 278 | iso_pu_bacteria | 2824732956 | 2824739303 | 280 |
| 279 | iso_pu_bacteria | 2824746037 | 2824750387 | 280 |
| 280 | iso_pu_bacteria | 2874620515 | 2874624251 | 280 |
| 281 | iso_pu_bacteria | 2904666416 | 2904670962 | 280 |
| 282 | iso_pu_bacteria | 2908775508 | 2908777122 | 280 |
| 283 | iso_pu_bacteria | 3005587118 | 3005591800 | 280 |
| 284 | 3300003792 | Ga0055540_1001304 | Ga0055540_100130417 | 281 |
| 285 | 3300005289 | Ga0065704_10088231 | Ga0065704_100882313 | 281 |
| 286 | 3300005327 | Ga0070658_10145326 | Ga0070658_101453262 | 281 |
| 287 | 3300005336 | Ga0070680_100251951 | Ga0070680_1002519512 | 281 |
| 288 | 3300005366 | Ga0070659_100043428 | Ga0070659_1000434283 | 281 |
| 289 | 3300005563 | Ga0068855_100256651 | Ga0068855_1002566512 | 281 |
| 290 | 3300005616 | Ga0068852_100016237 | Ga0068852_1000162378 | 281 |
| 291 | 3300005983 | Ga0081540_1015887 | Ga0081540_10158874 | 281 |
| 292 | 3300005983 | Ga0081540_1031359 | Ga0081540_10313591 | 281 |
| 293 | 3300005983 | Ga0081540_1041746 | Ga0081540_10417463 | 281 |
| 294 | 3300007265 | Ga0099794_10043155 | Ga0099794_100431552 | 281 |
| 295 | 3300009147 | Ga0114129_10157307 | Ga0114129_101573072 | 281 |
| 296 | 3300009177 | Ga0105248_10496096 | Ga0105248_104960961 | 281 |
| 297 | 3300010375 | Ga0105239_10169114 | Ga0105239_101691142 | 281 |
| 298 | 3300013307 | Ga0157372_10149868 | Ga0157372_101498683 | 281 |
| 299 | 3300025303 | Ga0209051_1000298 | Ga0209051_100029819 | 281 |
| 300 | 3300025917 | Ga0207660_10232901 | Ga0207660_102329012 | 281 |
| 301 | 3300025932 | Ga0207690_10074010 | Ga0207690_100740103 | 281 |
| 302 | 3300025939 | Ga0207665_10156926 | Ga0207665_101569262 | 281 |
| 303 | 3300026142 | Ga0207698_10268969 | Ga0207698_102689692 | 281 |
| 304 | 3300031731 | Ga0307405_10236767 | Ga0307405_102367672 | 281 |
| 305 | 3300031911 | Ga0307412_10349797 | Ga0307412_103497972 | 281 |
| 306 | 3300033180 | Ga0307510_10087981 | Ga0307510_100879812 | 281 |
| 307 | 3300046455 | Ga0495603_0017965 | Ga0495603_0017965_1677_2552 | 281 |
| 308 | 3300046455 | Ga0495603_0114087 | Ga0495603_0114087_263_1129 | 281 |
| 309 | 3300047317 | Ga0495604_0244404 | Ga0495604_0244404_165_1034 | 281 |
| 310 | 3300047446 | Ga0495679_007969 | Ga0495679_007969_3496_4341 | 281 |
| 311 | 3300050507 | nmdc:mga05p37_75724_c1 | nmdc:mga05p37_75724_c1_1995_2876 | 281 |
| 312 | 3300053080 | Ga0500635_0055288 | Ga0500635_0055288_204_1079 | 281 |
| 313 | 3300053102 | Ga0500554_067935 | Ga0500554_067935_180_1055 | 281 |
| 314 | 3300053150 | Ga0500603_003284 | Ga0500603_003284_13_888 | 281 |
| 315 | 3300053153 | Ga0500616_0015671 | Ga0500616_0015671_1937_2830 | 281 |
| 316 | iso_pu_bacteria | 2508501128 | 2509146538 | 281 |
| 317 | iso_pu_bacteria | 2513237141 | 2513892408 | 281 |
| 318 | iso_pu_bacteria | 2738543031 | 2739349328 | 281 |
| 319 | iso_pu_bacteria | 2857524615 | 2857525612 | 281 |
| 320 | iso_pu_bacteria | 2919073203 | 2919074580 | 281 |
| 321 | 3300001989 | JGI24739J22299_10004386 | JGI24739J22299_100043865 | 282 |
| 322 | 3300001990 | JGI24737J22298_10026694 | JGI24737J22298_100266942 | 282 |
| 323 | 3300002067 | JGI24735J21928_10029987 | JGI24735J21928_100299872 | 282 |
| 324 | 3300003214 | JGI25165J46597_1008266 | JGI25165J46597_10082662 | 282 |
| 325 | 3300003214 | JGI25165J46597_1009827 | JGI25165J46597_10098272 | 282 |
| 326 | 3300003214 | JGI25165J46597_1009894 | JGI25165J46597_10098942 | 282 |
| 327 | 3300003215 | JGI25153J46596_10009118 | JGI25153J46596_100091187 | 282 |
| 328 | 3300003215 | JGI25153J46596_10029846 | JGI25153J46596_100298462 | 282 |
| 329 | 3300003322 | rootL2_10124449 | rootL2_101244492 | 282 |
| 330 | 3300003659 | JGI25404J52841_10010825 | JGI25404J52841_100108252 | 282 |
| 331 | 3300005262 | Ga0065165_1003123 | Ga0065165_10031237 | 282 |
| 332 | 3300005262 | Ga0065165_1007216 | Ga0065165_10072167 | 282 |
| 333 | 3300005262 | Ga0065165_1010731 | Ga0065165_10107314 | 282 |
| 334 | 3300005262 | Ga0065165_1033623 | Ga0065165_10336232 | 282 |
| 335 | 3300005331 | Ga0070670_100223142 | Ga0070670_1002231422 | 282 |
| 336 | 3300005347 | Ga0070668_100116316 | Ga0070668_1001163162 | 282 |
| 337 | 3300005347 | Ga0070668_100448652 | Ga0070668_1004486521 | 282 |
| 338 | 3300005353 | Ga0070669_100238436 | Ga0070669_1002384362 | 282 |
| 339 | 3300005354 | Ga0070675_100309043 | Ga0070675_1003090432 | 282 |
| 340 | 3300005355 | Ga0070671_100241802 | Ga0070671_1002418022 | 282 |
| 341 | 3300005367 | Ga0070667_100163338 | Ga0070667_1001633381 | 282 |
| 342 | 3300005436 | Ga0070713_100228196 | Ga0070713_1002281962 | 282 |
| 343 | 3300005439 | Ga0070711_100010406 | Ga0070711_1000104066 | 282 |
| 344 | 3300005455 | Ga0070663_100160637 | Ga0070663_1001606372 | 282 |
| 345 | 3300005457 | Ga0070662_100121049 | Ga0070662_1001210492 | 282 |
| 346 | 3300005518 | Ga0070699_100382184 | Ga0070699_1003821842 | 282 |
| 347 | 3300005530 | Ga0070679_100613690 | Ga0070679_1006136901 | 282 |
| 348 | 3300005539 | Ga0068853_100026288 | Ga0068853_1000262885 | 282 |
| 349 | 3300005539 | Ga0068853_100269755 | Ga0068853_1002697552 | 282 |
| 350 | 3300005539 | Ga0068853_100368008 | Ga0068853_1003680081 | 282 |
| 351 | 3300005548 | Ga0070665_100155549 | Ga0070665_1001555492 | 282 |
| 352 | 3300005548 | Ga0070665_100499631 | Ga0070665_1004996312 | 282 |
| 353 | 3300005549 | Ga0070704_100241846 | Ga0070704_1002418461 | 282 |
| 354 | 3300005563 | Ga0068855_100300260 | Ga0068855_1003002602 | 282 |
| 355 | 3300005577 | Ga0068857_100056749 | Ga0068857_1000567493 | 282 |
| 356 | 3300005577 | Ga0068857_100060787 | Ga0068857_1000607873 | 282 |
| 357 | 3300005578 | Ga0068854_100008298 | Ga0068854_1000082984 | 282 |
| 358 | 3300005578 | Ga0068854_100017829 | Ga0068854_1000178295 | 282 |
| 359 | 3300005614 | Ga0068856_100019463 | Ga0068856_1000194634 | 282 |
| 360 | 3300005616 | Ga0068852_100326120 | Ga0068852_1003261201 | 282 |
| 361 | 3300005616 | Ga0068852_100448092 | Ga0068852_1004480921 | 282 |
| 362 | 3300005618 | Ga0068864_100487779 | Ga0068864_1004877792 | 282 |
| 363 | 3300005718 | Ga0068866_10093974 | Ga0068866_100939742 | 282 |
| 364 | 3300005834 | Ga0068851_10011168 | Ga0068851_100111683 | 282 |
| 365 | 3300005841 | Ga0068863_100406296 | Ga0068863_1004062962 | 282 |
| 366 | 3300005842 | Ga0068858_100511700 | Ga0068858_1005117002 | 282 |
| 367 | 3300005981 | Ga0081538_10036555 | Ga0081538_100365552 | 282 |
| 368 | 3300005983 | Ga0081540_1006936 | Ga0081540_10069363 | 282 |
| 369 | 3300005983 | Ga0081540_1010271 | Ga0081540_101027111 | 282 |
| 370 | 3300005983 | Ga0081540_1066406 | Ga0081540_10664062 | 282 |
| 371 | 3300005985 | Ga0081539_10039667 | Ga0081539_100396672 | 282 |
| 372 | 3300006028 | Ga0070717_10119675 | Ga0070717_101196752 | 282 |
| 373 | 3300006038 | Ga0075365_10146416 | Ga0075365_101464162 | 282 |
| 374 | 3300006038 | Ga0075365_10151624 | Ga0075365_101516242 | 282 |
| 375 | 3300006038 | Ga0075365_10184513 | Ga0075365_101845132 | 282 |
| 376 | 3300006042 | Ga0075368_10041629 | Ga0075368_100416292 | 282 |
| 377 | 3300006042 | Ga0075368_10068758 | Ga0075368_100687582 | 282 |
| 378 | 3300006173 | Ga0070716_100081468 | Ga0070716_1000814682 | 282 |
| 379 | 3300006175 | Ga0070712_100248704 | Ga0070712_1002487042 | 282 |
| 380 | 3300006175 | Ga0070712_100405837 | Ga0070712_1004058372 | 282 |
| 381 | 3300006178 | Ga0075367_10022959 | Ga0075367_100229593 | 282 |
| 382 | 3300006178 | Ga0075367_10051061 | Ga0075367_100510612 | 282 |
| 383 | 3300006178 | Ga0075367_10113608 | Ga0075367_101136082 | 282 |
| 384 | 3300006178 | Ga0075367_10131776 | Ga0075367_101317762 | 282 |
| 385 | 3300006178 | Ga0075367_10202456 | Ga0075367_102024562 | 282 |
| 386 | 3300006942 | Ga0099824_1008875 | Ga0099824_100887515 | 282 |
| 387 | 3300006942 | Ga0099824_1023890 | Ga0099824_10238901 | 282 |
| 388 | 3300006943 | Ga0099822_1017500 | Ga0099822_10175007 | 282 |
| 389 | 3300009093 | Ga0105240_10046064 | Ga0105240_100460644 | 282 |
| 390 | 3300009093 | Ga0105240_10538244 | Ga0105240_105382442 | 282 |
| 391 | 3300009101 | Ga0105247_10104696 | Ga0105247_101046962 | 282 |
| 392 | 3300009148 | Ga0105243_10485191 | Ga0105243_104851911 | 282 |
| 393 | 3300009174 | Ga0105241_10015112 | Ga0105241_100151124 | 282 |
| 394 | 3300009176 | Ga0105242_10205972 | Ga0105242_102059722 | 282 |
| 395 | 3300009177 | Ga0105248_10080990 | Ga0105248_100809901 | 282 |
| 396 | 3300009545 | Ga0105237_10044886 | Ga0105237_100448864 | 282 |
| 397 | 3300009545 | Ga0105237_10408045 | Ga0105237_104080452 | 282 |
| 398 | 3300009551 | Ga0105238_10025742 | Ga0105238_100257425 | 282 |
| 399 | 3300009551 | Ga0105238_10462551 | Ga0105238_104625512 | 282 |
| 400 | 3300009553 | Ga0105249_10692538 | Ga0105249_106925381 | 282 |
| 401 | 3300010159 | Ga0099796_10016875 | Ga0099796_100168752 | 282 |
| 402 | 3300010375 | Ga0105239_10271446 | Ga0105239_102714462 | 282 |
| 403 | 3300010375 | Ga0105239_10694216 | Ga0105239_106942162 | 282 |
| 404 | 3300013306 | Ga0163162_10773871 | Ga0163162_107738712 | 282 |
| 405 | 3300014326 | Ga0157380_10835908 | Ga0157380_108359081 | 282 |
| 406 | 3300014968 | Ga0157379_10107304 | Ga0157379_101073043 | 282 |
| 407 | 3300021321 | Ga0214542_1033238 | Ga0214542_10332382 | 282 |
| 408 | 3300025230 | Ga0209563_101581 | Ga0209563_1015816 | 282 |
| 409 | 3300025253 | Ga0209677_102936 | Ga0209677_1029363 | 282 |
| 410 | 3300025254 | Ga0209148_1000707 | Ga0209148_10007075 | 282 |
| 411 | 3300025261 | Ga0209233_1001624 | Ga0209233_10016247 | 282 |
| 412 | 3300025261 | Ga0209233_1010411 | Ga0209233_10104112 | 282 |
| 413 | 3300025272 | Ga0209455_1004030 | Ga0209455_10040304 | 282 |
| 414 | 3300025272 | Ga0209455_1005738 | Ga0209455_10057385 | 282 |
| 415 | 3300025272 | Ga0209455_1007958 | Ga0209455_10079583 | 282 |
| 416 | 3300025272 | Ga0209455_1012768 | Ga0209455_10127682 | 282 |
| 417 | 3300025295 | Ga0209564_1009431 | Ga0209564_10094312 | 282 |
| 418 | 3300025297 | Ga0209758_1000106 | Ga0209758_1000106161 | 282 |
| 419 | 3300025297 | Ga0209758_1002765 | Ga0209758_100276515 | 282 |
| 420 | 3300025297 | Ga0209758_1003053 | Ga0209758_10030537 | 282 |
| 421 | 3300025297 | Ga0209758_1011674 | Ga0209758_10116747 | 282 |
| 422 | 3300025297 | Ga0209758_1011887 | Ga0209758_10118875 | 282 |
| 423 | 3300025297 | Ga0209758_1069464 | Ga0209758_10694641 | 282 |
| 424 | 3300025299 | Ga0209256_1008328 | Ga0209256_10083282 | 282 |
| 425 | 3300025302 | Ga0207426_1000337 | Ga0207426_100033727 | 282 |
| 426 | 3300025302 | Ga0207426_1007201 | Ga0207426_10072012 | 282 |
| 427 | 3300025302 | Ga0207426_1009271 | Ga0207426_10092713 | 282 |
| 428 | 3300025304 | Ga0209257_1000684 | Ga0209257_100068429 | 282 |
| 429 | 3300025321 | Ga0207656_10035984 | Ga0207656_100359842 | 282 |
| 430 | 3300025321 | Ga0207656_10046534 | Ga0207656_100465341 | 282 |
| 431 | 3300025898 | Ga0207692_10070024 | Ga0207692_100700242 | 282 |
| 432 | 3300025901 | Ga0207688_10098160 | Ga0207688_100981602 | 282 |
| 433 | 3300025904 | Ga0207647_10009009 | Ga0207647_100090097 | 282 |
| 434 | 3300025904 | Ga0207647_10053238 | Ga0207647_100532383 | 282 |
| 435 | 3300025907 | Ga0207645_10133078 | Ga0207645_101330782 | 282 |
| 436 | 3300025913 | Ga0207695_10000478 | Ga0207695_1000047815 | 282 |
| 437 | 3300025913 | Ga0207695_10034396 | Ga0207695_100343963 | 282 |
| 438 | 3300025913 | Ga0207695_10142598 | Ga0207695_101425983 | 282 |
| 439 | 3300025914 | Ga0207671_10057143 | Ga0207671_100571432 | 282 |
| 440 | 3300025914 | Ga0207671_10063710 | Ga0207671_100637103 | 282 |
| 441 | 3300025914 | Ga0207671_10203488 | Ga0207671_102034882 | 282 |
| 442 | 3300025915 | Ga0207693_10293797 | Ga0207693_102937972 | 282 |
| 443 | 3300025916 | Ga0207663_10023479 | Ga0207663_100234794 | 282 |
| 444 | 3300025919 | Ga0207657_10113450 | Ga0207657_101134501 | 282 |
| 445 | 3300025924 | Ga0207694_10001415 | Ga0207694_100014159 | 282 |
| 446 | 3300025924 | Ga0207694_10177181 | Ga0207694_101771812 | 282 |
| 447 | 3300025927 | Ga0207687_10149563 | Ga0207687_101495632 | 282 |
| 448 | 3300025933 | Ga0207706_10251531 | Ga0207706_102515312 | 282 |
| 449 | 3300025933 | Ga0207706_10262690 | Ga0207706_102626902 | 282 |
| 450 | 3300025934 | Ga0207686_10295937 | Ga0207686_102959371 | 282 |
| 451 | 3300025935 | Ga0207709_10256222 | Ga0207709_102562222 | 282 |
| 452 | 3300025937 | Ga0207669_10224931 | Ga0207669_102249312 | 282 |
| 453 | 3300025941 | Ga0207711_10108494 | Ga0207711_101084942 | 282 |
| 454 | 3300025941 | Ga0207711_10195442 | Ga0207711_101954422 | 282 |
| 455 | 3300025941 | Ga0207711_10644284 | Ga0207711_106442841 | 282 |
| 456 | 3300025949 | Ga0207667_10011741 | Ga0207667_100117413 | 282 |
| 457 | 3300025949 | Ga0207667_10387248 | Ga0207667_103872482 | 282 |
| 458 | 3300025972 | Ga0207668_10042480 | Ga0207668_100424803 | 282 |
| 459 | 3300025972 | Ga0207668_10129694 | Ga0207668_101296942 | 282 |
| 460 | 3300025981 | Ga0207640_10060359 | Ga0207640_100603592 | 282 |
| 461 | 3300025981 | Ga0207640_10368608 | Ga0207640_103686082 | 282 |
| 462 | 3300026067 | Ga0207678_10079253 | Ga0207678_100792532 | 282 |
| 463 | 3300026067 | Ga0207678_10125020 | Ga0207678_101250202 | 282 |
| 464 | 3300026067 | Ga0207678_10329627 | Ga0207678_103296271 | 282 |
| 465 | 3300026078 | Ga0207702_10000003 | Ga0207702_1000000320 | 282 |
| 466 | 3300026078 | Ga0207702_10033457 | Ga0207702_100334572 | 282 |
| 467 | 3300026078 | Ga0207702_10211921 | Ga0207702_102119212 | 282 |
| 468 | 3300026088 | Ga0207641_10249261 | Ga0207641_102492612 | 282 |
| 469 | 3300026116 | Ga0207674_10009035 | Ga0207674_100090356 | 282 |
| 470 | 3300026116 | Ga0207674_10044466 | Ga0207674_100444662 | 282 |
| 471 | 3300026116 | Ga0207674_10175694 | Ga0207674_101756941 | 282 |
| 472 | 3300026142 | Ga0207698_10088283 | Ga0207698_100882833 | 282 |
| 473 | 3300026142 | Ga0207698_10406542 | Ga0207698_104065422 | 282 |
| 474 | 3300026142 | Ga0207698_10623316 | Ga0207698_106233162 | 282 |
| 475 | 3300027296 | Ga0209389_1000016 | Ga0209389_100001649 | 282 |
| 476 | 3300027296 | Ga0209389_1000027 | Ga0209389_100002796 | 282 |
| 477 | 3300027357 | Ga0209589_1000005 | Ga0209589_1000005307 | 282 |
| 478 | 3300027357 | Ga0209589_1000031 | Ga0209589_1000031108 | 282 |
| 479 | 3300027361 | Ga0209489_100005 | Ga0209489_100005307 | 282 |
| 480 | 3300027361 | Ga0209489_100057 | Ga0209489_10005739 | 282 |
| 481 | 3300027361 | Ga0209489_100063 | Ga0209489_1000637 | 282 |
| 482 | 3300027363 | Ga0209700_100006 | Ga0209700_100006307 | 282 |
| 483 | 3300027363 | Ga0209700_100012 | Ga0209700_10001250 | 282 |
| 484 | 3300028379 | Ga0268266_10086610 | Ga0268266_100866102 | 282 |
| 485 | 3300028379 | Ga0268266_10676159 | Ga0268266_106761591 | 282 |
| 486 | 3300031235 | Ga0265330_10056386 | Ga0265330_100563862 | 282 |
| 487 | 3300031250 | Ga0265331_10092294 | Ga0265331_100922942 | 282 |
| 488 | 3300031616 | Ga0307508_10221869 | Ga0307508_102218691 | 282 |
| 489 | 3300031616 | Ga0307508_10332828 | Ga0307508_103328281 | 282 |
| 490 | 3300031711 | Ga0265314_10022030 | Ga0265314_100220303 | 282 |
| 491 | 3300031712 | Ga0265342_10013040 | Ga0265342_100130404 | 282 |
| 492 | 3300031730 | Ga0307516_10077415 | Ga0307516_100774154 | 282 |
| 493 | 3300031730 | Ga0307516_10117287 | Ga0307516_101172872 | 282 |
| 494 | 3300031730 | Ga0307516_10199918 | Ga0307516_101999183 | 282 |
| 495 | 3300031901 | Ga0307406_10366718 | Ga0307406_103667182 | 282 |
| 496 | 3300033179 | Ga0307507_10062098 | Ga0307507_100620984 | 282 |
| 497 | 3300033180 | Ga0307510_10007708 | Ga0307510_1000770810 | 282 |
| 498 | 3300033180 | Ga0307510_10015767 | Ga0307510_100157673 | 282 |
| 499 | 3300033180 | Ga0307510_10204610 | Ga0307510_102046102 | 282 |
| 500 | 3300033442 | Ga0315911_1000005 | Ga0315911_1000005269 | 282 |
| 501 | 3300035112 | Ga0373932_0016069 | Ga0373932_0016069_1009_1878 | 282 |
| 502 | 3300035171 | Ga0373946_0059032 | Ga0373946_0059032_191_1063 | 282 |
| 503 | 3300035241 | Ga0373961_0027281 | Ga0373961_0027281_24_893 | 282 |
| 504 | 3300035691 | Ga0373931_0016534 | Ga0373931_0016534_634_1503 | 282 |
| 505 | 3300035725 | Ga0373947_0083172 | Ga0373947_0083172_248_1120 | 282 |
| 506 | 3300039437 | Ga0436365_0816185 | Ga0436365_0816185_80_952 | 282 |
| 507 | 3300041451 | Ga0451791_0675706 | Ga0451791_0675706_111_974 | 282 |
| 508 | 3300044656 | Ga0466969_0016241 | Ga0466969_0016241_979_1842 | 282 |
| 509 | 3300044658 | Ga0466972_0000585 | Ga0466972_0000585_16594_17457 | 282 |
| 510 | 3300044684 | Ga0466966_0000720 | Ga0466966_0000720_11731_12594 | 282 |
| 511 | 3300044693 | Ga0466961_0000136 | Ga0466961_0000136_27305_28168 | 282 |
| 512 | 3300044694 | Ga0466963_0047541 | Ga0466963_0047541_351_1214 | 282 |
| 513 | 3300044765 | Ga0466970_0091748 | Ga0466970_0091748_259_1131 | 282 |
| 514 | 3300044842 | Ga0466957_0070496 | Ga0466957_0070496_128_1000 | 282 |
| 515 | 3300044842 | Ga0466957_0198439 | Ga0466957_0198439_82_954 | 282 |
| 516 | 3300045049 | Ga0466959_0030496 | Ga0466959_0030496_859_1722 | 282 |
| 517 | 3300045049 | Ga0466959_0132374 | Ga0466959_0132374_770_1642 | 282 |
| 518 | 3300045976 | Ga0466967_0090376 | Ga0466967_0090376_12_875 | 282 |
| 519 | 3300045976 | Ga0466967_0118618 | Ga0466967_0118618_991_1863 | 282 |
| 520 | 3300045976 | Ga0466967_0257117 | Ga0466967_0257117_239_1114 | 282 |
| 521 | 3300046455 | Ga0495603_0036375 | Ga0495603_0036375_1861_2724 | 282 |
| 522 | 3300046460 | Ga0495638_0016562 | Ga0495638_0016562_3165_4028 | 282 |
| 523 | 3300046460 | Ga0495638_0025345 | Ga0495638_0025345_2667_3536 | 282 |
| 524 | 3300046461 | Ga0495641_0077094 | Ga0495641_0077094_273_1142 | 282 |
| 525 | 3300046474 | Ga0495605_0072285 | Ga0495605_0072285_709_1572 | 282 |
| 526 | 3300046477 | Ga0495664_0271384 | Ga0495664_0271384_99_971 | 282 |
| 527 | 3300046492 | Ga0495585_0136242 | Ga0495585_0136242_215_1078 | 282 |
| 528 | 3300046500 | Ga0495596_0104938 | Ga0495596_0104938_48_917 | 282 |
| 529 | 3300046507 | Ga0495606_0024749 | Ga0495606_0024749_2671_3534 | 282 |
| 530 | 3300046512 | Ga0495610_0055778 | Ga0495610_0055778_236_1099 | 282 |
| 531 | 3300046515 | Ga0495620_0089680 | Ga0495620_0089680_312_1175 | 282 |
| 532 | 3300046518 | Ga0495631_0119821 | Ga0495631_0119821_60_932 | 282 |
| 533 | 3300046519 | Ga0495632_0178900 | Ga0495632_0178900_35_901 | 282 |
| 534 | 3300046522 | Ga0495643_0021450 | Ga0495643_0021450_1353_2216 | 282 |
| 535 | 3300046524 | Ga0495648_0118424 | Ga0495648_0118424_334_1197 | 282 |
| 536 | 3300046538 | Ga0495609_0094911 | Ga0495609_0094911_313_1176 | 282 |
| 537 | 3300046538 | Ga0495609_0126024 | Ga0495609_0126024_79_942 | 282 |
| 538 | 3300046557 | Ga0495622_0009820 | Ga0495622_0009820_260_1123 | 282 |
| 539 | 3300046557 | Ga0495622_0061671 | Ga0495622_0061671_166_1029 | 282 |
| 540 | 3300046557 | Ga0495622_0076200 | Ga0495622_0076200_265_1134 | 282 |
| 541 | 3300046616 | Ga0495668_0024106 | Ga0495668_0024106_2402_3265 | 282 |
| 542 | 3300046616 | Ga0495668_0067864 | Ga0495668_0067864_1049_1915 | 282 |
| 543 | 3300046616 | Ga0495668_0098762 | Ga0495668_0098762_324_1193 | 282 |
| 544 | 3300046660 | Ga0495625_0236326 | Ga0495625_0236326_16_885 | 282 |
| 545 | 3300046663 | Ga0495635_0093517 | Ga0495635_0093517_556_1425 | 282 |
| 546 | 3300046684 | Ga0495669_0139417 | Ga0495669_0139417_205_1074 | 282 |
| 547 | 3300047315 | Ga0495581_0167462 | Ga0495581_0167462_391_1260 | 282 |
| 548 | 3300047321 | Ga0495676_0224246 | Ga0495676_0224246_246_1118 | 282 |
| 549 | 3300047443 | Ga0495687_016734 | Ga0495687_016734_2439_3302 | 282 |
| 550 | 3300048903 | Ga0496100_0012991 | Ga0496100_0012991_767_1630 | 282 |
| 551 | 3300048904 | Ga0496101_0130902 | Ga0496101_0130902_174_1043 | 282 |
| 552 | 3300048904 | Ga0496101_0203088 | Ga0496101_0203088_173_1036 | 282 |
| 553 | 3300048904 | Ga0496101_0250297 | Ga0496101_0250297_260_1123 | 282 |
| 554 | 3300048905 | Ga0496102_0051154 | Ga0496102_0051154_2206_3069 | 282 |
| 555 | 3300048905 | Ga0496102_0067221 | Ga0496102_0067221_478_1347 | 282 |
| 556 | 3300048905 | Ga0496102_0719152 | Ga0496102_0719152_31_900 | 282 |
| 557 | 3300048906 | Ga0496103_0116426 | Ga0496103_0116426_778_1641 | 282 |
| 558 | 3300048906 | Ga0496103_0276307 | Ga0496103_0276307_180_1049 | 282 |
| 559 | 3300048907 | Ga0496104_0029597 | Ga0496104_0029597_667_1530 | 282 |
| 560 | 3300048907 | Ga0496104_0108179 | Ga0496104_0108179_1596_2465 | 282 |
| 561 | 3300048907 | Ga0496104_0126288 | Ga0496104_0126288_1135_2004 | 282 |
| 562 | 3300048908 | Ga0496105_0087969 | Ga0496105_0087969_722_1585 | 282 |
| 563 | 3300048908 | Ga0496105_0123081 | Ga0496105_0123081_943_1806 | 282 |
| 564 | 3300048909 | Ga0496106_0001280 | Ga0496106_0001280_3331_4194 | 282 |
| 565 | 3300048909 | Ga0496106_0066732 | Ga0496106_0066732_1440_2303 | 282 |
| 566 | 3300048909 | Ga0496106_0234646 | Ga0496106_0234646_527_1390 | 282 |
| 567 | 3300048910 | Ga0496107_0202501 | Ga0496107_0202501_250_1113 | 282 |
| 568 | 3300048910 | Ga0496107_0226803 | Ga0496107_0226803_323_1195 | 282 |
| 569 | 3300048911 | Ga0496108_0031333 | Ga0496108_0031333_65_928 | 282 |
| 570 | 3300048912 | Ga0496109_0240372 | Ga0496109_0240372_382_1245 | 282 |
| 571 | 3300048912 | Ga0496109_0284205 | Ga0496109_0284205_52_921 | 282 |
| 572 | 3300048913 | Ga0496110_0056755 | Ga0496110_0056755_1135_2004 | 282 |
| 573 | 3300048913 | Ga0496110_0186033 | Ga0496110_0186033_253_1116 | 282 |
| 574 | 3300048913 | Ga0496110_0245272 | Ga0496110_0245272_263_1126 | 282 |
| 575 | 3300048913 | Ga0496110_0611197 | Ga0496110_0611197_46_909 | 282 |
| 576 | 3300048914 | Ga0496111_0057198 | Ga0496111_0057198_1449_2318 | 282 |
| 577 | 3300048914 | Ga0496111_0208005 | Ga0496111_0208005_534_1397 | 282 |
| 578 | 3300048915 | Ga0496112_0027302 | Ga0496112_0027302_2713_3576 | 282 |
| 579 | 3300048915 | Ga0496112_0144708 | Ga0496112_0144708_781_1650 | 282 |
| 580 | 3300048915 | Ga0496112_0503338 | Ga0496112_0503338_30_893 | 282 |
| 581 | 3300048918 | Ga0496115_0263750 | Ga0496115_0263750_137_1000 | 282 |
| 582 | 3300048919 | Ga0496116_0127078 | Ga0496116_0127078_320_1183 | 282 |
| 583 | 3300048920 | Ga0496117_0028354 | Ga0496117_0028354_686_1549 | 282 |
| 584 | 3300048920 | Ga0496117_0089657 | Ga0496117_0089657_36_899 | 282 |
| 585 | 3300048921 | Ga0496118_0001458 | Ga0496118_0001458_19360_20223 | 282 |
| 586 | 3300048921 | Ga0496118_0031386 | Ga0496118_0031386_3468_4331 | 282 |
| 587 | 3300048922 | Ga0496119_0197794 | Ga0496119_0197794_11_874 | 282 |
| 588 | 3300048923 | Ga0496120_0042462 | Ga0496120_0042462_1645_2508 | 282 |
| 589 | 3300048924 | Ga0496121_0000146 | Ga0496121_0000146_63222_64085 | 282 |
| 590 | 3300048924 | Ga0496121_0039521 | Ga0496121_0039521_2943_3815 | 282 |
| 591 | 3300048924 | Ga0496121_0073560 | Ga0496121_0073560_247_1119 | 282 |
| 592 | 3300048924 | Ga0496121_0079535 | Ga0496121_0079535_1549_2418 | 282 |
| 593 | 3300048924 | Ga0496121_0109129 | Ga0496121_0109129_938_1801 | 282 |
| 594 | 3300048924 | Ga0496121_0261049 | Ga0496121_0261049_149_1021 | 282 |
| 595 | 3300048927 | Ga0496124_0002217 | Ga0496124_0002217_21259_22122 | 282 |
| 596 | 3300048927 | Ga0496124_0330131 | Ga0496124_0330131_77_940 | 282 |
| 597 | 3300048928 | Ga0496125_0056870 | Ga0496125_0056870_2070_2933 | 282 |
| 598 | 3300048929 | Ga0496126_0003212 | Ga0496126_0003212_2934_3803 | 282 |
| 599 | 3300048929 | Ga0496126_0004243 | Ga0496126_0004243_1260_2144 | 282 |
| 600 | 3300048929 | Ga0496126_0010429 | Ga0496126_0010429_1254_2126 | 282 |
| 601 | 3300048929 | Ga0496126_0016652 | Ga0496126_0016652_1351_2214 | 282 |
| 602 | 3300048929 | Ga0496126_0142660 | Ga0496126_0142660_258_1121 | 282 |
| 603 | 3300048929 | Ga0496126_0252657 | Ga0496126_0252657_29_892 | 282 |
| 604 | 3300048929 | Ga0496126_0316293 | Ga0496126_0316293_204_1076 | 282 |
| 605 | 3300050492 | nmdc:mga0yw44_186447_c1 | nmdc:mga0yw44_186447_c1_440_1303 | 282 |
| 606 | 3300050492 | nmdc:mga0yw44_238276_c1 | nmdc:mga0yw44_238276_c1_283_1155 | 282 |
| 607 | 3300050494 | nmdc:mga06z11_185854_c1 | nmdc:mga06z11_185854_c1_66_929 | 282 |
| 608 | 3300050494 | nmdc:mga06z11_64715_c1 | nmdc:mga06z11_64715_c1_158_1030 | 282 |
| 609 | 3300050516 | nmdc:mga0sz30_43399_c1 | nmdc:mga0sz30_43399_c1_700_1563 | 282 |
| 610 | 3300053087 | Ga0500643_000052 | Ga0500643_000052_88274_89137 | 282 |
| 611 | 3300053091 | Ga0500647_0020775 | Ga0500647_0020775_1562_2425 | 282 |
| 612 | 3300053093 | Ga0500651_0018968 | Ga0500651_0018968_1470_2333 | 282 |
| 613 | 3300053094 | Ga0500566_0039993 | Ga0500566_0039993_921_1793 | 282 |
| 614 | 3300053102 | Ga0500554_028832 | Ga0500554_028832_567_1439 | 282 |
| 615 | 3300053103 | Ga0500555_001634 | Ga0500555_001634_2593_3456 | 282 |
| 616 | 3300053104 | Ga0500556_0003305 | Ga0500556_0003305_602_1465 | 282 |
| 617 | 3300053104 | Ga0500556_0094648 | Ga0500556_0094648_188_1057 | 282 |
| 618 | 3300053105 | Ga0500557_000096 | Ga0500557_000096_294_1157 | 282 |
| 619 | 3300053109 | Ga0500569_001480 | Ga0500569_001480_1601_2464 | 282 |
| 620 | 3300053111 | Ga0500572_012239 | Ga0500572_012239_1025_1888 | 282 |
| 621 | 3300053119 | Ga0500595_000728 | Ga0500595_000728_8355_9227 | 282 |
| 622 | 3300053119 | Ga0500595_012442 | Ga0500595_012442_478_1347 | 282 |
| 623 | 3300053130 | Ga0500642_0000083 | Ga0500642_0000083_49618_50481 | 282 |
| 624 | 3300053134 | Ga0500658_0026515 | Ga0500658_0026515_273_1136 | 282 |
| 625 | 3300053136 | Ga0500559_0037151 | Ga0500559_0037151_1164_2027 | 282 |
| 626 | 3300053138 | Ga0500564_067301 | Ga0500564_067301_310_1173 | 282 |
| 627 | 3300053142 | Ga0500577_0050831 | Ga0500577_0050831_160_1023 | 282 |
| 628 | 3300053153 | Ga0500616_0060448 | Ga0500616_0060448_795_1658 | 282 |
| 629 | 3300053156 | Ga0500622_0012122 | Ga0500622_0012122_1598_2461 | 282 |
| 630 | 3300053162 | Ga0500638_007140 | Ga0500638_007140_131_1003 | 282 |
| 631 | 3300053177 | Ga0500636_0000232 | Ga0500636_0000232_21100_21963 | 282 |
| 632 | 3300053177 | Ga0500636_0024967 | Ga0500636_0024967_2475_3347 | 282 |
| 633 | 3300053177 | Ga0500636_0175110 | Ga0500636_0175110_261_1124 | 282 |
| 634 | 3300053178 | Ga0500637_0000080 | Ga0500637_0000080_14112_14984 | 282 |
| 635 | 3300053178 | Ga0500637_0188357 | Ga0500637_0188357_282_1145 | 282 |
| 636 | 3300053729 | Ga0500625_026577 | Ga0500625_026577_138_1001 | 282 |
| 637 | 3300053730 | Ga0500645_004073 | Ga0500645_004073_4663_5535 | 282 |
| 638 | 3300053730 | Ga0500645_052144 | Ga0500645_052144_138_1001 | 282 |
| 639 | 3300053730 | Ga0500645_052415 | Ga0500645_052415_109_981 | 282 |
| 640 | 3300053731 | Ga0500609_000805 | Ga0500609_000805_1942_2805 | 282 |
| 641 | 3300053736 | Ga0500599_002446 | Ga0500599_002446_1006_1869 | 282 |
| 642 | 3300053737 | Ga0500601_000108 | Ga0500601_000108_12903_13766 | 282 |
| 643 | 3300054114 | Ga0501084_0016246 | Ga0501084_0016246_2302_3222 | 282 |
| 644 | iso_pu_bacteria | 2523231067 | 2523467875 | 282 |
| 645 | 3300003215 | JGI25153J46596_10013220 | JGI25153J46596_100132205 | 283 |
| 646 | 3300005329 | Ga0070683_100058153 | Ga0070683_1000581533 | 283 |
| 647 | 3300005334 | Ga0068869_100177413 | Ga0068869_1001774131 | 283 |
| 648 | 3300005336 | Ga0070680_100007323 | Ga0070680_10000732311 | 283 |
| 649 | 3300005337 | Ga0070682_100101303 | Ga0070682_1001013032 | 283 |
| 650 | 3300005338 | Ga0068868_100219698 | Ga0068868_1002196981 | 283 |
| 651 | 3300005339 | Ga0070660_100003353 | Ga0070660_10000335311 | 283 |
| 652 | 3300005340 | Ga0070689_100397977 | Ga0070689_1003979771 | 283 |
| 653 | 3300005344 | Ga0070661_100029726 | Ga0070661_1000297266 | 283 |
| 654 | 3300005347 | Ga0070668_100399295 | Ga0070668_1003992952 | 283 |
| 655 | 3300005355 | Ga0070671_100387593 | Ga0070671_1003875932 | 283 |
| 656 | 3300005434 | Ga0070709_10016287 | Ga0070709_100162874 | 283 |
| 657 | 3300005436 | Ga0070713_100024272 | Ga0070713_1000242724 | 283 |
| 658 | 3300005437 | Ga0070710_10039645 | Ga0070710_100396452 | 283 |
| 659 | 3300005456 | Ga0070678_100255989 | Ga0070678_1002559892 | 283 |
| 660 | 3300005458 | Ga0070681_10033490 | Ga0070681_100334904 | 283 |
| 661 | 3300005530 | Ga0070679_100075614 | Ga0070679_1000756141 | 283 |
| 662 | 3300005535 | Ga0070684_100006286 | Ga0070684_1000062865 | 283 |
| 663 | 3300005535 | Ga0070684_100025288 | Ga0070684_1000252883 | 283 |
| 664 | 3300005539 | Ga0068853_100001496 | Ga0068853_10000149617 | 283 |
| 665 | 3300005549 | Ga0070704_100192822 | Ga0070704_1001928222 | 283 |
| 666 | 3300005563 | Ga0068855_100031854 | Ga0068855_1000318549 | 283 |
| 667 | 3300005564 | Ga0070664_100503876 | Ga0070664_1005038762 | 283 |
| 668 | 3300005577 | Ga0068857_100004210 | Ga0068857_10000421013 | 283 |
| 669 | 3300005578 | Ga0068854_100061411 | Ga0068854_1000614114 | 283 |
| 670 | 3300005614 | Ga0068856_100006410 | Ga0068856_1000064106 | 283 |
| 671 | 3300005614 | Ga0068856_100077437 | Ga0068856_1000774372 | 283 |
| 672 | 3300005614 | Ga0068856_100547953 | Ga0068856_1005479532 | 283 |
| 673 | 3300005615 | Ga0070702_100275930 | Ga0070702_1002759301 | 283 |
| 674 | 3300005617 | Ga0068859_100178873 | Ga0068859_1001788733 | 283 |
| 675 | 3300005618 | Ga0068864_100133624 | Ga0068864_1001336241 | 283 |
| 676 | 3300005719 | Ga0068861_100489562 | Ga0068861_1004895622 | 283 |
| 677 | 3300005842 | Ga0068858_100334100 | Ga0068858_1003341002 | 283 |
| 678 | 3300005842 | Ga0068858_100400955 | Ga0068858_1004009551 | 283 |
| 679 | 3300005844 | Ga0068862_100145350 | Ga0068862_1001453502 | 283 |
| 680 | 3300005983 | Ga0081540_1005016 | Ga0081540_10050163 | 283 |
| 681 | 3300005983 | Ga0081540_1005578 | Ga0081540_10055785 | 283 |
| 682 | 3300005983 | Ga0081540_1005788 | Ga0081540_10057888 | 283 |
| 683 | 3300006028 | Ga0070717_10105321 | Ga0070717_101053212 | 283 |
| 684 | 3300006173 | Ga0070716_100010967 | Ga0070716_1000109676 | 283 |
| 685 | 3300006175 | Ga0070712_100028666 | Ga0070712_1000286663 | 283 |
| 686 | 3300006881 | Ga0068865_100057630 | Ga0068865_1000576302 | 283 |
| 687 | 3300006931 | Ga0097620_100178880 | Ga0097620_1001788803 | 283 |
| 688 | 3300009098 | Ga0105245_10071302 | Ga0105245_100713024 | 283 |
| 689 | 3300009176 | Ga0105242_10184248 | Ga0105242_101842482 | 283 |
| 690 | 3300009545 | Ga0105237_10008895 | Ga0105237_1000889511 | 283 |
| 691 | 3300009545 | Ga0105237_10356681 | Ga0105237_103566812 | 283 |
| 692 | 3300009551 | Ga0105238_10026375 | Ga0105238_100263755 | 283 |
| 693 | 3300010375 | Ga0105239_10008167 | Ga0105239_1000816710 | 283 |
| 694 | 3300010375 | Ga0105239_10414628 | Ga0105239_104146281 | 283 |
| 695 | 3300011119 | Ga0105246_10067767 | Ga0105246_100677672 | 283 |
| 696 | 3300013104 | Ga0157370_10054683 | Ga0157370_100546834 | 283 |
| 697 | 3300013105 | Ga0157369_10006096 | Ga0157369_1000609616 | 283 |
| 698 | 3300013296 | Ga0157374_10199007 | Ga0157374_101990072 | 283 |
| 699 | 3300013306 | Ga0163162_10064929 | Ga0163162_100649292 | 283 |
| 700 | 3300013306 | Ga0163162_10586244 | Ga0163162_105862441 | 283 |
| 701 | 3300014969 | Ga0157376_10042518 | Ga0157376_100425183 | 283 |
| 702 | 3300025297 | Ga0209758_1002009 | Ga0209758_100200922 | 283 |
| 703 | 3300025297 | Ga0209758_1006390 | Ga0209758_10063906 | 283 |
| 704 | 3300025898 | Ga0207692_10001396 | Ga0207692_100013969 | 283 |
| 705 | 3300025901 | Ga0207688_10048296 | Ga0207688_100482963 | 283 |
| 706 | 3300025905 | Ga0207685_10004095 | Ga0207685_100040953 | 283 |
| 707 | 3300025906 | Ga0207699_10038984 | Ga0207699_100389843 | 283 |
| 708 | 3300025907 | Ga0207645_10282096 | Ga0207645_102820962 | 283 |
| 709 | 3300025909 | Ga0207705_10080452 | Ga0207705_100804522 | 283 |
| 710 | 3300025912 | Ga0207707_10001933 | Ga0207707_1000193317 | 283 |
| 711 | 3300025914 | Ga0207671_10037028 | Ga0207671_100370283 | 283 |
| 712 | 3300025914 | Ga0207671_10047710 | Ga0207671_100477103 | 283 |
| 713 | 3300025915 | Ga0207693_10020323 | Ga0207693_100203232 | 283 |
| 714 | 3300025916 | Ga0207663_10001112 | Ga0207663_100011129 | 283 |
| 715 | 3300025917 | Ga0207660_10009206 | Ga0207660_100092062 | 283 |
| 716 | 3300025919 | Ga0207657_10005821 | Ga0207657_100058211 | 283 |
| 717 | 3300025921 | Ga0207652_10070273 | Ga0207652_100702733 | 283 |
| 718 | 3300025924 | Ga0207694_10022943 | Ga0207694_100229433 | 283 |
| 719 | 3300025928 | Ga0207700_10214960 | Ga0207700_102149601 | 283 |
| 720 | 3300025938 | Ga0207704_10244042 | Ga0207704_102440422 | 283 |
| 721 | 3300025939 | Ga0207665_10000703 | Ga0207665_1000070311 | 283 |
| 722 | 3300025942 | Ga0207689_10038013 | Ga0207689_100380135 | 283 |
| 723 | 3300025944 | Ga0207661_10000171 | Ga0207661_1000017139 | 283 |
| 724 | 3300025944 | Ga0207661_10030341 | Ga0207661_100303413 | 283 |
| 725 | 3300025945 | Ga0207679_10384077 | Ga0207679_103840772 | 283 |
| 726 | 3300025949 | Ga0207667_10013826 | Ga0207667_1001382611 | 283 |
| 727 | 3300026023 | Ga0207677_10061516 | Ga0207677_100615162 | 283 |
| 728 | 3300026035 | Ga0207703_10345982 | Ga0207703_103459822 | 283 |
| 729 | 3300026041 | Ga0207639_10008009 | Ga0207639_100080093 | 283 |
| 730 | 3300026067 | Ga0207678_10014592 | Ga0207678_100145927 | 283 |
| 731 | 3300026067 | Ga0207678_10027182 | Ga0207678_100271822 | 283 |
| 732 | 3300026078 | Ga0207702_10000014 | Ga0207702_10000014254 | 283 |
| 733 | 3300026078 | Ga0207702_10106532 | Ga0207702_101065322 | 283 |
| 734 | 3300026078 | Ga0207702_10420068 | Ga0207702_104200681 | 283 |
| 735 | 3300026116 | Ga0207674_10004961 | Ga0207674_1000496113 | 283 |
| 736 | 3300026121 | Ga0207683_10223320 | Ga0207683_102233202 | 283 |
| 737 | 3300026142 | Ga0207698_10120408 | Ga0207698_101204082 | 283 |
| 738 | 3300028380 | Ga0268265_10043874 | Ga0268265_100438743 | 283 |
| 739 | 3300028556 | Ga0265337_1009916 | Ga0265337_10099163 | 283 |
| 740 | 3300028563 | Ga0265319_1005843 | Ga0265319_10058435 | 283 |
| 741 | 3300028573 | Ga0265334_10011705 | Ga0265334_100117053 | 283 |
| 742 | 3300028653 | Ga0265323_10009578 | Ga0265323_100095784 | 283 |
| 743 | 3300028666 | Ga0265336_10000395 | Ga0265336_1000039526 | 283 |
| 744 | 3300028800 | Ga0265338_10000018 | Ga0265338_10000018267 | 283 |
| 745 | 3300031507 | Ga0307509_10337852 | Ga0307509_103378522 | 283 |
| 746 | 3300031711 | Ga0265314_10022428 | Ga0265314_100224286 | 283 |
| 747 | 3300035086 | Ga0373934_0004936 | Ga0373934_0004936_2784_3665 | 283 |
| 748 | 3300035118 | Ga0373954_0002374 | Ga0373954_0002374_5264_6145 | 283 |
| 749 | 3300035119 | Ga0373956_0038676 | Ga0373956_0038676_598_1479 | 283 |
| 750 | 3300035120 | Ga0373957_0008219 | Ga0373957_0008219_60_941 | 283 |
| 751 | 3300035170 | Ga0373943_0018713 | Ga0373943_0018713_1580_2455 | 283 |
| 752 | 3300035172 | Ga0373955_0000590 | Ga0373955_0000590_11933_12814 | 283 |
| 753 | 3300035410 | Ga0373924_0042035 | Ga0373924_0042035_711_1592 | 283 |
| 754 | 3300035695 | Ga0373927_0036611 | Ga0373927_0036611_1951_3030 | 283 |
| 755 | 3300035724 | Ga0373933_0044344 | Ga0373933_0044344_1282_2163 | 283 |
| 756 | 3300035725 | Ga0373947_0162647 | Ga0373947_0162647_367_1242 | 283 |
| 757 | 3300037418 | Ga0395900_0000753 | Ga0395900_0000753_34793_35659 | 283 |
| 758 | 3300037418 | Ga0395900_0034589 | Ga0395900_0034589_3600_4475 | 283 |
| 759 | 3300037466 | Ga0395898_0005579 | Ga0395898_0005579_2956_3822 | 283 |
| 760 | 3300037471 | Ga0395905_0095802 | Ga0395905_0095802_734_1600 | 283 |
| 761 | 3300038443 | Ga0395901_0290360 | Ga0395901_0290360_478_1344 | 283 |
| 762 | 3300045976 | Ga0466967_0049868 | Ga0466967_0049868_1277_2152 | 283 |
| 763 | 3300046454 | Ga0495592_0007391 | Ga0495592_0007391_3921_4802 | 283 |
| 764 | 3300046455 | Ga0495603_0046931 | Ga0495603_0046931_1494_2369 | 283 |
| 765 | 3300046462 | Ga0495651_0009620 | Ga0495651_0009620_3157_4038 | 283 |
| 766 | 3300046463 | Ga0495653_0017260 | Ga0495653_0017260_62_943 | 283 |
| 767 | 3300046475 | Ga0495639_0179251 | Ga0495639_0179251_67_942 | 283 |
| 768 | 3300046477 | Ga0495664_0009047 | Ga0495664_0009047_145_1014 | 283 |
| 769 | 3300046477 | Ga0495664_0011721 | Ga0495664_0011721_2709_3590 | 283 |
| 770 | 3300046511 | Ga0495608_0048870 | Ga0495608_0048870_426_1307 | 283 |
| 771 | 3300046512 | Ga0495610_0144162 | Ga0495610_0144162_76_963 | 283 |
| 772 | 3300046513 | Ga0495616_0149186 | Ga0495616_0149186_49_936 | 283 |
| 773 | 3300046516 | Ga0495628_0011834 | Ga0495628_0011834_3222_4103 | 283 |
| 774 | 3300046529 | Ga0495652_0033670 | Ga0495652_0033670_3472_4353 | 283 |
| 775 | 3300046533 | Ga0495640_0009547 | Ga0495640_0009547_5707_6588 | 283 |
| 776 | 3300046536 | Ga0495587_0027506 | Ga0495587_0027506_26_907 | 283 |
| 777 | 3300046543 | Ga0495645_0007861 | Ga0495645_0007861_4031_4900 | 283 |
| 778 | 3300046543 | Ga0495645_0009133 | Ga0495645_0009133_3482_4363 | 283 |
| 779 | 3300046558 | Ga0495633_0052517 | Ga0495633_0052517_650_1537 | 283 |
| 780 | 3300046559 | Ga0495667_0035440 | Ga0495667_0035440_1095_1976 | 283 |
| 781 | 3300046615 | Ga0495656_0042832 | Ga0495656_0042832_333_1220 | 283 |
| 782 | 3300046642 | Ga0495634_0009379 | Ga0495634_0009379_1203_2084 | 283 |
| 783 | 3300046663 | Ga0495635_0007423 | Ga0495635_0007423_973_1854 | 283 |
| 784 | 3300046664 | Ga0495659_0081824 | Ga0495659_0081824_264_1151 | 283 |
| 785 | 3300046675 | Ga0495657_0016949 | Ga0495657_0016949_3957_4838 | 283 |
| 786 | 3300046678 | Ga0495599_0019799 | Ga0495599_0019799_3194_4075 | 283 |
| 787 | 3300046678 | Ga0495599_0051324 | Ga0495599_0051324_548_1417 | 283 |
| 788 | 3300046679 | Ga0495623_0021928 | Ga0495623_0021928_118_999 | 283 |
| 789 | 3300046680 | Ga0495646_0046922 | Ga0495646_0046922_711_1592 | 283 |
| 790 | 3300046684 | Ga0495669_0108507 | Ga0495669_0108507_75_962 | 283 |
| 791 | 3300046692 | Ga0495671_0100551 | Ga0495671_0100551_342_1229 | 283 |
| 792 | 3300046794 | Ga0495589_0136929 | Ga0495589_0136929_213_1100 | 283 |
| 793 | 3300046809 | Ga0495600_0031062 | Ga0495600_0031062_2489_3370 | 283 |
| 794 | 3300047317 | Ga0495604_0020133 | Ga0495604_0020133_2425_3306 | 283 |
| 795 | 3300047319 | Ga0495674_0121079 | Ga0495674_0121079_1231_2112 | 283 |
| 796 | 3300047322 | Ga0495680_0014448 | Ga0495680_0014448_26_907 | 283 |
| 797 | 3300047471 | Ga0495684_0073127 | Ga0495684_0073127_781_1662 | 283 |
| 798 | 3300048904 | Ga0496101_0003670 | Ga0496101_0003670_1992_2867 | 283 |
| 799 | 3300048905 | Ga0496102_0001403 | Ga0496102_0001403_9202_10077 | 283 |
| 800 | 3300048907 | Ga0496104_0301812 | Ga0496104_0301812_107_982 | 283 |
| 801 | 3300048908 | Ga0496105_0076936 | Ga0496105_0076936_430_1305 | 283 |
| 802 | 3300048909 | Ga0496106_0011375 | Ga0496106_0011375_5222_6097 | 283 |
| 803 | 3300048913 | Ga0496110_0078391 | Ga0496110_0078391_1110_1985 | 283 |
| 804 | 3300048913 | Ga0496110_0146918 | Ga0496110_0146918_1208_2083 | 283 |
| 805 | 3300048914 | Ga0496111_0004711 | Ga0496111_0004711_2701_3576 | 283 |
| 806 | 3300048914 | Ga0496111_0369052 | Ga0496111_0369052_60_929 | 283 |
| 807 | 3300048915 | Ga0496112_0199695 | Ga0496112_0199695_831_1706 | 283 |
| 808 | 3300048916 | Ga0496113_0093556 | Ga0496113_0093556_44_919 | 283 |
| 809 | 3300048917 | Ga0496114_0069047 | Ga0496114_0069047_220_1095 | 283 |
| 810 | 3300048918 | Ga0496115_0004202 | Ga0496115_0004202_8859_9734 | 283 |
| 811 | 3300048928 | Ga0496125_0255755 | Ga0496125_0255755_57_932 | 283 |
| 812 | 3300048929 | Ga0496126_0398518 | Ga0496126_0398518_213_1088 | 283 |
| 813 | 3300053077 | Ga0495601_0032293 | Ga0495601_0032293_1483_2364 | 283 |
| 814 | 3300053077 | Ga0495601_0108477 | Ga0495601_0108477_273_1142 | 283 |
| 815 | 3300053078 | Ga0495612_0097656 | Ga0495612_0097656_308_1177 | 283 |
| 816 | 3300053083 | Ga0495655_0007769 | Ga0495655_0007769_841_1716 | 283 |
| 817 | 3300053084 | Ga0495595_0061912 | Ga0495595_0061912_90_971 | 283 |
| 818 | 3300053085 | Ga0495619_0077752 | Ga0495619_0077752_118_999 | 283 |
| 819 | iso_pu_bacteria | 2602042107 | 2603860653 | 283 |
| 820 | iso_pu_bacteria | 2871282230 | 2871286099 | 283 |
| 821 | iso_pu_bacteria | 8006926726 | 8006927298 | 283 |
| 822 | 3300005335 | Ga0070666_10116344 | Ga0070666_101163442 | 284 |
| 823 | 3300005434 | Ga0070709_10004499 | Ga0070709_100044998 | 284 |
| 824 | 3300005435 | Ga0070714_100032403 | Ga0070714_1000324035 | 284 |
| 825 | 3300005436 | Ga0070713_100097488 | Ga0070713_1000974882 | 284 |
| 826 | 3300005437 | Ga0070710_10003046 | Ga0070710_100030469 | 284 |
| 827 | 3300005457 | Ga0070662_100026265 | Ga0070662_1000262654 | 284 |
| 828 | 3300005548 | Ga0070665_100367819 | Ga0070665_1003678192 | 284 |
| 829 | 3300005617 | Ga0068859_100135138 | Ga0068859_1001351383 | 284 |
| 830 | 3300005843 | Ga0068860_100003385 | Ga0068860_1000033859 | 284 |
| 831 | 3300005983 | Ga0081540_1004705 | Ga0081540_10047052 | 284 |
| 832 | 3300006173 | Ga0070716_100079528 | Ga0070716_1000795282 | 284 |
| 833 | 3300006931 | Ga0097620_100135137 | Ga0097620_1001351372 | 284 |
| 834 | 3300009174 | Ga0105241_10240858 | Ga0105241_102408582 | 284 |
| 835 | 3300009177 | Ga0105248_10579251 | Ga0105248_105792512 | 284 |
| 836 | 3300009545 | Ga0105237_10183321 | Ga0105237_101833212 | 284 |
| 837 | 3300014969 | Ga0157376_10436292 | Ga0157376_104362922 | 284 |
| 838 | 3300021321 | Ga0214542_1000009 | Ga0214542_1000009214 | 284 |
| 839 | 3300021324 | Ga0214545_1000007 | Ga0214545_100000728 | 284 |
| 840 | 3300021324 | Ga0214545_1039271 | Ga0214545_10392712 | 284 |
| 841 | 3300021327 | Ga0214543_1000020 | Ga0214543_1000020214 | 284 |
| 842 | 3300021327 | Ga0214543_1040577 | Ga0214543_10405772 | 284 |
| 843 | 3300021358 | Ga0213873_10002858 | Ga0213873_100028584 | 284 |
| 844 | 3300021384 | Ga0213876_10001108 | Ga0213876_100011084 | 284 |
| 845 | 3300025903 | Ga0207680_10165964 | Ga0207680_101659642 | 284 |
| 846 | 3300025915 | Ga0207693_10027576 | Ga0207693_100275766 | 284 |
| 847 | 3300025916 | Ga0207663_10067343 | Ga0207663_100673432 | 284 |
| 848 | 3300025928 | Ga0207700_10064270 | Ga0207700_100642702 | 284 |
| 849 | 3300025929 | Ga0207664_10313407 | Ga0207664_103134072 | 284 |
| 850 | 3300025933 | Ga0207706_10154120 | Ga0207706_101541202 | 284 |
| 851 | 3300025939 | Ga0207665_10091630 | Ga0207665_100916302 | 284 |
| 852 | 3300026035 | Ga0207703_10554506 | Ga0207703_105545061 | 284 |
| 853 | 3300026078 | Ga0207702_10319646 | Ga0207702_103196462 | 284 |
| 854 | 3300026142 | Ga0207698_10275638 | Ga0207698_102756382 | 284 |
| 855 | 3300028379 | Ga0268266_10359651 | Ga0268266_103596512 | 284 |
| 856 | 3300028381 | Ga0268264_10000042 | Ga0268264_1000004214 | 284 |
| 857 | 3300028381 | Ga0268264_10380313 | Ga0268264_103803132 | 284 |
| 858 | 3300031249 | Ga0265339_10004193 | Ga0265339_100041939 | 284 |
| 859 | 3300031456 | Ga0307513_10072122 | Ga0307513_100721222 | 284 |
| 860 | 3300031507 | Ga0307509_10006260 | Ga0307509_1000626015 | 284 |
| 861 | 3300031507 | Ga0307509_10137057 | Ga0307509_101370572 | 284 |
| 862 | 3300031616 | Ga0307508_10000125 | Ga0307508_1000012565 | 284 |
| 863 | 3300031616 | Ga0307508_10343203 | Ga0307508_103432031 | 284 |
| 864 | 3300031730 | Ga0307516_10113165 | Ga0307516_101131654 | 284 |
| 865 | 3300033180 | Ga0307510_10206472 | Ga0307510_102064722 | 284 |
| 866 | 3300035695 | Ga0373927_0014600 | Ga0373927_0014600_534_1403 | 284 |
| 867 | 3300037068 | Ga0373925_0284792 | Ga0373925_0284792_380_1249 | 284 |
| 868 | 3300044706 | Ga0466964_0018290 | Ga0466964_0018290_1037_1906 | 284 |
| 869 | 3300046459 | Ga0495629_0021300 | Ga0495629_0021300_1197_2066 | 284 |
| 870 | 3300046462 | Ga0495651_0065835 | Ga0495651_0065835_342_1211 | 284 |
| 871 | 3300046474 | Ga0495605_0145814 | Ga0495605_0145814_105_974 | 284 |
| 872 | 3300046477 | Ga0495664_0018996 | Ga0495664_0018996_2408_3277 | 284 |
| 873 | 3300046506 | Ga0495583_0093806 | Ga0495583_0093806_102_971 | 284 |
| 874 | 3300046507 | Ga0495606_0012721 | Ga0495606_0012721_1749_2618 | 284 |
| 875 | 3300046507 | Ga0495606_0181991 | Ga0495606_0181991_108_977 | 284 |
| 876 | 3300046511 | Ga0495608_0019083 | Ga0495608_0019083_2093_2962 | 284 |
| 877 | 3300046511 | Ga0495608_0068933 | Ga0495608_0068933_240_1109 | 284 |
| 878 | 3300046514 | Ga0495618_0035324 | Ga0495618_0035324_1772_2641 | 284 |
| 879 | 3300046524 | Ga0495648_0056224 | Ga0495648_0056224_162_1031 | 284 |
| 880 | 3300046529 | Ga0495652_0004325 | Ga0495652_0004325_11155_12024 | 284 |
| 881 | 3300046533 | Ga0495640_0028702 | Ga0495640_0028702_1144_2013 | 284 |
| 882 | 3300046536 | Ga0495587_0058603 | Ga0495587_0058603_64_933 | 284 |
| 883 | 3300046557 | Ga0495622_0006001 | Ga0495622_0006001_3230_4099 | 284 |
| 884 | 3300046559 | Ga0495667_0026445 | Ga0495667_0026445_1302_2171 | 284 |
| 885 | 3300046642 | Ga0495634_0034428 | Ga0495634_0034428_407_1276 | 284 |
| 886 | 3300046663 | Ga0495635_0012284 | Ga0495635_0012284_2872_3741 | 284 |
| 887 | 3300046675 | Ga0495657_0001308 | Ga0495657_0001308_120_989 | 284 |
| 888 | 3300046675 | Ga0495657_0007247 | Ga0495657_0007247_6783_7652 | 284 |
| 889 | 3300046678 | Ga0495599_0025698 | Ga0495599_0025698_744_1613 | 284 |
| 890 | 3300046679 | Ga0495623_0120808 | Ga0495623_0120808_680_1549 | 284 |
| 891 | 3300046680 | Ga0495646_0081177 | Ga0495646_0081177_647_1516 | 284 |
| 892 | 3300046689 | Ga0495613_0119691 | Ga0495613_0119691_791_1660 | 284 |
| 893 | 3300046690 | Ga0495624_0074817 | Ga0495624_0074817_528_1397 | 284 |
| 894 | 3300046694 | Ga0495649_0119963 | Ga0495649_0119963_253_1122 | 284 |
| 895 | 3300046809 | Ga0495600_0007966 | Ga0495600_0007966_789_1658 | 284 |
| 896 | 3300046809 | Ga0495600_0020140 | Ga0495600_0020140_2549_3418 | 284 |
| 897 | 3300047317 | Ga0495604_0006128 | Ga0495604_0006128_1700_2569 | 284 |
| 898 | 3300047319 | Ga0495674_0011175 | Ga0495674_0011175_268_1137 | 284 |
| 899 | 3300047319 | Ga0495674_0044585 | Ga0495674_0044585_3003_3872 | 284 |
| 900 | 3300047321 | Ga0495676_0162888 | Ga0495676_0162888_74_943 | 284 |
| 901 | 3300047322 | Ga0495680_0001053 | Ga0495680_0001053_4240_5109 | 284 |
| 902 | 3300047472 | Ga0495686_0213485 | Ga0495686_0213485_217_1086 | 284 |
| 903 | 3300048088 | Ga0495602_0021411 | Ga0495602_0021411_2307_3176 | 284 |
| 904 | 3300048907 | Ga0496104_0014912 | Ga0496104_0014912_3433_4302 | 284 |
| 905 | 3300048908 | Ga0496105_0046798 | Ga0496105_0046798_1700_2569 | 284 |
| 906 | 3300048911 | Ga0496108_0399302 | Ga0496108_0399302_21_908 | 284 |
| 907 | 3300048915 | Ga0496112_0036649 | Ga0496112_0036649_1363_2250 | 284 |
| 908 | 3300048916 | Ga0496113_0035660 | Ga0496113_0035660_2280_3167 | 284 |
| 909 | 3300048917 | Ga0496114_0346237 | Ga0496114_0346237_384_1253 | 284 |
| 910 | 3300048918 | Ga0496115_0049654 | Ga0496115_0049654_609_1478 | 284 |
| 911 | 3300048922 | Ga0496119_0003138 | Ga0496119_0003138_15129_15998 | 284 |
| 912 | 3300048923 | Ga0496120_0015858 | Ga0496120_0015858_1497_2366 | 284 |
| 913 | 3300048924 | Ga0496121_0173220 | Ga0496121_0173220_630_1499 | 284 |
| 914 | 3300048925 | Ga0496122_0078087 | Ga0496122_0078087_1373_2254 | 284 |
| 915 | 3300048928 | Ga0496125_0000099 | Ga0496125_0000099_95860_96741 | 284 |
| 916 | 3300048928 | Ga0496125_0003103 | Ga0496125_0003103_11341_12222 | 284 |
| 917 | 3300048928 | Ga0496125_0098349 | Ga0496125_0098349_45_914 | 284 |
| 918 | 3300048929 | Ga0496126_0058992 | Ga0496126_0058992_1468_2337 | 284 |
| 919 | 3300049570 | Ga0501033_0020903 | Ga0501033_0020903_2207_3109 | 284 |
| 920 | 3300053094 | Ga0500566_0077548 | Ga0500566_0077548_230_1099 | 284 |
| 921 | 3300053119 | Ga0500595_021655 | Ga0500595_021655_1332_2201 | 284 |
| 922 | 3300053134 | Ga0500658_0051892 | Ga0500658_0051892_699_1580 | 284 |
| 923 | 3300053148 | Ga0500590_075347 | Ga0500590_075347_526_1395 | 284 |
| 924 | 3300053163 | Ga0500639_161605 | Ga0500639_161605_132_1001 | 284 |
| 925 | 3300055283 | Ga0500661_011701 | Ga0500661_011701_580_1449 | 284 |
| 926 | iso_pu_bacteria | 2904449895 | 2904454323 | 284 |
| 927 | iso_pu_bacteria | 2904456579 | 2904462681 | 284 |
| 928 | iso_pu_bacteria | 2929520902 | 2929527132 | 284 |
| 929 | iso_pu_bacteria | 2945972063 | 2945977277 | 284 |
| 930 | 3300003578 | Ga0006562J51391_1119272 | Ga0006562J51391_11192722 | 285 |
| 931 | 3300006028 | Ga0070717_10023806 | Ga0070717_100238063 | 285 |
| 932 | 3300006871 | Ga0075434_100244652 | Ga0075434_1002446522 | 285 |
| 933 | 3300009093 | Ga0105240_10014685 | Ga0105240_100146852 | 285 |
| 934 | 3300009098 | Ga0105245_10260089 | Ga0105245_102600892 | 285 |
| 935 | 3300009174 | Ga0105241_10111550 | Ga0105241_101115501 | 285 |
| 936 | 3300009174 | Ga0105241_10197931 | Ga0105241_101979312 | 285 |
| 937 | 3300009177 | Ga0105248_10170279 | Ga0105248_101702793 | 285 |
| 938 | 3300009545 | Ga0105237_10069051 | Ga0105237_100690513 | 285 |
| 939 | 3300013100 | Ga0157373_10096002 | Ga0157373_100960022 | 285 |
| 940 | 3300013296 | Ga0157374_10482983 | Ga0157374_104829832 | 285 |
| 941 | 3300014497 | Ga0182008_10000904 | Ga0182008_1000090419 | 285 |
| 942 | 3300015261 | Ga0182006_1092731 | Ga0182006_10927311 | 285 |
| 943 | 3300021361 | Ga0213872_10021501 | Ga0213872_100215013 | 285 |
| 944 | 3300031548 | Ga0307408_100014308 | Ga0307408_1000143082 | 285 |
| 945 | 3300031649 | Ga0307514_10003203 | Ga0307514_100032032 | 285 |
| 946 | 3300031901 | Ga0307406_10000052 | Ga0307406_1000005259 | 285 |
| 947 | 3300032004 | Ga0307414_10237263 | Ga0307414_102372632 | 285 |
| 948 | 3300037418 | Ga0395900_0570067 | Ga0395900_0570067_122_997 | 285 |
| 949 | 3300037466 | Ga0395898_0029509 | Ga0395898_0029509_3518_4393 | 285 |
| 950 | 3300039438 | Ga0436360_0121399 | Ga0436360_0121399_2225_3100 | 285 |
| 951 | 3300039447 | Ga0436361_0897018 | Ga0436361_0897018_979_1854 | 285 |
| 952 | 3300039447 | Ga0436361_1132428 | Ga0436361_1132428_1921_2796 | 285 |
| 953 | 3300039453 | Ga0436362_1029662 | Ga0436362_1029662_991_1866 | 285 |
| 954 | 3300048925 | Ga0496122_0013345 | Ga0496122_0013345_5955_6878 | 285 |
| 955 | 3300049571 | Ga0501034_0168820 | Ga0501034_0168820_765_1667 | 285 |
| 956 | 3300049573 | Ga0501037_0087480 | Ga0501037_0087480_1012_1914 | 285 |
| 957 | 3300049574 | Ga0501038_0113748 | Ga0501038_0113748_377_1279 | 285 |
| 958 | 3300049575 | Ga0501039_0187577 | Ga0501039_0187577_85_987 | 285 |
| 959 | 3300049581 | Ga0501047_0257069 | Ga0501047_0257069_257_1159 | 285 |
| 960 | 3300049584 | Ga0501068_0139925 | Ga0501068_0139925_490_1392 | 285 |
| 961 | 3300049589 | Ga0501073_0151635 | Ga0501073_0151635_507_1409 | 285 |
| 962 | 3300050489 | nmdc:mga03683_3300_c1 | nmdc:mga03683_3300_c1_3562_4476 | 285 |
| 963 | 3300050512 | nmdc:mga0n895_236471_c1 | nmdc:mga0n895_236471_c1_312_1208 | 285 |
| 964 | 3300053111 | Ga0500572_000335 | Ga0500572_000335_6615_7496 | 285 |
| 965 | 3300053136 | Ga0500559_0003196 | Ga0500559_0003196_522_1403 | 285 |
| 966 | 3300053735 | Ga0500596_002066 | Ga0500596_002066_2505_3386 | 285 |
| 967 | 3300006042 | Ga0075368_10012299 | Ga0075368_100122992 | 286 |
| 968 | 3300009101 | Ga0105247_10187173 | Ga0105247_101871732 | 286 |
| 969 | 3300009147 | Ga0114129_10004595 | Ga0114129_1000459513 | 286 |
| 970 | 3300010375 | Ga0105239_10074854 | Ga0105239_100748543 | 286 |
| 971 | 3300025924 | Ga0207694_10205787 | Ga0207694_102057872 | 286 |
| 972 | 3300048924 | Ga0496121_0001525 | Ga0496121_0001525_21803_22687 | 286 |
| 973 | 3300048927 | Ga0496124_0012006 | Ga0496124_0012006_1663_2547 | 286 |
| 974 | 3300048928 | Ga0496125_0171374 | Ga0496125_0171374_126_1010 | 286 |
| 975 | 3300050507 | nmdc:mga05p37_15155_c1 | nmdc:mga05p37_15155_c1_5496_6398 | 286 |
| 976 | 3300053087 | Ga0500643_023418 | Ga0500643_023418_413_1309 | 286 |
| 977 | 3300053119 | Ga0500595_059971 | Ga0500595_059971_140_1024 | 286 |
| 978 | 3300053177 | Ga0500636_0035062 | Ga0500636_0035062_265_1152 | 286 |
| 979 | iso_pu_bacteria | 2643221651 | 2644290240 | 286 |
| 980 | 3300009098 | Ga0105245_10216132 | Ga0105245_102161322 | 287 |
| 981 | 3300025295 | Ga0209564_1000503 | Ga0209564_100050321 | 287 |
| 982 | 3300039437 | Ga0436365_0122301 | Ga0436365_0122301_11135_12064 | 287 |
| 983 | 3300039453 | Ga0436362_0972873 | Ga0436362_0972873_3556_4485 | 287 |
| 984 | 3300048929 | Ga0496126_0124221 | Ga0496126_0124221_573_1490 | 287 |
| 985 | iso_pu_bacteria | 2599185188 | 2599503704 | 287 |
| 986 | iso_pu_bacteria | 2599185302 | 2599942115 | 287 |
| 987 | iso_pu_bacteria | 2599185304 | 2599955096 | 287 |
| 988 | iso_pu_bacteria | 2599185309 | 2599984511 | 287 |
| 989 | iso_pu_bacteria | 2599185310 | 2599990793 | 287 |
| 990 | iso_pu_bacteria | 2599185312 | 2600000715 | 287 |
| 991 | iso_pu_bacteria | 2599185320 | 2600049690 | 287 |
| 992 | iso_pu_bacteria | 2811994881 | 2812370627 | 287 |
| 993 | iso_pu_bacteria | 2923519811 | 2923524727 | 287 |
| 994 | iso_pu_bacteria | 2928115317 | 2928118629 | 287 |
| 995 | iso_pu_bacteria | 3007419365 | 3007419521 | 287 |
| 996 | 3300005366 | Ga0070659_100349769 | Ga0070659_1003497691 | 288 |
| 997 | 3300005530 | Ga0070679_100377415 | Ga0070679_1003774152 | 288 |
| 998 | 3300005563 | Ga0068855_100376434 | Ga0068855_1003764342 | 288 |
| 999 | 3300013100 | Ga0157373_10037722 | Ga0157373_100377223 | 288 |
| 1000 | 3300025909 | Ga0207705_10418436 | Ga0207705_104184362 | 288 |
| 1001 | 3300025919 | Ga0207657_10121119 | Ga0207657_101211192 | 288 |
| 1002 | 3300025921 | Ga0207652_10198291 | Ga0207652_101982912 | 288 |
| 1003 | 3300025949 | Ga0207667_10348678 | Ga0207667_103486782 | 288 |
| 1004 | 3300048907 | Ga0496104_0002112 | Ga0496104_0002112_15898_16872 | 288 |
| 1005 | 3300048910 | Ga0496107_0027212 | Ga0496107_0027212_1282_2256 | 288 |
| 1006 | 3300048911 | Ga0496108_0173496 | Ga0496108_0173496_128_1102 | 288 |
| 1007 | 3300048912 | Ga0496109_0010437 | Ga0496109_0010437_5481_6455 | 288 |
| 1008 | 3300048913 | Ga0496110_0133066 | Ga0496110_0133066_46_1020 | 288 |
| 1009 | 3300048916 | Ga0496113_0006206 | Ga0496113_0006206_1000_1974 | 288 |
| 1010 | 3300050496 | nmdc:mga07m45_180195_c1 | nmdc:mga07m45_180195_c1_180_1091 | 288 |
| 1011 | iso_pu_bacteria | 2597489888 | 2597866882 | 288 |
| 1012 | iso_pu_bacteria | 2597489889 | 2597872721 | 288 |
| 1013 | iso_pu_bacteria | 2599185189 | 2599505979 | 288 |
| 1014 | iso_pu_bacteria | 2600255296 | 2601693227 | 288 |
| 1015 | iso_pu_bacteria | 2619619299 | 2621296615 | 288 |
| 1016 | iso_pu_bacteria | 2643221571 | 2643873445 | 288 |
| 1017 | iso_pu_bacteria | 2643221713 | 2644624540 | 288 |
| 1018 | iso_pu_bacteria | 2721755607 | 2723251594 | 288 |
| 1019 | iso_pu_bacteria | 2738541265 | 2738673548 | 288 |
| 1020 | iso_pu_bacteria | 2738541282 | 2738751941 | 288 |
| 1021 | iso_pu_bacteria | 2738541303 | 2738860982 | 288 |
| 1022 | iso_pu_bacteria | 2808606385 | 2808976386 | 288 |
| 1023 | iso_pu_bacteria | 2808606388 | 2808994154 | 288 |
| 1024 | iso_pu_bacteria | 2816332298 | 2817494274 | 288 |
| 1025 | iso_pu_bacteria | 2834028612 | 2834031180 | 288 |
| 1026 | iso_pu_bacteria | 2842826826 | 2842828518 | 288 |
| 1027 | iso_pu_bacteria | 2842837860 | 2842838129 | 288 |
| 1028 | iso_pu_bacteria | 2852612431 | 2852616581 | 288 |
| 1029 | iso_pu_bacteria | 2852667396 | 2852671549 | 288 |
| 1030 | iso_pu_bacteria | 2860867994 | 2860873252 | 288 |
| 1031 | iso_pu_bacteria | 2929189879 | 2929195381 | 288 |
| 1032 | iso_pu_bacteria | 2946027586 | 2946028131 | 288 |
| 1033 | iso_pu_bacteria | 2947233263 | 2947234664 | 288 |
| 1034 | iso_pu_bacteria | 8054285046 | 8054290203 | 288 |
| 1035 | iso_pu_bacteria | 8054347763 | 8054349356 | 288 |
| 1036 | iso_pu_bacteria | 8055817908 | 8055824139 | 288 |
| 1037 | iso_pu_bacteria | 8056148874 | 8056151265 | 288 |
| 1038 | 3300048924 | Ga0496121_0141995 | Ga0496121_0141995_649_1581 | 289 |
| 1039 | 3300050495 | nmdc:mga04h51_45459_c1 | nmdc:mga04h51_45459_c1_376_1287 | 289 |
| 1040 | 3300050516 | nmdc:mga0sz30_93948_c1 | nmdc:mga0sz30_93948_c1_61_975 | 289 |
| 1041 | 3300003320 | rootH2_10345235 | rootH2_103452352 | 290 |
| 1042 | 3300005288 | Ga0065714_10004573 | Ga0065714_100045732 | 291 |
| 1043 | 3300013100 | Ga0157373_10047172 | Ga0157373_100471722 | 291 |
| 1044 | 3300030744 | Ga0316181_1259633 | Ga0316181_12596333 | 291 |
| 1045 | 3300042129 | Ga0450891_000878 | Ga0450891_000878_2169_3044 | 291 |
| 1046 | 3300002738 | JGI25154J39366_1004166 | JGI25154J39366_10041663 | 292 |
| 1047 | 3300003751 | Ga0055538_1000012 | Ga0055538_1000012156 | 292 |
| 1048 | 3300003752 | Ga0055539_1000017 | Ga0055539_1000017156 | 292 |
| 1049 | 3300003756 | Ga0055533_1000021 | Ga0055533_1000021156 | 292 |
| 1050 | 3300003758 | Ga0055532_1000020 | Ga0055532_100002086 | 292 |
| 1051 | 3300003759 | Ga0055525_1000078 | Ga0055525_100007827 | 292 |
| 1052 | 3300003841 | Ga0055541_1000012 | Ga0055541_1000012156 | 292 |
| 1053 | 3300005331 | Ga0070670_100000141 | Ga0070670_10000014146 | 292 |
| 1054 | 3300009036 | Ga0105244_10003428 | Ga0105244_1000342811 | 292 |
| 1055 | 3300009148 | Ga0105243_10075279 | Ga0105243_100752794 | 292 |
| 1056 | 3300013100 | Ga0157373_10011474 | Ga0157373_100114747 | 292 |
| 1057 | 3300013308 | Ga0157375_10010583 | Ga0157375_100105838 | 292 |
| 1058 | 3300014497 | Ga0182008_10000581 | Ga0182008_1000058115 | 292 |
| 1059 | 3300015261 | Ga0182006_1000467 | Ga0182006_10004673 | 292 |
| 1060 | 3300015262 | Ga0182007_10002786 | Ga0182007_100027864 | 292 |
| 1061 | 3300025206 | Ga0209435_100606 | Ga0209435_1006065 | 292 |
| 1062 | 3300025224 | Ga0209784_100007 | Ga0209784_100007156 | 292 |
| 1063 | 3300025225 | Ga0209566_100009 | Ga0209566_100009156 | 292 |
| 1064 | 3300025226 | Ga0209674_100021 | Ga0209674_100021156 | 292 |
| 1065 | 3300025229 | Ga0209147_100009 | Ga0209147_100009156 | 292 |
| 1066 | 3300025230 | Ga0209563_100018 | Ga0209563_100018156 | 292 |
| 1067 | 3300025242 | Ga0209258_100347 | Ga0209258_1003475 | 292 |
| 1068 | 3300025246 | Ga0209646_1001318 | Ga0209646_10013185 | 292 |
| 1069 | 3300025253 | Ga0209677_100012 | Ga0209677_100012156 | 292 |
| 1070 | 3300025728 | Ga0207655_1000534 | Ga0207655_100053427 | 292 |
| 1071 | 3300025925 | Ga0207650_10000089 | Ga0207650_1000008947 | 292 |
| 1072 | 3300025935 | Ga0207709_10042337 | Ga0207709_100423374 | 292 |
| 1073 | 3300028786 | Ga0307517_10176129 | Ga0307517_101761292 | 292 |
| 1074 | 3300030742 | Ga0316183_1201524 | Ga0316183_12015242 | 292 |
| 1075 | 3300031507 | Ga0307509_10070980 | Ga0307509_100709801 | 292 |
| 1076 | 3300042006 | Ga0439432_000047 | Ga0439432_000047_23909_24787 | 292 |
| 1077 | 3300048927 | Ga0496124_0074509 | Ga0496124_0074509_1741_2619 | 292 |
| 1078 | 3300048928 | Ga0496125_0003676 | Ga0496125_0003676_9552_10430 | 292 |
| 1079 | 3300001915 | JGI24741J21665_1005484 | JGI24741J21665_10054842 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hx7-assembly1.cif.gz_A | metal abc transporter from listeria monocytogenes | 0.9012 | 27 | 296 |
| 6xpn-assembly2.cif.gz_A | z-loop deletion mutant of aztc from paracoccus denitrificans | 0.8983 | 28 | 295 |
| 3zk9-assembly2.cif.gz_B | crystal structure of pneumococcal surface antigen psaa d280n in the metal-free, open state | 0.8943 | 27 | 296 |
| 6q1c-assembly1.cif.gz_A | apo yfea extracted from the e. coli periplasm | 0.8893 | 26 | 296 |
| 3zk8-assembly2.cif.gz_B | crystal structure of pneumococcal surface antigen psaa e205q in the metal-free, open state | 0.8873 | 27 | 296 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4irmB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9561 | 30 | 177 | 3.40.50.1980 |
| 4udnA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9333 | 30 | 178 | 3.40.50.1980 |
| 4oxrA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9322 | 27 | 165 | 3.40.50.1980 |
| 1pq4A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9205 | 26 | 174 | 3.40.50.1980 |
| 4irmB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nitrogenase molybdenum iron protein domain | 0.9187 | 30 | 177 | 3.40.50.1980 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A2Q068-F1-model_v4 | Metal ABC transporter substrate-binding protein | 0.9537 | 27 | 162 |
GO:0007155
GO:0030001 GO:0030313 GO:0046872 |
| AF-A0A3S5ES28-F1-model_v4 | Periplasmic iron-binding protein | 0.9512 | 23 | 169 |
GO:0007155
GO:0030001 GO:0030313 GO:0046872 |
| AF-A0A369FT21-F1-model_v4 | Metal ABC transporter substrate-binding protein | 0.9453 | 22 | 158 |
GO:0007155
GO:0030001 GO:0030313 GO:0046872 |
| AF-A0A7W1NBS9-F1-model_v4 | Zinc ABC transporter substrate-binding protein | 0.9441 | 25 | 171 |
GO:0007155
GO:0030001 GO:0030313 GO:0046872 |
| AF-A0A524KIM7-F1-model_v4 | Metal ABC transporter substrate-binding protein | 0.9392 | 86 | 296 |
GO:0007155
GO:0030001 GO:0030313 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar