F489638

General Info

Members Datasets Scaffolds Average Seq Length
1079 453 1043 143

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10008914|Ga0099794_100089146
Length 159
Sequence MSVCSIERDAPDEHQMTDSQAVHAPLNTENEPCGDLSIRTLAMPADTNQNGDIFGGWLLSQMDIGGGIFASKVARSRTVTVAIEAMNFRKSVFVGDVVSVHANLVRIGKTSVTVHLEAWVKRRKEMQSILVTDGNFTYVSIDDQGHPQVIKRDEPPISA

Samples

Sample ID Description Type Environment
1 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
2 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
7 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
8 2643221651 Afipia sp. Root123D2 Isolate Unclassified
9 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
10 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
11 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
12 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
13 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
14 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
15 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
16 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
17 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
18 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
19 2904699407
20 2906610324
21 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
22 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
23 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
24 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
25 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
26 2922425934
27 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
28 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
29 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
30 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
31 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
32 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
59 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
60 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
61 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
70 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
95 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
96 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
110 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
111 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
112 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
113 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
134 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
135 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
136 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
137 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
138 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
139 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
140 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
141 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
146 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
215 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
216 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
220 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
236 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
239 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
240 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
241 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
242 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
243 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
257 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
263 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
264 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
265 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
266 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
271 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
272 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
275 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
276 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
284 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
285 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
286 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
287 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
292 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
295 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
296 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
297 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
298 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
299 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
300 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
301 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
302 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
303 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
304 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
305 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
306 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
307 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
308 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
309 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
310 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
311 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
312 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
313 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
314 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
315 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
316 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
317 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
321 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
322 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
323 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
324 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
325 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
326 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
327 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
328 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
329 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
330 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
331 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
332 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
333 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
334 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
340 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
341 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
342 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
350 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
351 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
352 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
353 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
354 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
355 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
356 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
357 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
358 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
359 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
360 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
361 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
362 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
363 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
364 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
365 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
366 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
367 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
368 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
369 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
370 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
371 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
372 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
373 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
374 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
375 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
376 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
377 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
378 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
394 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
395 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
396 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
397 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
398 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
399 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
400 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
401 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
402 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
403 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
404 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
405 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
406 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
407 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
414 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
415 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
416 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
417 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
418 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
419 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
420 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
421 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
422 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
423 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
424 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
425 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
426 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
427 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
428 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
429 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
430 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
431 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
432 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
433 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
434 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
435 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
436 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
437 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
438 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
439 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
440 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
441 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
442 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
443 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
444 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
445 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
446 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
447 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
448 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
449 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
450 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
451 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
452 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
453 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.65
Metatranscriptomes 0.28
Isolates 3.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.14
Nodule 2.32
Rhizoplane 6.12
Rhizosphere 79.8
Stem 0
Stem Tuber 0
Unclassified 4.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10084309 3300001979 Bacteria 828
2 JGI25153J46596_10003620 3300003215 Bacteria 8577
3 Ga0070658_10412460 3300005327 Bacteria 1161
4 Ga0070658_10678046 3300005327 Bacteria 894
5 Ga0070676_10386348 3300005328 Bacteria 970
6 Ga0070683_100003964 3300005329 Bacteria 12115
7 Ga0070683_100079622 3300005329 Bacteria 3066
8 Ga0070683_100164572 3300005329 Bacteria 2104
9 Ga0070683_100827681 3300005329 Bacteria 888
10 Ga0068869_100015386 3300005334 Bacteria 5130
11 Ga0070680_100002273 3300005336 Bacteria 14200
12 Ga0070680_100022993 3300005336 Bacteria 4968
13 Ga0070680_100055170 3300005336 Bacteria 3247
14 Ga0070680_100068558 3300005336 Bacteria 2912
15 Ga0070680_100362859 3300005336 Bacteria 1232
16 Ga0070680_100497560 3300005336 Bacteria 1043
17 Ga0070680_100938049 3300005336 Bacteria 747
18 Ga0070682_100003870 3300005337 Bacteria 8307
19 Ga0070682_100938741 3300005337 Bacteria 714
20 Ga0068868_100030028 3300005338 Bacteria 4167
21 Ga0068868_100169058 3300005338 Bacteria 1809
22 Ga0068868_100282404 3300005338 Bacteria 1405
23 Ga0070660_100012040 3300005339 Bacteria 6170
24 Ga0070660_100137772 3300005339 Bacteria 1956
25 Ga0070691_10031624 3300005341 Bacteria 2483
26 Ga0070691_10525261 3300005341 Bacteria 688
27 Ga0070691_10760503 3300005341 Bacteria 587
28 Ga0070661_100059734 3300005344 Bacteria 2797
29 Ga0070661_100200692 3300005344 Bacteria 1524
30 Ga0070661_100994451 3300005344 Bacteria 695
31 Ga0070668_101229091 3300005347 Bacteria 679
32 Ga0070671_100216287 3300005355 Bacteria 1626
33 Ga0070671_100267297 3300005355 Bacteria 1453
34 Ga0070673_100152900 3300005364 Bacteria 1956
35 Ga0070673_101467808 3300005364 Bacteria 643
36 Ga0070688_100982178 3300005365 Bacteria 670
37 Ga0070659_100159506 3300005366 Bacteria 1844
38 Ga0070659_100172418 3300005366 Bacteria 1773
39 Ga0070659_100218186 3300005366 Bacteria 1573
40 Ga0070659_100242989 3300005366 Bacteria 1490
41 Ga0070659_101422310 3300005366 Bacteria 617
42 Ga0070667_100741837 3300005367 Bacteria 910
43 Ga0070667_101582433 3300005367 Bacteria 616
44 Ga0070709_10023329 3300005434 Bacteria 3630
45 Ga0070709_10073035 3300005434 Bacteria 2220
46 Ga0070714_100042125 3300005435 Bacteria 3856
47 Ga0070714_100157305 3300005435 Bacteria 2053
48 Ga0070714_101121316 3300005435 Bacteria 767
49 Ga0070713_100002836 3300005436 Bacteria 11341
50 Ga0070713_100031026 3300005436 Bacteria 4252
51 Ga0070713_100063352 3300005436 Bacteria 3099
52 Ga0070710_10000933 3300005437 Bacteria 13902
53 Ga0070710_10030040 3300005437 Bacteria 2921
54 Ga0070701_10143854 3300005438 Bacteria 1367
55 Ga0070711_100016753 3300005439 Bacteria 4658
56 Ga0070711_100102989 3300005439 Bacteria 2080
57 Ga0070711_100185301 3300005439 Bacteria 1595
58 Ga0070711_100317394 3300005439 Bacteria 1244
59 Ga0070711_100558258 3300005439 Bacteria 951
60 Ga0070711_101947039 3300005439 Bacteria 517
61 Ga0070705_100506717 3300005440 Bacteria 917
62 Ga0070700_100893457 3300005441 Bacteria 723
63 Ga0070708_100539136 3300005445 Bacteria 1101
64 Ga0070663_100016039 3300005455 Bacteria 4852
65 Ga0070663_100050610 3300005455 Bacteria 2956
66 Ga0070663_100334579 3300005455 Bacteria 1221
67 Ga0070663_100386757 3300005455 Bacteria 1140
68 Ga0070678_100066664 3300005456 Bacteria 2677
69 Ga0070678_100192514 3300005456 Bacteria 1677
70 Ga0070662_100197923 3300005457 Bacteria 1593
71 Ga0070662_100397645 3300005457 Bacteria 1136
72 Ga0070662_100711961 3300005457 Bacteria 850
73 Ga0070681_10013875 3300005458 Bacteria 8019
74 Ga0070681_10044746 3300005458 Bacteria 4431
75 Ga0070681_10075021 3300005458 Bacteria 3342
76 Ga0070681_10109202 3300005458 Bacteria 2706
77 Ga0070681_10482263 3300005458 Bacteria 1153
78 Ga0070681_10748817 3300005458 Bacteria 894
79 Ga0070681_11053154 3300005458 Bacteria 734
80 Ga0068867_100618778 3300005459 Bacteria 946
81 Ga0070698_100136725 3300005471 Bacteria 2404
82 Ga0070698_101561736 3300005471 Bacteria 612
83 Ga0070699_101415470 3300005518 Bacteria 638
84 Ga0070679_100006191 3300005530 Bacteria 11141
85 Ga0070679_100044706 3300005530 Bacteria 4412
86 Ga0070679_100055570 3300005530 Bacteria 3942
87 Ga0070679_100123421 3300005530 Bacteria 2573
88 Ga0070679_100142594 3300005530 Bacteria 2374
89 Ga0070679_100607748 3300005530 Bacteria 1037
90 Ga0070684_100013415 3300005535 Bacteria 6606
91 Ga0070684_100072576 3300005535 Bacteria 3030
92 Ga0070684_100262869 3300005535 Bacteria 1579
93 Ga0070684_101840348 3300005535 Bacteria 571
94 Ga0070697_100038617 3300005536 Bacteria 3858
95 Ga0070697_100043484 3300005536 Bacteria 3638
96 Ga0070697_100379741 3300005536 Bacteria 1224
97 Ga0068853_100013651 3300005539 Bacteria 6637
98 Ga0068853_100013662 3300005539 Bacteria 6635
99 Ga0068853_100055331 3300005539 Bacteria 3420
100 Ga0068853_100108774 3300005539 Bacteria 2460
101 Ga0068853_100196930 3300005539 Bacteria 1832
102 Ga0068853_100346712 3300005539 Bacteria 1381
103 Ga0068853_100503458 3300005539 Bacteria 1144
104 Ga0068853_100642569 3300005539 Bacteria 1009
105 Ga0070695_100020357 3300005545 Bacteria 4050
106 Ga0070695_100189578 3300005545 Bacteria 1462
107 Ga0070695_100605293 3300005545 Bacteria 861
108 Ga0070695_100855836 3300005545 Bacteria 732
109 Ga0070693_100127834 3300005547 Bacteria 1584
110 Ga0070693_100167943 3300005547 Bacteria 1403
111 Ga0070665_100086794 3300005548 Bacteria 3134
112 Ga0070665_100287823 3300005548 Bacteria 1645
113 Ga0070665_101579763 3300005548 Bacteria 664
114 Ga0070704_100008485 3300005549 Bacteria 6165
115 Ga0070704_100289844 3300005549 Bacteria 1360
116 Ga0068855_100015735 3300005563 Bacteria 9100
117 Ga0068855_100071280 3300005563 Bacteria 4041
118 Ga0068855_100081934 3300005563 Bacteria 3740
119 Ga0068855_100117221 3300005563 Bacteria 3051
120 Ga0068855_100128245 3300005563 Bacteria 2899
121 Ga0068855_100131157 3300005563 Bacteria 2862
122 Ga0068855_100163677 3300005563 Bacteria 2523
123 Ga0068855_100274313 3300005563 Bacteria 1874
124 Ga0068855_100452624 3300005563 Bacteria 1400
125 Ga0068855_100675651 3300005563 Bacteria 1107
126 Ga0070664_100151452 3300005564 Bacteria 2048
127 Ga0070664_100326781 3300005564 Bacteria 1391
128 Ga0070664_100360971 3300005564 Bacteria 1323
129 Ga0068857_100020118 3300005577 Bacteria 5867
130 Ga0068857_100042050 3300005577 Bacteria 4053
131 Ga0068857_100042440 3300005577 Bacteria 4035
132 Ga0068857_100057180 3300005577 Bacteria 3462
133 Ga0068857_100061246 3300005577 Bacteria 3343
134 Ga0068854_100009074 3300005578 Bacteria 6409
135 Ga0068854_100096172 3300005578 Bacteria 2212
136 Ga0068854_100098929 3300005578 Bacteria 2184
137 Ga0068854_100517428 3300005578 Bacteria 1007
138 Ga0068854_101554221 3300005578 Bacteria 602
139 Ga0068854_102097539 3300005578 Bacteria 522
140 Ga0068856_100000217 3300005614 Bacteria 61831
141 Ga0068856_100003953 3300005614 Bacteria 14841
142 Ga0068856_100084670 3300005614 Bacteria 3150
143 Ga0068856_100171502 3300005614 Bacteria 2182
144 Ga0068856_100991027 3300005614 Bacteria 859
145 Ga0068856_101835309 3300005614 Bacteria 618
146 Ga0070702_100144460 3300005615 Bacteria 1519
147 Ga0068852_100009784 3300005616 Bacteria 7127
148 Ga0068852_100023356 3300005616 Bacteria 4976
149 Ga0068852_100046151 3300005616 Bacteria 3711
150 Ga0068852_100057125 3300005616 Bacteria 3375
151 Ga0068852_100309219 3300005616 Bacteria 1532
152 Ga0068859_101490472 3300005617 Bacteria 746
153 Ga0068864_100024784 3300005618 Bacteria 5047
154 Ga0068864_100086389 3300005618 Bacteria 2759
155 Ga0068864_101883275 3300005618 Bacteria 604
156 Ga0068861_100376017 3300005719 Bacteria 1253
157 Ga0068851_10001080 3300005834 Bacteria 11820
158 Ga0068851_10007939 3300005834 Bacteria 4893
159 Ga0068851_10494069 3300005834 Bacteria 733
160 Ga0068870_10231807 3300005840 Bacteria 1136
161 Ga0068863_100034349 3300005841 Bacteria 4831
162 Ga0068858_100113683 3300005842 Bacteria 2528
163 Ga0068858_101461469 3300005842 Bacteria 674
164 Ga0068860_100573107 3300005843 Bacteria 1132
165 Ga0068862_100366826 3300005844 Bacteria 1339
166 Ga0068862_100382220 3300005844 Bacteria 1313
167 Ga0068862_101124203 3300005844 Bacteria 781
168 Ga0081455_10006836 3300005937 Bacteria 12152
169 Ga0081540_1002541 3300005983 Bacteria 14800
170 Ga0081540_1010845 3300005983 Bacteria 6125
171 Ga0081540_1058985 3300005983 Bacteria 1845
172 Ga0070717_10000851 3300006028 Bacteria 20235
173 Ga0070717_10002091 3300006028 Bacteria 13991
174 Ga0070717_10486552 3300006028 Bacteria 1114
175 Ga0075365_10001178 3300006038 Bacteria 11489
176 Ga0075365_10047222 3300006038 Bacteria 2829
177 Ga0075365_10065154 3300006038 Bacteria 2441
178 Ga0075365_10287239 3300006038 Bacteria 1157
179 Ga0075365_10444706 3300006038 Bacteria 915
180 Ga0075368_10019165 3300006042 Bacteria 2581
181 Ga0075363_100030294 3300006048 Bacteria 2800
182 Ga0075363_100200181 3300006048 Bacteria 1141
183 Ga0075363_100607542 3300006048 Bacteria 656
184 Ga0075364_10065790 3300006051 Bacteria 2380
185 Ga0075364_10084281 3300006051 Bacteria 2104
186 Ga0075364_10167889 3300006051 Bacteria 1483
187 Ga0070715_10004429 3300006163 Bacteria 4608
188 Ga0070716_100010202 3300006173 Bacteria 4706
189 Ga0070716_100074228 3300006173 Bacteria 2009
190 Ga0070716_100181662 3300006173 Bacteria 1382
191 Ga0070712_101548153 3300006175 Bacteria 580
192 Ga0070712_102033410 3300006175 Bacteria 503
193 Ga0075362_10103282 3300006177 Bacteria 1335
194 Ga0075362_10627797 3300006177 Bacteria 557
195 Ga0075367_10014213 3300006178 Bacteria 4304
196 Ga0075367_10053655 3300006178 Bacteria 2389
197 Ga0075367_10115824 3300006178 Bacteria 1648
198 Ga0075367_10553360 3300006178 Bacteria 731
199 Ga0075369_10074750 3300006186 Bacteria 1495
200 Ga0075369_10471773 3300006186 Bacteria 595
201 Ga0097621_100214525 3300006237 Bacteria 1675
202 Ga0097621_100220989 3300006237 Bacteria 1651
203 Ga0097621_100804800 3300006237 Bacteria 871
204 Ga0075370_10137360 3300006353 Bacteria 1428
205 Ga0068871_100793340 3300006358 Bacteria 872
206 Ga0075433_10411595 3300006852 Bacteria 1193
207 Ga0075434_100011681 3300006871 Bacteria 8294
208 Ga0075434_100125946 3300006871 Bacteria 2579
209 Ga0075429_101013421 3300006880 Bacteria 726
210 Ga0075429_101542139 3300006880 Bacteria 578
211 Ga0075436_100032312 3300006914 Bacteria 3607
212 Ga0097620_101490507 3300006931 Bacteria 746
213 Ga0075435_100044739 3300007076 Bacteria 3547
214 Ga0075435_100087178 3300007076 Bacteria 2571
215 Ga0075435_100214341 3300007076 Bacteria 1634
216 Ga0099794_10008914 3300007265 Bacteria 4183
217 Ga0099794_10030714 3300007265 Bacteria 2511
218 Ga0099794_10136813 3300007265 Bacteria 1239
219 Ga0099794_10160171 3300007265 Bacteria 1145
220 Ga0099795_10034354 3300007788 Bacteria 1766
221 Ga0099795_10117919 3300007788 Bacteria 1058
222 Ga0105250_10176393 3300009092 Bacteria 896
223 Ga0105240_10005613 3300009093 Bacteria 18626
224 Ga0105240_10016416 3300009093 Bacteria 10025
225 Ga0105240_10099064 3300009093 Bacteria 3548
226 Ga0105240_10124519 3300009093 Bacteria 3099
227 Ga0105240_10654067 3300009093 Bacteria 1151
228 Ga0105240_11357771 3300009093 Bacteria 748
229 Ga0111539_11892877 3300009094 Bacteria 692
230 Ga0105245_10070474 3300009098 Bacteria 3172
231 Ga0105245_10484188 3300009098 Bacteria 1251
232 Ga0105245_10929987 3300009098 Bacteria 912
233 Ga0105247_10118533 3300009101 Bacteria 1712
234 Ga0105247_10422074 3300009101 Bacteria 955
235 Ga0105247_10604256 3300009101 Bacteria 814
236 Ga0105243_10445796 3300009148 Bacteria 1213
237 Ga0105243_10541592 3300009148 Bacteria 1110
238 Ga0105243_11006571 3300009148 Bacteria 836
239 Ga0105241_10002158 3300009174 Bacteria 14829
240 Ga0105241_10040893 3300009174 Bacteria 3501
241 Ga0105241_10064090 3300009174 Bacteria 2837
242 Ga0105241_10096656 3300009174 Bacteria 2340
243 Ga0105241_10274619 3300009174 Bacteria 1437
244 Ga0105241_10592683 3300009174 Bacteria 1000
245 Ga0105242_11741590 3300009176 Bacteria 660
246 Ga0105248_10020941 3300009177 Bacteria 7247
247 Ga0105237_10019705 3300009545 Bacteria 6964
248 Ga0105237_10048626 3300009545 Bacteria 4263
249 Ga0105237_10102579 3300009545 Bacteria 2852
250 Ga0105237_10354544 3300009545 Bacteria 1471
251 Ga0105237_10459415 3300009545 Bacteria 1279
252 Ga0105237_10632851 3300009545 Bacteria 1077
253 Ga0105237_10783784 3300009545 Bacteria 960
254 Ga0105238_10020302 3300009551 Bacteria 6763
255 Ga0105238_10054925 3300009551 Bacteria 3999
256 Ga0105238_10076860 3300009551 Bacteria 3331
257 Ga0105238_10099537 3300009551 Bacteria 2890
258 Ga0105238_10131256 3300009551 Bacteria 2483
259 Ga0105238_10438766 3300009551 Bacteria 1302
260 Ga0105238_10452935 3300009551 Bacteria 1280
261 Ga0105238_11480337 3300009551 Bacteria 707
262 Ga0105249_10002531 3300009553 Bacteria 15819
263 Ga0105249_11935997 3300009553 Bacteria 662
264 Ga0099796_10015444 3300010159 Bacteria 2232
265 Ga0099796_10067998 3300010159 Bacteria 1279
266 Ga0105239_10038407 3300010375 Bacteria 5247
267 Ga0105239_10075551 3300010375 Bacteria 3705
268 Ga0105239_10325222 3300010375 Bacteria 1734
269 Ga0105239_10385430 3300010375 Bacteria 1585
270 Ga0105239_11096518 3300010375 Bacteria 916
271 Ga0105239_11662826 3300010375 Bacteria 739
272 Ga0105246_10130517 3300011119 Bacteria 1876
273 Ga0105246_10214800 3300011119 Bacteria 1504
274 Ga0157373_10012448 3300013100 Bacteria 6253
275 Ga0157373_10460675 3300013100 Bacteria 916
276 Ga0157371_11128816 3300013102 Bacteria 602
277 Ga0157370_10014857 3300013104 Bacteria 7945
278 Ga0157370_10059963 3300013104 Bacteria 3614
279 Ga0157370_10270395 3300013104 Bacteria 1570
280 Ga0157370_11872048 3300013104 Bacteria 538
281 Ga0157369_10048194 3300013105 Bacteria 4623
282 Ga0157369_10078520 3300013105 Bacteria 3536
283 Ga0157369_10379284 3300013105 Bacteria 1468
284 Ga0157369_11527992 3300013105 Bacteria 679
285 Ga0157374_10318448 3300013296 Bacteria 1541
286 Ga0157374_10532013 3300013296 Bacteria 1182
287 Ga0157374_10633030 3300013296 Bacteria 1081
288 Ga0157378_10010055 3300013297 Bacteria 8245
289 Ga0157378_10144697 3300013297 Bacteria 2210
290 Ga0157378_10147673 3300013297 Bacteria 2188
291 Ga0163162_10038417 3300013306 Bacteria 4777
292 Ga0163162_10086558 3300013306 Bacteria 3211
293 Ga0163162_10455510 3300013306 Bacteria 1411
294 Ga0157372_10004565 3300013307 Bacteria 14741
295 Ga0157372_10533060 3300013307 Bacteria 1369
296 Ga0157372_10679728 3300013307 Bacteria 1198
297 Ga0157372_11290869 3300013307 Bacteria 842
298 Ga0157375_10405941 3300013308 Bacteria 1529
299 Ga0157375_11032767 3300013308 Bacteria 960
300 Ga0157375_11116547 3300013308 Bacteria 923
301 Ga0163163_10058281 3300014325 Bacteria 3818
302 Ga0182008_10254125 3300014497 Bacteria 907
303 Ga0157377_10102115 3300014745 Bacteria 1710
304 Ga0157379_10162863 3300014968 Bacteria 2013
305 Ga0157379_10223506 3300014968 Bacteria 1706
306 Ga0206356_10162217 3300020070 Bacteria 749
307 Ga0213874_10018729 3300021377 Bacteria 1875
308 Ga0209233_1011817 3300025261 Bacteria 2561
309 Ga0209758_1015056 3300025297 Bacteria 4041
310 Ga0207697_10068025 3300025315 Bacteria 1489
311 Ga0207697_10076668 3300025315 Bacteria 1405
312 Ga0207656_10004848 3300025321 Bacteria 4723
313 Ga0207656_10008610 3300025321 Bacteria 3761
314 Ga0207653_10064430 3300025885 Bacteria 1242
315 Ga0207692_10002049 3300025898 Bacteria 7694
316 Ga0207692_10025941 3300025898 Bacteria 2745
317 Ga0207642_10856937 3300025899 Bacteria 580
318 Ga0207710_10021793 3300025900 Bacteria 2749
319 Ga0207710_10368135 3300025900 Bacteria 734
320 Ga0207688_10152574 3300025901 Bacteria 1365
321 Ga0207680_10672501 3300025903 Bacteria 742
322 Ga0207647_10060817 3300025904 Bacteria 2308
323 Ga0207647_10222495 3300025904 Bacteria 1087
324 Ga0207647_10390757 3300025904 Bacteria 784
325 Ga0207685_10108629 3300025905 Bacteria 1199
326 Ga0207699_10004105 3300025906 Bacteria 6976
327 Ga0207699_10704524 3300025906 Bacteria 739
328 Ga0207699_11138615 3300025906 Bacteria 578
329 Ga0207645_10264630 3300025907 Bacteria 1139
330 Ga0207645_10416669 3300025907 Bacteria 904
331 Ga0207643_10050095 3300025908 Bacteria 2368
332 Ga0207705_10048396 3300025909 Bacteria 3058
333 Ga0207705_10123978 3300025909 Bacteria 1919
334 Ga0207684_10767755 3300025910 Bacteria 816
335 Ga0207654_10000358 3300025911 Bacteria 26923
336 Ga0207654_10003362 3300025911 Bacteria 8100
337 Ga0207654_10057787 3300025911 Bacteria 2256
338 Ga0207654_10212208 3300025911 Bacteria 1280
339 Ga0207707_10000183 3300025912 Bacteria 65793
340 Ga0207707_10021814 3300025912 Bacteria 5597
341 Ga0207707_10062133 3300025912 Bacteria 3250
342 Ga0207707_10322129 3300025912 Bacteria 1334
343 Ga0207707_11119159 3300025912 Bacteria 641
344 Ga0207695_10002150 3300025913 Bacteria 29851
345 Ga0207695_10092385 3300025913 Bacteria 3037
346 Ga0207695_10425958 3300025913 Bacteria 1211
347 Ga0207671_10178937 3300025914 Bacteria 1650
348 Ga0207671_10188167 3300025914 Bacteria 1609
349 Ga0207671_10234716 3300025914 Bacteria 1440
350 Ga0207671_10443051 3300025914 Bacteria 1034
351 Ga0207671_10982847 3300025914 Bacteria 665
352 Ga0207693_10000269 3300025915 Bacteria 47979
353 Ga0207693_11275601 3300025915 Bacteria 551
354 Ga0207663_10000096 3300025916 Bacteria 41229
355 Ga0207663_10236845 3300025916 Bacteria 1336
356 Ga0207660_10023670 3300025917 Bacteria 4150
357 Ga0207660_10069162 3300025917 Bacteria 2563
358 Ga0207660_10096617 3300025917 Bacteria 2200
359 Ga0207660_10479831 3300025917 Bacteria 1007
360 Ga0207660_10729217 3300025917 Bacteria 809
361 Ga0207657_10001382 3300025919 Bacteria 25893
362 Ga0207657_10006462 3300025919 Bacteria 12146
363 Ga0207649_10222504 3300025920 Bacteria 1345
364 Ga0207649_10459160 3300025920 Bacteria 963
365 Ga0207652_10020826 3300025921 Bacteria 5406
366 Ga0207652_10038444 3300025921 Bacteria 4057
367 Ga0207652_10059768 3300025921 Bacteria 3286
368 Ga0207652_10077512 3300025921 Bacteria 2900
369 Ga0207652_10088398 3300025921 Bacteria 2719
370 Ga0207652_10124322 3300025921 Bacteria 2297
371 Ga0207652_10171088 3300025921 Bacteria 1949
372 Ga0207652_11077526 3300025921 Bacteria 704
373 Ga0207681_10225047 3300025923 Bacteria 1453
374 Ga0207694_10000491 3300025924 Bacteria 35820
375 Ga0207694_10025960 3300025924 Bacteria 4454
376 Ga0207694_10090730 3300025924 Bacteria 2411
377 Ga0207694_10111406 3300025924 Bacteria 2177
378 Ga0207694_11078741 3300025924 Bacteria 680
379 Ga0207687_10106524 3300025927 Bacteria 2073
380 Ga0207687_10385792 3300025927 Bacteria 1149
381 Ga0207700_10030762 3300025928 Bacteria 3806
382 Ga0207664_10202826 3300025929 Bacteria 1713
383 Ga0207664_10368328 3300025929 Bacteria 1274
384 Ga0207644_10200635 3300025931 Bacteria 1573
385 Ga0207644_10329652 3300025931 Bacteria 1236
386 Ga0207644_10671596 3300025931 Bacteria 863
387 Ga0207690_10046304 3300025932 Bacteria 2880
388 Ga0207690_10100023 3300025932 Bacteria 2068
389 Ga0207690_10230175 3300025932 Bacteria 1422
390 Ga0207706_10050870 3300025933 Bacteria 3660
391 Ga0207706_10217014 3300025933 Bacteria 1676
392 Ga0207686_10779655 3300025934 Bacteria 765
393 Ga0207709_10087617 3300025935 Bacteria 2024
394 Ga0207709_10222826 3300025935 Bacteria 1361
395 Ga0207709_10653648 3300025935 Bacteria 837
396 Ga0207669_10478619 3300025937 Bacteria 992
397 Ga0207704_10820670 3300025938 Bacteria 778
398 Ga0207665_10000104 3300025939 Bacteria 55188
399 Ga0207665_10019587 3300025939 Bacteria 4449
400 Ga0207665_10048415 3300025939 Bacteria 2853
401 Ga0207691_10512795 3300025940 Bacteria 1018
402 Ga0207711_10028374 3300025941 Bacteria 4709
403 Ga0207689_10115421 3300025942 Bacteria 2207
404 Ga0207661_10039177 3300025944 Bacteria 3718
405 Ga0207661_10113555 3300025944 Bacteria 2295
406 Ga0207661_10813694 3300025944 Bacteria 860
407 Ga0207661_10949270 3300025944 Bacteria 792
408 Ga0207679_10058092 3300025945 Bacteria 2864
409 Ga0207679_10320714 3300025945 Bacteria 1341
410 Ga0207679_10347950 3300025945 Bacteria 1291
411 Ga0207679_10421523 3300025945 Bacteria 1178
412 Ga0207679_10630265 3300025945 Bacteria 968
413 Ga0207667_10032720 3300025949 Bacteria 5598
414 Ga0207667_10041172 3300025949 Bacteria 4915
415 Ga0207667_10060913 3300025949 Bacteria 3950
416 Ga0207667_10081604 3300025949 Bacteria 3350
417 Ga0207667_10111120 3300025949 Bacteria 2827
418 Ga0207667_10204620 3300025949 Bacteria 2024
419 Ga0207667_10365346 3300025949 Bacteria 1471
420 Ga0207651_11066868 3300025960 Bacteria 723
421 Ga0207651_11096735 3300025960 Bacteria 713
422 Ga0207712_10033358 3300025961 Bacteria 3480
423 Ga0207668_10056922 3300025972 Bacteria 2725
424 Ga0207668_11440105 3300025972 Bacteria 621
425 Ga0207640_10059871 3300025981 Bacteria 2515
426 Ga0207640_10229976 3300025981 Bacteria 1426
427 Ga0207640_10583733 3300025981 Bacteria 944
428 Ga0207640_10735439 3300025981 Bacteria 849
429 Ga0207658_10646311 3300025986 Bacteria 953
430 Ga0207658_11214743 3300025986 Bacteria 689
431 Ga0207677_10058951 3300026023 Bacteria 2646
432 Ga0207703_10042864 3300026035 Bacteria 3630
433 Ga0207639_10016671 3300026041 Bacteria 5203
434 Ga0207639_10052074 3300026041 Bacteria 3117
435 Ga0207639_10084236 3300026041 Bacteria 2525
436 Ga0207639_10282221 3300026041 Bacteria 1461
437 Ga0207639_10353301 3300026041 Bacteria 1313
438 Ga0207639_10947955 3300026041 Bacteria 805
439 Ga0207639_11123800 3300026041 Bacteria 737
440 Ga0207678_10049171 3300026067 Bacteria 3644
441 Ga0207678_10086523 3300026067 Bacteria 2678
442 Ga0207678_10422840 3300026067 Bacteria 1155
443 Ga0207708_10958335 3300026075 Bacteria 742
444 Ga0207702_10000003 3300026078 Bacteria 434196
445 Ga0207702_10001581 3300026078 Bacteria 22550
446 Ga0207702_10449499 3300026078 Bacteria 1250
447 Ga0207702_10706647 3300026078 Bacteria 994
448 Ga0207702_10710806 3300026078 Bacteria 991
449 Ga0207702_11540266 3300026078 Bacteria 658
450 Ga0207641_10048178 3300026088 Bacteria 3596
451 Ga0207641_12419811 3300026088 Bacteria 524
452 Ga0207648_10318615 3300026089 Bacteria 1397
453 Ga0207676_10121531 3300026095 Bacteria 2203
454 Ga0207676_10212243 3300026095 Bacteria 1718
455 Ga0207674_10010369 3300026116 Bacteria 10561
456 Ga0207674_10013847 3300026116 Bacteria 8924
457 Ga0207674_10026698 3300026116 Bacteria 6126
458 Ga0207674_10043409 3300026116 Bacteria 4636
459 Ga0207674_10074949 3300026116 Bacteria 3394
460 Ga0207674_10130613 3300026116 Bacteria 2475
461 Ga0207675_100134494 3300026118 Bacteria 2345
462 Ga0207683_10078559 3300026121 Bacteria 2924
463 Ga0207683_10256196 3300026121 Bacteria 1597
464 Ga0207683_10379938 3300026121 Bacteria 1298
465 Ga0207698_10017298 3300026142 Bacteria 4888
466 Ga0207698_10021472 3300026142 Bacteria 4466
467 Ga0207698_10051950 3300026142 Bacteria 3137
468 Ga0207698_10054092 3300026142 Bacteria 3086
469 Ga0207698_10300379 3300026142 Bacteria 1494
470 Ga0207698_11739866 3300026142 Bacteria 639
471 Ga0209179_1004354 3300027512 Bacteria 2129
472 Ga0209588_1007193 3300027671 Bacteria 3265
473 Ga0209813_10034886 3300027866 Bacteria 1504
474 Ga0209813_10053603 3300027866 Bacteria 1268
475 Ga0209813_10060064 3300027866 Bacteria 1212
476 Ga0268266_10040140 3300028379 Bacteria 3988
477 Ga0268265_10113824 3300028380 Bacteria 2214
478 Ga0268265_11059051 3300028380 Bacteria 803
479 Ga0268264_10338604 3300028381 Bacteria 1428
480 Ga0268264_11868550 3300028381 Bacteria 610
481 Ga0307515_10370212 3300028794 Bacteria 1070
482 Ga0307512_10165615 3300030522 Bacteria 1282
483 Ga0265762_1021234 3300030760 Bacteria 1196
484 Ga0265763_1039418 3300030763 Bacteria 565
485 Ga0265332_10220541 3300031238 Bacteria 787
486 Ga0265331_10006331 3300031250 Bacteria 7009
487 Ga0265316_10498635 3300031344 Bacteria 870
488 Ga0307513_10242857 3300031456 Bacteria 1604
489 Ga0307509_10371502 3300031507 Bacteria 1146
490 Ga0307408_100113900 3300031548 Bacteria 2082
491 Ga0307508_10097824 3300031616 Bacteria 2527
492 Ga0265314_10155411 3300031711 Bacteria 1397
493 Ga0265342_10002958 3300031712 Bacteria 14291
494 Ga0307516_10192735 3300031730 Bacteria 1763
495 Ga0307406_10500803 3300031901 Bacteria 985
496 Ga0307412_10722316 3300031911 Bacteria 857
497 Ga0307412_10970404 3300031911 Bacteria 749
498 Ga0307415_100162761 3300032126 Bacteria 1731
499 Ga0307510_10036728 3300033180 Bacteria 5450
500 Ga0307510_10229328 3300033180 Bacteria 1361
501 Ga0315911_1000004 3300033442 Bacteria 472637
502 Ga0373926_0009290 3300035083 Bacteria 3283
503 Ga0373934_0068318 3300035086 Bacteria 1420
504 Ga0373944_0009603 3300035089 Bacteria 2627
505 Ga0373923_0042643 3300035111 Bacteria 1875
506 Ga0373923_0046874 3300035111 Bacteria 1799
507 Ga0373936_0017300 3300035113 Bacteria 2775
508 Ga0373936_0037042 3300035113 Bacteria 1947
509 Ga0373939_0541396 3300035114 Bacteria 502
510 Ga0373945_0148279 3300035116 Bacteria 949
511 Ga0373945_0255021 3300035116 Bacteria 742
512 Ga0373953_0047024 3300035117 Bacteria 1735
513 Ga0373953_0064513 3300035117 Bacteria 1502
514 Ga0373954_0056287 3300035118 Bacteria 1850
515 Ga0373954_0103943 3300035118 Bacteria 1371
516 Ga0373954_0621327 3300035118 Bacteria 536
517 Ga0373956_0015097 3300035119 Bacteria 3230
518 Ga0373957_0058898 3300035120 Bacteria 1484
519 Ga0373957_0231513 3300035120 Bacteria 775
520 Ga0373943_0043404 3300035170 Bacteria 2183
521 Ga0373946_0043799 3300035171 Bacteria 1845
522 Ga0373946_0139035 3300035171 Bacteria 1124
523 Ga0373955_0024852 3300035172 Bacteria 3068
524 Ga0373955_0033080 3300035172 Bacteria 2720
525 Ga0373955_0057334 3300035172 Bacteria 2140
526 Ga0373924_0031722 3300035410 Bacteria 2126
527 Ga0373924_0112886 3300035410 Bacteria 1175
528 Ga0373931_0031876 3300035691 Bacteria 2724
529 Ga0373935_0000493 3300035692 Bacteria 20439
530 Ga0373935_0007392 3300035692 Bacteria 6572
531 Ga0373935_0040922 3300035692 Bacteria 2910
532 Ga0373927_0000331 3300035695 Bacteria 37139
533 Ga0373927_0012394 3300035695 Bacteria 5675
534 Ga0373927_0819604 3300035695 Bacteria 614
535 Ga0373933_0000272 3300035724 Bacteria 33654
536 Ga0373933_0038006 3300035724 Bacteria 2827
537 Ga0373933_0393415 3300035724 Bacteria 903
538 Ga0373947_0002830 3300035725 Bacteria 10355
539 Ga0373947_0021069 3300035725 Bacteria 3771
540 Ga0373947_0076095 3300035725 Bacteria 2068
541 Ga0373937_0008766 3300036401 Bacteria 8778
542 Ga0373937_0042265 3300036401 Bacteria 4157
543 Ga0373937_0071845 3300036401 Bacteria 3191
544 Ga0373937_0276180 3300036401 Bacteria 1586
545 Ga0373937_1266934 3300036401 Bacteria 685
546 Ga0373925_0004263 3300037068 Bacteria 10834
547 Ga0373925_0182984 3300037068 Bacteria 1660
548 Ga0373925_0222747 3300037068 Bacteria 1506
549 Ga0373925_0421026 3300037068 Bacteria 1091
550 Ga0395900_0166816 3300037418 Bacteria 2244
551 Ga0395898_0146205 3300037466 Bacteria 2262
552 Ga0395898_0166907 3300037466 Bacteria 2105
553 Ga0395905_0505853 3300037471 Bacteria 1108
554 Ga0395905_0675452 3300037471 Bacteria 935
555 Ga0395901_0470988 3300038443 Bacteria 1282
556 Ga0395901_0941018 3300038443 Bacteria 843
557 Ga0436365_0781961 3300039437 Bacteria 572
558 Ga0436365_1855944 3300039437 Bacteria 1329
559 Ga0436361_0297606 3300039447 Bacteria 903
560 Ga0436363_0863724 3300039450 Bacteria 1366
561 Ga0436363_0991916 3300039450 Bacteria 2051
562 Ga0436363_1655123 3300039450 Bacteria 900
563 Ga0451789_0114694 3300041443 Bacteria 715
564 Ga0451797_0871558 3300041453 Bacteria 933
565 Ga0451807_0093477 3300041486 Bacteria 1012
566 Ga0451835_0260168 3300041492 Bacteria 778
567 Ga0439458_0009740 3300042157 Bacteria 2140
568 Ga0466969_0197166 3300044656 Bacteria 919
569 Ga0466965_0138651 3300044683 Bacteria 1265
570 Ga0466966_0553481 3300044684 Bacteria 692
571 Ga0466964_0067938 3300044706 Bacteria 1500
572 Ga0466971_0153010 3300044719 Bacteria 1077
573 Ga0466968_0395778 3300044735 Bacteria 677
574 Ga0466959_0013030 3300045049 Bacteria 6021
575 Ga0466959_0042527 3300045049 Bacteria 3351
576 Ga0466967_0141055 3300045976 Bacteria 2245
577 Ga0466967_0165418 3300045976 Bacteria 2078
578 Ga0466967_0605290 3300045976 Bacteria 1082
579 Ga0495617_122277 3300046452 Bacteria 838
580 Ga0495627_087526 3300046453 Bacteria 898
581 Ga0495592_0006330 3300046454 Bacteria 8813
582 Ga0495592_0021816 3300046454 Bacteria 4872
583 Ga0495603_0000643 3300046455 Bacteria 19657
584 Ga0495603_0037079 3300046455 Bacteria 2925
585 Ga0495603_0037349 3300046455 Bacteria 2914
586 Ga0495603_0037582 3300046455 Bacteria 2905
587 Ga0495603_0199261 3300046455 Bacteria 1157
588 Ga0495603_0371880 3300046455 Bacteria 820
589 Ga0495629_0000423 3300046459 Bacteria 35258
590 Ga0495629_0067609 3300046459 Bacteria 2493
591 Ga0495629_0179129 3300046459 Bacteria 1469
592 Ga0495629_0558886 3300046459 Bacteria 768
593 Ga0495641_0003178 3300046461 Bacteria 12492
594 Ga0495651_0030654 3300046462 Bacteria 4194
595 Ga0495651_0089382 3300046462 Bacteria 2312
596 Ga0495653_0047134 3300046463 Bacteria 3335
597 Ga0495653_0170875 3300046463 Bacteria 1500
598 Ga0495650_0068980 3300046471 Bacteria 1393
599 Ga0495580_0001799 3300046472 Bacteria 18843
600 Ga0495580_0002433 3300046472 Bacteria 16271
601 Ga0495582_0000166 3300046473 Bacteria 35616
602 Ga0495605_0321293 3300046474 Bacteria 652
603 Ga0495605_0431742 3300046474 Bacteria 544
604 Ga0495639_0000306 3300046475 Bacteria 23854
605 Ga0495639_0024678 3300046475 Bacteria 2647
606 Ga0495639_0084506 3300046475 Bacteria 1482
607 Ga0495662_0019982 3300046476 Bacteria 3240
608 Ga0495662_0093108 3300046476 Bacteria 1471
609 Ga0495664_0002707 3300046477 Bacteria 9527
610 Ga0495664_0005452 3300046477 Bacteria 6986
611 Ga0495664_0091326 3300046477 Bacteria 1830
612 Ga0495664_0091908 3300046477 Bacteria 1825
613 Ga0495664_0149781 3300046477 Bacteria 1415
614 Ga0495664_0450544 3300046477 Bacteria 771
615 Ga0495584_0018933 3300046491 Bacteria 3498
616 Ga0495584_0227838 3300046491 Bacteria 947
617 Ga0495584_0291975 3300046491 Bacteria 828
618 Ga0495594_0002782 3300046499 Bacteria 9074
619 Ga0495594_0075067 3300046499 Bacteria 1884
620 Ga0495594_0345256 3300046499 Bacteria 848
621 Ga0495594_0415687 3300046499 Bacteria 765
622 Ga0495606_0001165 3300046507 Bacteria 37175
623 Ga0495606_0340912 3300046507 Bacteria 798
624 Ga0495608_0082145 3300046511 Bacteria 2092
625 Ga0495608_0147841 3300046511 Bacteria 1498
626 Ga0495608_0194068 3300046511 Bacteria 1281
627 Ga0495610_0068686 3300046512 Bacteria 1660
628 Ga0495610_0342685 3300046512 Bacteria 565
629 Ga0495616_0053323 3300046513 Bacteria 2010
630 Ga0495618_0013721 3300046514 Bacteria 4931
631 Ga0495618_0166950 3300046514 Bacteria 1401
632 Ga0495628_0021914 3300046516 Bacteria 5251
633 Ga0495628_0025658 3300046516 Bacteria 4814
634 Ga0495628_0066757 3300046516 Bacteria 2811
635 Ga0495628_0516497 3300046516 Bacteria 861
636 Ga0495630_0005320 3300046517 Bacteria 9085
637 Ga0495630_0128189 3300046517 Bacteria 1926
638 Ga0495631_0036711 3300046518 Bacteria 2187
639 Ga0495632_0191378 3300046519 Bacteria 934
640 Ga0495637_0198126 3300046520 Bacteria 739
641 Ga0495643_0145063 3300046522 Bacteria 1180
642 Ga0495644_0251562 3300046523 Bacteria 686
643 Ga0495648_0146153 3300046524 Bacteria 1239
644 Ga0495663_0029997 3300046525 Bacteria 1609
645 Ga0495666_0031319 3300046526 Bacteria 2606
646 Ga0495652_0011395 3300046529 Bacteria 8040
647 Ga0495652_0138197 3300046529 Bacteria 1919
648 Ga0495652_0173019 3300046529 Bacteria 1665
649 Ga0495652_0348316 3300046529 Bacteria 1062
650 Ga0495665_0000104 3300046531 Bacteria 39624
651 Ga0495665_0056289 3300046531 Bacteria 2076
652 Ga0495640_0043096 3300046533 Bacteria 3144
653 Ga0495586_0090832 3300046535 Bacteria 1687
654 Ga0495586_0192089 3300046535 Bacteria 1156
655 Ga0495586_0287379 3300046535 Bacteria 941
656 Ga0495587_0422757 3300046536 Bacteria 739
657 Ga0495621_0235045 3300046539 Bacteria 745
658 Ga0495597_0288849 3300046542 Bacteria 638
659 Ga0495645_0014804 3300046543 Bacteria 5541
660 Ga0495645_0021320 3300046543 Bacteria 4682
661 Ga0495645_0205916 3300046543 Bacteria 1331
662 Ga0495622_0004750 3300046557 Bacteria 6291
663 Ga0495622_0033943 3300046557 Bacteria 2381
664 Ga0495622_0259627 3300046557 Bacteria 763
665 Ga0495667_0035722 3300046559 Bacteria 3320
666 Ga0495667_0089330 3300046559 Bacteria 1997
667 Ga0495667_0129327 3300046559 Bacteria 1629
668 Ga0495656_0382694 3300046615 Bacteria 733
669 Ga0495668_0023759 3300046616 Bacteria 3492
670 Ga0495668_0170843 3300046616 Bacteria 1191
671 Ga0495634_0003095 3300046642 Bacteria 13527
672 Ga0495634_0154436 3300046642 Bacteria 1449
673 Ga0495611_0045991 3300046648 Bacteria 1956
674 Ga0495611_0483152 3300046648 Bacteria 563
675 Ga0495611_0498704 3300046648 Bacteria 553
676 Ga0495635_0004351 3300046663 Bacteria 9807
677 Ga0495635_0104833 3300046663 Bacteria 1932
678 Ga0495635_0243431 3300046663 Bacteria 1213
679 Ga0495635_0560539 3300046663 Bacteria 748
680 Ga0495635_0930923 3300046663 Bacteria 555
681 Ga0495588_0006073 3300046674 Bacteria 5420
682 Ga0495588_0042080 3300046674 Bacteria 2335
683 Ga0495588_0148096 3300046674 Bacteria 1241
684 Ga0495588_0343312 3300046674 Bacteria 785
685 Ga0495657_0077257 3300046675 Bacteria 2160
686 Ga0495657_0186570 3300046675 Bacteria 1269
687 Ga0495657_0194155 3300046675 Bacteria 1240
688 Ga0495599_0034495 3300046678 Bacteria 3179
689 Ga0495599_0104592 3300046678 Bacteria 1763
690 Ga0495623_0043027 3300046679 Bacteria 2874
691 Ga0495623_0303048 3300046679 Bacteria 882
692 Ga0495623_0318098 3300046679 Bacteria 855
693 Ga0495623_0363689 3300046679 Bacteria 786
694 Ga0495646_0030478 3300046680 Bacteria 3369
695 Ga0495646_0128197 3300046680 Bacteria 1430
696 Ga0495647_0000279 3300046681 Bacteria 14215
697 Ga0495647_0067363 3300046681 Bacteria 1426
698 Ga0495647_0113762 3300046681 Bacteria 1132
699 Ga0495647_0135440 3300046681 Bacteria 1047
700 Ga0495658_0007144 3300046683 Bacteria 5518
701 Ga0495658_0016130 3300046683 Bacteria 3844
702 Ga0495669_0141250 3300046684 Bacteria 1137
703 Ga0495669_0338513 3300046684 Bacteria 727
704 Ga0495613_0006409 3300046689 Bacteria 8795
705 Ga0495613_0238783 3300046689 Bacteria 1271
706 Ga0495613_0252560 3300046689 Bacteria 1230
707 Ga0495624_0003391 3300046690 Bacteria 11822
708 Ga0495624_0033966 3300046690 Bacteria 3303
709 Ga0495671_0448985 3300046692 Bacteria 616
710 Ga0495649_0584707 3300046694 Bacteria 551
711 Ga0495600_0112015 3300046809 Bacteria 1777
712 Ga0495600_0153077 3300046809 Bacteria 1492
713 Ga0495581_0001274 3300047315 Bacteria 13870
714 Ga0495581_0201879 3300047315 Bacteria 1163
715 Ga0495581_0251889 3300047315 Bacteria 1033
716 Ga0495581_0480552 3300047315 Bacteria 723
717 Ga0495604_0265313 3300047317 Bacteria 1165
718 Ga0495636_0172175 3300047318 Bacteria 979
719 Ga0495674_0001108 3300047319 Bacteria 25886
720 Ga0495674_0099668 3300047319 Bacteria 2473
721 Ga0495674_0104773 3300047319 Bacteria 2404
722 Ga0495672_0135540 3300047320 Bacteria 1291
723 Ga0495676_0018692 3300047321 Bacteria 6112
724 Ga0495676_0340693 3300047321 Bacteria 1004
725 Ga0495680_0052972 3300047322 Bacteria 3160
726 Ga0495680_0556609 3300047322 Bacteria 772
727 Ga0495680_0705176 3300047322 Bacteria 666
728 Ga0495683_0424028 3300047323 Bacteria 549
729 Ga0495675_0056324 3300047444 Bacteria 2492
730 Ga0495675_0352082 3300047444 Bacteria 866
731 Ga0495679_116558 3300047446 Bacteria 733
732 Ga0495684_0004305 3300047471 Bacteria 11116
733 Ga0495684_0063256 3300047471 Bacteria 2813
734 Ga0495686_0112743 3300047472 Bacteria 1629
735 Ga0495686_0146519 3300047472 Bacteria 1389
736 Ga0495593_0000180 3300047673 Bacteria 32786
737 Ga0495593_0087193 3300047673 Bacteria 1609
738 Ga0495593_0161747 3300047673 Bacteria 1130
739 Ga0495602_0166728 3300048088 Bacteria 1713
740 Ga0495602_0341173 3300048088 Bacteria 1084
741 Ga0495602_0473899 3300048088 Bacteria 880
742 Ga0495602_0712355 3300048088 Bacteria 680
743 Ga0495614_0132823 3300048089 Bacteria 1102
744 Ga0495626_0089026 3300048091 Bacteria 1360
745 Ga0496100_0106485 3300048903 Bacteria 1941
746 Ga0496100_0203330 3300048903 Bacteria 1445
747 Ga0496101_0008882 3300048904 Bacteria 6580
748 Ga0496101_0182288 3300048904 Bacteria 1617
749 Ga0496101_0478768 3300048904 Bacteria 983
750 Ga0496102_0007049 3300048905 Bacteria 9593
751 Ga0496102_0208311 3300048905 Bacteria 1843
752 Ga0496102_0293655 3300048905 Bacteria 1532
753 Ga0496102_1236806 3300048905 Bacteria 666
754 Ga0496103_0088070 3300048906 Bacteria 1958
755 Ga0496103_0231341 3300048906 Bacteria 1189
756 Ga0496104_0038703 3300048907 Bacteria 4463
757 Ga0496104_0105809 3300048907 Bacteria 2696
758 Ga0496104_0888238 3300048907 Bacteria 796
759 Ga0496105_0179549 3300048908 Bacteria 1733
760 Ga0496105_0682782 3300048908 Bacteria 790
761 Ga0496106_0012499 3300048909 Bacteria 6271
762 Ga0496106_0046854 3300048909 Bacteria 3251
763 Ga0496106_0095010 3300048909 Bacteria 2305
764 Ga0496106_0440421 3300048909 Bacteria 1047
765 Ga0496106_0550105 3300048909 Bacteria 926
766 Ga0496107_0021922 3300048910 Bacteria 4513
767 Ga0496107_0131559 3300048910 Bacteria 1847
768 Ga0496107_0397140 3300048910 Bacteria 1025
769 Ga0496107_1058291 3300048910 Bacteria 587
770 Ga0496108_0003612 3300048911 Bacteria 12386
771 Ga0496108_0023293 3300048911 Bacteria 5094
772 Ga0496108_0172544 3300048911 Bacteria 1871
773 Ga0496108_0633283 3300048911 Bacteria 930
774 Ga0496109_0000166 3300048912 Bacteria 64848
775 Ga0496109_0020611 3300048912 Bacteria 5824
776 Ga0496109_0051360 3300048912 Bacteria 3755
777 Ga0496109_0573670 3300048912 Bacteria 1063
778 Ga0496109_0898071 3300048912 Bacteria 824
779 Ga0496110_0019876 3300048913 Bacteria 5661
780 Ga0496110_0033450 3300048913 Bacteria 4447
781 Ga0496110_0244401 3300048913 Bacteria 1633
782 Ga0496110_0383222 3300048913 Bacteria 1281
783 Ga0496110_0664587 3300048913 Bacteria 942
784 Ga0496110_0883901 3300048913 Bacteria 799
785 Ga0496111_0071138 3300048914 Bacteria 2532
786 Ga0496111_0092490 3300048914 Bacteria 2217
787 Ga0496111_0500419 3300048914 Bacteria 894
788 Ga0496111_0583190 3300048914 Bacteria 819
789 Ga0496112_0001913 3300048915 Bacteria 16432
790 Ga0496112_0009707 3300048915 Bacteria 8689
791 Ga0496112_0020318 3300048915 Bacteria 6292
792 Ga0496112_0053396 3300048915 Bacteria 3969
793 Ga0496112_0305009 3300048915 Bacteria 1537
794 Ga0496112_0395307 3300048915 Bacteria 1322
795 Ga0496112_1641239 3300048915 Bacteria 556
796 Ga0496113_0061810 3300048916 Bacteria 2827
797 Ga0496113_0121025 3300048916 Bacteria 2046
798 Ga0496113_0254192 3300048916 Bacteria 1403
799 Ga0496113_0460122 3300048916 Bacteria 1022
800 Ga0496114_0579553 3300048917 Bacteria 990
801 Ga0496114_0875937 3300048917 Bacteria 779
802 Ga0496115_0002825 3300048918 Bacteria 12488
803 Ga0496115_0029552 3300048918 Bacteria 4305
804 Ga0496115_0076639 3300048918 Bacteria 2718
805 Ga0496115_0120072 3300048918 Bacteria 2162
806 Ga0496115_0744133 3300048918 Bacteria 767
807 Ga0496116_0291458 3300048919 Bacteria 783
808 Ga0496117_0278837 3300048920 Bacteria 896
809 Ga0496118_0167681 3300048921 Bacteria 1347
810 Ga0496118_0312399 3300048921 Bacteria 857
811 Ga0496119_0231190 3300048922 Bacteria 941
812 Ga0496119_0538281 3300048922 Bacteria 539
813 Ga0496121_0001158 3300048924 Bacteria 46235
814 Ga0496121_0007126 3300048924 Bacteria 13567
815 Ga0496121_0091430 3300048924 Bacteria 2376
816 Ga0496121_0221411 3300048924 Bacteria 1333
817 Ga0496121_0244714 3300048924 Bacteria 1247
818 Ga0496122_0092764 3300048925 Bacteria 2051
819 Ga0496123_0052353 3300048926 Bacteria 2710
820 Ga0496124_0067834 3300048927 Bacteria 2967
821 Ga0496125_0086642 3300048928 Bacteria 2368
822 Ga0496126_0010775 3300048929 Bacteria 9547
823 Ga0496126_0032384 3300048929 Bacteria 4926
824 Ga0496126_0039916 3300048929 Bacteria 4352
825 Ga0496126_0055168 3300048929 Bacteria 3596
826 Ga0496126_0305003 3300048929 Bacteria 1312
827 Ga0496126_0368144 3300048929 Bacteria 1172
828 Ga0496126_0369924 3300048929 Bacteria 1169
829 Ga0496126_0399822 3300048929 Bacteria 1114
830 Ga0496126_0465443 3300048929 Bacteria 1015
831 Ga0495678_157074 3300049459 Bacteria 730
832 Ga0501031_0001969 3300049568 Bacteria 12970
833 Ga0501031_0045495 3300049568 Bacteria 2863
834 Ga0501031_0563012 3300049568 Bacteria 734
835 Ga0501031_0960207 3300049568 Bacteria 546
836 Ga0501032_0000088 3300049569 Bacteria 79913
837 Ga0501032_0013062 3300049569 Bacteria 5913
838 Ga0501032_0075408 3300049569 Bacteria 2246
839 Ga0501032_0080439 3300049569 Bacteria 2168
840 Ga0501032_0169164 3300049569 Bacteria 1433
841 Ga0501033_0000749 3300049570 Bacteria 29895
842 Ga0501033_0002046 3300049570 Bacteria 17530
843 Ga0501033_0038747 3300049570 Bacteria 3560
844 Ga0501033_0113529 3300049570 Bacteria 1970
845 Ga0501033_0115213 3300049570 Bacteria 1953
846 Ga0501033_0178484 3300049570 Bacteria 1523
847 Ga0501033_0276716 3300049570 Bacteria 1186
848 Ga0501033_0306343 3300049570 Bacteria 1117
849 Ga0501034_0000332 3300049571 Bacteria 82900
850 Ga0501034_0383805 3300049571 Bacteria 1329
851 Ga0501034_0389111 3300049571 Bacteria 1318
852 Ga0501034_0417586 3300049571 Bacteria 1263
853 Ga0501036_0000233 3300049572 Bacteria 37220
854 Ga0501036_0005560 3300049572 Bacteria 10225
855 Ga0501036_0015255 3300049572 Bacteria 6416
856 Ga0501036_0110617 3300049572 Bacteria 2321
857 Ga0501036_0146974 3300049572 Bacteria 1988
858 Ga0501036_0395148 3300049572 Bacteria 1153
859 Ga0501036_0668271 3300049572 Bacteria 859
860 Ga0501036_0695152 3300049572 Bacteria 840
861 Ga0501036_1016100 3300049572 Bacteria 678
862 Ga0501037_0001094 3300049573 Bacteria 20095
863 Ga0501037_0057389 3300049573 Bacteria 2843
864 Ga0501037_0059496 3300049573 Bacteria 2787
865 Ga0501037_0403535 3300049573 Bacteria 937
866 Ga0501037_0539281 3300049573 Bacteria 788
867 Ga0501037_0846391 3300049573 Bacteria 602
868 Ga0501038_0000049 3300049574 Bacteria 100279
869 Ga0501038_0002752 3300049574 Bacteria 16386
870 Ga0501038_0014983 3300049574 Bacteria 7060
871 Ga0501038_0087077 3300049574 Bacteria 2623
872 Ga0501038_0163858 3300049574 Bacteria 1805
873 Ga0501038_0241022 3300049574 Bacteria 1435
874 Ga0501038_0275113 3300049574 Bacteria 1327
875 Ga0501038_0532396 3300049574 Bacteria 895
876 Ga0501039_0002402 3300049575 Bacteria 13924
877 Ga0501039_0076203 3300049575 Bacteria 2607
878 Ga0501039_0107283 3300049575 Bacteria 2181
879 Ga0501039_0153981 3300049575 Bacteria 1806
880 Ga0501039_1038670 3300049575 Bacteria 636
881 Ga0501040_0040480 3300049576 Bacteria 3171
882 Ga0501041_0472820 3300049577 Bacteria 796
883 Ga0501042_0003793 3300049578 Bacteria 9554
884 Ga0501042_0081614 3300049578 Bacteria 2317
885 Ga0501042_0704770 3300049578 Bacteria 734
886 Ga0501043_0000740 3300049579 Bacteria 28916
887 Ga0501043_0010172 3300049579 Bacteria 7375
888 Ga0501043_0036335 3300049579 Bacteria 3874
889 Ga0501043_0038739 3300049579 Bacteria 3748
890 Ga0501043_0042848 3300049579 Bacteria 3557
891 Ga0501043_0046404 3300049579 Bacteria 3416
892 Ga0501043_0318234 3300049579 Bacteria 1187
893 Ga0501043_0354043 3300049579 Bacteria 1115
894 Ga0501043_0417942 3300049579 Bacteria 1011
895 Ga0501043_0690282 3300049579 Bacteria 746
896 Ga0501046_0014785 3300049580 Bacteria 6571
897 Ga0501046_0028098 3300049580 Bacteria 4583
898 Ga0501046_0098249 3300049580 Bacteria 2248
899 Ga0501046_0102565 3300049580 Bacteria 2193
900 Ga0501046_0388503 3300049580 Bacteria 1009
901 Ga0501047_0000875 3300049581 Bacteria 30740
902 Ga0501047_0006243 3300049581 Bacteria 11205
903 Ga0501047_0273890 3300049581 Bacteria 1533
904 Ga0501047_0331051 3300049581 Bacteria 1361
905 Ga0501047_0373234 3300049581 Bacteria 1261
906 Ga0501047_0864291 3300049581 Bacteria 718
907 Ga0501047_1105068 3300049581 Bacteria 606
908 Ga0501048_0006667 3300049582 Bacteria 8768
909 Ga0501048_0241639 3300049582 Bacteria 1281
910 Ga0501048_0421579 3300049582 Bacteria 955
911 Ga0501067_0000622 3300049583 Bacteria 19101
912 Ga0501067_0004029 3300049583 Bacteria 8107
913 Ga0501067_0368137 3300049583 Bacteria 801
914 Ga0501068_0004203 3300049584 Bacteria 7810
915 Ga0501068_0021789 3300049584 Bacteria 3744
916 Ga0501068_0092548 3300049584 Bacteria 1867
917 Ga0501068_0259797 3300049584 Bacteria 1108
918 Ga0501068_0500772 3300049584 Bacteria 788
919 Ga0501069_0018680 3300049585 Bacteria 3744
920 Ga0501069_0284198 3300049585 Bacteria 968
921 Ga0501069_0357985 3300049585 Bacteria 861
922 Ga0501069_0479078 3300049585 Bacteria 741
923 Ga0501070_0004157 3300049586 Bacteria 12451
924 Ga0501070_0006105 3300049586 Bacteria 10269
925 Ga0501070_0039330 3300049586 Bacteria 3945
926 Ga0501070_0081600 3300049586 Bacteria 2676
927 Ga0501070_0435315 3300049586 Bacteria 1058
928 Ga0501070_0637867 3300049586 Bacteria 847
929 Ga0501070_0880607 3300049586 Bacteria 699
930 Ga0501071_0243514 3300049587 Bacteria 1356
931 Ga0501071_0370304 3300049587 Bacteria 1092
932 Ga0501071_0413273 3300049587 Bacteria 1031
933 Ga0501071_1073489 3300049587 Bacteria 622
934 Ga0501072_0036419 3300049588 Bacteria 3857
935 Ga0501072_0315275 3300049588 Bacteria 1243
936 Ga0501073_0003598 3300049589 Bacteria 11649
937 Ga0501073_0019684 3300049589 Bacteria 4871
938 Ga0501074_0006273 3300049590 Bacteria 8584
939 Ga0501074_0024471 3300049590 Bacteria 4389
940 Ga0501074_0030015 3300049590 Bacteria 3940
941 Ga0501075_0190110 3300049591 Bacteria 1566
942 Ga0501076_0214954 3300049592 Bacteria 1572
943 Ga0501076_1409130 3300049592 Bacteria 572
944 Ga0501079_0003748 3300049741 Bacteria 11218
945 Ga0501079_0022539 3300049741 Bacteria 4830
946 Ga0501079_0805432 3300049741 Bacteria 740
947 Ga0501080_0000343 3300049742 Bacteria 35792
948 Ga0501080_0003847 3300049742 Bacteria 13260
949 Ga0501080_0078280 3300049742 Bacteria 3075
950 Ga0501080_0121332 3300049742 Bacteria 2422
951 Ga0501081_0261076 3300049743 Bacteria 1266
952 Ga0501083_0000724 3300049744 Bacteria 21483
953 Ga0501083_0444738 3300049744 Bacteria 843
954 Ga0501035_0000442 3300049822 Bacteria 46373
955 Ga0501035_0008258 3300049822 Bacteria 9702
956 Ga0501035_0040311 3300049822 Bacteria 4221
957 Ga0501035_0095868 3300049822 Bacteria 2607
958 Ga0501035_0179627 3300049822 Bacteria 1824
959 Ga0501035_0184190 3300049822 Bacteria 1798
960 Ga0501035_0307541 3300049822 Bacteria 1334
961 Ga0501044_0000182 3300049823 Bacteria 78052
962 Ga0501044_0025532 3300049823 Bacteria 6263
963 Ga0501044_0036302 3300049823 Bacteria 5157
964 Ga0501044_0053556 3300049823 Bacteria 4150
965 Ga0501044_0078732 3300049823 Bacteria 3340
966 Ga0501044_0093465 3300049823 Bacteria 3032
967 Ga0501044_0136258 3300049823 Bacteria 2446
968 Ga0501044_0176688 3300049823 Bacteria 2104
969 Ga0501044_0185359 3300049823 Bacteria 2046
970 Ga0501044_0388223 3300049823 Bacteria 1310
971 Ga0501044_1425381 3300049823 Bacteria 558
972 Ga0501045_0039733 3300049824 Bacteria 3424
973 Ga0501045_0727895 3300049824 Bacteria 731
974 nmdc:mga03n38_256831_c1 3300050490 Bacteria 925
975 nmdc:mga03n38_44440_c1 3300050490 Bacteria 1951
976 nmdc:mga03n38_89156_c1 3300050490 Bacteria 1465
977 nmdc:mga00v17_124232_c1 3300050491 Bacteria 1646
978 nmdc:mga00v17_346850_c1 3300050491 Bacteria 965
979 nmdc:mga00v17_52683_c1 3300050491 Bacteria 2477
980 nmdc:mga0yw44_122842_c1 3300050492 Bacteria 1674
981 nmdc:mga0yw44_20161_c2 3300050492 Bacteria 3041
982 nmdc:mga06z11_694435_c1 3300050494 Bacteria 620
983 nmdc:mga06z11_76263_c1 3300050494 Bacteria 1787
984 nmdc:mga04h51_245177_c1 3300050495 Bacteria 716
985 nmdc:mga04h51_66496_c1 3300050495 Bacteria 1249
986 nmdc:mga07m45_52186_c1 3300050496 Bacteria 2308
987 nmdc:mga08y16_1736710_c1 3300050511 Bacteria 578
988 nmdc:mga0n895_42303_c1 3300050512 Bacteria 4432
989 nmdc:mga0rr50_166033_c1 3300050513 Bacteria 1795
990 nmdc:mga08x19_24_c1 3300050514 Bacteria 245940
991 nmdc:mga0a205_441294_c1 3300050515 Bacteria 1162
992 Ga0495601_0010823 3300053077 Bacteria 5442
993 Ga0495601_0024851 3300053077 Bacteria 3690
994 Ga0495601_0101899 3300053077 Bacteria 1855
995 Ga0495601_0277602 3300053077 Bacteria 1092
996 Ga0495612_0011616 3300053078 Bacteria 3549
997 Ga0495612_0036334 3300053078 Bacteria 1999
998 Ga0495612_0054027 3300053078 Bacteria 1654
999 Ga0495612_0324273 3300053078 Bacteria 693
1000 Ga0495655_0167158 3300053083 Bacteria 702
1001 Ga0495595_0132181 3300053084 Bacteria 1220
1002 Ga0495619_0111129 3300053085 Bacteria 1873
1003 Ga0495619_0185497 3300053085 Bacteria 1439
1004 Ga0495619_0374245 3300053085 Bacteria 984
1005 Ga0500578_0380689 3300053086 Bacteria 818
1006 Ga0500646_0071520 3300053090 Bacteria 1041
1007 Ga0500583_0257118 3300053092 Bacteria 861
1008 Ga0500651_0000751 3300053093 Bacteria 15835
1009 Ga0500651_0273545 3300053093 Bacteria 976
1010 Ga0500651_0368486 3300053093 Bacteria 812
1011 Ga0500651_0749059 3300053093 Bacteria 519
1012 Ga0500566_0411937 3300053094 Bacteria 602
1013 Ga0500641_0004900 3300053096 Bacteria 4740
1014 Ga0500641_0031435 3300053096 Bacteria 2093
1015 Ga0500556_0291440 3300053104 Bacteria 639
1016 Ga0500595_001428 3300053119 Bacteria 12817
1017 Ga0500595_002631 3300053119 Bacteria 8742
1018 Ga0500595_005379 3300053119 Bacteria 5602
1019 Ga0500595_058497 3300053119 Bacteria 1171
1020 Ga0500595_157430 3300053119 Bacteria 633
1021 Ga0500597_312734 3300053120 Bacteria 623
1022 Ga0500642_0001478 3300053130 Bacteria 6759
1023 Ga0500642_0419472 3300053130 Bacteria 580
1024 Ga0500642_0442601 3300053130 Bacteria 559
1025 Ga0500561_0050864 3300053137 Bacteria 1130
1026 Ga0500568_0010263 3300053139 Bacteria 4396
1027 Ga0500568_0047112 3300053139 Bacteria 1708
1028 Ga0500568_0056655 3300053139 Bacteria 1527
1029 Ga0500577_0183766 3300053142 Bacteria 898
1030 Ga0500589_142002 3300053147 Bacteria 988
1031 Ga0500589_177467 3300053147 Bacteria 840
1032 Ga0500590_198964 3300053148 Bacteria 850
1033 Ga0500603_000998 3300053150 Bacteria 6665
1034 Ga0500603_013970 3300053150 Bacteria 1870
1035 Ga0500622_0301647 3300053156 Bacteria 682
1036 Ga0500634_0106542 3300053161 Bacteria 1392
1037 Ga0500636_0047345 3300053177 Bacteria 2533
1038 Ga0500636_0183142 3300053177 Bacteria 1123
1039 Ga0500637_0001776 3300053178 Bacteria 9320
1040 Ga0500637_0371650 3300053178 Bacteria 753
1041 Ga0500645_042809 3300053730 Bacteria 1335
1042 Ga0501084_0008620 3300054114 Bacteria 8429
1043 Ga0501082_0019978 3300060353 Bacteria 5772

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300007265 Ga0099794_10136813 Ga0099794_101368132 128
2 3300005842 Ga0068858_101461469 Ga0068858_1014614691 129
3 3300049568 Ga0501031_0563012 Ga0501031_0563012_325_720 129
4 3300049570 Ga0501033_0113529 Ga0501033_0113529_337_732 129
5 3300049572 Ga0501036_0015255 Ga0501036_0015255_3563_3958 129
6 3300049573 Ga0501037_0539281 Ga0501037_0539281_267_662 129
7 3300049574 Ga0501038_0087077 Ga0501038_0087077_2191_2586 129
8 3300049575 Ga0501039_0153981 Ga0501039_0153981_1130_1525 129
9 3300049579 Ga0501043_0354043 Ga0501043_0354043_594_989 129
10 3300049581 Ga0501047_0373234 Ga0501047_0373234_89_484 129
11 3300049742 Ga0501080_0078280 Ga0501080_0078280_115_510 129
12 3300049823 Ga0501044_0036302 Ga0501044_0036302_3898_4293 129
13 3300013308 Ga0157375_11032767 Ga0157375_110327671 130
14 3300005336 Ga0070680_100002273 Ga0070680_10000227311 131
15 3300005337 Ga0070682_100003870 Ga0070682_1000038702 131
16 3300005366 Ga0070659_100159506 Ga0070659_1001595062 131
17 3300005457 Ga0070662_100197923 Ga0070662_1001979233 131
18 3300005530 Ga0070679_100123421 Ga0070679_1001234211 131
19 3300005539 Ga0068853_100013651 Ga0068853_1000136511 131
20 3300005545 Ga0070695_100855836 Ga0070695_1008558361 131
21 3300005547 Ga0070693_100127834 Ga0070693_1001278342 131
22 3300005563 Ga0068855_100675651 Ga0068855_1006756511 131
23 3300005577 Ga0068857_100042050 Ga0068857_1000420503 131
24 3300005578 Ga0068854_100096172 Ga0068854_1000961722 131
25 3300009174 Ga0105241_10040893 Ga0105241_100408933 131
26 3300009545 Ga0105237_10632851 Ga0105237_106328512 131
27 3300010375 Ga0105239_10385430 Ga0105239_103854302 131
28 3300013100 Ga0157373_10012448 Ga0157373_100124482 131
29 3300013104 Ga0157370_10014857 Ga0157370_100148573 131
30 3300013307 Ga0157372_10004565 Ga0157372_100045655 131
31 3300025315 Ga0207697_10068025 Ga0207697_100680252 131
32 3300025910 Ga0207684_10767755 Ga0207684_107677552 131
33 3300025911 Ga0207654_10057787 Ga0207654_100577873 131
34 3300025912 Ga0207707_10062133 Ga0207707_100621333 131
35 3300025917 Ga0207660_10069162 Ga0207660_100691622 131
36 3300025921 Ga0207652_10077512 Ga0207652_100775121 131
37 3300025933 Ga0207706_10217014 Ga0207706_102170142 131
38 3300025949 Ga0207667_10204620 Ga0207667_102046202 131
39 3300026041 Ga0207639_10084236 Ga0207639_100842361 131
40 3300026116 Ga0207674_10130613 Ga0207674_101306131 131
41 3300046513 Ga0495616_0053323 Ga0495616_0053323_1002_1406 132
42 3300046616 Ga0495668_0170843 Ga0495668_0170843_213_620 132
43 3300053120 Ga0500597_312734 Ga0500597_312734_33_434 132
44 3300005545 Ga0070695_100189578 Ga0070695_1001895782 133
45 3300005549 Ga0070704_100008485 Ga0070704_1000084853 133
46 3300005578 Ga0068854_102097539 Ga0068854_1020975391 133
47 3300005843 Ga0068860_100573107 Ga0068860_1005731072 133
48 3300009148 Ga0105243_11006571 Ga0105243_110065711 133
49 3300009553 Ga0105249_10002531 Ga0105249_100025315 133
50 3300013307 Ga0157372_10679728 Ga0157372_106797282 133
51 3300025935 Ga0207709_10653648 Ga0207709_106536482 133
52 3300025961 Ga0207712_10033358 Ga0207712_100333584 133
53 3300035113 Ga0373936_0037042 Ga0373936_0037042_806_1210 133
54 3300049579 Ga0501043_0318234 Ga0501043_0318234_302_709 133
55 3300005366 Ga0070659_101422310 Ga0070659_1014223102 134
56 3300005367 Ga0070667_101582433 Ga0070667_1015824331 134
57 3300005440 Ga0070705_100506717 Ga0070705_1005067172 134
58 3300005536 Ga0070697_100038617 Ga0070697_1000386172 134
59 3300005536 Ga0070697_100379741 Ga0070697_1003797412 134
60 3300005545 Ga0070695_100020357 Ga0070695_1000203576 134
61 3300006914 Ga0075436_100032312 Ga0075436_1000323126 134
62 3300007076 Ga0075435_100044739 Ga0075435_1000447396 134
63 3300009551 Ga0105238_10076860 Ga0105238_100768606 134
64 3300025906 Ga0207699_11138615 Ga0207699_111386152 134
65 3300025939 Ga0207665_10019587 Ga0207665_100195872 134
66 3300031548 Ga0307408_100113900 Ga0307408_1001139004 134
67 3300031911 Ga0307412_10722316 Ga0307412_107223162 134
68 3300041443 Ga0451789_0114694 Ga0451789_0114694_290_697 134
69 3300050514 nmdc:mga08x19_24_c1 nmdc:mga08x19_24_c1_196402_196815 134
70 iso_pu_bacteria 2908756301 2908758037 134
71 3300005548 Ga0070665_101579763 Ga0070665_1015797631 135
72 3300025972 Ga0207668_11440105 Ga0207668_114401052 135
73 3300050491 nmdc:mga00v17_346850_c1 nmdc:mga00v17_346850_c1_64_477 135
74 iso_pu_bacteria 2513237098 2513672012 135
75 iso_pu_bacteria 2524023210 2524469209 135
76 iso_pu_bacteria 2885383462 2885383699 135
77 iso_pu_bacteria 2903768456 2903770065 135
78 iso_pu_bacteria 8056681323 8056682143 135
79 3300003215 JGI25153J46596_10003620 JGI25153J46596_100036207 136
80 3300006038 Ga0075365_10001178 Ga0075365_100011781 136
81 3300006051 Ga0075364_10084281 Ga0075364_100842812 136
82 3300006177 Ga0075362_10627797 Ga0075362_106277971 136
83 3300006178 Ga0075367_10115824 Ga0075367_101158243 136
84 3300006186 Ga0075369_10471773 Ga0075369_104717732 136
85 3300009101 Ga0105247_10422074 Ga0105247_104220742 136
86 3300013102 Ga0157371_11128816 Ga0157371_111288162 136
87 3300013308 Ga0157375_10405941 Ga0157375_104059412 136
88 3300025297 Ga0209758_1015056 Ga0209758_10150562 136
89 3300025907 Ga0207645_10264630 Ga0207645_102646302 136
90 3300025931 Ga0207644_10329652 Ga0207644_103296522 136
91 3300028381 Ga0268264_10338604 Ga0268264_103386042 136
92 3300042157 Ga0439458_0009740 Ga0439458_0009740_1695_2108 136
93 3300046452 Ga0495617_122277 Ga0495617_122277_414_827 136
94 3300046471 Ga0495650_0068980 Ga0495650_0068980_876_1292 136
95 3300046474 Ga0495605_0321293 Ga0495605_0321293_116_529 136
96 3300046474 Ga0495605_0431742 Ga0495605_0431742_121_534 136
97 3300046507 Ga0495606_0340912 Ga0495606_0340912_164_577 136
98 3300046512 Ga0495610_0068686 Ga0495610_0068686_1129_1542 136
99 3300046512 Ga0495610_0342685 Ga0495610_0342685_128_541 136
100 3300046519 Ga0495632_0191378 Ga0495632_0191378_195_608 136
101 3300046524 Ga0495648_0146153 Ga0495648_0146153_624_1037 136
102 3300046542 Ga0495597_0288849 Ga0495597_0288849_72_485 136
103 3300046615 Ga0495656_0382694 Ga0495656_0382694_289_702 136
104 3300046616 Ga0495668_0023759 Ga0495668_0023759_2839_3252 136
105 3300046648 Ga0495611_0483152 Ga0495611_0483152_37_450 136
106 3300046681 Ga0495647_0067363 Ga0495647_0067363_322_735 136
107 3300046692 Ga0495671_0448985 Ga0495671_0448985_69_482 136
108 3300046694 Ga0495649_0584707 Ga0495649_0584707_53_466 136
109 3300047318 Ga0495636_0172175 Ga0495636_0172175_206_619 136
110 3300047323 Ga0495683_0424028 Ga0495683_0424028_123_536 136
111 3300047472 Ga0495686_0112743 Ga0495686_0112743_969_1382 136
112 3300048912 Ga0496109_0898071 Ga0496109_0898071_263_676 136
113 3300048925 Ga0496122_0092764 Ga0496122_0092764_445_858 136
114 3300048926 Ga0496123_0052353 Ga0496123_0052353_1949_2362 136
115 3300048929 Ga0496126_0039916 Ga0496126_0039916_2281_2694 136
116 3300049459 Ga0495678_157074 Ga0495678_157074_13_426 136
117 3300049743 Ga0501081_0261076 Ga0501081_0261076_253_666 136
118 3300050491 nmdc:mga00v17_52683_c1 nmdc:mga00v17_52683_c1_553_969 136
119 3300050492 nmdc:mga0yw44_20161_c2 nmdc:mga0yw44_20161_c2_2402_2818 136
120 3300050494 nmdc:mga06z11_76263_c1 nmdc:mga06z11_76263_c1_84_500 136
121 3300053093 Ga0500651_0368486 Ga0500651_0368486_262_675 136
122 3300053130 Ga0500642_0442601 Ga0500642_0442601_27_440 136
123 3300053137 Ga0500561_0050864 Ga0500561_0050864_653_1066 136
124 3300053147 Ga0500589_177467 Ga0500589_177467_292_705 136
125 3300053156 Ga0500622_0301647 Ga0500622_0301647_133_546 136
126 3300053161 Ga0500634_0106542 Ga0500634_0106542_851_1264 136
127 3300006880 Ga0075429_101013421 Ga0075429_1010134211 137
128 3300009551 Ga0105238_10020302 Ga0105238_100203021 137
129 3300021377 Ga0213874_10018729 Ga0213874_100187293 137
130 3300025937 Ga0207669_10478619 Ga0207669_104786192 137
131 3300026041 Ga0207639_10947955 Ga0207639_109479552 137
132 3300026118 Ga0207675_100134494 Ga0207675_1001344942 137
133 3300039437 Ga0436365_0781961 Ga0436365_0781961_122_538 137
134 3300039450 Ga0436363_0991916 Ga0436363_0991916_983_1408 137
135 3300046499 Ga0495594_0345256 Ga0495594_0345256_386_802 137
136 3300048906 Ga0496103_0088070 Ga0496103_0088070_77_493 137
137 3300050490 nmdc:mga03n38_44440_c1 nmdc:mga03n38_44440_c1_386_808 137
138 iso_pu_bacteria 2876808645 2876809319 137
139 iso_pu_bacteria 2879110137 2879118124 137
140 iso_pu_bacteria 2922386360 2922390153 137
141 iso_pu_bacteria 8056673599 8056674947 137
142 3300005327 Ga0070658_10678046 Ga0070658_106780462 138
143 3300005339 Ga0070660_100137772 Ga0070660_1001377722 138
144 3300005366 Ga0070659_100218186 Ga0070659_1002181863 138
145 3300005458 Ga0070681_10482263 Ga0070681_104822633 138
146 3300005530 Ga0070679_100044706 Ga0070679_1000447062 138
147 3300005535 Ga0070684_101840348 Ga0070684_1018403481 138
148 3300005539 Ga0068853_100196930 Ga0068853_1001969302 138
149 3300005563 Ga0068855_100274313 Ga0068855_1002743133 138
150 3300005983 Ga0081540_1058985 Ga0081540_10589853 138
151 3300013100 Ga0157373_10460675 Ga0157373_104606752 138
152 3300013104 Ga0157370_10270395 Ga0157370_102703952 138
153 3300025904 Ga0207647_10390757 Ga0207647_103907571 138
154 3300025909 Ga0207705_10048396 Ga0207705_100483962 138
155 3300025919 Ga0207657_10001382 Ga0207657_1000138224 138
156 3300025921 Ga0207652_10124322 Ga0207652_101243221 138
157 3300025932 Ga0207690_10100023 Ga0207690_101000233 138
158 3300026067 Ga0207678_10422840 Ga0207678_104228402 138
159 3300037471 Ga0395905_0505853 Ga0395905_0505853_18_440 138
160 3300046523 Ga0495644_0251562 Ga0495644_0251562_131_547 138
161 3300046648 Ga0495611_0498704 Ga0495611_0498704_14_430 138
162 3300047472 Ga0495686_0146519 Ga0495686_0146519_648_1070 138
163 3300048927 Ga0496124_0067834 Ga0496124_0067834_1885_2301 138
164 3300048929 Ga0496126_0055168 Ga0496126_0055168_2743_3165 138
165 3300049570 Ga0501033_0306343 Ga0501033_0306343_359_775 138
166 3300049572 Ga0501036_0146974 Ga0501036_0146974_777_1193 138
167 3300049573 Ga0501037_0057389 Ga0501037_0057389_872_1288 138
168 3300049574 Ga0501038_0532396 Ga0501038_0532396_173_589 138
169 3300049578 Ga0501042_0704770 Ga0501042_0704770_227_643 138
170 3300049579 Ga0501043_0038739 Ga0501043_0038739_1155_1571 138
171 3300049580 Ga0501046_0388503 Ga0501046_0388503_566_982 138
172 3300049582 Ga0501048_0421579 Ga0501048_0421579_292_708 138
173 3300049583 Ga0501067_0368137 Ga0501067_0368137_236_652 138
174 3300049584 Ga0501068_0259797 Ga0501068_0259797_673_1089 138
175 3300049585 Ga0501069_0479078 Ga0501069_0479078_236_652 138
176 3300049586 Ga0501070_0637867 Ga0501070_0637867_95_511 138
177 3300049587 Ga0501071_0370304 Ga0501071_0370304_600_1016 138
178 3300049588 Ga0501072_0315275 Ga0501072_0315275_377_793 138
179 3300049741 Ga0501079_0805432 Ga0501079_0805432_74_490 138
180 3300049742 Ga0501080_0121332 Ga0501080_0121332_1042_1458 138
181 3300049823 Ga0501044_0136258 Ga0501044_0136258_1887_2303 138
182 3300053139 Ga0500568_0010263 Ga0500568_0010263_3330_3752 138
183 iso_pu_bacteria 2643221651 2644287325 138
184 iso_pu_bacteria 2728368998 2728754402 138
185 3300005338 Ga0068868_100282404 Ga0068868_1002824043 139
186 3300009094 Ga0111539_11892877 Ga0111539_118928772 139
187 3300025315 Ga0207697_10076668 Ga0207697_100766682 139
188 3300025899 Ga0207642_10856937 Ga0207642_108569372 139
189 3300025907 Ga0207645_10416669 Ga0207645_104166692 139
190 3300025938 Ga0207704_10820670 Ga0207704_108206702 139
191 3300025960 Ga0207651_11066868 Ga0207651_110668682 139
192 3300037466 Ga0395898_0146205 Ga0395898_0146205_263_727 139
193 3300046459 Ga0495629_0558886 Ga0495629_0558886_133_552 139
194 3300046539 Ga0495621_0235045 Ga0495621_0235045_199_618 139
195 3300048924 Ga0496121_0221411 Ga0496121_0221411_114_539 139
196 3300049573 Ga0501037_0846391 Ga0501037_0846391_67_492 139
197 3300049574 Ga0501038_0163858 Ga0501038_0163858_677_1102 139
198 3300049574 Ga0501038_0275113 Ga0501038_0275113_165_590 139
199 3300049575 Ga0501039_1038670 Ga0501039_1038670_44_469 139
200 3300049579 Ga0501043_0046404 Ga0501043_0046404_1380_1805 139
201 3300049581 Ga0501047_1105068 Ga0501047_1105068_138_563 139
202 3300049586 Ga0501070_0081600 Ga0501070_0081600_690_1115 139
203 3300049587 Ga0501071_1073489 Ga0501071_1073489_23_448 139
204 3300049822 Ga0501035_0184190 Ga0501035_0184190_342_767 139
205 3300049822 Ga0501035_0307541 Ga0501035_0307541_679_1104 139
206 3300049823 Ga0501044_0093465 Ga0501044_0093465_2231_2656 139
207 3300049823 Ga0501044_0176688 Ga0501044_0176688_359_784 139
208 3300009093 Ga0105240_11357771 Ga0105240_113577711 140
209 3300031911 Ga0307412_10970404 Ga0307412_109704042 140
210 3300049571 Ga0501034_0389111 Ga0501034_0389111_50_487 140
211 3300053730 Ga0500645_042809 Ga0500645_042809_533_964 140
212 3300005328 Ga0070676_10386348 Ga0070676_103863482 141
213 3300005329 Ga0070683_100827681 Ga0070683_1008276812 141
214 3300005334 Ga0068869_100015386 Ga0068869_1000153868 141
215 3300005336 Ga0070680_100362859 Ga0070680_1003628592 141
216 3300005337 Ga0070682_100938741 Ga0070682_1009387412 141
217 3300005338 Ga0068868_100030028 Ga0068868_1000300284 141
218 3300005338 Ga0068868_100169058 Ga0068868_1001690581 141
219 3300005344 Ga0070661_100200692 Ga0070661_1002006922 141
220 3300005347 Ga0070668_101229091 Ga0070668_1012290911 141
221 3300005355 Ga0070671_100216287 Ga0070671_1002162872 141
222 3300005355 Ga0070671_100267297 Ga0070671_1002672972 141
223 3300005364 Ga0070673_100152900 Ga0070673_1001529003 141
224 3300005364 Ga0070673_101467808 Ga0070673_1014678081 141
225 3300005435 Ga0070714_101121316 Ga0070714_1011213162 141
226 3300005438 Ga0070701_10143854 Ga0070701_101438542 141
227 3300005439 Ga0070711_100317394 Ga0070711_1003173942 141
228 3300005455 Ga0070663_100016039 Ga0070663_1000160397 141
229 3300005455 Ga0070663_100050610 Ga0070663_1000506103 141
230 3300005456 Ga0070678_100066664 Ga0070678_1000666645 141
231 3300005456 Ga0070678_100192514 Ga0070678_1001925144 141
232 3300005457 Ga0070662_100397645 Ga0070662_1003976452 141
233 3300005459 Ga0068867_100618778 Ga0068867_1006187782 141
234 3300005471 Ga0070698_100136725 Ga0070698_1001367253 141
235 3300005518 Ga0070699_101415470 Ga0070699_1014154701 141
236 3300005535 Ga0070684_100262869 Ga0070684_1002628692 141
237 3300005539 Ga0068853_100642569 Ga0068853_1006425691 141
238 3300005545 Ga0070695_100605293 Ga0070695_1006052932 141
239 3300005547 Ga0070693_100167943 Ga0070693_1001679432 141
240 3300005548 Ga0070665_100086794 Ga0070665_1000867945 141
241 3300005548 Ga0070665_100287823 Ga0070665_1002878232 141
242 3300005549 Ga0070704_100289844 Ga0070704_1002898442 141
243 3300005563 Ga0068855_100071280 Ga0068855_1000712807 141
244 3300005564 Ga0070664_100151452 Ga0070664_1001514524 141
245 3300005564 Ga0070664_100326781 Ga0070664_1003267812 141
246 3300005577 Ga0068857_100061246 Ga0068857_1000612466 141
247 3300005614 Ga0068856_100171502 Ga0068856_1001715025 141
248 3300005615 Ga0070702_100144460 Ga0070702_1001444602 141
249 3300005616 Ga0068852_100057125 Ga0068852_1000571252 141
250 3300005616 Ga0068852_100309219 Ga0068852_1003092192 141
251 3300005617 Ga0068859_101490472 Ga0068859_1014904722 141
252 3300005618 Ga0068864_100024784 Ga0068864_1000247844 141
253 3300005618 Ga0068864_100086389 Ga0068864_1000863895 141
254 3300005618 Ga0068864_101883275 Ga0068864_1018832751 141
255 3300005719 Ga0068861_100376017 Ga0068861_1003760172 141
256 3300005834 Ga0068851_10494069 Ga0068851_104940692 141
257 3300005840 Ga0068870_10231807 Ga0068870_102318072 141
258 3300005841 Ga0068863_100034349 Ga0068863_1000343493 141
259 3300005842 Ga0068858_100113683 Ga0068858_1001136832 141
260 3300005844 Ga0068862_100366826 Ga0068862_1003668262 141
261 3300005844 Ga0068862_100382220 Ga0068862_1003822202 141
262 3300005844 Ga0068862_101124203 Ga0068862_1011242032 141
263 3300005983 Ga0081540_1010845 Ga0081540_10108452 141
264 3300006038 Ga0075365_10047222 Ga0075365_100472222 141
265 3300006038 Ga0075365_10065154 Ga0075365_100651543 141
266 3300006038 Ga0075365_10287239 Ga0075365_102872392 141
267 3300006042 Ga0075368_10019165 Ga0075368_100191652 141
268 3300006048 Ga0075363_100030294 Ga0075363_1000302942 141
269 3300006051 Ga0075364_10065790 Ga0075364_100657902 141
270 3300006051 Ga0075364_10167889 Ga0075364_101678892 141
271 3300006177 Ga0075362_10103282 Ga0075362_101032822 141
272 3300006178 Ga0075367_10053655 Ga0075367_100536552 141
273 3300006186 Ga0075369_10074750 Ga0075369_100747502 141
274 3300006237 Ga0097621_100220989 Ga0097621_1002209892 141
275 3300006237 Ga0097621_100804800 Ga0097621_1008048002 141
276 3300006353 Ga0075370_10137360 Ga0075370_101373603 141
277 3300006358 Ga0068871_100793340 Ga0068871_1007933402 141
278 3300006852 Ga0075433_10411595 Ga0075433_104115953 141
279 3300006871 Ga0075434_100125946 Ga0075434_1001259462 141
280 3300006880 Ga0075429_101542139 Ga0075429_1015421392 141
281 3300006931 Ga0097620_101490507 Ga0097620_1014905072 141
282 3300007076 Ga0075435_100087178 Ga0075435_1000871785 141
283 3300009092 Ga0105250_10176393 Ga0105250_101763932 141
284 3300009098 Ga0105245_10070474 Ga0105245_100704742 141
285 3300009098 Ga0105245_10484188 Ga0105245_104841882 141
286 3300009098 Ga0105245_10929987 Ga0105245_109299872 141
287 3300009101 Ga0105247_10118533 Ga0105247_101185334 141
288 3300009148 Ga0105243_10445796 Ga0105243_104457962 141
289 3300009148 Ga0105243_10541592 Ga0105243_105415922 141
290 3300009174 Ga0105241_10064090 Ga0105241_100640905 141
291 3300009177 Ga0105248_10020941 Ga0105248_100209412 141
292 3300009545 Ga0105237_10019705 Ga0105237_100197052 141
293 3300009545 Ga0105237_10459415 Ga0105237_104594152 141
294 3300010375 Ga0105239_10325222 Ga0105239_103252224 141
295 3300011119 Ga0105246_10130517 Ga0105246_101305174 141
296 3300011119 Ga0105246_10214800 Ga0105246_102148004 141
297 3300013105 Ga0157369_11527992 Ga0157369_115279921 141
298 3300013296 Ga0157374_10532013 Ga0157374_105320133 141
299 3300013296 Ga0157374_10633030 Ga0157374_106330302 141
300 3300013297 Ga0157378_10144697 Ga0157378_101446972 141
301 3300013297 Ga0157378_10147673 Ga0157378_101476732 141
302 3300013306 Ga0163162_10038417 Ga0163162_100384175 141
303 3300013306 Ga0163162_10086558 Ga0163162_100865584 141
304 3300013306 Ga0163162_10455510 Ga0163162_104555102 141
305 3300013308 Ga0157375_11116547 Ga0157375_111165472 141
306 3300014325 Ga0163163_10058281 Ga0163163_100582816 141
307 3300014745 Ga0157377_10102115 Ga0157377_101021151 141
308 3300014968 Ga0157379_10162863 Ga0157379_101628634 141
309 3300014968 Ga0157379_10223506 Ga0157379_102235062 141
310 3300025885 Ga0207653_10064430 Ga0207653_100644301 141
311 3300025900 Ga0207710_10021793 Ga0207710_100217932 141
312 3300025900 Ga0207710_10368135 Ga0207710_103681352 141
313 3300025901 Ga0207688_10152574 Ga0207688_101525742 141
314 3300025903 Ga0207680_10672501 Ga0207680_106725012 141
315 3300025904 Ga0207647_10222495 Ga0207647_102224952 141
316 3300025908 Ga0207643_10050095 Ga0207643_100500955 141
317 3300025911 Ga0207654_10003362 Ga0207654_1000336210 141
318 3300025914 Ga0207671_10443051 Ga0207671_104430513 141
319 3300025917 Ga0207660_10729217 Ga0207660_107292171 141
320 3300025920 Ga0207649_10459160 Ga0207649_104591602 141
321 3300025923 Ga0207681_10225047 Ga0207681_102250473 141
322 3300025927 Ga0207687_10106524 Ga0207687_101065243 141
323 3300025927 Ga0207687_10385792 Ga0207687_103857921 141
324 3300025931 Ga0207644_10200635 Ga0207644_102006352 141
325 3300025931 Ga0207644_10671596 Ga0207644_106715962 141
326 3300025933 Ga0207706_10050870 Ga0207706_100508703 141
327 3300025934 Ga0207686_10779655 Ga0207686_107796552 141
328 3300025935 Ga0207709_10087617 Ga0207709_100876172 141
329 3300025935 Ga0207709_10222826 Ga0207709_102228263 141
330 3300025940 Ga0207691_10512795 Ga0207691_105127952 141
331 3300025941 Ga0207711_10028374 Ga0207711_100283742 141
332 3300025942 Ga0207689_10115421 Ga0207689_101154212 141
333 3300025944 Ga0207661_10813694 Ga0207661_108136943 141
334 3300025945 Ga0207679_10058092 Ga0207679_100580923 141
335 3300025945 Ga0207679_10320714 Ga0207679_103207142 141
336 3300025945 Ga0207679_10347950 Ga0207679_103479502 141
337 3300025949 Ga0207667_10081604 Ga0207667_100816046 141
338 3300025960 Ga0207651_11096735 Ga0207651_110967352 141
339 3300025972 Ga0207668_10056922 Ga0207668_100569222 141
340 3300025986 Ga0207658_11214743 Ga0207658_112147432 141
341 3300026023 Ga0207677_10058951 Ga0207677_100589512 141
342 3300026035 Ga0207703_10042864 Ga0207703_100428646 141
343 3300026041 Ga0207639_11123800 Ga0207639_111238002 141
344 3300026067 Ga0207678_10049171 Ga0207678_100491712 141
345 3300026067 Ga0207678_10086523 Ga0207678_100865232 141
346 3300026075 Ga0207708_10958335 Ga0207708_109583351 141
347 3300026078 Ga0207702_10449499 Ga0207702_104494992 141
348 3300026078 Ga0207702_10706647 Ga0207702_107066472 141
349 3300026088 Ga0207641_10048178 Ga0207641_100481785 141
350 3300026089 Ga0207648_10318615 Ga0207648_103186151 141
351 3300026095 Ga0207676_10121531 Ga0207676_101215315 141
352 3300026095 Ga0207676_10212243 Ga0207676_102122432 141
353 3300026116 Ga0207674_10043409 Ga0207674_100434097 141
354 3300026121 Ga0207683_10078559 Ga0207683_100785594 141
355 3300026121 Ga0207683_10256196 Ga0207683_102561962 141
356 3300026121 Ga0207683_10379938 Ga0207683_103799382 141
357 3300026142 Ga0207698_10051950 Ga0207698_100519502 141
358 3300026142 Ga0207698_10054092 Ga0207698_100540925 141
359 3300027866 Ga0209813_10053603 Ga0209813_100536032 141
360 3300027866 Ga0209813_10060064 Ga0209813_100600642 141
361 3300028379 Ga0268266_10040140 Ga0268266_100401403 141
362 3300028380 Ga0268265_10113824 Ga0268265_101138243 141
363 3300028380 Ga0268265_11059051 Ga0268265_110590512 141
364 3300028381 Ga0268264_11868550 Ga0268264_118685502 141
365 3300030522 Ga0307512_10165615 Ga0307512_101656152 141
366 3300031507 Ga0307509_10371502 Ga0307509_103715022 141
367 3300032126 Ga0307415_100162761 Ga0307415_1001627612 141
368 3300033180 Ga0307510_10036728 Ga0307510_100367283 141
369 3300035089 Ga0373944_0009603 Ga0373944_0009603_1974_2402 141
370 3300035116 Ga0373945_0148279 Ga0373945_0148279_42_470 141
371 3300035116 Ga0373945_0255021 Ga0373945_0255021_168_602 141
372 3300035117 Ga0373953_0047024 Ga0373953_0047024_683_1111 141
373 3300035170 Ga0373943_0043404 Ga0373943_0043404_1031_1459 141
374 3300035171 Ga0373946_0043799 Ga0373946_0043799_713_1141 141
375 3300035172 Ga0373955_0057334 Ga0373955_0057334_1030_1458 141
376 3300035692 Ga0373935_0000493 Ga0373935_0000493_9981_10409 141
377 3300035695 Ga0373927_0000331 Ga0373927_0000331_14507_14935 141
378 3300035725 Ga0373947_0002830 Ga0373947_0002830_2227_2655 141
379 3300036401 Ga0373937_0008766 Ga0373937_0008766_7600_8028 141
380 3300037068 Ga0373925_0004263 Ga0373925_0004263_4234_4662 141
381 3300037068 Ga0373925_0182984 Ga0373925_0182984_512_946 141
382 3300037471 Ga0395905_0675452 Ga0395905_0675452_39_467 141
383 3300039447 Ga0436361_0297606 Ga0436361_0297606_286_711 141
384 3300039450 Ga0436363_1655123 Ga0436363_1655123_451_876 141
385 3300041486 Ga0451807_0093477 Ga0451807_0093477_243_686 141
386 3300044684 Ga0466966_0553481 Ga0466966_0553481_245_673 141
387 3300046453 Ga0495627_087526 Ga0495627_087526_392_820 141
388 3300046455 Ga0495603_0000643 Ga0495603_0000643_4841_5269 141
389 3300046455 Ga0495603_0037582 Ga0495603_0037582_486_920 141
390 3300046459 Ga0495629_0000423 Ga0495629_0000423_27793_28221 141
391 3300046461 Ga0495641_0003178 Ga0495641_0003178_11641_12069 141
392 3300046463 Ga0495653_0047134 Ga0495653_0047134_376_804 141
393 3300046472 Ga0495580_0002433 Ga0495580_0002433_4079_4507 141
394 3300046473 Ga0495582_0000166 Ga0495582_0000166_26743_27171 141
395 3300046475 Ga0495639_0000306 Ga0495639_0000306_4869_5297 141
396 3300046476 Ga0495662_0019982 Ga0495662_0019982_2230_2658 141
397 3300046477 Ga0495664_0005452 Ga0495664_0005452_1372_1800 141
398 3300046491 Ga0495584_0018933 Ga0495584_0018933_1866_2300 141
399 3300046491 Ga0495584_0227838 Ga0495584_0227838_108_536 141
400 3300046491 Ga0495584_0291975 Ga0495584_0291975_364_792 141
401 3300046499 Ga0495594_0002782 Ga0495594_0002782_1897_2325 141
402 3300046499 Ga0495594_0075067 Ga0495594_0075067_1420_1848 141
403 3300046511 Ga0495608_0147841 Ga0495608_0147841_317_745 141
404 3300046516 Ga0495628_0025658 Ga0495628_0025658_2028_2456 141
405 3300046516 Ga0495628_0516497 Ga0495628_0516497_103_531 141
406 3300046517 Ga0495630_0005320 Ga0495630_0005320_5225_5653 141
407 3300046518 Ga0495631_0036711 Ga0495631_0036711_67_495 141
408 3300046520 Ga0495637_0198126 Ga0495637_0198126_269_703 141
409 3300046522 Ga0495643_0145063 Ga0495643_0145063_632_1060 141
410 3300046525 Ga0495663_0029997 Ga0495663_0029997_1162_1590 141
411 3300046526 Ga0495666_0031319 Ga0495666_0031319_1920_2348 141
412 3300046529 Ga0495652_0011395 Ga0495652_0011395_4907_5335 141
413 3300046529 Ga0495652_0173019 Ga0495652_0173019_27_455 141
414 3300046531 Ga0495665_0000104 Ga0495665_0000104_16535_16963 141
415 3300046535 Ga0495586_0090832 Ga0495586_0090832_975_1403 141
416 3300046557 Ga0495622_0004750 Ga0495622_0004750_3655_4083 141
417 3300046557 Ga0495622_0033943 Ga0495622_0033943_1053_1487 141
418 3300046557 Ga0495622_0259627 Ga0495622_0259627_247_675 141
419 3300046559 Ga0495667_0035722 Ga0495667_0035722_633_1061 141
420 3300046642 Ga0495634_0003095 Ga0495634_0003095_5197_5625 141
421 3300046663 Ga0495635_0004351 Ga0495635_0004351_6705_7133 141
422 3300046674 Ga0495588_0006073 Ga0495588_0006073_3039_3473 141
423 3300046674 Ga0495588_0343312 Ga0495588_0343312_88_516 141
424 3300046675 Ga0495657_0186570 Ga0495657_0186570_675_1103 141
425 3300046680 Ga0495646_0030478 Ga0495646_0030478_2721_3149 141
426 3300046681 Ga0495647_0000279 Ga0495647_0000279_12674_13102 141
427 3300046681 Ga0495647_0135440 Ga0495647_0135440_521_952 141
428 3300046683 Ga0495658_0007144 Ga0495658_0007144_2626_3054 141
429 3300046689 Ga0495613_0006409 Ga0495613_0006409_5003_5431 141
430 3300046690 Ga0495624_0003391 Ga0495624_0003391_1382_1810 141
431 3300046809 Ga0495600_0112015 Ga0495600_0112015_516_944 141
432 3300047315 Ga0495581_0001274 Ga0495581_0001274_4869_5297 141
433 3300047319 Ga0495674_0001108 Ga0495674_0001108_16539_16967 141
434 3300047321 Ga0495676_0018692 Ga0495676_0018692_2697_3125 141
435 3300047322 Ga0495680_0705176 Ga0495680_0705176_64_492 141
436 3300047446 Ga0495679_116558 Ga0495679_116558_11_439 141
437 3300047673 Ga0495593_0000180 Ga0495593_0000180_26738_27166 141
438 3300048091 Ga0495626_0089026 Ga0495626_0089026_353_781 141
439 3300048903 Ga0496100_0106485 Ga0496100_0106485_1491_1919 141
440 3300048904 Ga0496101_0008882 Ga0496101_0008882_3489_3917 141
441 3300048905 Ga0496102_0007049 Ga0496102_0007049_270_698 141
442 3300048905 Ga0496102_0208311 Ga0496102_0208311_684_1112 141
443 3300048906 Ga0496103_0231341 Ga0496103_0231341_598_1026 141
444 3300048907 Ga0496104_0105809 Ga0496104_0105809_136_564 141
445 3300048908 Ga0496105_0179549 Ga0496105_0179549_928_1356 141
446 3300048908 Ga0496105_0682782 Ga0496105_0682782_42_470 141
447 3300048909 Ga0496106_0046854 Ga0496106_0046854_1014_1442 141
448 3300048909 Ga0496106_0095010 Ga0496106_0095010_1500_1928 141
449 3300048909 Ga0496106_0550105 Ga0496106_0550105_311_739 141
450 3300048910 Ga0496107_0021922 Ga0496107_0021922_406_834 141
451 3300048910 Ga0496107_0397140 Ga0496107_0397140_255_683 141
452 3300048910 Ga0496107_1058291 Ga0496107_1058291_74_508 141
453 3300048911 Ga0496108_0023293 Ga0496108_0023293_106_534 141
454 3300048911 Ga0496108_0172544 Ga0496108_0172544_1014_1442 141
455 3300048912 Ga0496109_0051360 Ga0496109_0051360_106_534 141
456 3300048912 Ga0496109_0573670 Ga0496109_0573670_576_1004 141
457 3300048913 Ga0496110_0033450 Ga0496110_0033450_3836_4264 141
458 3300048913 Ga0496110_0383222 Ga0496110_0383222_519_947 141
459 3300048913 Ga0496110_0883901 Ga0496110_0883901_30_458 141
460 3300048914 Ga0496111_0071138 Ga0496111_0071138_1705_2133 141
461 3300048914 Ga0496111_0092490 Ga0496111_0092490_649_1077 141
462 3300048915 Ga0496112_0020318 Ga0496112_0020318_5557_5985 141
463 3300048915 Ga0496112_0305009 Ga0496112_0305009_803_1231 141
464 3300048916 Ga0496113_0121025 Ga0496113_0121025_946_1374 141
465 3300048916 Ga0496113_0460122 Ga0496113_0460122_351_779 141
466 3300048917 Ga0496114_0875937 Ga0496114_0875937_84_512 141
467 3300048918 Ga0496115_0002825 Ga0496115_0002825_2540_2968 141
468 3300048919 Ga0496116_0291458 Ga0496116_0291458_236_664 141
469 3300048922 Ga0496119_0231190 Ga0496119_0231190_209_637 141
470 3300048924 Ga0496121_0244714 Ga0496121_0244714_685_1113 141
471 3300048928 Ga0496125_0086642 Ga0496125_0086642_1833_2261 141
472 3300049579 Ga0501043_0417942 Ga0501043_0417942_139_570 141
473 3300049584 Ga0501068_0500772 Ga0501068_0500772_74_502 141
474 3300049586 Ga0501070_0435315 Ga0501070_0435315_253_684 141
475 3300049822 Ga0501035_0179627 Ga0501035_0179627_323_757 141
476 3300049823 Ga0501044_0388223 Ga0501044_0388223_408_839 141
477 3300050490 nmdc:mga03n38_89156_c1 nmdc:mga03n38_89156_c1_422_850 141
478 3300050491 nmdc:mga00v17_124232_c1 nmdc:mga00v17_124232_c1_377_805 141
479 3300050492 nmdc:mga0yw44_122842_c1 nmdc:mga0yw44_122842_c1_1236_1664 141
480 3300050495 nmdc:mga04h51_66496_c1 nmdc:mga04h51_66496_c1_636_1064 141
481 3300050496 nmdc:mga07m45_52186_c1 nmdc:mga07m45_52186_c1_107_535 141
482 3300050511 nmdc:mga08y16_1736710_c1 nmdc:mga08y16_1736710_c1_79_507 141
483 3300050515 nmdc:mga0a205_441294_c1 nmdc:mga0a205_441294_c1_49_477 141
484 3300053077 Ga0495601_0024851 Ga0495601_0024851_1095_1523 141
485 3300053093 Ga0500651_0273545 Ga0500651_0273545_396_830 141
486 3300053096 Ga0500641_0004900 Ga0500641_0004900_2736_3164 141
487 3300053096 Ga0500641_0031435 Ga0500641_0031435_87_515 141
488 3300053119 Ga0500595_157430 Ga0500595_157430_179_613 141
489 3300053147 Ga0500589_142002 Ga0500589_142002_87_515 141
490 3300053148 Ga0500590_198964 Ga0500590_198964_398_832 141
491 3300053178 Ga0500637_0371650 Ga0500637_0371650_27_461 141
492 3300005329 Ga0070683_100003964 Ga0070683_10000396410 142
493 3300005329 Ga0070683_100079622 Ga0070683_1000796222 142
494 3300005336 Ga0070680_100055170 Ga0070680_1000551702 142
495 3300005336 Ga0070680_100068558 Ga0070680_1000685582 142
496 3300005341 Ga0070691_10525261 Ga0070691_105252611 142
497 3300005341 Ga0070691_10760503 Ga0070691_107605031 142
498 3300005365 Ga0070688_100982178 Ga0070688_1009821782 142
499 3300005434 Ga0070709_10073035 Ga0070709_100730354 142
500 3300005436 Ga0070713_100031026 Ga0070713_1000310264 142
501 3300005436 Ga0070713_100063352 Ga0070713_1000633521 142
502 3300005437 Ga0070710_10030040 Ga0070710_100300403 142
503 3300005439 Ga0070711_100102989 Ga0070711_1001029892 142
504 3300005439 Ga0070711_100185301 Ga0070711_1001853013 142
505 3300005439 Ga0070711_100558258 Ga0070711_1005582582 142
506 3300005458 Ga0070681_10013875 Ga0070681_100138755 142
507 3300005458 Ga0070681_10044746 Ga0070681_100447462 142
508 3300005458 Ga0070681_10075021 Ga0070681_100750216 142
509 3300005458 Ga0070681_11053154 Ga0070681_110531542 142
510 3300005530 Ga0070679_100006191 Ga0070679_1000061912 142
511 3300005530 Ga0070679_100142594 Ga0070679_1001425943 142
512 3300005530 Ga0070679_100607748 Ga0070679_1006077482 142
513 3300005535 Ga0070684_100013415 Ga0070684_1000134152 142
514 3300005539 Ga0068853_100346712 Ga0068853_1003467122 142
515 3300005539 Ga0068853_100503458 Ga0068853_1005034582 142
516 3300005563 Ga0068855_100131157 Ga0068855_1001311573 142
517 3300005563 Ga0068855_100163677 Ga0068855_1001636776 142
518 3300005563 Ga0068855_100452624 Ga0068855_1004526242 142
519 3300005564 Ga0070664_100360971 Ga0070664_1003609712 142
520 3300005578 Ga0068854_101554221 Ga0068854_1015542211 142
521 3300005614 Ga0068856_101835309 Ga0068856_1018353092 142
522 3300005937 Ga0081455_10006836 Ga0081455_100068367 142
523 3300005983 Ga0081540_1002541 Ga0081540_10025412 142
524 3300006028 Ga0070717_10486552 Ga0070717_104865521 142
525 3300006048 Ga0075363_100200181 Ga0075363_1002001812 142
526 3300006048 Ga0075363_100607542 Ga0075363_1006075422 142
527 3300006173 Ga0070716_100074228 Ga0070716_1000742284 142
528 3300006173 Ga0070716_100181662 Ga0070716_1001816621 142
529 3300006175 Ga0070712_101548153 Ga0070712_1015481532 142
530 3300006178 Ga0075367_10014213 Ga0075367_100142132 142
531 3300006178 Ga0075367_10553360 Ga0075367_105533602 142
532 3300006237 Ga0097621_100214525 Ga0097621_1002145253 142
533 3300006871 Ga0075434_100011681 Ga0075434_1000116813 142
534 3300007076 Ga0075435_100214341 Ga0075435_1002143411 142
535 3300009093 Ga0105240_10124519 Ga0105240_101245192 142
536 3300009174 Ga0105241_10274619 Ga0105241_102746192 142
537 3300009176 Ga0105242_11741590 Ga0105242_117415901 142
538 3300009545 Ga0105237_10783784 Ga0105237_107837842 142
539 3300009551 Ga0105238_10099537 Ga0105238_100995372 142
540 3300009551 Ga0105238_10131256 Ga0105238_101312562 142
541 3300009551 Ga0105238_10438766 Ga0105238_104387661 142
542 3300009551 Ga0105238_10452935 Ga0105238_104529352 142
543 3300009551 Ga0105238_11480337 Ga0105238_114803371 142
544 3300010375 Ga0105239_11096518 Ga0105239_110965181 142
545 3300010375 Ga0105239_11662826 Ga0105239_116628262 142
546 3300013104 Ga0157370_11872048 Ga0157370_118720481 142
547 3300013105 Ga0157369_10078520 Ga0157369_100785202 142
548 3300013307 Ga0157372_11290869 Ga0157372_112908691 142
549 3300020070 Ga0206356_10162217 Ga0206356_101622171 142
550 3300025261 Ga0209233_1011817 Ga0209233_10118172 142
551 3300025898 Ga0207692_10025941 Ga0207692_100259411 142
552 3300025906 Ga0207699_10704524 Ga0207699_107045242 142
553 3300025911 Ga0207654_10212208 Ga0207654_102122082 142
554 3300025912 Ga0207707_10000183 Ga0207707_1000018336 142
555 3300025912 Ga0207707_10322129 Ga0207707_103221292 142
556 3300025912 Ga0207707_11119159 Ga0207707_111191592 142
557 3300025914 Ga0207671_10178937 Ga0207671_101789371 142
558 3300025914 Ga0207671_10982847 Ga0207671_109828471 142
559 3300025916 Ga0207663_10236845 Ga0207663_102368452 142
560 3300025917 Ga0207660_10096617 Ga0207660_100966172 142
561 3300025921 Ga0207652_10038444 Ga0207652_100384442 142
562 3300025921 Ga0207652_10059768 Ga0207652_100597684 142
563 3300025921 Ga0207652_10171088 Ga0207652_101710882 142
564 3300025924 Ga0207694_10111406 Ga0207694_101114062 142
565 3300025924 Ga0207694_11078741 Ga0207694_110787411 142
566 3300025929 Ga0207664_10368328 Ga0207664_103683282 142
567 3300025939 Ga0207665_10048415 Ga0207665_100484153 142
568 3300025944 Ga0207661_10039177 Ga0207661_100391772 142
569 3300025944 Ga0207661_10949270 Ga0207661_109492702 142
570 3300025945 Ga0207679_10630265 Ga0207679_106302651 142
571 3300025949 Ga0207667_10365346 Ga0207667_103653463 142
572 3300026041 Ga0207639_10282221 Ga0207639_102822212 142
573 3300026078 Ga0207702_11540266 Ga0207702_115402662 142
574 3300026116 Ga0207674_10074949 Ga0207674_100749493 142
575 3300026142 Ga0207698_11739866 Ga0207698_117398661 142
576 3300027866 Ga0209813_10034886 Ga0209813_100348863 142
577 3300031456 Ga0307513_10242857 Ga0307513_102428572 142
578 3300031730 Ga0307516_10192735 Ga0307516_101927354 142
579 3300031901 Ga0307406_10500803 Ga0307406_105008031 142
580 3300033180 Ga0307510_10229328 Ga0307510_102293282 142
581 3300033442 Ga0315911_1000004 Ga0315911_1000004322 142
582 3300035083 Ga0373926_0009290 Ga0373926_0009290_2336_2767 142
583 3300035086 Ga0373934_0068318 Ga0373934_0068318_282_710 142
584 3300035111 Ga0373923_0046874 Ga0373923_0046874_500_931 142
585 3300035113 Ga0373936_0017300 Ga0373936_0017300_494_925 142
586 3300035114 Ga0373939_0541396 Ga0373939_0541396_40_471 142
587 3300035118 Ga0373954_0103943 Ga0373954_0103943_395_826 142
588 3300035172 Ga0373955_0024852 Ga0373955_0024852_510_941 142
589 3300035410 Ga0373924_0112886 Ga0373924_0112886_656_1087 142
590 3300035692 Ga0373935_0007392 Ga0373935_0007392_2410_2847 142
591 3300035695 Ga0373927_0819604 Ga0373927_0819604_70_501 142
592 3300035724 Ga0373933_0393415 Ga0373933_0393415_13_450 142
593 3300036401 Ga0373937_0071845 Ga0373937_0071845_744_1181 142
594 3300037418 Ga0395900_0166816 Ga0395900_0166816_381_812 142
595 3300037466 Ga0395898_0166907 Ga0395898_0166907_588_1019 142
596 3300038443 Ga0395901_0470988 Ga0395901_0470988_471_902 142
597 3300039437 Ga0436365_1855944 Ga0436365_1855944_337_768 142
598 3300039450 Ga0436363_0863724 Ga0436363_0863724_198_629 142
599 3300041453 Ga0451797_0871558 Ga0451797_0871558_189_620 142
600 3300041492 Ga0451835_0260168 Ga0451835_0260168_59_490 142
601 3300044683 Ga0466965_0138651 Ga0466965_0138651_174_605 142
602 3300044706 Ga0466964_0067938 Ga0466964_0067938_963_1394 142
603 3300044719 Ga0466971_0153010 Ga0466971_0153010_517_948 142
604 3300044735 Ga0466968_0395778 Ga0466968_0395778_151_582 142
605 3300045049 Ga0466959_0013030 Ga0466959_0013030_3689_4120 142
606 3300045976 Ga0466967_0141055 Ga0466967_0141055_791_1237 142
607 3300045976 Ga0466967_0165418 Ga0466967_0165418_1240_1671 142
608 3300045976 Ga0466967_0605290 Ga0466967_0605290_478_909 142
609 3300046454 Ga0495592_0021816 Ga0495592_0021816_3140_3571 142
610 3300046455 Ga0495603_0371880 Ga0495603_0371880_111_542 142
611 3300046459 Ga0495629_0067609 Ga0495629_0067609_1530_1967 142
612 3300046472 Ga0495580_0001799 Ga0495580_0001799_12964_13395 142
613 3300046475 Ga0495639_0024678 Ga0495639_0024678_513_944 142
614 3300046476 Ga0495662_0093108 Ga0495662_0093108_714_1145 142
615 3300046477 Ga0495664_0002707 Ga0495664_0002707_248_679 142
616 3300046477 Ga0495664_0091326 Ga0495664_0091326_1201_1638 142
617 3300046477 Ga0495664_0149781 Ga0495664_0149781_696_1124 142
618 3300046511 Ga0495608_0194068 Ga0495608_0194068_255_692 142
619 3300046514 Ga0495618_0013721 Ga0495618_0013721_1792_2229 142
620 3300046516 Ga0495628_0021914 Ga0495628_0021914_3270_3707 142
621 3300046529 Ga0495652_0348316 Ga0495652_0348316_27_464 142
622 3300046531 Ga0495665_0056289 Ga0495665_0056289_1444_1881 142
623 3300046535 Ga0495586_0192089 Ga0495586_0192089_394_825 142
624 3300046536 Ga0495587_0422757 Ga0495587_0422757_119_556 142
625 3300046543 Ga0495645_0014804 Ga0495645_0014804_888_1319 142
626 3300046543 Ga0495645_0205916 Ga0495645_0205916_730_1161 142
627 3300046559 Ga0495667_0129327 Ga0495667_0129327_605_1042 142
628 3300046648 Ga0495611_0045991 Ga0495611_0045991_315_755 142
629 3300046663 Ga0495635_0243431 Ga0495635_0243431_278_715 142
630 3300046663 Ga0495635_0930923 Ga0495635_0930923_61_492 142
631 3300046674 Ga0495588_0042080 Ga0495588_0042080_453_884 142
632 3300046675 Ga0495657_0194155 Ga0495657_0194155_531_962 142
633 3300046678 Ga0495599_0034495 Ga0495599_0034495_1853_2284 142
634 3300046679 Ga0495623_0363689 Ga0495623_0363689_29_466 142
635 3300046681 Ga0495647_0113762 Ga0495647_0113762_166_597 142
636 3300046683 Ga0495658_0016130 Ga0495658_0016130_1594_2025 142
637 3300046684 Ga0495669_0141250 Ga0495669_0141250_25_459 142
638 3300046684 Ga0495669_0338513 Ga0495669_0338513_259_690 142
639 3300046689 Ga0495613_0238783 Ga0495613_0238783_450_887 142
640 3300047315 Ga0495581_0201879 Ga0495581_0201879_111_542 142
641 3300047319 Ga0495674_0104773 Ga0495674_0104773_270_701 142
642 3300047321 Ga0495676_0340693 Ga0495676_0340693_62_493 142
643 3300047322 Ga0495680_0556609 Ga0495680_0556609_16_447 142
644 3300047444 Ga0495675_0352082 Ga0495675_0352082_184_615 142
645 3300047471 Ga0495684_0004305 Ga0495684_0004305_581_1018 142
646 3300047673 Ga0495593_0087193 Ga0495593_0087193_624_1061 142
647 3300048088 Ga0495602_0712355 Ga0495602_0712355_19_450 142
648 3300048089 Ga0495614_0132823 Ga0495614_0132823_349_780 142
649 3300048903 Ga0496100_0203330 Ga0496100_0203330_368_799 142
650 3300048905 Ga0496102_0293655 Ga0496102_0293655_431_862 142
651 3300048905 Ga0496102_1236806 Ga0496102_1236806_196_627 142
652 3300048909 Ga0496106_0440421 Ga0496106_0440421_138_584 142
653 3300048910 Ga0496107_0131559 Ga0496107_0131559_1122_1568 142
654 3300048922 Ga0496119_0538281 Ga0496119_0538281_48_479 142
655 3300048924 Ga0496121_0091430 Ga0496121_0091430_1466_1912 142
656 3300048929 Ga0496126_0399822 Ga0496126_0399822_474_905 142
657 3300048929 Ga0496126_0465443 Ga0496126_0465443_82_528 142
658 3300049569 Ga0501032_0013062 Ga0501032_0013062_3583_4026 142
659 3300049570 Ga0501033_0038747 Ga0501033_0038747_697_1140 142
660 3300049570 Ga0501033_0178484 Ga0501033_0178484_876_1307 142
661 3300049572 Ga0501036_1016100 Ga0501036_1016100_208_651 142
662 3300049578 Ga0501042_0003793 Ga0501042_0003793_43_486 142
663 3300049579 Ga0501043_0042848 Ga0501043_0042848_451_894 142
664 3300049580 Ga0501046_0014785 Ga0501046_0014785_3018_3449 142
665 3300049580 Ga0501046_0098249 Ga0501046_0098249_668_1111 142
666 3300049581 Ga0501047_0006243 Ga0501047_0006243_4607_5038 142
667 3300049581 Ga0501047_0273890 Ga0501047_0273890_368_811 142
668 3300049582 Ga0501048_0241639 Ga0501048_0241639_758_1201 142
669 3300049583 Ga0501067_0004029 Ga0501067_0004029_210_653 142
670 3300049584 Ga0501068_0021789 Ga0501068_0021789_2182_2625 142
671 3300049585 Ga0501069_0018680 Ga0501069_0018680_530_973 142
672 3300049586 Ga0501070_0006105 Ga0501070_0006105_8144_8575 142
673 3300049586 Ga0501070_0039330 Ga0501070_0039330_519_962 142
674 3300049589 Ga0501073_0019684 Ga0501073_0019684_2174_2605 142
675 3300049590 Ga0501074_0024471 Ga0501074_0024471_2230_2661 142
676 3300049590 Ga0501074_0030015 Ga0501074_0030015_3329_3772 142
677 3300049592 Ga0501076_0214954 Ga0501076_0214954_534_977 142
678 3300049741 Ga0501079_0022539 Ga0501079_0022539_384_827 142
679 3300049742 Ga0501080_0003847 Ga0501080_0003847_2485_2916 142
680 3300049823 Ga0501044_0025532 Ga0501044_0025532_2437_2868 142
681 3300049823 Ga0501044_0053556 Ga0501044_0053556_2054_2497 142
682 3300050490 nmdc:mga03n38_256831_c1 nmdc:mga03n38_256831_c1_165_599 142
683 3300050494 nmdc:mga06z11_694435_c1 nmdc:mga06z11_694435_c1_129_563 142
684 3300050495 nmdc:mga04h51_245177_c1 nmdc:mga04h51_245177_c1_210_644 142
685 3300050512 nmdc:mga0n895_42303_c1 nmdc:mga0n895_42303_c1_2367_2798 142
686 3300050513 nmdc:mga0rr50_166033_c1 nmdc:mga0rr50_166033_c1_182_613 142
687 3300053077 Ga0495601_0010823 Ga0495601_0010823_1389_1820 142
688 3300053077 Ga0495601_0101899 Ga0495601_0101899_696_1124 142
689 3300053078 Ga0495612_0011616 Ga0495612_0011616_294_725 142
690 3300053078 Ga0495612_0054027 Ga0495612_0054027_207_638 142
691 3300053085 Ga0495619_0111129 Ga0495619_0111129_1004_1441 142
692 3300053090 Ga0500646_0071520 Ga0500646_0071520_274_714 142
693 3300053092 Ga0500583_0257118 Ga0500583_0257118_151_591 142
694 3300053130 Ga0500642_0419472 Ga0500642_0419472_56_496 142
695 3300053142 Ga0500577_0183766 Ga0500577_0183766_89_529 142
696 iso_pu_bacteria 2513237096 2513655812 142
697 iso_pu_bacteria 2513237137 2513856692 142
698 iso_pu_bacteria 2513237145 2513917275 142
699 iso_pu_bacteria 2517572143 2517895441 142
700 iso_pu_bacteria 2524023228 2524539616 142
701 iso_pu_bacteria 2667528175 2671122117 142
702 iso_pu_bacteria 2791355197 2793069420 142
703 iso_pu_bacteria 2885374607 2885382175 142
704 iso_pu_bacteria 2903748898 2903753913 142
705 iso_pu_bacteria 2904690495 2904698786 142
706 iso_pu_bacteria 2904699407 2904710906 142
707 iso_pu_bacteria 2906610324 2906615939 142
708 iso_pu_bacteria 2906635258 2906639035 142
709 iso_pu_bacteria 2906660503 2906662083 142
710 iso_pu_bacteria 2908739725 2908740953 142
711 iso_pu_bacteria 2922425934 2922432089 142
712 iso_pu_bacteria 2935630451 2935631034 142
713 iso_pu_bacteria 2941507105 2941507686 142
714 iso_pu_bacteria 2941515067 2941516113 142
715 iso_pu_bacteria 2941523033 2941523179 142
716 iso_pu_bacteria 3005474847 3005476888 142
717 iso_pu_bacteria 8006933436 8006934529 142
718 iso_pu_bacteria 8006973647 8006974499 142
719 iso_pu_bacteria 8019565922 8019574224 142
720 3300005327 Ga0070658_10412460 Ga0070658_104124602 143
721 3300005329 Ga0070683_100164572 Ga0070683_1001645723 143
722 3300005336 Ga0070680_100022993 Ga0070680_1000229932 143
723 3300005336 Ga0070680_100497560 Ga0070680_1004975602 143
724 3300005336 Ga0070680_100938049 Ga0070680_1009380491 143
725 3300005339 Ga0070660_100012040 Ga0070660_1000120406 143
726 3300005341 Ga0070691_10031624 Ga0070691_100316242 143
727 3300005344 Ga0070661_100059734 Ga0070661_1000597343 143
728 3300005344 Ga0070661_100994451 Ga0070661_1009944511 143
729 3300005366 Ga0070659_100172418 Ga0070659_1001724183 143
730 3300005366 Ga0070659_100242989 Ga0070659_1002429892 143
731 3300005367 Ga0070667_100741837 Ga0070667_1007418372 143
732 3300005434 Ga0070709_10023329 Ga0070709_100233292 143
733 3300005435 Ga0070714_100042125 Ga0070714_1000421253 143
734 3300005435 Ga0070714_100157305 Ga0070714_1001573052 143
735 3300005436 Ga0070713_100002836 Ga0070713_1000028368 143
736 3300005437 Ga0070710_10000933 Ga0070710_100009337 143
737 3300005439 Ga0070711_100016753 Ga0070711_1000167531 143
738 3300005439 Ga0070711_101947039 Ga0070711_1019470391 143
739 3300005441 Ga0070700_100893457 Ga0070700_1008934572 143
740 3300005445 Ga0070708_100539136 Ga0070708_1005391361 143
741 3300005455 Ga0070663_100386757 Ga0070663_1003867572 143
742 3300005457 Ga0070662_100711961 Ga0070662_1007119611 143
743 3300005458 Ga0070681_10109202 Ga0070681_101092022 143
744 3300005458 Ga0070681_10748817 Ga0070681_107488172 143
745 3300005471 Ga0070698_101561736 Ga0070698_1015617361 143
746 3300005530 Ga0070679_100055570 Ga0070679_1000555706 143
747 3300005535 Ga0070684_100072576 Ga0070684_1000725763 143
748 3300005536 Ga0070697_100043484 Ga0070697_1000434842 143
749 3300005539 Ga0068853_100013662 Ga0068853_1000136624 143
750 3300005563 Ga0068855_100117221 Ga0068855_1001172212 143
751 3300005563 Ga0068855_100128245 Ga0068855_1001282452 143
752 3300005577 Ga0068857_100057180 Ga0068857_1000571803 143
753 3300005578 Ga0068854_100098929 Ga0068854_1000989292 143
754 3300005578 Ga0068854_100517428 Ga0068854_1005174281 143
755 3300005614 Ga0068856_100000217 Ga0068856_10000021714 143
756 3300005614 Ga0068856_100084670 Ga0068856_1000846703 143
757 3300005614 Ga0068856_100991027 Ga0068856_1009910271 143
758 3300005616 Ga0068852_100009784 Ga0068852_1000097842 143
759 3300005616 Ga0068852_100046151 Ga0068852_1000461514 143
760 3300005834 Ga0068851_10007939 Ga0068851_100079392 143
761 3300006028 Ga0070717_10000851 Ga0070717_1000085110 143
762 3300006028 Ga0070717_10002091 Ga0070717_1000209114 143
763 3300006038 Ga0075365_10444706 Ga0075365_104447062 143
764 3300006163 Ga0070715_10004429 Ga0070715_100044294 143
765 3300006173 Ga0070716_100010202 Ga0070716_1000102021 143
766 3300006175 Ga0070712_102033410 Ga0070712_1020334101 143
767 3300007265 Ga0099794_10008914 Ga0099794_100089146 143
768 3300007265 Ga0099794_10030714 Ga0099794_100307144 143
769 3300007265 Ga0099794_10160171 Ga0099794_101601712 143
770 3300007788 Ga0099795_10034354 Ga0099795_100343543 143
771 3300007788 Ga0099795_10117919 Ga0099795_101179191 143
772 3300009093 Ga0105240_10099064 Ga0105240_100990643 143
773 3300009093 Ga0105240_10654067 Ga0105240_106540672 143
774 3300009101 Ga0105247_10604256 Ga0105247_106042562 143
775 3300009174 Ga0105241_10592683 Ga0105241_105926832 143
776 3300009545 Ga0105237_10048626 Ga0105237_100486263 143
777 3300009551 Ga0105238_10054925 Ga0105238_100549252 143
778 3300009553 Ga0105249_11935997 Ga0105249_119359971 143
779 3300010159 Ga0099796_10015444 Ga0099796_100154442 143
780 3300010159 Ga0099796_10067998 Ga0099796_100679982 143
781 3300010375 Ga0105239_10075551 Ga0105239_100755512 143
782 3300013104 Ga0157370_10059963 Ga0157370_100599632 143
783 3300013105 Ga0157369_10048194 Ga0157369_100481942 143
784 3300013105 Ga0157369_10379284 Ga0157369_103792842 143
785 3300013296 Ga0157374_10318448 Ga0157374_103184481 143
786 3300013307 Ga0157372_10533060 Ga0157372_105330602 143
787 3300014497 Ga0182008_10254125 Ga0182008_102541251 143
788 3300025321 Ga0207656_10004848 Ga0207656_100048482 143
789 3300025898 Ga0207692_10002049 Ga0207692_100020499 143
790 3300025905 Ga0207685_10108629 Ga0207685_101086291 143
791 3300025906 Ga0207699_10004105 Ga0207699_100041052 143
792 3300025909 Ga0207705_10123978 Ga0207705_101239782 143
793 3300025912 Ga0207707_10021814 Ga0207707_100218142 143
794 3300025913 Ga0207695_10092385 Ga0207695_100923852 143
795 3300025913 Ga0207695_10425958 Ga0207695_104259582 143
796 3300025914 Ga0207671_10188167 Ga0207671_101881672 143
797 3300025915 Ga0207693_10000269 Ga0207693_1000026923 143
798 3300025915 Ga0207693_11275601 Ga0207693_112756011 143
799 3300025916 Ga0207663_10000096 Ga0207663_1000009625 143
800 3300025917 Ga0207660_10023670 Ga0207660_100236703 143
801 3300025917 Ga0207660_10479831 Ga0207660_104798311 143
802 3300025919 Ga0207657_10006462 Ga0207657_100064624 143
803 3300025920 Ga0207649_10222504 Ga0207649_102225042 143
804 3300025921 Ga0207652_10020826 Ga0207652_100208263 143
805 3300025921 Ga0207652_10088398 Ga0207652_100883982 143
806 3300025921 Ga0207652_11077526 Ga0207652_110775262 143
807 3300025924 Ga0207694_10025960 Ga0207694_100259602 143
808 3300025928 Ga0207700_10030762 Ga0207700_100307623 143
809 3300025929 Ga0207664_10202826 Ga0207664_102028263 143
810 3300025932 Ga0207690_10046304 Ga0207690_100463042 143
811 3300025932 Ga0207690_10230175 Ga0207690_102301752 143
812 3300025939 Ga0207665_10000104 Ga0207665_1000010416 143
813 3300025944 Ga0207661_10113555 Ga0207661_101135553 143
814 3300025945 Ga0207679_10421523 Ga0207679_104215231 143
815 3300025949 Ga0207667_10060913 Ga0207667_100609133 143
816 3300025949 Ga0207667_10111120 Ga0207667_101111202 143
817 3300025981 Ga0207640_10059871 Ga0207640_100598712 143
818 3300025981 Ga0207640_10229976 Ga0207640_102299762 143
819 3300025981 Ga0207640_10583733 Ga0207640_105837331 143
820 3300025986 Ga0207658_10646311 Ga0207658_106463111 143
821 3300026041 Ga0207639_10016671 Ga0207639_100166713 143
822 3300026078 Ga0207702_10001581 Ga0207702_1000158125 143
823 3300026078 Ga0207702_10710806 Ga0207702_107108062 143
824 3300026088 Ga0207641_12419811 Ga0207641_124198111 143
825 3300026116 Ga0207674_10026698 Ga0207674_100266982 143
826 3300026142 Ga0207698_10017298 Ga0207698_100172982 143
827 3300026142 Ga0207698_10021472 Ga0207698_100214723 143
828 3300027512 Ga0209179_1004354 Ga0209179_10043543 143
829 3300027671 Ga0209588_1007193 Ga0209588_10071935 143
830 3300028794 Ga0307515_10370212 Ga0307515_103702123 143
831 3300030760 Ga0265762_1021234 Ga0265762_10212342 143
832 3300030763 Ga0265763_1039418 Ga0265763_10394181 143
833 3300031238 Ga0265332_10220541 Ga0265332_102205412 143
834 3300031250 Ga0265331_10006331 Ga0265331_100063313 143
835 3300031344 Ga0265316_10498635 Ga0265316_104986351 143
836 3300031616 Ga0307508_10097824 Ga0307508_100978241 143
837 3300031711 Ga0265314_10155411 Ga0265314_101554112 143
838 3300031712 Ga0265342_10002958 Ga0265342_100029586 143
839 3300035111 Ga0373923_0042643 Ga0373923_0042643_331_765 143
840 3300035117 Ga0373953_0064513 Ga0373953_0064513_180_614 143
841 3300035118 Ga0373954_0056287 Ga0373954_0056287_1107_1541 143
842 3300035118 Ga0373954_0621327 Ga0373954_0621327_24_458 143
843 3300035119 Ga0373956_0015097 Ga0373956_0015097_1134_1568 143
844 3300035120 Ga0373957_0058898 Ga0373957_0058898_336_770 143
845 3300035120 Ga0373957_0231513 Ga0373957_0231513_37_471 143
846 3300035171 Ga0373946_0139035 Ga0373946_0139035_90_524 143
847 3300035172 Ga0373955_0033080 Ga0373955_0033080_1749_2183 143
848 3300035410 Ga0373924_0031722 Ga0373924_0031722_440_874 143
849 3300035691 Ga0373931_0031876 Ga0373931_0031876_1188_1622 143
850 3300035692 Ga0373935_0040922 Ga0373935_0040922_1253_1687 143
851 3300035695 Ga0373927_0012394 Ga0373927_0012394_581_1015 143
852 3300035724 Ga0373933_0000272 Ga0373933_0000272_10090_10527 143
853 3300035724 Ga0373933_0038006 Ga0373933_0038006_770_1204 143
854 3300035725 Ga0373947_0021069 Ga0373947_0021069_2048_2482 143
855 3300035725 Ga0373947_0076095 Ga0373947_0076095_1389_1823 143
856 3300036401 Ga0373937_0042265 Ga0373937_0042265_734_1168 143
857 3300036401 Ga0373937_0276180 Ga0373937_0276180_1111_1545 143
858 3300036401 Ga0373937_1266934 Ga0373937_1266934_213_647 143
859 3300037068 Ga0373925_0222747 Ga0373925_0222747_128_562 143
860 3300037068 Ga0373925_0421026 Ga0373925_0421026_257_691 143
861 3300038443 Ga0395901_0941018 Ga0395901_0941018_354_818 143
862 3300044656 Ga0466969_0197166 Ga0466969_0197166_188_622 143
863 3300045049 Ga0466959_0042527 Ga0466959_0042527_1167_1601 143
864 3300046454 Ga0495592_0006330 Ga0495592_0006330_3263_3697 143
865 3300046455 Ga0495603_0037079 Ga0495603_0037079_1543_1977 143
866 3300046455 Ga0495603_0037349 Ga0495603_0037349_1260_1694 143
867 3300046455 Ga0495603_0199261 Ga0495603_0199261_681_1115 143
868 3300046459 Ga0495629_0179129 Ga0495629_0179129_302_736 143
869 3300046462 Ga0495651_0030654 Ga0495651_0030654_3138_3572 143
870 3300046462 Ga0495651_0089382 Ga0495651_0089382_799_1233 143
871 3300046463 Ga0495653_0170875 Ga0495653_0170875_652_1086 143
872 3300046475 Ga0495639_0084506 Ga0495639_0084506_171_605 143
873 3300046477 Ga0495664_0091908 Ga0495664_0091908_481_915 143
874 3300046477 Ga0495664_0450544 Ga0495664_0450544_178_612 143
875 3300046499 Ga0495594_0415687 Ga0495594_0415687_219_653 143
876 3300046507 Ga0495606_0001165 Ga0495606_0001165_29570_30004 143
877 3300046511 Ga0495608_0082145 Ga0495608_0082145_1102_1536 143
878 3300046514 Ga0495618_0166950 Ga0495618_0166950_336_770 143
879 3300046516 Ga0495628_0066757 Ga0495628_0066757_1822_2256 143
880 3300046517 Ga0495630_0128189 Ga0495630_0128189_818_1252 143
881 3300046529 Ga0495652_0138197 Ga0495652_0138197_612_1046 143
882 3300046533 Ga0495640_0043096 Ga0495640_0043096_1560_1994 143
883 3300046535 Ga0495586_0287379 Ga0495586_0287379_171_605 143
884 3300046543 Ga0495645_0021320 Ga0495645_0021320_3964_4398 143
885 3300046559 Ga0495667_0089330 Ga0495667_0089330_1454_1888 143
886 3300046642 Ga0495634_0154436 Ga0495634_0154436_788_1222 143
887 3300046663 Ga0495635_0104833 Ga0495635_0104833_805_1239 143
888 3300046663 Ga0495635_0560539 Ga0495635_0560539_250_684 143
889 3300046674 Ga0495588_0148096 Ga0495588_0148096_382_816 143
890 3300046675 Ga0495657_0077257 Ga0495657_0077257_1097_1531 143
891 3300046678 Ga0495599_0104592 Ga0495599_0104592_993_1427 143
892 3300046679 Ga0495623_0043027 Ga0495623_0043027_1720_2154 143
893 3300046679 Ga0495623_0303048 Ga0495623_0303048_139_573 143
894 3300046679 Ga0495623_0318098 Ga0495623_0318098_324_758 143
895 3300046680 Ga0495646_0128197 Ga0495646_0128197_583_1017 143
896 3300046689 Ga0495613_0252560 Ga0495613_0252560_155_589 143
897 3300046690 Ga0495624_0033966 Ga0495624_0033966_1688_2122 143
898 3300046809 Ga0495600_0153077 Ga0495600_0153077_799_1233 143
899 3300047315 Ga0495581_0251889 Ga0495581_0251889_71_505 143
900 3300047315 Ga0495581_0480552 Ga0495581_0480552_145_579 143
901 3300047317 Ga0495604_0265313 Ga0495604_0265313_456_890 143
902 3300047319 Ga0495674_0099668 Ga0495674_0099668_824_1258 143
903 3300047320 Ga0495672_0135540 Ga0495672_0135540_812_1246 143
904 3300047322 Ga0495680_0052972 Ga0495680_0052972_2062_2496 143
905 3300047444 Ga0495675_0056324 Ga0495675_0056324_556_990 143
906 3300047471 Ga0495684_0063256 Ga0495684_0063256_738_1172 143
907 3300047673 Ga0495593_0161747 Ga0495593_0161747_79_513 143
908 3300048088 Ga0495602_0166728 Ga0495602_0166728_868_1302 143
909 3300048088 Ga0495602_0341173 Ga0495602_0341173_567_1001 143
910 3300048088 Ga0495602_0473899 Ga0495602_0473899_251_685 143
911 3300048904 Ga0496101_0182288 Ga0496101_0182288_129_563 143
912 3300048904 Ga0496101_0478768 Ga0496101_0478768_172_606 143
913 3300048907 Ga0496104_0038703 Ga0496104_0038703_2326_2760 143
914 3300048907 Ga0496104_0888238 Ga0496104_0888238_65_499 143
915 3300048909 Ga0496106_0012499 Ga0496106_0012499_3561_4031 143
916 3300048911 Ga0496108_0003612 Ga0496108_0003612_3291_3761 143
917 3300048911 Ga0496108_0633283 Ga0496108_0633283_184_618 143
918 3300048912 Ga0496109_0000166 Ga0496109_0000166_51988_52458 143
919 3300048912 Ga0496109_0020611 Ga0496109_0020611_459_893 143
920 3300048913 Ga0496110_0019876 Ga0496110_0019876_754_1188 143
921 3300048913 Ga0496110_0244401 Ga0496110_0244401_261_731 143
922 3300048913 Ga0496110_0664587 Ga0496110_0664587_94_528 143
923 3300048914 Ga0496111_0500419 Ga0496111_0500419_245_679 143
924 3300048914 Ga0496111_0583190 Ga0496111_0583190_150_584 143
925 3300048915 Ga0496112_0001913 Ga0496112_0001913_12330_12800 143
926 3300048915 Ga0496112_0009707 Ga0496112_0009707_7230_7664 143
927 3300048915 Ga0496112_0053396 Ga0496112_0053396_1585_2019 143
928 3300048915 Ga0496112_0395307 Ga0496112_0395307_481_915 143
929 3300048915 Ga0496112_1641239 Ga0496112_1641239_17_451 143
930 3300048916 Ga0496113_0061810 Ga0496113_0061810_293_763 143
931 3300048916 Ga0496113_0254192 Ga0496113_0254192_451_885 143
932 3300048917 Ga0496114_0579553 Ga0496114_0579553_166_600 143
933 3300048918 Ga0496115_0029552 Ga0496115_0029552_1704_2138 143
934 3300048918 Ga0496115_0076639 Ga0496115_0076639_1359_1793 143
935 3300048918 Ga0496115_0120072 Ga0496115_0120072_475_909 143
936 3300048918 Ga0496115_0744133 Ga0496115_0744133_131_565 143
937 3300048920 Ga0496117_0278837 Ga0496117_0278837_384_818 143
938 3300048921 Ga0496118_0167681 Ga0496118_0167681_467_901 143
939 3300048921 Ga0496118_0312399 Ga0496118_0312399_170_604 143
940 3300048924 Ga0496121_0001158 Ga0496121_0001158_2307_2741 143
941 3300048924 Ga0496121_0007126 Ga0496121_0007126_4512_4946 143
942 3300048929 Ga0496126_0010775 Ga0496126_0010775_3997_4431 143
943 3300048929 Ga0496126_0032384 Ga0496126_0032384_2210_2644 143
944 3300048929 Ga0496126_0305003 Ga0496126_0305003_86_520 143
945 3300048929 Ga0496126_0368144 Ga0496126_0368144_511_945 143
946 3300048929 Ga0496126_0369924 Ga0496126_0369924_103_537 143
947 3300049568 Ga0501031_0045495 Ga0501031_0045495_815_1261 143
948 3300049568 Ga0501031_0960207 Ga0501031_0960207_36_482 143
949 3300049569 Ga0501032_0075408 Ga0501032_0075408_1174_1620 143
950 3300049569 Ga0501032_0080439 Ga0501032_0080439_1594_2040 143
951 3300049569 Ga0501032_0169164 Ga0501032_0169164_255_704 143
952 3300049570 Ga0501033_0000749 Ga0501033_0000749_22098_22544 143
953 3300049570 Ga0501033_0115213 Ga0501033_0115213_768_1217 143
954 3300049570 Ga0501033_0276716 Ga0501033_0276716_622_1071 143
955 3300049571 Ga0501034_0383805 Ga0501034_0383805_422_871 143
956 3300049571 Ga0501034_0417586 Ga0501034_0417586_343_789 143
957 3300049572 Ga0501036_0005560 Ga0501036_0005560_9448_9894 143
958 3300049572 Ga0501036_0110617 Ga0501036_0110617_807_1241 143
959 3300049572 Ga0501036_0395148 Ga0501036_0395148_209_658 143
960 3300049572 Ga0501036_0668271 Ga0501036_0668271_15_464 143
961 3300049572 Ga0501036_0695152 Ga0501036_0695152_197_646 143
962 3300049573 Ga0501037_0001094 Ga0501037_0001094_10612_11058 143
963 3300049573 Ga0501037_0059496 Ga0501037_0059496_2042_2506 143
964 3300049573 Ga0501037_0403535 Ga0501037_0403535_292_741 143
965 3300049574 Ga0501038_0002752 Ga0501038_0002752_10719_11168 143
966 3300049574 Ga0501038_0014983 Ga0501038_0014983_4469_4915 143
967 3300049574 Ga0501038_0241022 Ga0501038_0241022_852_1298 143
968 3300049575 Ga0501039_0076203 Ga0501039_0076203_1750_2196 143
969 3300049575 Ga0501039_0107283 Ga0501039_0107283_1241_1690 143
970 3300049576 Ga0501040_0040480 Ga0501040_0040480_2436_2885 143
971 3300049577 Ga0501041_0472820 Ga0501041_0472820_152_598 143
972 3300049578 Ga0501042_0081614 Ga0501042_0081614_1470_1916 143
973 3300049579 Ga0501043_0010172 Ga0501043_0010172_3970_4416 143
974 3300049579 Ga0501043_0036335 Ga0501043_0036335_284_733 143
975 3300049579 Ga0501043_0690282 Ga0501043_0690282_258_707 143
976 3300049580 Ga0501046_0102565 Ga0501046_0102565_534_980 143
977 3300049581 Ga0501047_0331051 Ga0501047_0331051_898_1347 143
978 3300049581 Ga0501047_0864291 Ga0501047_0864291_160_609 143
979 3300049584 Ga0501068_0092548 Ga0501068_0092548_1150_1596 143
980 3300049585 Ga0501069_0357985 Ga0501069_0357985_60_494 143
981 3300049586 Ga0501070_0880607 Ga0501070_0880607_111_560 143
982 3300049587 Ga0501071_0243514 Ga0501071_0243514_754_1203 143
983 3300049587 Ga0501071_0413273 Ga0501071_0413273_102_548 143
984 3300049591 Ga0501075_0190110 Ga0501075_0190110_119_568 143
985 3300049744 Ga0501083_0444738 Ga0501083_0444738_168_617 143
986 3300049822 Ga0501035_0008258 Ga0501035_0008258_219_665 143
987 3300049822 Ga0501035_0040311 Ga0501035_0040311_1513_1977 143
988 3300049822 Ga0501035_0095868 Ga0501035_0095868_511_960 143
989 3300049823 Ga0501044_0078732 Ga0501044_0078732_1870_2304 143
990 3300049823 Ga0501044_0185359 Ga0501044_0185359_383_832 143
991 3300049823 Ga0501044_1425381 Ga0501044_1425381_25_459 143
992 3300049824 Ga0501045_0727895 Ga0501045_0727895_81_530 143
993 3300053077 Ga0495601_0277602 Ga0495601_0277602_456_890 143
994 3300053078 Ga0495612_0036334 Ga0495612_0036334_1253_1687 143
995 3300053078 Ga0495612_0324273 Ga0495612_0324273_239_673 143
996 3300053083 Ga0495655_0167158 Ga0495655_0167158_191_625 143
997 3300053084 Ga0495595_0132181 Ga0495595_0132181_203_637 143
998 3300053085 Ga0495619_0185497 Ga0495619_0185497_456_890 143
999 3300053085 Ga0495619_0374245 Ga0495619_0374245_18_452 143
1000 3300053086 Ga0500578_0380689 Ga0500578_0380689_186_620 143
1001 3300053093 Ga0500651_0000751 Ga0500651_0000751_13219_13653 143
1002 3300053093 Ga0500651_0749059 Ga0500651_0749059_71_505 143
1003 3300053094 Ga0500566_0411937 Ga0500566_0411937_102_536 143
1004 3300053104 Ga0500556_0291440 Ga0500556_0291440_127_561 143
1005 3300053119 Ga0500595_001428 Ga0500595_001428_11346_11780 143
1006 3300053119 Ga0500595_002631 Ga0500595_002631_6475_6909 143
1007 3300053119 Ga0500595_005379 Ga0500595_005379_69_503 143
1008 3300053119 Ga0500595_058497 Ga0500595_058497_669_1103 143
1009 3300053130 Ga0500642_0001478 Ga0500642_0001478_4474_4908 143
1010 3300053139 Ga0500568_0047112 Ga0500568_0047112_1174_1608 143
1011 3300053139 Ga0500568_0056655 Ga0500568_0056655_697_1131 143
1012 3300053150 Ga0500603_000998 Ga0500603_000998_1486_1920 143
1013 3300053150 Ga0500603_013970 Ga0500603_013970_619_1053 143
1014 3300053177 Ga0500636_0047345 Ga0500636_0047345_1780_2214 143
1015 3300053177 Ga0500636_0183142 Ga0500636_0183142_232_666 143
1016 3300053178 Ga0500637_0001776 Ga0500637_0001776_4308_4742 143
1017 3300001979 JGI24740J21852_10084309 JGI24740J21852_100843091 144
1018 3300005455 Ga0070663_100334579 Ga0070663_1003345791 144
1019 3300005539 Ga0068853_100055331 Ga0068853_1000553312 144
1020 3300005539 Ga0068853_100108774 Ga0068853_1001087742 144
1021 3300005563 Ga0068855_100015735 Ga0068855_1000157355 144
1022 3300005563 Ga0068855_100081934 Ga0068855_1000819343 144
1023 3300005577 Ga0068857_100020118 Ga0068857_1000201182 144
1024 3300005577 Ga0068857_100042440 Ga0068857_1000424402 144
1025 3300005578 Ga0068854_100009074 Ga0068854_1000090742 144
1026 3300005614 Ga0068856_100003953 Ga0068856_1000039536 144
1027 3300005616 Ga0068852_100023356 Ga0068852_1000233566 144
1028 3300005834 Ga0068851_10001080 Ga0068851_100010803 144
1029 3300009093 Ga0105240_10005613 Ga0105240_1000561314 144
1030 3300009093 Ga0105240_10016416 Ga0105240_100164164 144
1031 3300009174 Ga0105241_10002158 Ga0105241_1000215815 144
1032 3300009174 Ga0105241_10096656 Ga0105241_100966562 144
1033 3300009545 Ga0105237_10102579 Ga0105237_101025792 144
1034 3300009545 Ga0105237_10354544 Ga0105237_103545441 144
1035 3300010375 Ga0105239_10038407 Ga0105239_100384072 144
1036 3300013297 Ga0157378_10010055 Ga0157378_100100558 144
1037 3300025321 Ga0207656_10008610 Ga0207656_100086102 144
1038 3300025904 Ga0207647_10060817 Ga0207647_100608171 144
1039 3300025911 Ga0207654_10000358 Ga0207654_100003588 144
1040 3300025913 Ga0207695_10002150 Ga0207695_1000215014 144
1041 3300025914 Ga0207671_10234716 Ga0207671_102347162 144
1042 3300025924 Ga0207694_10000491 Ga0207694_1000049119 144
1043 3300025924 Ga0207694_10090730 Ga0207694_100907302 144
1044 3300025949 Ga0207667_10032720 Ga0207667_100327203 144
1045 3300025949 Ga0207667_10041172 Ga0207667_100411723 144
1046 3300025981 Ga0207640_10735439 Ga0207640_107354391 144
1047 3300026041 Ga0207639_10052074 Ga0207639_100520743 144
1048 3300026041 Ga0207639_10353301 Ga0207639_103533012 144
1049 3300026078 Ga0207702_10000003 Ga0207702_10000003298 144
1050 3300026116 Ga0207674_10010369 Ga0207674_1001036910 144
1051 3300026116 Ga0207674_10013847 Ga0207674_100138473 144
1052 3300026142 Ga0207698_10300379 Ga0207698_103003792 144
1053 3300049568 Ga0501031_0001969 Ga0501031_0001969_11734_12177 144
1054 3300049569 Ga0501032_0000088 Ga0501032_0000088_20774_21217 144
1055 3300049570 Ga0501033_0002046 Ga0501033_0002046_1324_1767 144
1056 3300049571 Ga0501034_0000332 Ga0501034_0000332_70953_71396 144
1057 3300049572 Ga0501036_0000233 Ga0501036_0000233_34325_34768 144
1058 3300049574 Ga0501038_0000049 Ga0501038_0000049_31625_32068 144
1059 3300049575 Ga0501039_0002402 Ga0501039_0002402_2255_2728 144
1060 3300049579 Ga0501043_0000740 Ga0501043_0000740_26121_26564 144
1061 3300049580 Ga0501046_0028098 Ga0501046_0028098_723_1166 144
1062 3300049581 Ga0501047_0000875 Ga0501047_0000875_11197_11640 144
1063 3300049582 Ga0501048_0006667 Ga0501048_0006667_1262_1705 144
1064 3300049583 Ga0501067_0000622 Ga0501067_0000622_13327_13770 144
1065 3300049584 Ga0501068_0004203 Ga0501068_0004203_1520_1963 144
1066 3300049585 Ga0501069_0284198 Ga0501069_0284198_27_470 144
1067 3300049586 Ga0501070_0004157 Ga0501070_0004157_213_656 144
1068 3300049588 Ga0501072_0036419 Ga0501072_0036419_142_585 144
1069 3300049589 Ga0501073_0003598 Ga0501073_0003598_2832_3275 144
1070 3300049590 Ga0501074_0006273 Ga0501074_0006273_8058_8501 144
1071 3300049592 Ga0501076_1409130 Ga0501076_1409130_57_530 144
1072 3300049741 Ga0501079_0003748 Ga0501079_0003748_4223_4666 144
1073 3300049742 Ga0501080_0000343 Ga0501080_0000343_26062_26505 144
1074 3300049744 Ga0501083_0000724 Ga0501083_0000724_15109_15582 144
1075 3300049822 Ga0501035_0000442 Ga0501035_0000442_43415_43858 144
1076 3300049823 Ga0501044_0000182 Ga0501044_0000182_21517_21960 144
1077 3300049824 Ga0501045_0039733 Ga0501045_0039733_2701_3144 144
1078 3300054114 Ga0501084_0008620 Ga0501084_0008620_7838_8311 144
1079 3300060353 Ga0501082_0019978 Ga0501082_0019978_2959_3402 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

50

127

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dm5-assembly1.cif.gz_E crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.9677 18 137
5dm5-assembly1.cif.gz_D crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.9557 16 137
5dm5-assembly1.cif.gz_F crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.9543 18 137
5dm5-assembly1.cif.gz_B crystal structure of the hexameric thioesterase y2039 from yersinia pestis 0.9543 18 137
3bjk-assembly1.cif.gz_D crystal structure of hi0827, a hexameric broad specificity acyl-coenzyme a thioesterase: the asp44ala mutant enzyme 0.9503 19 140
ID Description Score Start End Superfamily
5dm5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.949 16 132 3.10.129.10
1nngB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9471 19 140 3.10.129.10
3b7kC02 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9423 24 126 3.10.129.10
5dm5A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9412 16 132 3.10.129.10
3d6lA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9387 20 137 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3N2QXF4-F1-model_v4 Acyl-CoA thioesterase 0.986 16 137 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A240E9R3-F1-model_v4 Acyl-CoA thioesterase YciA 0.9786 14 138 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A356IIP3-F1-model_v4 Acyl-CoA thioesterase 0.9756 20 140 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A4Q2R961-F1-model_v4 Acyl-CoA thioester hydrolase YciA 0.975 15 139 GO:0005829
GO:0006637
GO:0009062
GO:0052816
AF-A0A7Y8N2W3-F1-model_v4 deleted 0.9744 20 140

Feature Viewer

pLDDT pTM Quality
87.15 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map