F489638
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1079 | 453 | 1043 | 143 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10008914|Ga0099794_100089146 |
| Length | 159 |
| Sequence | MSVCSIERDAPDEHQMTDSQAVHAPLNTENEPCGDLSIRTLAMPADTNQNGDIFGGWLLSQMDIGGGIFASKVARSRTVTVAIEAMNFRKSVFVGDVVSVHANLVRIGKTSVTVHLEAWVKRRKEMQSILVTDGNFTYVSIDDQGHPQVIKRDEPPISA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 2 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 7 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 8 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 9 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 10 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 11 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 12 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 13 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 14 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 15 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 16 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 17 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 18 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 19 | 2904699407 | |||
| 20 | 2906610324 | |||
| 21 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 22 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 23 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 24 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 25 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 26 | 2922425934 | |||
| 27 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 28 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 29 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 30 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 31 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 32 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 33 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 70 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 79 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 92 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 94 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 95 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 96 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 97 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 98 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 103 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 110 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 112 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 113 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 114 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 140 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 144 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 215 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 216 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 220 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 228 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 229 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 232 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 238 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 239 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 241 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 242 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 257 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 266 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 267 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 268 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 271 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 272 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 275 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 354 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 355 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 356 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 357 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 358 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 359 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 361 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 362 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 363 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 364 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 365 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 366 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 367 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 368 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 369 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 370 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 371 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 372 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 373 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 374 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 375 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 376 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 377 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 405 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 414 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 415 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 416 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 427 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 428 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 429 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 430 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 431 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 432 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 433 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 434 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 435 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 436 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 437 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 438 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 439 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 440 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 441 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 442 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 443 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 444 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 445 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 446 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 447 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 448 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 449 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 450 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 451 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 452 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 453 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.65 |
| Metatranscriptomes | 0.28 |
| Isolates | 3.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.14 |
| Nodule | 2.32 |
| Rhizoplane | 6.12 |
| Rhizosphere | 79.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10084309 | 3300001979 | Bacteria | 828 |
| 2 | JGI25153J46596_10003620 | 3300003215 | Bacteria | 8577 |
| 3 | Ga0070658_10412460 | 3300005327 | Bacteria | 1161 |
| 4 | Ga0070658_10678046 | 3300005327 | Bacteria | 894 |
| 5 | Ga0070676_10386348 | 3300005328 | Bacteria | 970 |
| 6 | Ga0070683_100003964 | 3300005329 | Bacteria | 12115 |
| 7 | Ga0070683_100079622 | 3300005329 | Bacteria | 3066 |
| 8 | Ga0070683_100164572 | 3300005329 | Bacteria | 2104 |
| 9 | Ga0070683_100827681 | 3300005329 | Bacteria | 888 |
| 10 | Ga0068869_100015386 | 3300005334 | Bacteria | 5130 |
| 11 | Ga0070680_100002273 | 3300005336 | Bacteria | 14200 |
| 12 | Ga0070680_100022993 | 3300005336 | Bacteria | 4968 |
| 13 | Ga0070680_100055170 | 3300005336 | Bacteria | 3247 |
| 14 | Ga0070680_100068558 | 3300005336 | Bacteria | 2912 |
| 15 | Ga0070680_100362859 | 3300005336 | Bacteria | 1232 |
| 16 | Ga0070680_100497560 | 3300005336 | Bacteria | 1043 |
| 17 | Ga0070680_100938049 | 3300005336 | Bacteria | 747 |
| 18 | Ga0070682_100003870 | 3300005337 | Bacteria | 8307 |
| 19 | Ga0070682_100938741 | 3300005337 | Bacteria | 714 |
| 20 | Ga0068868_100030028 | 3300005338 | Bacteria | 4167 |
| 21 | Ga0068868_100169058 | 3300005338 | Bacteria | 1809 |
| 22 | Ga0068868_100282404 | 3300005338 | Bacteria | 1405 |
| 23 | Ga0070660_100012040 | 3300005339 | Bacteria | 6170 |
| 24 | Ga0070660_100137772 | 3300005339 | Bacteria | 1956 |
| 25 | Ga0070691_10031624 | 3300005341 | Bacteria | 2483 |
| 26 | Ga0070691_10525261 | 3300005341 | Bacteria | 688 |
| 27 | Ga0070691_10760503 | 3300005341 | Bacteria | 587 |
| 28 | Ga0070661_100059734 | 3300005344 | Bacteria | 2797 |
| 29 | Ga0070661_100200692 | 3300005344 | Bacteria | 1524 |
| 30 | Ga0070661_100994451 | 3300005344 | Bacteria | 695 |
| 31 | Ga0070668_101229091 | 3300005347 | Bacteria | 679 |
| 32 | Ga0070671_100216287 | 3300005355 | Bacteria | 1626 |
| 33 | Ga0070671_100267297 | 3300005355 | Bacteria | 1453 |
| 34 | Ga0070673_100152900 | 3300005364 | Bacteria | 1956 |
| 35 | Ga0070673_101467808 | 3300005364 | Bacteria | 643 |
| 36 | Ga0070688_100982178 | 3300005365 | Bacteria | 670 |
| 37 | Ga0070659_100159506 | 3300005366 | Bacteria | 1844 |
| 38 | Ga0070659_100172418 | 3300005366 | Bacteria | 1773 |
| 39 | Ga0070659_100218186 | 3300005366 | Bacteria | 1573 |
| 40 | Ga0070659_100242989 | 3300005366 | Bacteria | 1490 |
| 41 | Ga0070659_101422310 | 3300005366 | Bacteria | 617 |
| 42 | Ga0070667_100741837 | 3300005367 | Bacteria | 910 |
| 43 | Ga0070667_101582433 | 3300005367 | Bacteria | 616 |
| 44 | Ga0070709_10023329 | 3300005434 | Bacteria | 3630 |
| 45 | Ga0070709_10073035 | 3300005434 | Bacteria | 2220 |
| 46 | Ga0070714_100042125 | 3300005435 | Bacteria | 3856 |
| 47 | Ga0070714_100157305 | 3300005435 | Bacteria | 2053 |
| 48 | Ga0070714_101121316 | 3300005435 | Bacteria | 767 |
| 49 | Ga0070713_100002836 | 3300005436 | Bacteria | 11341 |
| 50 | Ga0070713_100031026 | 3300005436 | Bacteria | 4252 |
| 51 | Ga0070713_100063352 | 3300005436 | Bacteria | 3099 |
| 52 | Ga0070710_10000933 | 3300005437 | Bacteria | 13902 |
| 53 | Ga0070710_10030040 | 3300005437 | Bacteria | 2921 |
| 54 | Ga0070701_10143854 | 3300005438 | Bacteria | 1367 |
| 55 | Ga0070711_100016753 | 3300005439 | Bacteria | 4658 |
| 56 | Ga0070711_100102989 | 3300005439 | Bacteria | 2080 |
| 57 | Ga0070711_100185301 | 3300005439 | Bacteria | 1595 |
| 58 | Ga0070711_100317394 | 3300005439 | Bacteria | 1244 |
| 59 | Ga0070711_100558258 | 3300005439 | Bacteria | 951 |
| 60 | Ga0070711_101947039 | 3300005439 | Bacteria | 517 |
| 61 | Ga0070705_100506717 | 3300005440 | Bacteria | 917 |
| 62 | Ga0070700_100893457 | 3300005441 | Bacteria | 723 |
| 63 | Ga0070708_100539136 | 3300005445 | Bacteria | 1101 |
| 64 | Ga0070663_100016039 | 3300005455 | Bacteria | 4852 |
| 65 | Ga0070663_100050610 | 3300005455 | Bacteria | 2956 |
| 66 | Ga0070663_100334579 | 3300005455 | Bacteria | 1221 |
| 67 | Ga0070663_100386757 | 3300005455 | Bacteria | 1140 |
| 68 | Ga0070678_100066664 | 3300005456 | Bacteria | 2677 |
| 69 | Ga0070678_100192514 | 3300005456 | Bacteria | 1677 |
| 70 | Ga0070662_100197923 | 3300005457 | Bacteria | 1593 |
| 71 | Ga0070662_100397645 | 3300005457 | Bacteria | 1136 |
| 72 | Ga0070662_100711961 | 3300005457 | Bacteria | 850 |
| 73 | Ga0070681_10013875 | 3300005458 | Bacteria | 8019 |
| 74 | Ga0070681_10044746 | 3300005458 | Bacteria | 4431 |
| 75 | Ga0070681_10075021 | 3300005458 | Bacteria | 3342 |
| 76 | Ga0070681_10109202 | 3300005458 | Bacteria | 2706 |
| 77 | Ga0070681_10482263 | 3300005458 | Bacteria | 1153 |
| 78 | Ga0070681_10748817 | 3300005458 | Bacteria | 894 |
| 79 | Ga0070681_11053154 | 3300005458 | Bacteria | 734 |
| 80 | Ga0068867_100618778 | 3300005459 | Bacteria | 946 |
| 81 | Ga0070698_100136725 | 3300005471 | Bacteria | 2404 |
| 82 | Ga0070698_101561736 | 3300005471 | Bacteria | 612 |
| 83 | Ga0070699_101415470 | 3300005518 | Bacteria | 638 |
| 84 | Ga0070679_100006191 | 3300005530 | Bacteria | 11141 |
| 85 | Ga0070679_100044706 | 3300005530 | Bacteria | 4412 |
| 86 | Ga0070679_100055570 | 3300005530 | Bacteria | 3942 |
| 87 | Ga0070679_100123421 | 3300005530 | Bacteria | 2573 |
| 88 | Ga0070679_100142594 | 3300005530 | Bacteria | 2374 |
| 89 | Ga0070679_100607748 | 3300005530 | Bacteria | 1037 |
| 90 | Ga0070684_100013415 | 3300005535 | Bacteria | 6606 |
| 91 | Ga0070684_100072576 | 3300005535 | Bacteria | 3030 |
| 92 | Ga0070684_100262869 | 3300005535 | Bacteria | 1579 |
| 93 | Ga0070684_101840348 | 3300005535 | Bacteria | 571 |
| 94 | Ga0070697_100038617 | 3300005536 | Bacteria | 3858 |
| 95 | Ga0070697_100043484 | 3300005536 | Bacteria | 3638 |
| 96 | Ga0070697_100379741 | 3300005536 | Bacteria | 1224 |
| 97 | Ga0068853_100013651 | 3300005539 | Bacteria | 6637 |
| 98 | Ga0068853_100013662 | 3300005539 | Bacteria | 6635 |
| 99 | Ga0068853_100055331 | 3300005539 | Bacteria | 3420 |
| 100 | Ga0068853_100108774 | 3300005539 | Bacteria | 2460 |
| 101 | Ga0068853_100196930 | 3300005539 | Bacteria | 1832 |
| 102 | Ga0068853_100346712 | 3300005539 | Bacteria | 1381 |
| 103 | Ga0068853_100503458 | 3300005539 | Bacteria | 1144 |
| 104 | Ga0068853_100642569 | 3300005539 | Bacteria | 1009 |
| 105 | Ga0070695_100020357 | 3300005545 | Bacteria | 4050 |
| 106 | Ga0070695_100189578 | 3300005545 | Bacteria | 1462 |
| 107 | Ga0070695_100605293 | 3300005545 | Bacteria | 861 |
| 108 | Ga0070695_100855836 | 3300005545 | Bacteria | 732 |
| 109 | Ga0070693_100127834 | 3300005547 | Bacteria | 1584 |
| 110 | Ga0070693_100167943 | 3300005547 | Bacteria | 1403 |
| 111 | Ga0070665_100086794 | 3300005548 | Bacteria | 3134 |
| 112 | Ga0070665_100287823 | 3300005548 | Bacteria | 1645 |
| 113 | Ga0070665_101579763 | 3300005548 | Bacteria | 664 |
| 114 | Ga0070704_100008485 | 3300005549 | Bacteria | 6165 |
| 115 | Ga0070704_100289844 | 3300005549 | Bacteria | 1360 |
| 116 | Ga0068855_100015735 | 3300005563 | Bacteria | 9100 |
| 117 | Ga0068855_100071280 | 3300005563 | Bacteria | 4041 |
| 118 | Ga0068855_100081934 | 3300005563 | Bacteria | 3740 |
| 119 | Ga0068855_100117221 | 3300005563 | Bacteria | 3051 |
| 120 | Ga0068855_100128245 | 3300005563 | Bacteria | 2899 |
| 121 | Ga0068855_100131157 | 3300005563 | Bacteria | 2862 |
| 122 | Ga0068855_100163677 | 3300005563 | Bacteria | 2523 |
| 123 | Ga0068855_100274313 | 3300005563 | Bacteria | 1874 |
| 124 | Ga0068855_100452624 | 3300005563 | Bacteria | 1400 |
| 125 | Ga0068855_100675651 | 3300005563 | Bacteria | 1107 |
| 126 | Ga0070664_100151452 | 3300005564 | Bacteria | 2048 |
| 127 | Ga0070664_100326781 | 3300005564 | Bacteria | 1391 |
| 128 | Ga0070664_100360971 | 3300005564 | Bacteria | 1323 |
| 129 | Ga0068857_100020118 | 3300005577 | Bacteria | 5867 |
| 130 | Ga0068857_100042050 | 3300005577 | Bacteria | 4053 |
| 131 | Ga0068857_100042440 | 3300005577 | Bacteria | 4035 |
| 132 | Ga0068857_100057180 | 3300005577 | Bacteria | 3462 |
| 133 | Ga0068857_100061246 | 3300005577 | Bacteria | 3343 |
| 134 | Ga0068854_100009074 | 3300005578 | Bacteria | 6409 |
| 135 | Ga0068854_100096172 | 3300005578 | Bacteria | 2212 |
| 136 | Ga0068854_100098929 | 3300005578 | Bacteria | 2184 |
| 137 | Ga0068854_100517428 | 3300005578 | Bacteria | 1007 |
| 138 | Ga0068854_101554221 | 3300005578 | Bacteria | 602 |
| 139 | Ga0068854_102097539 | 3300005578 | Bacteria | 522 |
| 140 | Ga0068856_100000217 | 3300005614 | Bacteria | 61831 |
| 141 | Ga0068856_100003953 | 3300005614 | Bacteria | 14841 |
| 142 | Ga0068856_100084670 | 3300005614 | Bacteria | 3150 |
| 143 | Ga0068856_100171502 | 3300005614 | Bacteria | 2182 |
| 144 | Ga0068856_100991027 | 3300005614 | Bacteria | 859 |
| 145 | Ga0068856_101835309 | 3300005614 | Bacteria | 618 |
| 146 | Ga0070702_100144460 | 3300005615 | Bacteria | 1519 |
| 147 | Ga0068852_100009784 | 3300005616 | Bacteria | 7127 |
| 148 | Ga0068852_100023356 | 3300005616 | Bacteria | 4976 |
| 149 | Ga0068852_100046151 | 3300005616 | Bacteria | 3711 |
| 150 | Ga0068852_100057125 | 3300005616 | Bacteria | 3375 |
| 151 | Ga0068852_100309219 | 3300005616 | Bacteria | 1532 |
| 152 | Ga0068859_101490472 | 3300005617 | Bacteria | 746 |
| 153 | Ga0068864_100024784 | 3300005618 | Bacteria | 5047 |
| 154 | Ga0068864_100086389 | 3300005618 | Bacteria | 2759 |
| 155 | Ga0068864_101883275 | 3300005618 | Bacteria | 604 |
| 156 | Ga0068861_100376017 | 3300005719 | Bacteria | 1253 |
| 157 | Ga0068851_10001080 | 3300005834 | Bacteria | 11820 |
| 158 | Ga0068851_10007939 | 3300005834 | Bacteria | 4893 |
| 159 | Ga0068851_10494069 | 3300005834 | Bacteria | 733 |
| 160 | Ga0068870_10231807 | 3300005840 | Bacteria | 1136 |
| 161 | Ga0068863_100034349 | 3300005841 | Bacteria | 4831 |
| 162 | Ga0068858_100113683 | 3300005842 | Bacteria | 2528 |
| 163 | Ga0068858_101461469 | 3300005842 | Bacteria | 674 |
| 164 | Ga0068860_100573107 | 3300005843 | Bacteria | 1132 |
| 165 | Ga0068862_100366826 | 3300005844 | Bacteria | 1339 |
| 166 | Ga0068862_100382220 | 3300005844 | Bacteria | 1313 |
| 167 | Ga0068862_101124203 | 3300005844 | Bacteria | 781 |
| 168 | Ga0081455_10006836 | 3300005937 | Bacteria | 12152 |
| 169 | Ga0081540_1002541 | 3300005983 | Bacteria | 14800 |
| 170 | Ga0081540_1010845 | 3300005983 | Bacteria | 6125 |
| 171 | Ga0081540_1058985 | 3300005983 | Bacteria | 1845 |
| 172 | Ga0070717_10000851 | 3300006028 | Bacteria | 20235 |
| 173 | Ga0070717_10002091 | 3300006028 | Bacteria | 13991 |
| 174 | Ga0070717_10486552 | 3300006028 | Bacteria | 1114 |
| 175 | Ga0075365_10001178 | 3300006038 | Bacteria | 11489 |
| 176 | Ga0075365_10047222 | 3300006038 | Bacteria | 2829 |
| 177 | Ga0075365_10065154 | 3300006038 | Bacteria | 2441 |
| 178 | Ga0075365_10287239 | 3300006038 | Bacteria | 1157 |
| 179 | Ga0075365_10444706 | 3300006038 | Bacteria | 915 |
| 180 | Ga0075368_10019165 | 3300006042 | Bacteria | 2581 |
| 181 | Ga0075363_100030294 | 3300006048 | Bacteria | 2800 |
| 182 | Ga0075363_100200181 | 3300006048 | Bacteria | 1141 |
| 183 | Ga0075363_100607542 | 3300006048 | Bacteria | 656 |
| 184 | Ga0075364_10065790 | 3300006051 | Bacteria | 2380 |
| 185 | Ga0075364_10084281 | 3300006051 | Bacteria | 2104 |
| 186 | Ga0075364_10167889 | 3300006051 | Bacteria | 1483 |
| 187 | Ga0070715_10004429 | 3300006163 | Bacteria | 4608 |
| 188 | Ga0070716_100010202 | 3300006173 | Bacteria | 4706 |
| 189 | Ga0070716_100074228 | 3300006173 | Bacteria | 2009 |
| 190 | Ga0070716_100181662 | 3300006173 | Bacteria | 1382 |
| 191 | Ga0070712_101548153 | 3300006175 | Bacteria | 580 |
| 192 | Ga0070712_102033410 | 3300006175 | Bacteria | 503 |
| 193 | Ga0075362_10103282 | 3300006177 | Bacteria | 1335 |
| 194 | Ga0075362_10627797 | 3300006177 | Bacteria | 557 |
| 195 | Ga0075367_10014213 | 3300006178 | Bacteria | 4304 |
| 196 | Ga0075367_10053655 | 3300006178 | Bacteria | 2389 |
| 197 | Ga0075367_10115824 | 3300006178 | Bacteria | 1648 |
| 198 | Ga0075367_10553360 | 3300006178 | Bacteria | 731 |
| 199 | Ga0075369_10074750 | 3300006186 | Bacteria | 1495 |
| 200 | Ga0075369_10471773 | 3300006186 | Bacteria | 595 |
| 201 | Ga0097621_100214525 | 3300006237 | Bacteria | 1675 |
| 202 | Ga0097621_100220989 | 3300006237 | Bacteria | 1651 |
| 203 | Ga0097621_100804800 | 3300006237 | Bacteria | 871 |
| 204 | Ga0075370_10137360 | 3300006353 | Bacteria | 1428 |
| 205 | Ga0068871_100793340 | 3300006358 | Bacteria | 872 |
| 206 | Ga0075433_10411595 | 3300006852 | Bacteria | 1193 |
| 207 | Ga0075434_100011681 | 3300006871 | Bacteria | 8294 |
| 208 | Ga0075434_100125946 | 3300006871 | Bacteria | 2579 |
| 209 | Ga0075429_101013421 | 3300006880 | Bacteria | 726 |
| 210 | Ga0075429_101542139 | 3300006880 | Bacteria | 578 |
| 211 | Ga0075436_100032312 | 3300006914 | Bacteria | 3607 |
| 212 | Ga0097620_101490507 | 3300006931 | Bacteria | 746 |
| 213 | Ga0075435_100044739 | 3300007076 | Bacteria | 3547 |
| 214 | Ga0075435_100087178 | 3300007076 | Bacteria | 2571 |
| 215 | Ga0075435_100214341 | 3300007076 | Bacteria | 1634 |
| 216 | Ga0099794_10008914 | 3300007265 | Bacteria | 4183 |
| 217 | Ga0099794_10030714 | 3300007265 | Bacteria | 2511 |
| 218 | Ga0099794_10136813 | 3300007265 | Bacteria | 1239 |
| 219 | Ga0099794_10160171 | 3300007265 | Bacteria | 1145 |
| 220 | Ga0099795_10034354 | 3300007788 | Bacteria | 1766 |
| 221 | Ga0099795_10117919 | 3300007788 | Bacteria | 1058 |
| 222 | Ga0105250_10176393 | 3300009092 | Bacteria | 896 |
| 223 | Ga0105240_10005613 | 3300009093 | Bacteria | 18626 |
| 224 | Ga0105240_10016416 | 3300009093 | Bacteria | 10025 |
| 225 | Ga0105240_10099064 | 3300009093 | Bacteria | 3548 |
| 226 | Ga0105240_10124519 | 3300009093 | Bacteria | 3099 |
| 227 | Ga0105240_10654067 | 3300009093 | Bacteria | 1151 |
| 228 | Ga0105240_11357771 | 3300009093 | Bacteria | 748 |
| 229 | Ga0111539_11892877 | 3300009094 | Bacteria | 692 |
| 230 | Ga0105245_10070474 | 3300009098 | Bacteria | 3172 |
| 231 | Ga0105245_10484188 | 3300009098 | Bacteria | 1251 |
| 232 | Ga0105245_10929987 | 3300009098 | Bacteria | 912 |
| 233 | Ga0105247_10118533 | 3300009101 | Bacteria | 1712 |
| 234 | Ga0105247_10422074 | 3300009101 | Bacteria | 955 |
| 235 | Ga0105247_10604256 | 3300009101 | Bacteria | 814 |
| 236 | Ga0105243_10445796 | 3300009148 | Bacteria | 1213 |
| 237 | Ga0105243_10541592 | 3300009148 | Bacteria | 1110 |
| 238 | Ga0105243_11006571 | 3300009148 | Bacteria | 836 |
| 239 | Ga0105241_10002158 | 3300009174 | Bacteria | 14829 |
| 240 | Ga0105241_10040893 | 3300009174 | Bacteria | 3501 |
| 241 | Ga0105241_10064090 | 3300009174 | Bacteria | 2837 |
| 242 | Ga0105241_10096656 | 3300009174 | Bacteria | 2340 |
| 243 | Ga0105241_10274619 | 3300009174 | Bacteria | 1437 |
| 244 | Ga0105241_10592683 | 3300009174 | Bacteria | 1000 |
| 245 | Ga0105242_11741590 | 3300009176 | Bacteria | 660 |
| 246 | Ga0105248_10020941 | 3300009177 | Bacteria | 7247 |
| 247 | Ga0105237_10019705 | 3300009545 | Bacteria | 6964 |
| 248 | Ga0105237_10048626 | 3300009545 | Bacteria | 4263 |
| 249 | Ga0105237_10102579 | 3300009545 | Bacteria | 2852 |
| 250 | Ga0105237_10354544 | 3300009545 | Bacteria | 1471 |
| 251 | Ga0105237_10459415 | 3300009545 | Bacteria | 1279 |
| 252 | Ga0105237_10632851 | 3300009545 | Bacteria | 1077 |
| 253 | Ga0105237_10783784 | 3300009545 | Bacteria | 960 |
| 254 | Ga0105238_10020302 | 3300009551 | Bacteria | 6763 |
| 255 | Ga0105238_10054925 | 3300009551 | Bacteria | 3999 |
| 256 | Ga0105238_10076860 | 3300009551 | Bacteria | 3331 |
| 257 | Ga0105238_10099537 | 3300009551 | Bacteria | 2890 |
| 258 | Ga0105238_10131256 | 3300009551 | Bacteria | 2483 |
| 259 | Ga0105238_10438766 | 3300009551 | Bacteria | 1302 |
| 260 | Ga0105238_10452935 | 3300009551 | Bacteria | 1280 |
| 261 | Ga0105238_11480337 | 3300009551 | Bacteria | 707 |
| 262 | Ga0105249_10002531 | 3300009553 | Bacteria | 15819 |
| 263 | Ga0105249_11935997 | 3300009553 | Bacteria | 662 |
| 264 | Ga0099796_10015444 | 3300010159 | Bacteria | 2232 |
| 265 | Ga0099796_10067998 | 3300010159 | Bacteria | 1279 |
| 266 | Ga0105239_10038407 | 3300010375 | Bacteria | 5247 |
| 267 | Ga0105239_10075551 | 3300010375 | Bacteria | 3705 |
| 268 | Ga0105239_10325222 | 3300010375 | Bacteria | 1734 |
| 269 | Ga0105239_10385430 | 3300010375 | Bacteria | 1585 |
| 270 | Ga0105239_11096518 | 3300010375 | Bacteria | 916 |
| 271 | Ga0105239_11662826 | 3300010375 | Bacteria | 739 |
| 272 | Ga0105246_10130517 | 3300011119 | Bacteria | 1876 |
| 273 | Ga0105246_10214800 | 3300011119 | Bacteria | 1504 |
| 274 | Ga0157373_10012448 | 3300013100 | Bacteria | 6253 |
| 275 | Ga0157373_10460675 | 3300013100 | Bacteria | 916 |
| 276 | Ga0157371_11128816 | 3300013102 | Bacteria | 602 |
| 277 | Ga0157370_10014857 | 3300013104 | Bacteria | 7945 |
| 278 | Ga0157370_10059963 | 3300013104 | Bacteria | 3614 |
| 279 | Ga0157370_10270395 | 3300013104 | Bacteria | 1570 |
| 280 | Ga0157370_11872048 | 3300013104 | Bacteria | 538 |
| 281 | Ga0157369_10048194 | 3300013105 | Bacteria | 4623 |
| 282 | Ga0157369_10078520 | 3300013105 | Bacteria | 3536 |
| 283 | Ga0157369_10379284 | 3300013105 | Bacteria | 1468 |
| 284 | Ga0157369_11527992 | 3300013105 | Bacteria | 679 |
| 285 | Ga0157374_10318448 | 3300013296 | Bacteria | 1541 |
| 286 | Ga0157374_10532013 | 3300013296 | Bacteria | 1182 |
| 287 | Ga0157374_10633030 | 3300013296 | Bacteria | 1081 |
| 288 | Ga0157378_10010055 | 3300013297 | Bacteria | 8245 |
| 289 | Ga0157378_10144697 | 3300013297 | Bacteria | 2210 |
| 290 | Ga0157378_10147673 | 3300013297 | Bacteria | 2188 |
| 291 | Ga0163162_10038417 | 3300013306 | Bacteria | 4777 |
| 292 | Ga0163162_10086558 | 3300013306 | Bacteria | 3211 |
| 293 | Ga0163162_10455510 | 3300013306 | Bacteria | 1411 |
| 294 | Ga0157372_10004565 | 3300013307 | Bacteria | 14741 |
| 295 | Ga0157372_10533060 | 3300013307 | Bacteria | 1369 |
| 296 | Ga0157372_10679728 | 3300013307 | Bacteria | 1198 |
| 297 | Ga0157372_11290869 | 3300013307 | Bacteria | 842 |
| 298 | Ga0157375_10405941 | 3300013308 | Bacteria | 1529 |
| 299 | Ga0157375_11032767 | 3300013308 | Bacteria | 960 |
| 300 | Ga0157375_11116547 | 3300013308 | Bacteria | 923 |
| 301 | Ga0163163_10058281 | 3300014325 | Bacteria | 3818 |
| 302 | Ga0182008_10254125 | 3300014497 | Bacteria | 907 |
| 303 | Ga0157377_10102115 | 3300014745 | Bacteria | 1710 |
| 304 | Ga0157379_10162863 | 3300014968 | Bacteria | 2013 |
| 305 | Ga0157379_10223506 | 3300014968 | Bacteria | 1706 |
| 306 | Ga0206356_10162217 | 3300020070 | Bacteria | 749 |
| 307 | Ga0213874_10018729 | 3300021377 | Bacteria | 1875 |
| 308 | Ga0209233_1011817 | 3300025261 | Bacteria | 2561 |
| 309 | Ga0209758_1015056 | 3300025297 | Bacteria | 4041 |
| 310 | Ga0207697_10068025 | 3300025315 | Bacteria | 1489 |
| 311 | Ga0207697_10076668 | 3300025315 | Bacteria | 1405 |
| 312 | Ga0207656_10004848 | 3300025321 | Bacteria | 4723 |
| 313 | Ga0207656_10008610 | 3300025321 | Bacteria | 3761 |
| 314 | Ga0207653_10064430 | 3300025885 | Bacteria | 1242 |
| 315 | Ga0207692_10002049 | 3300025898 | Bacteria | 7694 |
| 316 | Ga0207692_10025941 | 3300025898 | Bacteria | 2745 |
| 317 | Ga0207642_10856937 | 3300025899 | Bacteria | 580 |
| 318 | Ga0207710_10021793 | 3300025900 | Bacteria | 2749 |
| 319 | Ga0207710_10368135 | 3300025900 | Bacteria | 734 |
| 320 | Ga0207688_10152574 | 3300025901 | Bacteria | 1365 |
| 321 | Ga0207680_10672501 | 3300025903 | Bacteria | 742 |
| 322 | Ga0207647_10060817 | 3300025904 | Bacteria | 2308 |
| 323 | Ga0207647_10222495 | 3300025904 | Bacteria | 1087 |
| 324 | Ga0207647_10390757 | 3300025904 | Bacteria | 784 |
| 325 | Ga0207685_10108629 | 3300025905 | Bacteria | 1199 |
| 326 | Ga0207699_10004105 | 3300025906 | Bacteria | 6976 |
| 327 | Ga0207699_10704524 | 3300025906 | Bacteria | 739 |
| 328 | Ga0207699_11138615 | 3300025906 | Bacteria | 578 |
| 329 | Ga0207645_10264630 | 3300025907 | Bacteria | 1139 |
| 330 | Ga0207645_10416669 | 3300025907 | Bacteria | 904 |
| 331 | Ga0207643_10050095 | 3300025908 | Bacteria | 2368 |
| 332 | Ga0207705_10048396 | 3300025909 | Bacteria | 3058 |
| 333 | Ga0207705_10123978 | 3300025909 | Bacteria | 1919 |
| 334 | Ga0207684_10767755 | 3300025910 | Bacteria | 816 |
| 335 | Ga0207654_10000358 | 3300025911 | Bacteria | 26923 |
| 336 | Ga0207654_10003362 | 3300025911 | Bacteria | 8100 |
| 337 | Ga0207654_10057787 | 3300025911 | Bacteria | 2256 |
| 338 | Ga0207654_10212208 | 3300025911 | Bacteria | 1280 |
| 339 | Ga0207707_10000183 | 3300025912 | Bacteria | 65793 |
| 340 | Ga0207707_10021814 | 3300025912 | Bacteria | 5597 |
| 341 | Ga0207707_10062133 | 3300025912 | Bacteria | 3250 |
| 342 | Ga0207707_10322129 | 3300025912 | Bacteria | 1334 |
| 343 | Ga0207707_11119159 | 3300025912 | Bacteria | 641 |
| 344 | Ga0207695_10002150 | 3300025913 | Bacteria | 29851 |
| 345 | Ga0207695_10092385 | 3300025913 | Bacteria | 3037 |
| 346 | Ga0207695_10425958 | 3300025913 | Bacteria | 1211 |
| 347 | Ga0207671_10178937 | 3300025914 | Bacteria | 1650 |
| 348 | Ga0207671_10188167 | 3300025914 | Bacteria | 1609 |
| 349 | Ga0207671_10234716 | 3300025914 | Bacteria | 1440 |
| 350 | Ga0207671_10443051 | 3300025914 | Bacteria | 1034 |
| 351 | Ga0207671_10982847 | 3300025914 | Bacteria | 665 |
| 352 | Ga0207693_10000269 | 3300025915 | Bacteria | 47979 |
| 353 | Ga0207693_11275601 | 3300025915 | Bacteria | 551 |
| 354 | Ga0207663_10000096 | 3300025916 | Bacteria | 41229 |
| 355 | Ga0207663_10236845 | 3300025916 | Bacteria | 1336 |
| 356 | Ga0207660_10023670 | 3300025917 | Bacteria | 4150 |
| 357 | Ga0207660_10069162 | 3300025917 | Bacteria | 2563 |
| 358 | Ga0207660_10096617 | 3300025917 | Bacteria | 2200 |
| 359 | Ga0207660_10479831 | 3300025917 | Bacteria | 1007 |
| 360 | Ga0207660_10729217 | 3300025917 | Bacteria | 809 |
| 361 | Ga0207657_10001382 | 3300025919 | Bacteria | 25893 |
| 362 | Ga0207657_10006462 | 3300025919 | Bacteria | 12146 |
| 363 | Ga0207649_10222504 | 3300025920 | Bacteria | 1345 |
| 364 | Ga0207649_10459160 | 3300025920 | Bacteria | 963 |
| 365 | Ga0207652_10020826 | 3300025921 | Bacteria | 5406 |
| 366 | Ga0207652_10038444 | 3300025921 | Bacteria | 4057 |
| 367 | Ga0207652_10059768 | 3300025921 | Bacteria | 3286 |
| 368 | Ga0207652_10077512 | 3300025921 | Bacteria | 2900 |
| 369 | Ga0207652_10088398 | 3300025921 | Bacteria | 2719 |
| 370 | Ga0207652_10124322 | 3300025921 | Bacteria | 2297 |
| 371 | Ga0207652_10171088 | 3300025921 | Bacteria | 1949 |
| 372 | Ga0207652_11077526 | 3300025921 | Bacteria | 704 |
| 373 | Ga0207681_10225047 | 3300025923 | Bacteria | 1453 |
| 374 | Ga0207694_10000491 | 3300025924 | Bacteria | 35820 |
| 375 | Ga0207694_10025960 | 3300025924 | Bacteria | 4454 |
| 376 | Ga0207694_10090730 | 3300025924 | Bacteria | 2411 |
| 377 | Ga0207694_10111406 | 3300025924 | Bacteria | 2177 |
| 378 | Ga0207694_11078741 | 3300025924 | Bacteria | 680 |
| 379 | Ga0207687_10106524 | 3300025927 | Bacteria | 2073 |
| 380 | Ga0207687_10385792 | 3300025927 | Bacteria | 1149 |
| 381 | Ga0207700_10030762 | 3300025928 | Bacteria | 3806 |
| 382 | Ga0207664_10202826 | 3300025929 | Bacteria | 1713 |
| 383 | Ga0207664_10368328 | 3300025929 | Bacteria | 1274 |
| 384 | Ga0207644_10200635 | 3300025931 | Bacteria | 1573 |
| 385 | Ga0207644_10329652 | 3300025931 | Bacteria | 1236 |
| 386 | Ga0207644_10671596 | 3300025931 | Bacteria | 863 |
| 387 | Ga0207690_10046304 | 3300025932 | Bacteria | 2880 |
| 388 | Ga0207690_10100023 | 3300025932 | Bacteria | 2068 |
| 389 | Ga0207690_10230175 | 3300025932 | Bacteria | 1422 |
| 390 | Ga0207706_10050870 | 3300025933 | Bacteria | 3660 |
| 391 | Ga0207706_10217014 | 3300025933 | Bacteria | 1676 |
| 392 | Ga0207686_10779655 | 3300025934 | Bacteria | 765 |
| 393 | Ga0207709_10087617 | 3300025935 | Bacteria | 2024 |
| 394 | Ga0207709_10222826 | 3300025935 | Bacteria | 1361 |
| 395 | Ga0207709_10653648 | 3300025935 | Bacteria | 837 |
| 396 | Ga0207669_10478619 | 3300025937 | Bacteria | 992 |
| 397 | Ga0207704_10820670 | 3300025938 | Bacteria | 778 |
| 398 | Ga0207665_10000104 | 3300025939 | Bacteria | 55188 |
| 399 | Ga0207665_10019587 | 3300025939 | Bacteria | 4449 |
| 400 | Ga0207665_10048415 | 3300025939 | Bacteria | 2853 |
| 401 | Ga0207691_10512795 | 3300025940 | Bacteria | 1018 |
| 402 | Ga0207711_10028374 | 3300025941 | Bacteria | 4709 |
| 403 | Ga0207689_10115421 | 3300025942 | Bacteria | 2207 |
| 404 | Ga0207661_10039177 | 3300025944 | Bacteria | 3718 |
| 405 | Ga0207661_10113555 | 3300025944 | Bacteria | 2295 |
| 406 | Ga0207661_10813694 | 3300025944 | Bacteria | 860 |
| 407 | Ga0207661_10949270 | 3300025944 | Bacteria | 792 |
| 408 | Ga0207679_10058092 | 3300025945 | Bacteria | 2864 |
| 409 | Ga0207679_10320714 | 3300025945 | Bacteria | 1341 |
| 410 | Ga0207679_10347950 | 3300025945 | Bacteria | 1291 |
| 411 | Ga0207679_10421523 | 3300025945 | Bacteria | 1178 |
| 412 | Ga0207679_10630265 | 3300025945 | Bacteria | 968 |
| 413 | Ga0207667_10032720 | 3300025949 | Bacteria | 5598 |
| 414 | Ga0207667_10041172 | 3300025949 | Bacteria | 4915 |
| 415 | Ga0207667_10060913 | 3300025949 | Bacteria | 3950 |
| 416 | Ga0207667_10081604 | 3300025949 | Bacteria | 3350 |
| 417 | Ga0207667_10111120 | 3300025949 | Bacteria | 2827 |
| 418 | Ga0207667_10204620 | 3300025949 | Bacteria | 2024 |
| 419 | Ga0207667_10365346 | 3300025949 | Bacteria | 1471 |
| 420 | Ga0207651_11066868 | 3300025960 | Bacteria | 723 |
| 421 | Ga0207651_11096735 | 3300025960 | Bacteria | 713 |
| 422 | Ga0207712_10033358 | 3300025961 | Bacteria | 3480 |
| 423 | Ga0207668_10056922 | 3300025972 | Bacteria | 2725 |
| 424 | Ga0207668_11440105 | 3300025972 | Bacteria | 621 |
| 425 | Ga0207640_10059871 | 3300025981 | Bacteria | 2515 |
| 426 | Ga0207640_10229976 | 3300025981 | Bacteria | 1426 |
| 427 | Ga0207640_10583733 | 3300025981 | Bacteria | 944 |
| 428 | Ga0207640_10735439 | 3300025981 | Bacteria | 849 |
| 429 | Ga0207658_10646311 | 3300025986 | Bacteria | 953 |
| 430 | Ga0207658_11214743 | 3300025986 | Bacteria | 689 |
| 431 | Ga0207677_10058951 | 3300026023 | Bacteria | 2646 |
| 432 | Ga0207703_10042864 | 3300026035 | Bacteria | 3630 |
| 433 | Ga0207639_10016671 | 3300026041 | Bacteria | 5203 |
| 434 | Ga0207639_10052074 | 3300026041 | Bacteria | 3117 |
| 435 | Ga0207639_10084236 | 3300026041 | Bacteria | 2525 |
| 436 | Ga0207639_10282221 | 3300026041 | Bacteria | 1461 |
| 437 | Ga0207639_10353301 | 3300026041 | Bacteria | 1313 |
| 438 | Ga0207639_10947955 | 3300026041 | Bacteria | 805 |
| 439 | Ga0207639_11123800 | 3300026041 | Bacteria | 737 |
| 440 | Ga0207678_10049171 | 3300026067 | Bacteria | 3644 |
| 441 | Ga0207678_10086523 | 3300026067 | Bacteria | 2678 |
| 442 | Ga0207678_10422840 | 3300026067 | Bacteria | 1155 |
| 443 | Ga0207708_10958335 | 3300026075 | Bacteria | 742 |
| 444 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 445 | Ga0207702_10001581 | 3300026078 | Bacteria | 22550 |
| 446 | Ga0207702_10449499 | 3300026078 | Bacteria | 1250 |
| 447 | Ga0207702_10706647 | 3300026078 | Bacteria | 994 |
| 448 | Ga0207702_10710806 | 3300026078 | Bacteria | 991 |
| 449 | Ga0207702_11540266 | 3300026078 | Bacteria | 658 |
| 450 | Ga0207641_10048178 | 3300026088 | Bacteria | 3596 |
| 451 | Ga0207641_12419811 | 3300026088 | Bacteria | 524 |
| 452 | Ga0207648_10318615 | 3300026089 | Bacteria | 1397 |
| 453 | Ga0207676_10121531 | 3300026095 | Bacteria | 2203 |
| 454 | Ga0207676_10212243 | 3300026095 | Bacteria | 1718 |
| 455 | Ga0207674_10010369 | 3300026116 | Bacteria | 10561 |
| 456 | Ga0207674_10013847 | 3300026116 | Bacteria | 8924 |
| 457 | Ga0207674_10026698 | 3300026116 | Bacteria | 6126 |
| 458 | Ga0207674_10043409 | 3300026116 | Bacteria | 4636 |
| 459 | Ga0207674_10074949 | 3300026116 | Bacteria | 3394 |
| 460 | Ga0207674_10130613 | 3300026116 | Bacteria | 2475 |
| 461 | Ga0207675_100134494 | 3300026118 | Bacteria | 2345 |
| 462 | Ga0207683_10078559 | 3300026121 | Bacteria | 2924 |
| 463 | Ga0207683_10256196 | 3300026121 | Bacteria | 1597 |
| 464 | Ga0207683_10379938 | 3300026121 | Bacteria | 1298 |
| 465 | Ga0207698_10017298 | 3300026142 | Bacteria | 4888 |
| 466 | Ga0207698_10021472 | 3300026142 | Bacteria | 4466 |
| 467 | Ga0207698_10051950 | 3300026142 | Bacteria | 3137 |
| 468 | Ga0207698_10054092 | 3300026142 | Bacteria | 3086 |
| 469 | Ga0207698_10300379 | 3300026142 | Bacteria | 1494 |
| 470 | Ga0207698_11739866 | 3300026142 | Bacteria | 639 |
| 471 | Ga0209179_1004354 | 3300027512 | Bacteria | 2129 |
| 472 | Ga0209588_1007193 | 3300027671 | Bacteria | 3265 |
| 473 | Ga0209813_10034886 | 3300027866 | Bacteria | 1504 |
| 474 | Ga0209813_10053603 | 3300027866 | Bacteria | 1268 |
| 475 | Ga0209813_10060064 | 3300027866 | Bacteria | 1212 |
| 476 | Ga0268266_10040140 | 3300028379 | Bacteria | 3988 |
| 477 | Ga0268265_10113824 | 3300028380 | Bacteria | 2214 |
| 478 | Ga0268265_11059051 | 3300028380 | Bacteria | 803 |
| 479 | Ga0268264_10338604 | 3300028381 | Bacteria | 1428 |
| 480 | Ga0268264_11868550 | 3300028381 | Bacteria | 610 |
| 481 | Ga0307515_10370212 | 3300028794 | Bacteria | 1070 |
| 482 | Ga0307512_10165615 | 3300030522 | Bacteria | 1282 |
| 483 | Ga0265762_1021234 | 3300030760 | Bacteria | 1196 |
| 484 | Ga0265763_1039418 | 3300030763 | Bacteria | 565 |
| 485 | Ga0265332_10220541 | 3300031238 | Bacteria | 787 |
| 486 | Ga0265331_10006331 | 3300031250 | Bacteria | 7009 |
| 487 | Ga0265316_10498635 | 3300031344 | Bacteria | 870 |
| 488 | Ga0307513_10242857 | 3300031456 | Bacteria | 1604 |
| 489 | Ga0307509_10371502 | 3300031507 | Bacteria | 1146 |
| 490 | Ga0307408_100113900 | 3300031548 | Bacteria | 2082 |
| 491 | Ga0307508_10097824 | 3300031616 | Bacteria | 2527 |
| 492 | Ga0265314_10155411 | 3300031711 | Bacteria | 1397 |
| 493 | Ga0265342_10002958 | 3300031712 | Bacteria | 14291 |
| 494 | Ga0307516_10192735 | 3300031730 | Bacteria | 1763 |
| 495 | Ga0307406_10500803 | 3300031901 | Bacteria | 985 |
| 496 | Ga0307412_10722316 | 3300031911 | Bacteria | 857 |
| 497 | Ga0307412_10970404 | 3300031911 | Bacteria | 749 |
| 498 | Ga0307415_100162761 | 3300032126 | Bacteria | 1731 |
| 499 | Ga0307510_10036728 | 3300033180 | Bacteria | 5450 |
| 500 | Ga0307510_10229328 | 3300033180 | Bacteria | 1361 |
| 501 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 502 | Ga0373926_0009290 | 3300035083 | Bacteria | 3283 |
| 503 | Ga0373934_0068318 | 3300035086 | Bacteria | 1420 |
| 504 | Ga0373944_0009603 | 3300035089 | Bacteria | 2627 |
| 505 | Ga0373923_0042643 | 3300035111 | Bacteria | 1875 |
| 506 | Ga0373923_0046874 | 3300035111 | Bacteria | 1799 |
| 507 | Ga0373936_0017300 | 3300035113 | Bacteria | 2775 |
| 508 | Ga0373936_0037042 | 3300035113 | Bacteria | 1947 |
| 509 | Ga0373939_0541396 | 3300035114 | Bacteria | 502 |
| 510 | Ga0373945_0148279 | 3300035116 | Bacteria | 949 |
| 511 | Ga0373945_0255021 | 3300035116 | Bacteria | 742 |
| 512 | Ga0373953_0047024 | 3300035117 | Bacteria | 1735 |
| 513 | Ga0373953_0064513 | 3300035117 | Bacteria | 1502 |
| 514 | Ga0373954_0056287 | 3300035118 | Bacteria | 1850 |
| 515 | Ga0373954_0103943 | 3300035118 | Bacteria | 1371 |
| 516 | Ga0373954_0621327 | 3300035118 | Bacteria | 536 |
| 517 | Ga0373956_0015097 | 3300035119 | Bacteria | 3230 |
| 518 | Ga0373957_0058898 | 3300035120 | Bacteria | 1484 |
| 519 | Ga0373957_0231513 | 3300035120 | Bacteria | 775 |
| 520 | Ga0373943_0043404 | 3300035170 | Bacteria | 2183 |
| 521 | Ga0373946_0043799 | 3300035171 | Bacteria | 1845 |
| 522 | Ga0373946_0139035 | 3300035171 | Bacteria | 1124 |
| 523 | Ga0373955_0024852 | 3300035172 | Bacteria | 3068 |
| 524 | Ga0373955_0033080 | 3300035172 | Bacteria | 2720 |
| 525 | Ga0373955_0057334 | 3300035172 | Bacteria | 2140 |
| 526 | Ga0373924_0031722 | 3300035410 | Bacteria | 2126 |
| 527 | Ga0373924_0112886 | 3300035410 | Bacteria | 1175 |
| 528 | Ga0373931_0031876 | 3300035691 | Bacteria | 2724 |
| 529 | Ga0373935_0000493 | 3300035692 | Bacteria | 20439 |
| 530 | Ga0373935_0007392 | 3300035692 | Bacteria | 6572 |
| 531 | Ga0373935_0040922 | 3300035692 | Bacteria | 2910 |
| 532 | Ga0373927_0000331 | 3300035695 | Bacteria | 37139 |
| 533 | Ga0373927_0012394 | 3300035695 | Bacteria | 5675 |
| 534 | Ga0373927_0819604 | 3300035695 | Bacteria | 614 |
| 535 | Ga0373933_0000272 | 3300035724 | Bacteria | 33654 |
| 536 | Ga0373933_0038006 | 3300035724 | Bacteria | 2827 |
| 537 | Ga0373933_0393415 | 3300035724 | Bacteria | 903 |
| 538 | Ga0373947_0002830 | 3300035725 | Bacteria | 10355 |
| 539 | Ga0373947_0021069 | 3300035725 | Bacteria | 3771 |
| 540 | Ga0373947_0076095 | 3300035725 | Bacteria | 2068 |
| 541 | Ga0373937_0008766 | 3300036401 | Bacteria | 8778 |
| 542 | Ga0373937_0042265 | 3300036401 | Bacteria | 4157 |
| 543 | Ga0373937_0071845 | 3300036401 | Bacteria | 3191 |
| 544 | Ga0373937_0276180 | 3300036401 | Bacteria | 1586 |
| 545 | Ga0373937_1266934 | 3300036401 | Bacteria | 685 |
| 546 | Ga0373925_0004263 | 3300037068 | Bacteria | 10834 |
| 547 | Ga0373925_0182984 | 3300037068 | Bacteria | 1660 |
| 548 | Ga0373925_0222747 | 3300037068 | Bacteria | 1506 |
| 549 | Ga0373925_0421026 | 3300037068 | Bacteria | 1091 |
| 550 | Ga0395900_0166816 | 3300037418 | Bacteria | 2244 |
| 551 | Ga0395898_0146205 | 3300037466 | Bacteria | 2262 |
| 552 | Ga0395898_0166907 | 3300037466 | Bacteria | 2105 |
| 553 | Ga0395905_0505853 | 3300037471 | Bacteria | 1108 |
| 554 | Ga0395905_0675452 | 3300037471 | Bacteria | 935 |
| 555 | Ga0395901_0470988 | 3300038443 | Bacteria | 1282 |
| 556 | Ga0395901_0941018 | 3300038443 | Bacteria | 843 |
| 557 | Ga0436365_0781961 | 3300039437 | Bacteria | 572 |
| 558 | Ga0436365_1855944 | 3300039437 | Bacteria | 1329 |
| 559 | Ga0436361_0297606 | 3300039447 | Bacteria | 903 |
| 560 | Ga0436363_0863724 | 3300039450 | Bacteria | 1366 |
| 561 | Ga0436363_0991916 | 3300039450 | Bacteria | 2051 |
| 562 | Ga0436363_1655123 | 3300039450 | Bacteria | 900 |
| 563 | Ga0451789_0114694 | 3300041443 | Bacteria | 715 |
| 564 | Ga0451797_0871558 | 3300041453 | Bacteria | 933 |
| 565 | Ga0451807_0093477 | 3300041486 | Bacteria | 1012 |
| 566 | Ga0451835_0260168 | 3300041492 | Bacteria | 778 |
| 567 | Ga0439458_0009740 | 3300042157 | Bacteria | 2140 |
| 568 | Ga0466969_0197166 | 3300044656 | Bacteria | 919 |
| 569 | Ga0466965_0138651 | 3300044683 | Bacteria | 1265 |
| 570 | Ga0466966_0553481 | 3300044684 | Bacteria | 692 |
| 571 | Ga0466964_0067938 | 3300044706 | Bacteria | 1500 |
| 572 | Ga0466971_0153010 | 3300044719 | Bacteria | 1077 |
| 573 | Ga0466968_0395778 | 3300044735 | Bacteria | 677 |
| 574 | Ga0466959_0013030 | 3300045049 | Bacteria | 6021 |
| 575 | Ga0466959_0042527 | 3300045049 | Bacteria | 3351 |
| 576 | Ga0466967_0141055 | 3300045976 | Bacteria | 2245 |
| 577 | Ga0466967_0165418 | 3300045976 | Bacteria | 2078 |
| 578 | Ga0466967_0605290 | 3300045976 | Bacteria | 1082 |
| 579 | Ga0495617_122277 | 3300046452 | Bacteria | 838 |
| 580 | Ga0495627_087526 | 3300046453 | Bacteria | 898 |
| 581 | Ga0495592_0006330 | 3300046454 | Bacteria | 8813 |
| 582 | Ga0495592_0021816 | 3300046454 | Bacteria | 4872 |
| 583 | Ga0495603_0000643 | 3300046455 | Bacteria | 19657 |
| 584 | Ga0495603_0037079 | 3300046455 | Bacteria | 2925 |
| 585 | Ga0495603_0037349 | 3300046455 | Bacteria | 2914 |
| 586 | Ga0495603_0037582 | 3300046455 | Bacteria | 2905 |
| 587 | Ga0495603_0199261 | 3300046455 | Bacteria | 1157 |
| 588 | Ga0495603_0371880 | 3300046455 | Bacteria | 820 |
| 589 | Ga0495629_0000423 | 3300046459 | Bacteria | 35258 |
| 590 | Ga0495629_0067609 | 3300046459 | Bacteria | 2493 |
| 591 | Ga0495629_0179129 | 3300046459 | Bacteria | 1469 |
| 592 | Ga0495629_0558886 | 3300046459 | Bacteria | 768 |
| 593 | Ga0495641_0003178 | 3300046461 | Bacteria | 12492 |
| 594 | Ga0495651_0030654 | 3300046462 | Bacteria | 4194 |
| 595 | Ga0495651_0089382 | 3300046462 | Bacteria | 2312 |
| 596 | Ga0495653_0047134 | 3300046463 | Bacteria | 3335 |
| 597 | Ga0495653_0170875 | 3300046463 | Bacteria | 1500 |
| 598 | Ga0495650_0068980 | 3300046471 | Bacteria | 1393 |
| 599 | Ga0495580_0001799 | 3300046472 | Bacteria | 18843 |
| 600 | Ga0495580_0002433 | 3300046472 | Bacteria | 16271 |
| 601 | Ga0495582_0000166 | 3300046473 | Bacteria | 35616 |
| 602 | Ga0495605_0321293 | 3300046474 | Bacteria | 652 |
| 603 | Ga0495605_0431742 | 3300046474 | Bacteria | 544 |
| 604 | Ga0495639_0000306 | 3300046475 | Bacteria | 23854 |
| 605 | Ga0495639_0024678 | 3300046475 | Bacteria | 2647 |
| 606 | Ga0495639_0084506 | 3300046475 | Bacteria | 1482 |
| 607 | Ga0495662_0019982 | 3300046476 | Bacteria | 3240 |
| 608 | Ga0495662_0093108 | 3300046476 | Bacteria | 1471 |
| 609 | Ga0495664_0002707 | 3300046477 | Bacteria | 9527 |
| 610 | Ga0495664_0005452 | 3300046477 | Bacteria | 6986 |
| 611 | Ga0495664_0091326 | 3300046477 | Bacteria | 1830 |
| 612 | Ga0495664_0091908 | 3300046477 | Bacteria | 1825 |
| 613 | Ga0495664_0149781 | 3300046477 | Bacteria | 1415 |
| 614 | Ga0495664_0450544 | 3300046477 | Bacteria | 771 |
| 615 | Ga0495584_0018933 | 3300046491 | Bacteria | 3498 |
| 616 | Ga0495584_0227838 | 3300046491 | Bacteria | 947 |
| 617 | Ga0495584_0291975 | 3300046491 | Bacteria | 828 |
| 618 | Ga0495594_0002782 | 3300046499 | Bacteria | 9074 |
| 619 | Ga0495594_0075067 | 3300046499 | Bacteria | 1884 |
| 620 | Ga0495594_0345256 | 3300046499 | Bacteria | 848 |
| 621 | Ga0495594_0415687 | 3300046499 | Bacteria | 765 |
| 622 | Ga0495606_0001165 | 3300046507 | Bacteria | 37175 |
| 623 | Ga0495606_0340912 | 3300046507 | Bacteria | 798 |
| 624 | Ga0495608_0082145 | 3300046511 | Bacteria | 2092 |
| 625 | Ga0495608_0147841 | 3300046511 | Bacteria | 1498 |
| 626 | Ga0495608_0194068 | 3300046511 | Bacteria | 1281 |
| 627 | Ga0495610_0068686 | 3300046512 | Bacteria | 1660 |
| 628 | Ga0495610_0342685 | 3300046512 | Bacteria | 565 |
| 629 | Ga0495616_0053323 | 3300046513 | Bacteria | 2010 |
| 630 | Ga0495618_0013721 | 3300046514 | Bacteria | 4931 |
| 631 | Ga0495618_0166950 | 3300046514 | Bacteria | 1401 |
| 632 | Ga0495628_0021914 | 3300046516 | Bacteria | 5251 |
| 633 | Ga0495628_0025658 | 3300046516 | Bacteria | 4814 |
| 634 | Ga0495628_0066757 | 3300046516 | Bacteria | 2811 |
| 635 | Ga0495628_0516497 | 3300046516 | Bacteria | 861 |
| 636 | Ga0495630_0005320 | 3300046517 | Bacteria | 9085 |
| 637 | Ga0495630_0128189 | 3300046517 | Bacteria | 1926 |
| 638 | Ga0495631_0036711 | 3300046518 | Bacteria | 2187 |
| 639 | Ga0495632_0191378 | 3300046519 | Bacteria | 934 |
| 640 | Ga0495637_0198126 | 3300046520 | Bacteria | 739 |
| 641 | Ga0495643_0145063 | 3300046522 | Bacteria | 1180 |
| 642 | Ga0495644_0251562 | 3300046523 | Bacteria | 686 |
| 643 | Ga0495648_0146153 | 3300046524 | Bacteria | 1239 |
| 644 | Ga0495663_0029997 | 3300046525 | Bacteria | 1609 |
| 645 | Ga0495666_0031319 | 3300046526 | Bacteria | 2606 |
| 646 | Ga0495652_0011395 | 3300046529 | Bacteria | 8040 |
| 647 | Ga0495652_0138197 | 3300046529 | Bacteria | 1919 |
| 648 | Ga0495652_0173019 | 3300046529 | Bacteria | 1665 |
| 649 | Ga0495652_0348316 | 3300046529 | Bacteria | 1062 |
| 650 | Ga0495665_0000104 | 3300046531 | Bacteria | 39624 |
| 651 | Ga0495665_0056289 | 3300046531 | Bacteria | 2076 |
| 652 | Ga0495640_0043096 | 3300046533 | Bacteria | 3144 |
| 653 | Ga0495586_0090832 | 3300046535 | Bacteria | 1687 |
| 654 | Ga0495586_0192089 | 3300046535 | Bacteria | 1156 |
| 655 | Ga0495586_0287379 | 3300046535 | Bacteria | 941 |
| 656 | Ga0495587_0422757 | 3300046536 | Bacteria | 739 |
| 657 | Ga0495621_0235045 | 3300046539 | Bacteria | 745 |
| 658 | Ga0495597_0288849 | 3300046542 | Bacteria | 638 |
| 659 | Ga0495645_0014804 | 3300046543 | Bacteria | 5541 |
| 660 | Ga0495645_0021320 | 3300046543 | Bacteria | 4682 |
| 661 | Ga0495645_0205916 | 3300046543 | Bacteria | 1331 |
| 662 | Ga0495622_0004750 | 3300046557 | Bacteria | 6291 |
| 663 | Ga0495622_0033943 | 3300046557 | Bacteria | 2381 |
| 664 | Ga0495622_0259627 | 3300046557 | Bacteria | 763 |
| 665 | Ga0495667_0035722 | 3300046559 | Bacteria | 3320 |
| 666 | Ga0495667_0089330 | 3300046559 | Bacteria | 1997 |
| 667 | Ga0495667_0129327 | 3300046559 | Bacteria | 1629 |
| 668 | Ga0495656_0382694 | 3300046615 | Bacteria | 733 |
| 669 | Ga0495668_0023759 | 3300046616 | Bacteria | 3492 |
| 670 | Ga0495668_0170843 | 3300046616 | Bacteria | 1191 |
| 671 | Ga0495634_0003095 | 3300046642 | Bacteria | 13527 |
| 672 | Ga0495634_0154436 | 3300046642 | Bacteria | 1449 |
| 673 | Ga0495611_0045991 | 3300046648 | Bacteria | 1956 |
| 674 | Ga0495611_0483152 | 3300046648 | Bacteria | 563 |
| 675 | Ga0495611_0498704 | 3300046648 | Bacteria | 553 |
| 676 | Ga0495635_0004351 | 3300046663 | Bacteria | 9807 |
| 677 | Ga0495635_0104833 | 3300046663 | Bacteria | 1932 |
| 678 | Ga0495635_0243431 | 3300046663 | Bacteria | 1213 |
| 679 | Ga0495635_0560539 | 3300046663 | Bacteria | 748 |
| 680 | Ga0495635_0930923 | 3300046663 | Bacteria | 555 |
| 681 | Ga0495588_0006073 | 3300046674 | Bacteria | 5420 |
| 682 | Ga0495588_0042080 | 3300046674 | Bacteria | 2335 |
| 683 | Ga0495588_0148096 | 3300046674 | Bacteria | 1241 |
| 684 | Ga0495588_0343312 | 3300046674 | Bacteria | 785 |
| 685 | Ga0495657_0077257 | 3300046675 | Bacteria | 2160 |
| 686 | Ga0495657_0186570 | 3300046675 | Bacteria | 1269 |
| 687 | Ga0495657_0194155 | 3300046675 | Bacteria | 1240 |
| 688 | Ga0495599_0034495 | 3300046678 | Bacteria | 3179 |
| 689 | Ga0495599_0104592 | 3300046678 | Bacteria | 1763 |
| 690 | Ga0495623_0043027 | 3300046679 | Bacteria | 2874 |
| 691 | Ga0495623_0303048 | 3300046679 | Bacteria | 882 |
| 692 | Ga0495623_0318098 | 3300046679 | Bacteria | 855 |
| 693 | Ga0495623_0363689 | 3300046679 | Bacteria | 786 |
| 694 | Ga0495646_0030478 | 3300046680 | Bacteria | 3369 |
| 695 | Ga0495646_0128197 | 3300046680 | Bacteria | 1430 |
| 696 | Ga0495647_0000279 | 3300046681 | Bacteria | 14215 |
| 697 | Ga0495647_0067363 | 3300046681 | Bacteria | 1426 |
| 698 | Ga0495647_0113762 | 3300046681 | Bacteria | 1132 |
| 699 | Ga0495647_0135440 | 3300046681 | Bacteria | 1047 |
| 700 | Ga0495658_0007144 | 3300046683 | Bacteria | 5518 |
| 701 | Ga0495658_0016130 | 3300046683 | Bacteria | 3844 |
| 702 | Ga0495669_0141250 | 3300046684 | Bacteria | 1137 |
| 703 | Ga0495669_0338513 | 3300046684 | Bacteria | 727 |
| 704 | Ga0495613_0006409 | 3300046689 | Bacteria | 8795 |
| 705 | Ga0495613_0238783 | 3300046689 | Bacteria | 1271 |
| 706 | Ga0495613_0252560 | 3300046689 | Bacteria | 1230 |
| 707 | Ga0495624_0003391 | 3300046690 | Bacteria | 11822 |
| 708 | Ga0495624_0033966 | 3300046690 | Bacteria | 3303 |
| 709 | Ga0495671_0448985 | 3300046692 | Bacteria | 616 |
| 710 | Ga0495649_0584707 | 3300046694 | Bacteria | 551 |
| 711 | Ga0495600_0112015 | 3300046809 | Bacteria | 1777 |
| 712 | Ga0495600_0153077 | 3300046809 | Bacteria | 1492 |
| 713 | Ga0495581_0001274 | 3300047315 | Bacteria | 13870 |
| 714 | Ga0495581_0201879 | 3300047315 | Bacteria | 1163 |
| 715 | Ga0495581_0251889 | 3300047315 | Bacteria | 1033 |
| 716 | Ga0495581_0480552 | 3300047315 | Bacteria | 723 |
| 717 | Ga0495604_0265313 | 3300047317 | Bacteria | 1165 |
| 718 | Ga0495636_0172175 | 3300047318 | Bacteria | 979 |
| 719 | Ga0495674_0001108 | 3300047319 | Bacteria | 25886 |
| 720 | Ga0495674_0099668 | 3300047319 | Bacteria | 2473 |
| 721 | Ga0495674_0104773 | 3300047319 | Bacteria | 2404 |
| 722 | Ga0495672_0135540 | 3300047320 | Bacteria | 1291 |
| 723 | Ga0495676_0018692 | 3300047321 | Bacteria | 6112 |
| 724 | Ga0495676_0340693 | 3300047321 | Bacteria | 1004 |
| 725 | Ga0495680_0052972 | 3300047322 | Bacteria | 3160 |
| 726 | Ga0495680_0556609 | 3300047322 | Bacteria | 772 |
| 727 | Ga0495680_0705176 | 3300047322 | Bacteria | 666 |
| 728 | Ga0495683_0424028 | 3300047323 | Bacteria | 549 |
| 729 | Ga0495675_0056324 | 3300047444 | Bacteria | 2492 |
| 730 | Ga0495675_0352082 | 3300047444 | Bacteria | 866 |
| 731 | Ga0495679_116558 | 3300047446 | Bacteria | 733 |
| 732 | Ga0495684_0004305 | 3300047471 | Bacteria | 11116 |
| 733 | Ga0495684_0063256 | 3300047471 | Bacteria | 2813 |
| 734 | Ga0495686_0112743 | 3300047472 | Bacteria | 1629 |
| 735 | Ga0495686_0146519 | 3300047472 | Bacteria | 1389 |
| 736 | Ga0495593_0000180 | 3300047673 | Bacteria | 32786 |
| 737 | Ga0495593_0087193 | 3300047673 | Bacteria | 1609 |
| 738 | Ga0495593_0161747 | 3300047673 | Bacteria | 1130 |
| 739 | Ga0495602_0166728 | 3300048088 | Bacteria | 1713 |
| 740 | Ga0495602_0341173 | 3300048088 | Bacteria | 1084 |
| 741 | Ga0495602_0473899 | 3300048088 | Bacteria | 880 |
| 742 | Ga0495602_0712355 | 3300048088 | Bacteria | 680 |
| 743 | Ga0495614_0132823 | 3300048089 | Bacteria | 1102 |
| 744 | Ga0495626_0089026 | 3300048091 | Bacteria | 1360 |
| 745 | Ga0496100_0106485 | 3300048903 | Bacteria | 1941 |
| 746 | Ga0496100_0203330 | 3300048903 | Bacteria | 1445 |
| 747 | Ga0496101_0008882 | 3300048904 | Bacteria | 6580 |
| 748 | Ga0496101_0182288 | 3300048904 | Bacteria | 1617 |
| 749 | Ga0496101_0478768 | 3300048904 | Bacteria | 983 |
| 750 | Ga0496102_0007049 | 3300048905 | Bacteria | 9593 |
| 751 | Ga0496102_0208311 | 3300048905 | Bacteria | 1843 |
| 752 | Ga0496102_0293655 | 3300048905 | Bacteria | 1532 |
| 753 | Ga0496102_1236806 | 3300048905 | Bacteria | 666 |
| 754 | Ga0496103_0088070 | 3300048906 | Bacteria | 1958 |
| 755 | Ga0496103_0231341 | 3300048906 | Bacteria | 1189 |
| 756 | Ga0496104_0038703 | 3300048907 | Bacteria | 4463 |
| 757 | Ga0496104_0105809 | 3300048907 | Bacteria | 2696 |
| 758 | Ga0496104_0888238 | 3300048907 | Bacteria | 796 |
| 759 | Ga0496105_0179549 | 3300048908 | Bacteria | 1733 |
| 760 | Ga0496105_0682782 | 3300048908 | Bacteria | 790 |
| 761 | Ga0496106_0012499 | 3300048909 | Bacteria | 6271 |
| 762 | Ga0496106_0046854 | 3300048909 | Bacteria | 3251 |
| 763 | Ga0496106_0095010 | 3300048909 | Bacteria | 2305 |
| 764 | Ga0496106_0440421 | 3300048909 | Bacteria | 1047 |
| 765 | Ga0496106_0550105 | 3300048909 | Bacteria | 926 |
| 766 | Ga0496107_0021922 | 3300048910 | Bacteria | 4513 |
| 767 | Ga0496107_0131559 | 3300048910 | Bacteria | 1847 |
| 768 | Ga0496107_0397140 | 3300048910 | Bacteria | 1025 |
| 769 | Ga0496107_1058291 | 3300048910 | Bacteria | 587 |
| 770 | Ga0496108_0003612 | 3300048911 | Bacteria | 12386 |
| 771 | Ga0496108_0023293 | 3300048911 | Bacteria | 5094 |
| 772 | Ga0496108_0172544 | 3300048911 | Bacteria | 1871 |
| 773 | Ga0496108_0633283 | 3300048911 | Bacteria | 930 |
| 774 | Ga0496109_0000166 | 3300048912 | Bacteria | 64848 |
| 775 | Ga0496109_0020611 | 3300048912 | Bacteria | 5824 |
| 776 | Ga0496109_0051360 | 3300048912 | Bacteria | 3755 |
| 777 | Ga0496109_0573670 | 3300048912 | Bacteria | 1063 |
| 778 | Ga0496109_0898071 | 3300048912 | Bacteria | 824 |
| 779 | Ga0496110_0019876 | 3300048913 | Bacteria | 5661 |
| 780 | Ga0496110_0033450 | 3300048913 | Bacteria | 4447 |
| 781 | Ga0496110_0244401 | 3300048913 | Bacteria | 1633 |
| 782 | Ga0496110_0383222 | 3300048913 | Bacteria | 1281 |
| 783 | Ga0496110_0664587 | 3300048913 | Bacteria | 942 |
| 784 | Ga0496110_0883901 | 3300048913 | Bacteria | 799 |
| 785 | Ga0496111_0071138 | 3300048914 | Bacteria | 2532 |
| 786 | Ga0496111_0092490 | 3300048914 | Bacteria | 2217 |
| 787 | Ga0496111_0500419 | 3300048914 | Bacteria | 894 |
| 788 | Ga0496111_0583190 | 3300048914 | Bacteria | 819 |
| 789 | Ga0496112_0001913 | 3300048915 | Bacteria | 16432 |
| 790 | Ga0496112_0009707 | 3300048915 | Bacteria | 8689 |
| 791 | Ga0496112_0020318 | 3300048915 | Bacteria | 6292 |
| 792 | Ga0496112_0053396 | 3300048915 | Bacteria | 3969 |
| 793 | Ga0496112_0305009 | 3300048915 | Bacteria | 1537 |
| 794 | Ga0496112_0395307 | 3300048915 | Bacteria | 1322 |
| 795 | Ga0496112_1641239 | 3300048915 | Bacteria | 556 |
| 796 | Ga0496113_0061810 | 3300048916 | Bacteria | 2827 |
| 797 | Ga0496113_0121025 | 3300048916 | Bacteria | 2046 |
| 798 | Ga0496113_0254192 | 3300048916 | Bacteria | 1403 |
| 799 | Ga0496113_0460122 | 3300048916 | Bacteria | 1022 |
| 800 | Ga0496114_0579553 | 3300048917 | Bacteria | 990 |
| 801 | Ga0496114_0875937 | 3300048917 | Bacteria | 779 |
| 802 | Ga0496115_0002825 | 3300048918 | Bacteria | 12488 |
| 803 | Ga0496115_0029552 | 3300048918 | Bacteria | 4305 |
| 804 | Ga0496115_0076639 | 3300048918 | Bacteria | 2718 |
| 805 | Ga0496115_0120072 | 3300048918 | Bacteria | 2162 |
| 806 | Ga0496115_0744133 | 3300048918 | Bacteria | 767 |
| 807 | Ga0496116_0291458 | 3300048919 | Bacteria | 783 |
| 808 | Ga0496117_0278837 | 3300048920 | Bacteria | 896 |
| 809 | Ga0496118_0167681 | 3300048921 | Bacteria | 1347 |
| 810 | Ga0496118_0312399 | 3300048921 | Bacteria | 857 |
| 811 | Ga0496119_0231190 | 3300048922 | Bacteria | 941 |
| 812 | Ga0496119_0538281 | 3300048922 | Bacteria | 539 |
| 813 | Ga0496121_0001158 | 3300048924 | Bacteria | 46235 |
| 814 | Ga0496121_0007126 | 3300048924 | Bacteria | 13567 |
| 815 | Ga0496121_0091430 | 3300048924 | Bacteria | 2376 |
| 816 | Ga0496121_0221411 | 3300048924 | Bacteria | 1333 |
| 817 | Ga0496121_0244714 | 3300048924 | Bacteria | 1247 |
| 818 | Ga0496122_0092764 | 3300048925 | Bacteria | 2051 |
| 819 | Ga0496123_0052353 | 3300048926 | Bacteria | 2710 |
| 820 | Ga0496124_0067834 | 3300048927 | Bacteria | 2967 |
| 821 | Ga0496125_0086642 | 3300048928 | Bacteria | 2368 |
| 822 | Ga0496126_0010775 | 3300048929 | Bacteria | 9547 |
| 823 | Ga0496126_0032384 | 3300048929 | Bacteria | 4926 |
| 824 | Ga0496126_0039916 | 3300048929 | Bacteria | 4352 |
| 825 | Ga0496126_0055168 | 3300048929 | Bacteria | 3596 |
| 826 | Ga0496126_0305003 | 3300048929 | Bacteria | 1312 |
| 827 | Ga0496126_0368144 | 3300048929 | Bacteria | 1172 |
| 828 | Ga0496126_0369924 | 3300048929 | Bacteria | 1169 |
| 829 | Ga0496126_0399822 | 3300048929 | Bacteria | 1114 |
| 830 | Ga0496126_0465443 | 3300048929 | Bacteria | 1015 |
| 831 | Ga0495678_157074 | 3300049459 | Bacteria | 730 |
| 832 | Ga0501031_0001969 | 3300049568 | Bacteria | 12970 |
| 833 | Ga0501031_0045495 | 3300049568 | Bacteria | 2863 |
| 834 | Ga0501031_0563012 | 3300049568 | Bacteria | 734 |
| 835 | Ga0501031_0960207 | 3300049568 | Bacteria | 546 |
| 836 | Ga0501032_0000088 | 3300049569 | Bacteria | 79913 |
| 837 | Ga0501032_0013062 | 3300049569 | Bacteria | 5913 |
| 838 | Ga0501032_0075408 | 3300049569 | Bacteria | 2246 |
| 839 | Ga0501032_0080439 | 3300049569 | Bacteria | 2168 |
| 840 | Ga0501032_0169164 | 3300049569 | Bacteria | 1433 |
| 841 | Ga0501033_0000749 | 3300049570 | Bacteria | 29895 |
| 842 | Ga0501033_0002046 | 3300049570 | Bacteria | 17530 |
| 843 | Ga0501033_0038747 | 3300049570 | Bacteria | 3560 |
| 844 | Ga0501033_0113529 | 3300049570 | Bacteria | 1970 |
| 845 | Ga0501033_0115213 | 3300049570 | Bacteria | 1953 |
| 846 | Ga0501033_0178484 | 3300049570 | Bacteria | 1523 |
| 847 | Ga0501033_0276716 | 3300049570 | Bacteria | 1186 |
| 848 | Ga0501033_0306343 | 3300049570 | Bacteria | 1117 |
| 849 | Ga0501034_0000332 | 3300049571 | Bacteria | 82900 |
| 850 | Ga0501034_0383805 | 3300049571 | Bacteria | 1329 |
| 851 | Ga0501034_0389111 | 3300049571 | Bacteria | 1318 |
| 852 | Ga0501034_0417586 | 3300049571 | Bacteria | 1263 |
| 853 | Ga0501036_0000233 | 3300049572 | Bacteria | 37220 |
| 854 | Ga0501036_0005560 | 3300049572 | Bacteria | 10225 |
| 855 | Ga0501036_0015255 | 3300049572 | Bacteria | 6416 |
| 856 | Ga0501036_0110617 | 3300049572 | Bacteria | 2321 |
| 857 | Ga0501036_0146974 | 3300049572 | Bacteria | 1988 |
| 858 | Ga0501036_0395148 | 3300049572 | Bacteria | 1153 |
| 859 | Ga0501036_0668271 | 3300049572 | Bacteria | 859 |
| 860 | Ga0501036_0695152 | 3300049572 | Bacteria | 840 |
| 861 | Ga0501036_1016100 | 3300049572 | Bacteria | 678 |
| 862 | Ga0501037_0001094 | 3300049573 | Bacteria | 20095 |
| 863 | Ga0501037_0057389 | 3300049573 | Bacteria | 2843 |
| 864 | Ga0501037_0059496 | 3300049573 | Bacteria | 2787 |
| 865 | Ga0501037_0403535 | 3300049573 | Bacteria | 937 |
| 866 | Ga0501037_0539281 | 3300049573 | Bacteria | 788 |
| 867 | Ga0501037_0846391 | 3300049573 | Bacteria | 602 |
| 868 | Ga0501038_0000049 | 3300049574 | Bacteria | 100279 |
| 869 | Ga0501038_0002752 | 3300049574 | Bacteria | 16386 |
| 870 | Ga0501038_0014983 | 3300049574 | Bacteria | 7060 |
| 871 | Ga0501038_0087077 | 3300049574 | Bacteria | 2623 |
| 872 | Ga0501038_0163858 | 3300049574 | Bacteria | 1805 |
| 873 | Ga0501038_0241022 | 3300049574 | Bacteria | 1435 |
| 874 | Ga0501038_0275113 | 3300049574 | Bacteria | 1327 |
| 875 | Ga0501038_0532396 | 3300049574 | Bacteria | 895 |
| 876 | Ga0501039_0002402 | 3300049575 | Bacteria | 13924 |
| 877 | Ga0501039_0076203 | 3300049575 | Bacteria | 2607 |
| 878 | Ga0501039_0107283 | 3300049575 | Bacteria | 2181 |
| 879 | Ga0501039_0153981 | 3300049575 | Bacteria | 1806 |
| 880 | Ga0501039_1038670 | 3300049575 | Bacteria | 636 |
| 881 | Ga0501040_0040480 | 3300049576 | Bacteria | 3171 |
| 882 | Ga0501041_0472820 | 3300049577 | Bacteria | 796 |
| 883 | Ga0501042_0003793 | 3300049578 | Bacteria | 9554 |
| 884 | Ga0501042_0081614 | 3300049578 | Bacteria | 2317 |
| 885 | Ga0501042_0704770 | 3300049578 | Bacteria | 734 |
| 886 | Ga0501043_0000740 | 3300049579 | Bacteria | 28916 |
| 887 | Ga0501043_0010172 | 3300049579 | Bacteria | 7375 |
| 888 | Ga0501043_0036335 | 3300049579 | Bacteria | 3874 |
| 889 | Ga0501043_0038739 | 3300049579 | Bacteria | 3748 |
| 890 | Ga0501043_0042848 | 3300049579 | Bacteria | 3557 |
| 891 | Ga0501043_0046404 | 3300049579 | Bacteria | 3416 |
| 892 | Ga0501043_0318234 | 3300049579 | Bacteria | 1187 |
| 893 | Ga0501043_0354043 | 3300049579 | Bacteria | 1115 |
| 894 | Ga0501043_0417942 | 3300049579 | Bacteria | 1011 |
| 895 | Ga0501043_0690282 | 3300049579 | Bacteria | 746 |
| 896 | Ga0501046_0014785 | 3300049580 | Bacteria | 6571 |
| 897 | Ga0501046_0028098 | 3300049580 | Bacteria | 4583 |
| 898 | Ga0501046_0098249 | 3300049580 | Bacteria | 2248 |
| 899 | Ga0501046_0102565 | 3300049580 | Bacteria | 2193 |
| 900 | Ga0501046_0388503 | 3300049580 | Bacteria | 1009 |
| 901 | Ga0501047_0000875 | 3300049581 | Bacteria | 30740 |
| 902 | Ga0501047_0006243 | 3300049581 | Bacteria | 11205 |
| 903 | Ga0501047_0273890 | 3300049581 | Bacteria | 1533 |
| 904 | Ga0501047_0331051 | 3300049581 | Bacteria | 1361 |
| 905 | Ga0501047_0373234 | 3300049581 | Bacteria | 1261 |
| 906 | Ga0501047_0864291 | 3300049581 | Bacteria | 718 |
| 907 | Ga0501047_1105068 | 3300049581 | Bacteria | 606 |
| 908 | Ga0501048_0006667 | 3300049582 | Bacteria | 8768 |
| 909 | Ga0501048_0241639 | 3300049582 | Bacteria | 1281 |
| 910 | Ga0501048_0421579 | 3300049582 | Bacteria | 955 |
| 911 | Ga0501067_0000622 | 3300049583 | Bacteria | 19101 |
| 912 | Ga0501067_0004029 | 3300049583 | Bacteria | 8107 |
| 913 | Ga0501067_0368137 | 3300049583 | Bacteria | 801 |
| 914 | Ga0501068_0004203 | 3300049584 | Bacteria | 7810 |
| 915 | Ga0501068_0021789 | 3300049584 | Bacteria | 3744 |
| 916 | Ga0501068_0092548 | 3300049584 | Bacteria | 1867 |
| 917 | Ga0501068_0259797 | 3300049584 | Bacteria | 1108 |
| 918 | Ga0501068_0500772 | 3300049584 | Bacteria | 788 |
| 919 | Ga0501069_0018680 | 3300049585 | Bacteria | 3744 |
| 920 | Ga0501069_0284198 | 3300049585 | Bacteria | 968 |
| 921 | Ga0501069_0357985 | 3300049585 | Bacteria | 861 |
| 922 | Ga0501069_0479078 | 3300049585 | Bacteria | 741 |
| 923 | Ga0501070_0004157 | 3300049586 | Bacteria | 12451 |
| 924 | Ga0501070_0006105 | 3300049586 | Bacteria | 10269 |
| 925 | Ga0501070_0039330 | 3300049586 | Bacteria | 3945 |
| 926 | Ga0501070_0081600 | 3300049586 | Bacteria | 2676 |
| 927 | Ga0501070_0435315 | 3300049586 | Bacteria | 1058 |
| 928 | Ga0501070_0637867 | 3300049586 | Bacteria | 847 |
| 929 | Ga0501070_0880607 | 3300049586 | Bacteria | 699 |
| 930 | Ga0501071_0243514 | 3300049587 | Bacteria | 1356 |
| 931 | Ga0501071_0370304 | 3300049587 | Bacteria | 1092 |
| 932 | Ga0501071_0413273 | 3300049587 | Bacteria | 1031 |
| 933 | Ga0501071_1073489 | 3300049587 | Bacteria | 622 |
| 934 | Ga0501072_0036419 | 3300049588 | Bacteria | 3857 |
| 935 | Ga0501072_0315275 | 3300049588 | Bacteria | 1243 |
| 936 | Ga0501073_0003598 | 3300049589 | Bacteria | 11649 |
| 937 | Ga0501073_0019684 | 3300049589 | Bacteria | 4871 |
| 938 | Ga0501074_0006273 | 3300049590 | Bacteria | 8584 |
| 939 | Ga0501074_0024471 | 3300049590 | Bacteria | 4389 |
| 940 | Ga0501074_0030015 | 3300049590 | Bacteria | 3940 |
| 941 | Ga0501075_0190110 | 3300049591 | Bacteria | 1566 |
| 942 | Ga0501076_0214954 | 3300049592 | Bacteria | 1572 |
| 943 | Ga0501076_1409130 | 3300049592 | Bacteria | 572 |
| 944 | Ga0501079_0003748 | 3300049741 | Bacteria | 11218 |
| 945 | Ga0501079_0022539 | 3300049741 | Bacteria | 4830 |
| 946 | Ga0501079_0805432 | 3300049741 | Bacteria | 740 |
| 947 | Ga0501080_0000343 | 3300049742 | Bacteria | 35792 |
| 948 | Ga0501080_0003847 | 3300049742 | Bacteria | 13260 |
| 949 | Ga0501080_0078280 | 3300049742 | Bacteria | 3075 |
| 950 | Ga0501080_0121332 | 3300049742 | Bacteria | 2422 |
| 951 | Ga0501081_0261076 | 3300049743 | Bacteria | 1266 |
| 952 | Ga0501083_0000724 | 3300049744 | Bacteria | 21483 |
| 953 | Ga0501083_0444738 | 3300049744 | Bacteria | 843 |
| 954 | Ga0501035_0000442 | 3300049822 | Bacteria | 46373 |
| 955 | Ga0501035_0008258 | 3300049822 | Bacteria | 9702 |
| 956 | Ga0501035_0040311 | 3300049822 | Bacteria | 4221 |
| 957 | Ga0501035_0095868 | 3300049822 | Bacteria | 2607 |
| 958 | Ga0501035_0179627 | 3300049822 | Bacteria | 1824 |
| 959 | Ga0501035_0184190 | 3300049822 | Bacteria | 1798 |
| 960 | Ga0501035_0307541 | 3300049822 | Bacteria | 1334 |
| 961 | Ga0501044_0000182 | 3300049823 | Bacteria | 78052 |
| 962 | Ga0501044_0025532 | 3300049823 | Bacteria | 6263 |
| 963 | Ga0501044_0036302 | 3300049823 | Bacteria | 5157 |
| 964 | Ga0501044_0053556 | 3300049823 | Bacteria | 4150 |
| 965 | Ga0501044_0078732 | 3300049823 | Bacteria | 3340 |
| 966 | Ga0501044_0093465 | 3300049823 | Bacteria | 3032 |
| 967 | Ga0501044_0136258 | 3300049823 | Bacteria | 2446 |
| 968 | Ga0501044_0176688 | 3300049823 | Bacteria | 2104 |
| 969 | Ga0501044_0185359 | 3300049823 | Bacteria | 2046 |
| 970 | Ga0501044_0388223 | 3300049823 | Bacteria | 1310 |
| 971 | Ga0501044_1425381 | 3300049823 | Bacteria | 558 |
| 972 | Ga0501045_0039733 | 3300049824 | Bacteria | 3424 |
| 973 | Ga0501045_0727895 | 3300049824 | Bacteria | 731 |
| 974 | nmdc:mga03n38_256831_c1 | 3300050490 | Bacteria | 925 |
| 975 | nmdc:mga03n38_44440_c1 | 3300050490 | Bacteria | 1951 |
| 976 | nmdc:mga03n38_89156_c1 | 3300050490 | Bacteria | 1465 |
| 977 | nmdc:mga00v17_124232_c1 | 3300050491 | Bacteria | 1646 |
| 978 | nmdc:mga00v17_346850_c1 | 3300050491 | Bacteria | 965 |
| 979 | nmdc:mga00v17_52683_c1 | 3300050491 | Bacteria | 2477 |
| 980 | nmdc:mga0yw44_122842_c1 | 3300050492 | Bacteria | 1674 |
| 981 | nmdc:mga0yw44_20161_c2 | 3300050492 | Bacteria | 3041 |
| 982 | nmdc:mga06z11_694435_c1 | 3300050494 | Bacteria | 620 |
| 983 | nmdc:mga06z11_76263_c1 | 3300050494 | Bacteria | 1787 |
| 984 | nmdc:mga04h51_245177_c1 | 3300050495 | Bacteria | 716 |
| 985 | nmdc:mga04h51_66496_c1 | 3300050495 | Bacteria | 1249 |
| 986 | nmdc:mga07m45_52186_c1 | 3300050496 | Bacteria | 2308 |
| 987 | nmdc:mga08y16_1736710_c1 | 3300050511 | Bacteria | 578 |
| 988 | nmdc:mga0n895_42303_c1 | 3300050512 | Bacteria | 4432 |
| 989 | nmdc:mga0rr50_166033_c1 | 3300050513 | Bacteria | 1795 |
| 990 | nmdc:mga08x19_24_c1 | 3300050514 | Bacteria | 245940 |
| 991 | nmdc:mga0a205_441294_c1 | 3300050515 | Bacteria | 1162 |
| 992 | Ga0495601_0010823 | 3300053077 | Bacteria | 5442 |
| 993 | Ga0495601_0024851 | 3300053077 | Bacteria | 3690 |
| 994 | Ga0495601_0101899 | 3300053077 | Bacteria | 1855 |
| 995 | Ga0495601_0277602 | 3300053077 | Bacteria | 1092 |
| 996 | Ga0495612_0011616 | 3300053078 | Bacteria | 3549 |
| 997 | Ga0495612_0036334 | 3300053078 | Bacteria | 1999 |
| 998 | Ga0495612_0054027 | 3300053078 | Bacteria | 1654 |
| 999 | Ga0495612_0324273 | 3300053078 | Bacteria | 693 |
| 1000 | Ga0495655_0167158 | 3300053083 | Bacteria | 702 |
| 1001 | Ga0495595_0132181 | 3300053084 | Bacteria | 1220 |
| 1002 | Ga0495619_0111129 | 3300053085 | Bacteria | 1873 |
| 1003 | Ga0495619_0185497 | 3300053085 | Bacteria | 1439 |
| 1004 | Ga0495619_0374245 | 3300053085 | Bacteria | 984 |
| 1005 | Ga0500578_0380689 | 3300053086 | Bacteria | 818 |
| 1006 | Ga0500646_0071520 | 3300053090 | Bacteria | 1041 |
| 1007 | Ga0500583_0257118 | 3300053092 | Bacteria | 861 |
| 1008 | Ga0500651_0000751 | 3300053093 | Bacteria | 15835 |
| 1009 | Ga0500651_0273545 | 3300053093 | Bacteria | 976 |
| 1010 | Ga0500651_0368486 | 3300053093 | Bacteria | 812 |
| 1011 | Ga0500651_0749059 | 3300053093 | Bacteria | 519 |
| 1012 | Ga0500566_0411937 | 3300053094 | Bacteria | 602 |
| 1013 | Ga0500641_0004900 | 3300053096 | Bacteria | 4740 |
| 1014 | Ga0500641_0031435 | 3300053096 | Bacteria | 2093 |
| 1015 | Ga0500556_0291440 | 3300053104 | Bacteria | 639 |
| 1016 | Ga0500595_001428 | 3300053119 | Bacteria | 12817 |
| 1017 | Ga0500595_002631 | 3300053119 | Bacteria | 8742 |
| 1018 | Ga0500595_005379 | 3300053119 | Bacteria | 5602 |
| 1019 | Ga0500595_058497 | 3300053119 | Bacteria | 1171 |
| 1020 | Ga0500595_157430 | 3300053119 | Bacteria | 633 |
| 1021 | Ga0500597_312734 | 3300053120 | Bacteria | 623 |
| 1022 | Ga0500642_0001478 | 3300053130 | Bacteria | 6759 |
| 1023 | Ga0500642_0419472 | 3300053130 | Bacteria | 580 |
| 1024 | Ga0500642_0442601 | 3300053130 | Bacteria | 559 |
| 1025 | Ga0500561_0050864 | 3300053137 | Bacteria | 1130 |
| 1026 | Ga0500568_0010263 | 3300053139 | Bacteria | 4396 |
| 1027 | Ga0500568_0047112 | 3300053139 | Bacteria | 1708 |
| 1028 | Ga0500568_0056655 | 3300053139 | Bacteria | 1527 |
| 1029 | Ga0500577_0183766 | 3300053142 | Bacteria | 898 |
| 1030 | Ga0500589_142002 | 3300053147 | Bacteria | 988 |
| 1031 | Ga0500589_177467 | 3300053147 | Bacteria | 840 |
| 1032 | Ga0500590_198964 | 3300053148 | Bacteria | 850 |
| 1033 | Ga0500603_000998 | 3300053150 | Bacteria | 6665 |
| 1034 | Ga0500603_013970 | 3300053150 | Bacteria | 1870 |
| 1035 | Ga0500622_0301647 | 3300053156 | Bacteria | 682 |
| 1036 | Ga0500634_0106542 | 3300053161 | Bacteria | 1392 |
| 1037 | Ga0500636_0047345 | 3300053177 | Bacteria | 2533 |
| 1038 | Ga0500636_0183142 | 3300053177 | Bacteria | 1123 |
| 1039 | Ga0500637_0001776 | 3300053178 | Bacteria | 9320 |
| 1040 | Ga0500637_0371650 | 3300053178 | Bacteria | 753 |
| 1041 | Ga0500645_042809 | 3300053730 | Bacteria | 1335 |
| 1042 | Ga0501084_0008620 | 3300054114 | Bacteria | 8429 |
| 1043 | Ga0501082_0019978 | 3300060353 | Bacteria | 5772 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300007265 | Ga0099794_10136813 | Ga0099794_101368132 | 128 |
| 2 | 3300005842 | Ga0068858_101461469 | Ga0068858_1014614691 | 129 |
| 3 | 3300049568 | Ga0501031_0563012 | Ga0501031_0563012_325_720 | 129 |
| 4 | 3300049570 | Ga0501033_0113529 | Ga0501033_0113529_337_732 | 129 |
| 5 | 3300049572 | Ga0501036_0015255 | Ga0501036_0015255_3563_3958 | 129 |
| 6 | 3300049573 | Ga0501037_0539281 | Ga0501037_0539281_267_662 | 129 |
| 7 | 3300049574 | Ga0501038_0087077 | Ga0501038_0087077_2191_2586 | 129 |
| 8 | 3300049575 | Ga0501039_0153981 | Ga0501039_0153981_1130_1525 | 129 |
| 9 | 3300049579 | Ga0501043_0354043 | Ga0501043_0354043_594_989 | 129 |
| 10 | 3300049581 | Ga0501047_0373234 | Ga0501047_0373234_89_484 | 129 |
| 11 | 3300049742 | Ga0501080_0078280 | Ga0501080_0078280_115_510 | 129 |
| 12 | 3300049823 | Ga0501044_0036302 | Ga0501044_0036302_3898_4293 | 129 |
| 13 | 3300013308 | Ga0157375_11032767 | Ga0157375_110327671 | 130 |
| 14 | 3300005336 | Ga0070680_100002273 | Ga0070680_10000227311 | 131 |
| 15 | 3300005337 | Ga0070682_100003870 | Ga0070682_1000038702 | 131 |
| 16 | 3300005366 | Ga0070659_100159506 | Ga0070659_1001595062 | 131 |
| 17 | 3300005457 | Ga0070662_100197923 | Ga0070662_1001979233 | 131 |
| 18 | 3300005530 | Ga0070679_100123421 | Ga0070679_1001234211 | 131 |
| 19 | 3300005539 | Ga0068853_100013651 | Ga0068853_1000136511 | 131 |
| 20 | 3300005545 | Ga0070695_100855836 | Ga0070695_1008558361 | 131 |
| 21 | 3300005547 | Ga0070693_100127834 | Ga0070693_1001278342 | 131 |
| 22 | 3300005563 | Ga0068855_100675651 | Ga0068855_1006756511 | 131 |
| 23 | 3300005577 | Ga0068857_100042050 | Ga0068857_1000420503 | 131 |
| 24 | 3300005578 | Ga0068854_100096172 | Ga0068854_1000961722 | 131 |
| 25 | 3300009174 | Ga0105241_10040893 | Ga0105241_100408933 | 131 |
| 26 | 3300009545 | Ga0105237_10632851 | Ga0105237_106328512 | 131 |
| 27 | 3300010375 | Ga0105239_10385430 | Ga0105239_103854302 | 131 |
| 28 | 3300013100 | Ga0157373_10012448 | Ga0157373_100124482 | 131 |
| 29 | 3300013104 | Ga0157370_10014857 | Ga0157370_100148573 | 131 |
| 30 | 3300013307 | Ga0157372_10004565 | Ga0157372_100045655 | 131 |
| 31 | 3300025315 | Ga0207697_10068025 | Ga0207697_100680252 | 131 |
| 32 | 3300025910 | Ga0207684_10767755 | Ga0207684_107677552 | 131 |
| 33 | 3300025911 | Ga0207654_10057787 | Ga0207654_100577873 | 131 |
| 34 | 3300025912 | Ga0207707_10062133 | Ga0207707_100621333 | 131 |
| 35 | 3300025917 | Ga0207660_10069162 | Ga0207660_100691622 | 131 |
| 36 | 3300025921 | Ga0207652_10077512 | Ga0207652_100775121 | 131 |
| 37 | 3300025933 | Ga0207706_10217014 | Ga0207706_102170142 | 131 |
| 38 | 3300025949 | Ga0207667_10204620 | Ga0207667_102046202 | 131 |
| 39 | 3300026041 | Ga0207639_10084236 | Ga0207639_100842361 | 131 |
| 40 | 3300026116 | Ga0207674_10130613 | Ga0207674_101306131 | 131 |
| 41 | 3300046513 | Ga0495616_0053323 | Ga0495616_0053323_1002_1406 | 132 |
| 42 | 3300046616 | Ga0495668_0170843 | Ga0495668_0170843_213_620 | 132 |
| 43 | 3300053120 | Ga0500597_312734 | Ga0500597_312734_33_434 | 132 |
| 44 | 3300005545 | Ga0070695_100189578 | Ga0070695_1001895782 | 133 |
| 45 | 3300005549 | Ga0070704_100008485 | Ga0070704_1000084853 | 133 |
| 46 | 3300005578 | Ga0068854_102097539 | Ga0068854_1020975391 | 133 |
| 47 | 3300005843 | Ga0068860_100573107 | Ga0068860_1005731072 | 133 |
| 48 | 3300009148 | Ga0105243_11006571 | Ga0105243_110065711 | 133 |
| 49 | 3300009553 | Ga0105249_10002531 | Ga0105249_100025315 | 133 |
| 50 | 3300013307 | Ga0157372_10679728 | Ga0157372_106797282 | 133 |
| 51 | 3300025935 | Ga0207709_10653648 | Ga0207709_106536482 | 133 |
| 52 | 3300025961 | Ga0207712_10033358 | Ga0207712_100333584 | 133 |
| 53 | 3300035113 | Ga0373936_0037042 | Ga0373936_0037042_806_1210 | 133 |
| 54 | 3300049579 | Ga0501043_0318234 | Ga0501043_0318234_302_709 | 133 |
| 55 | 3300005366 | Ga0070659_101422310 | Ga0070659_1014223102 | 134 |
| 56 | 3300005367 | Ga0070667_101582433 | Ga0070667_1015824331 | 134 |
| 57 | 3300005440 | Ga0070705_100506717 | Ga0070705_1005067172 | 134 |
| 58 | 3300005536 | Ga0070697_100038617 | Ga0070697_1000386172 | 134 |
| 59 | 3300005536 | Ga0070697_100379741 | Ga0070697_1003797412 | 134 |
| 60 | 3300005545 | Ga0070695_100020357 | Ga0070695_1000203576 | 134 |
| 61 | 3300006914 | Ga0075436_100032312 | Ga0075436_1000323126 | 134 |
| 62 | 3300007076 | Ga0075435_100044739 | Ga0075435_1000447396 | 134 |
| 63 | 3300009551 | Ga0105238_10076860 | Ga0105238_100768606 | 134 |
| 64 | 3300025906 | Ga0207699_11138615 | Ga0207699_111386152 | 134 |
| 65 | 3300025939 | Ga0207665_10019587 | Ga0207665_100195872 | 134 |
| 66 | 3300031548 | Ga0307408_100113900 | Ga0307408_1001139004 | 134 |
| 67 | 3300031911 | Ga0307412_10722316 | Ga0307412_107223162 | 134 |
| 68 | 3300041443 | Ga0451789_0114694 | Ga0451789_0114694_290_697 | 134 |
| 69 | 3300050514 | nmdc:mga08x19_24_c1 | nmdc:mga08x19_24_c1_196402_196815 | 134 |
| 70 | iso_pu_bacteria | 2908756301 | 2908758037 | 134 |
| 71 | 3300005548 | Ga0070665_101579763 | Ga0070665_1015797631 | 135 |
| 72 | 3300025972 | Ga0207668_11440105 | Ga0207668_114401052 | 135 |
| 73 | 3300050491 | nmdc:mga00v17_346850_c1 | nmdc:mga00v17_346850_c1_64_477 | 135 |
| 74 | iso_pu_bacteria | 2513237098 | 2513672012 | 135 |
| 75 | iso_pu_bacteria | 2524023210 | 2524469209 | 135 |
| 76 | iso_pu_bacteria | 2885383462 | 2885383699 | 135 |
| 77 | iso_pu_bacteria | 2903768456 | 2903770065 | 135 |
| 78 | iso_pu_bacteria | 8056681323 | 8056682143 | 135 |
| 79 | 3300003215 | JGI25153J46596_10003620 | JGI25153J46596_100036207 | 136 |
| 80 | 3300006038 | Ga0075365_10001178 | Ga0075365_100011781 | 136 |
| 81 | 3300006051 | Ga0075364_10084281 | Ga0075364_100842812 | 136 |
| 82 | 3300006177 | Ga0075362_10627797 | Ga0075362_106277971 | 136 |
| 83 | 3300006178 | Ga0075367_10115824 | Ga0075367_101158243 | 136 |
| 84 | 3300006186 | Ga0075369_10471773 | Ga0075369_104717732 | 136 |
| 85 | 3300009101 | Ga0105247_10422074 | Ga0105247_104220742 | 136 |
| 86 | 3300013102 | Ga0157371_11128816 | Ga0157371_111288162 | 136 |
| 87 | 3300013308 | Ga0157375_10405941 | Ga0157375_104059412 | 136 |
| 88 | 3300025297 | Ga0209758_1015056 | Ga0209758_10150562 | 136 |
| 89 | 3300025907 | Ga0207645_10264630 | Ga0207645_102646302 | 136 |
| 90 | 3300025931 | Ga0207644_10329652 | Ga0207644_103296522 | 136 |
| 91 | 3300028381 | Ga0268264_10338604 | Ga0268264_103386042 | 136 |
| 92 | 3300042157 | Ga0439458_0009740 | Ga0439458_0009740_1695_2108 | 136 |
| 93 | 3300046452 | Ga0495617_122277 | Ga0495617_122277_414_827 | 136 |
| 94 | 3300046471 | Ga0495650_0068980 | Ga0495650_0068980_876_1292 | 136 |
| 95 | 3300046474 | Ga0495605_0321293 | Ga0495605_0321293_116_529 | 136 |
| 96 | 3300046474 | Ga0495605_0431742 | Ga0495605_0431742_121_534 | 136 |
| 97 | 3300046507 | Ga0495606_0340912 | Ga0495606_0340912_164_577 | 136 |
| 98 | 3300046512 | Ga0495610_0068686 | Ga0495610_0068686_1129_1542 | 136 |
| 99 | 3300046512 | Ga0495610_0342685 | Ga0495610_0342685_128_541 | 136 |
| 100 | 3300046519 | Ga0495632_0191378 | Ga0495632_0191378_195_608 | 136 |
| 101 | 3300046524 | Ga0495648_0146153 | Ga0495648_0146153_624_1037 | 136 |
| 102 | 3300046542 | Ga0495597_0288849 | Ga0495597_0288849_72_485 | 136 |
| 103 | 3300046615 | Ga0495656_0382694 | Ga0495656_0382694_289_702 | 136 |
| 104 | 3300046616 | Ga0495668_0023759 | Ga0495668_0023759_2839_3252 | 136 |
| 105 | 3300046648 | Ga0495611_0483152 | Ga0495611_0483152_37_450 | 136 |
| 106 | 3300046681 | Ga0495647_0067363 | Ga0495647_0067363_322_735 | 136 |
| 107 | 3300046692 | Ga0495671_0448985 | Ga0495671_0448985_69_482 | 136 |
| 108 | 3300046694 | Ga0495649_0584707 | Ga0495649_0584707_53_466 | 136 |
| 109 | 3300047318 | Ga0495636_0172175 | Ga0495636_0172175_206_619 | 136 |
| 110 | 3300047323 | Ga0495683_0424028 | Ga0495683_0424028_123_536 | 136 |
| 111 | 3300047472 | Ga0495686_0112743 | Ga0495686_0112743_969_1382 | 136 |
| 112 | 3300048912 | Ga0496109_0898071 | Ga0496109_0898071_263_676 | 136 |
| 113 | 3300048925 | Ga0496122_0092764 | Ga0496122_0092764_445_858 | 136 |
| 114 | 3300048926 | Ga0496123_0052353 | Ga0496123_0052353_1949_2362 | 136 |
| 115 | 3300048929 | Ga0496126_0039916 | Ga0496126_0039916_2281_2694 | 136 |
| 116 | 3300049459 | Ga0495678_157074 | Ga0495678_157074_13_426 | 136 |
| 117 | 3300049743 | Ga0501081_0261076 | Ga0501081_0261076_253_666 | 136 |
| 118 | 3300050491 | nmdc:mga00v17_52683_c1 | nmdc:mga00v17_52683_c1_553_969 | 136 |
| 119 | 3300050492 | nmdc:mga0yw44_20161_c2 | nmdc:mga0yw44_20161_c2_2402_2818 | 136 |
| 120 | 3300050494 | nmdc:mga06z11_76263_c1 | nmdc:mga06z11_76263_c1_84_500 | 136 |
| 121 | 3300053093 | Ga0500651_0368486 | Ga0500651_0368486_262_675 | 136 |
| 122 | 3300053130 | Ga0500642_0442601 | Ga0500642_0442601_27_440 | 136 |
| 123 | 3300053137 | Ga0500561_0050864 | Ga0500561_0050864_653_1066 | 136 |
| 124 | 3300053147 | Ga0500589_177467 | Ga0500589_177467_292_705 | 136 |
| 125 | 3300053156 | Ga0500622_0301647 | Ga0500622_0301647_133_546 | 136 |
| 126 | 3300053161 | Ga0500634_0106542 | Ga0500634_0106542_851_1264 | 136 |
| 127 | 3300006880 | Ga0075429_101013421 | Ga0075429_1010134211 | 137 |
| 128 | 3300009551 | Ga0105238_10020302 | Ga0105238_100203021 | 137 |
| 129 | 3300021377 | Ga0213874_10018729 | Ga0213874_100187293 | 137 |
| 130 | 3300025937 | Ga0207669_10478619 | Ga0207669_104786192 | 137 |
| 131 | 3300026041 | Ga0207639_10947955 | Ga0207639_109479552 | 137 |
| 132 | 3300026118 | Ga0207675_100134494 | Ga0207675_1001344942 | 137 |
| 133 | 3300039437 | Ga0436365_0781961 | Ga0436365_0781961_122_538 | 137 |
| 134 | 3300039450 | Ga0436363_0991916 | Ga0436363_0991916_983_1408 | 137 |
| 135 | 3300046499 | Ga0495594_0345256 | Ga0495594_0345256_386_802 | 137 |
| 136 | 3300048906 | Ga0496103_0088070 | Ga0496103_0088070_77_493 | 137 |
| 137 | 3300050490 | nmdc:mga03n38_44440_c1 | nmdc:mga03n38_44440_c1_386_808 | 137 |
| 138 | iso_pu_bacteria | 2876808645 | 2876809319 | 137 |
| 139 | iso_pu_bacteria | 2879110137 | 2879118124 | 137 |
| 140 | iso_pu_bacteria | 2922386360 | 2922390153 | 137 |
| 141 | iso_pu_bacteria | 8056673599 | 8056674947 | 137 |
| 142 | 3300005327 | Ga0070658_10678046 | Ga0070658_106780462 | 138 |
| 143 | 3300005339 | Ga0070660_100137772 | Ga0070660_1001377722 | 138 |
| 144 | 3300005366 | Ga0070659_100218186 | Ga0070659_1002181863 | 138 |
| 145 | 3300005458 | Ga0070681_10482263 | Ga0070681_104822633 | 138 |
| 146 | 3300005530 | Ga0070679_100044706 | Ga0070679_1000447062 | 138 |
| 147 | 3300005535 | Ga0070684_101840348 | Ga0070684_1018403481 | 138 |
| 148 | 3300005539 | Ga0068853_100196930 | Ga0068853_1001969302 | 138 |
| 149 | 3300005563 | Ga0068855_100274313 | Ga0068855_1002743133 | 138 |
| 150 | 3300005983 | Ga0081540_1058985 | Ga0081540_10589853 | 138 |
| 151 | 3300013100 | Ga0157373_10460675 | Ga0157373_104606752 | 138 |
| 152 | 3300013104 | Ga0157370_10270395 | Ga0157370_102703952 | 138 |
| 153 | 3300025904 | Ga0207647_10390757 | Ga0207647_103907571 | 138 |
| 154 | 3300025909 | Ga0207705_10048396 | Ga0207705_100483962 | 138 |
| 155 | 3300025919 | Ga0207657_10001382 | Ga0207657_1000138224 | 138 |
| 156 | 3300025921 | Ga0207652_10124322 | Ga0207652_101243221 | 138 |
| 157 | 3300025932 | Ga0207690_10100023 | Ga0207690_101000233 | 138 |
| 158 | 3300026067 | Ga0207678_10422840 | Ga0207678_104228402 | 138 |
| 159 | 3300037471 | Ga0395905_0505853 | Ga0395905_0505853_18_440 | 138 |
| 160 | 3300046523 | Ga0495644_0251562 | Ga0495644_0251562_131_547 | 138 |
| 161 | 3300046648 | Ga0495611_0498704 | Ga0495611_0498704_14_430 | 138 |
| 162 | 3300047472 | Ga0495686_0146519 | Ga0495686_0146519_648_1070 | 138 |
| 163 | 3300048927 | Ga0496124_0067834 | Ga0496124_0067834_1885_2301 | 138 |
| 164 | 3300048929 | Ga0496126_0055168 | Ga0496126_0055168_2743_3165 | 138 |
| 165 | 3300049570 | Ga0501033_0306343 | Ga0501033_0306343_359_775 | 138 |
| 166 | 3300049572 | Ga0501036_0146974 | Ga0501036_0146974_777_1193 | 138 |
| 167 | 3300049573 | Ga0501037_0057389 | Ga0501037_0057389_872_1288 | 138 |
| 168 | 3300049574 | Ga0501038_0532396 | Ga0501038_0532396_173_589 | 138 |
| 169 | 3300049578 | Ga0501042_0704770 | Ga0501042_0704770_227_643 | 138 |
| 170 | 3300049579 | Ga0501043_0038739 | Ga0501043_0038739_1155_1571 | 138 |
| 171 | 3300049580 | Ga0501046_0388503 | Ga0501046_0388503_566_982 | 138 |
| 172 | 3300049582 | Ga0501048_0421579 | Ga0501048_0421579_292_708 | 138 |
| 173 | 3300049583 | Ga0501067_0368137 | Ga0501067_0368137_236_652 | 138 |
| 174 | 3300049584 | Ga0501068_0259797 | Ga0501068_0259797_673_1089 | 138 |
| 175 | 3300049585 | Ga0501069_0479078 | Ga0501069_0479078_236_652 | 138 |
| 176 | 3300049586 | Ga0501070_0637867 | Ga0501070_0637867_95_511 | 138 |
| 177 | 3300049587 | Ga0501071_0370304 | Ga0501071_0370304_600_1016 | 138 |
| 178 | 3300049588 | Ga0501072_0315275 | Ga0501072_0315275_377_793 | 138 |
| 179 | 3300049741 | Ga0501079_0805432 | Ga0501079_0805432_74_490 | 138 |
| 180 | 3300049742 | Ga0501080_0121332 | Ga0501080_0121332_1042_1458 | 138 |
| 181 | 3300049823 | Ga0501044_0136258 | Ga0501044_0136258_1887_2303 | 138 |
| 182 | 3300053139 | Ga0500568_0010263 | Ga0500568_0010263_3330_3752 | 138 |
| 183 | iso_pu_bacteria | 2643221651 | 2644287325 | 138 |
| 184 | iso_pu_bacteria | 2728368998 | 2728754402 | 138 |
| 185 | 3300005338 | Ga0068868_100282404 | Ga0068868_1002824043 | 139 |
| 186 | 3300009094 | Ga0111539_11892877 | Ga0111539_118928772 | 139 |
| 187 | 3300025315 | Ga0207697_10076668 | Ga0207697_100766682 | 139 |
| 188 | 3300025899 | Ga0207642_10856937 | Ga0207642_108569372 | 139 |
| 189 | 3300025907 | Ga0207645_10416669 | Ga0207645_104166692 | 139 |
| 190 | 3300025938 | Ga0207704_10820670 | Ga0207704_108206702 | 139 |
| 191 | 3300025960 | Ga0207651_11066868 | Ga0207651_110668682 | 139 |
| 192 | 3300037466 | Ga0395898_0146205 | Ga0395898_0146205_263_727 | 139 |
| 193 | 3300046459 | Ga0495629_0558886 | Ga0495629_0558886_133_552 | 139 |
| 194 | 3300046539 | Ga0495621_0235045 | Ga0495621_0235045_199_618 | 139 |
| 195 | 3300048924 | Ga0496121_0221411 | Ga0496121_0221411_114_539 | 139 |
| 196 | 3300049573 | Ga0501037_0846391 | Ga0501037_0846391_67_492 | 139 |
| 197 | 3300049574 | Ga0501038_0163858 | Ga0501038_0163858_677_1102 | 139 |
| 198 | 3300049574 | Ga0501038_0275113 | Ga0501038_0275113_165_590 | 139 |
| 199 | 3300049575 | Ga0501039_1038670 | Ga0501039_1038670_44_469 | 139 |
| 200 | 3300049579 | Ga0501043_0046404 | Ga0501043_0046404_1380_1805 | 139 |
| 201 | 3300049581 | Ga0501047_1105068 | Ga0501047_1105068_138_563 | 139 |
| 202 | 3300049586 | Ga0501070_0081600 | Ga0501070_0081600_690_1115 | 139 |
| 203 | 3300049587 | Ga0501071_1073489 | Ga0501071_1073489_23_448 | 139 |
| 204 | 3300049822 | Ga0501035_0184190 | Ga0501035_0184190_342_767 | 139 |
| 205 | 3300049822 | Ga0501035_0307541 | Ga0501035_0307541_679_1104 | 139 |
| 206 | 3300049823 | Ga0501044_0093465 | Ga0501044_0093465_2231_2656 | 139 |
| 207 | 3300049823 | Ga0501044_0176688 | Ga0501044_0176688_359_784 | 139 |
| 208 | 3300009093 | Ga0105240_11357771 | Ga0105240_113577711 | 140 |
| 209 | 3300031911 | Ga0307412_10970404 | Ga0307412_109704042 | 140 |
| 210 | 3300049571 | Ga0501034_0389111 | Ga0501034_0389111_50_487 | 140 |
| 211 | 3300053730 | Ga0500645_042809 | Ga0500645_042809_533_964 | 140 |
| 212 | 3300005328 | Ga0070676_10386348 | Ga0070676_103863482 | 141 |
| 213 | 3300005329 | Ga0070683_100827681 | Ga0070683_1008276812 | 141 |
| 214 | 3300005334 | Ga0068869_100015386 | Ga0068869_1000153868 | 141 |
| 215 | 3300005336 | Ga0070680_100362859 | Ga0070680_1003628592 | 141 |
| 216 | 3300005337 | Ga0070682_100938741 | Ga0070682_1009387412 | 141 |
| 217 | 3300005338 | Ga0068868_100030028 | Ga0068868_1000300284 | 141 |
| 218 | 3300005338 | Ga0068868_100169058 | Ga0068868_1001690581 | 141 |
| 219 | 3300005344 | Ga0070661_100200692 | Ga0070661_1002006922 | 141 |
| 220 | 3300005347 | Ga0070668_101229091 | Ga0070668_1012290911 | 141 |
| 221 | 3300005355 | Ga0070671_100216287 | Ga0070671_1002162872 | 141 |
| 222 | 3300005355 | Ga0070671_100267297 | Ga0070671_1002672972 | 141 |
| 223 | 3300005364 | Ga0070673_100152900 | Ga0070673_1001529003 | 141 |
| 224 | 3300005364 | Ga0070673_101467808 | Ga0070673_1014678081 | 141 |
| 225 | 3300005435 | Ga0070714_101121316 | Ga0070714_1011213162 | 141 |
| 226 | 3300005438 | Ga0070701_10143854 | Ga0070701_101438542 | 141 |
| 227 | 3300005439 | Ga0070711_100317394 | Ga0070711_1003173942 | 141 |
| 228 | 3300005455 | Ga0070663_100016039 | Ga0070663_1000160397 | 141 |
| 229 | 3300005455 | Ga0070663_100050610 | Ga0070663_1000506103 | 141 |
| 230 | 3300005456 | Ga0070678_100066664 | Ga0070678_1000666645 | 141 |
| 231 | 3300005456 | Ga0070678_100192514 | Ga0070678_1001925144 | 141 |
| 232 | 3300005457 | Ga0070662_100397645 | Ga0070662_1003976452 | 141 |
| 233 | 3300005459 | Ga0068867_100618778 | Ga0068867_1006187782 | 141 |
| 234 | 3300005471 | Ga0070698_100136725 | Ga0070698_1001367253 | 141 |
| 235 | 3300005518 | Ga0070699_101415470 | Ga0070699_1014154701 | 141 |
| 236 | 3300005535 | Ga0070684_100262869 | Ga0070684_1002628692 | 141 |
| 237 | 3300005539 | Ga0068853_100642569 | Ga0068853_1006425691 | 141 |
| 238 | 3300005545 | Ga0070695_100605293 | Ga0070695_1006052932 | 141 |
| 239 | 3300005547 | Ga0070693_100167943 | Ga0070693_1001679432 | 141 |
| 240 | 3300005548 | Ga0070665_100086794 | Ga0070665_1000867945 | 141 |
| 241 | 3300005548 | Ga0070665_100287823 | Ga0070665_1002878232 | 141 |
| 242 | 3300005549 | Ga0070704_100289844 | Ga0070704_1002898442 | 141 |
| 243 | 3300005563 | Ga0068855_100071280 | Ga0068855_1000712807 | 141 |
| 244 | 3300005564 | Ga0070664_100151452 | Ga0070664_1001514524 | 141 |
| 245 | 3300005564 | Ga0070664_100326781 | Ga0070664_1003267812 | 141 |
| 246 | 3300005577 | Ga0068857_100061246 | Ga0068857_1000612466 | 141 |
| 247 | 3300005614 | Ga0068856_100171502 | Ga0068856_1001715025 | 141 |
| 248 | 3300005615 | Ga0070702_100144460 | Ga0070702_1001444602 | 141 |
| 249 | 3300005616 | Ga0068852_100057125 | Ga0068852_1000571252 | 141 |
| 250 | 3300005616 | Ga0068852_100309219 | Ga0068852_1003092192 | 141 |
| 251 | 3300005617 | Ga0068859_101490472 | Ga0068859_1014904722 | 141 |
| 252 | 3300005618 | Ga0068864_100024784 | Ga0068864_1000247844 | 141 |
| 253 | 3300005618 | Ga0068864_100086389 | Ga0068864_1000863895 | 141 |
| 254 | 3300005618 | Ga0068864_101883275 | Ga0068864_1018832751 | 141 |
| 255 | 3300005719 | Ga0068861_100376017 | Ga0068861_1003760172 | 141 |
| 256 | 3300005834 | Ga0068851_10494069 | Ga0068851_104940692 | 141 |
| 257 | 3300005840 | Ga0068870_10231807 | Ga0068870_102318072 | 141 |
| 258 | 3300005841 | Ga0068863_100034349 | Ga0068863_1000343493 | 141 |
| 259 | 3300005842 | Ga0068858_100113683 | Ga0068858_1001136832 | 141 |
| 260 | 3300005844 | Ga0068862_100366826 | Ga0068862_1003668262 | 141 |
| 261 | 3300005844 | Ga0068862_100382220 | Ga0068862_1003822202 | 141 |
| 262 | 3300005844 | Ga0068862_101124203 | Ga0068862_1011242032 | 141 |
| 263 | 3300005983 | Ga0081540_1010845 | Ga0081540_10108452 | 141 |
| 264 | 3300006038 | Ga0075365_10047222 | Ga0075365_100472222 | 141 |
| 265 | 3300006038 | Ga0075365_10065154 | Ga0075365_100651543 | 141 |
| 266 | 3300006038 | Ga0075365_10287239 | Ga0075365_102872392 | 141 |
| 267 | 3300006042 | Ga0075368_10019165 | Ga0075368_100191652 | 141 |
| 268 | 3300006048 | Ga0075363_100030294 | Ga0075363_1000302942 | 141 |
| 269 | 3300006051 | Ga0075364_10065790 | Ga0075364_100657902 | 141 |
| 270 | 3300006051 | Ga0075364_10167889 | Ga0075364_101678892 | 141 |
| 271 | 3300006177 | Ga0075362_10103282 | Ga0075362_101032822 | 141 |
| 272 | 3300006178 | Ga0075367_10053655 | Ga0075367_100536552 | 141 |
| 273 | 3300006186 | Ga0075369_10074750 | Ga0075369_100747502 | 141 |
| 274 | 3300006237 | Ga0097621_100220989 | Ga0097621_1002209892 | 141 |
| 275 | 3300006237 | Ga0097621_100804800 | Ga0097621_1008048002 | 141 |
| 276 | 3300006353 | Ga0075370_10137360 | Ga0075370_101373603 | 141 |
| 277 | 3300006358 | Ga0068871_100793340 | Ga0068871_1007933402 | 141 |
| 278 | 3300006852 | Ga0075433_10411595 | Ga0075433_104115953 | 141 |
| 279 | 3300006871 | Ga0075434_100125946 | Ga0075434_1001259462 | 141 |
| 280 | 3300006880 | Ga0075429_101542139 | Ga0075429_1015421392 | 141 |
| 281 | 3300006931 | Ga0097620_101490507 | Ga0097620_1014905072 | 141 |
| 282 | 3300007076 | Ga0075435_100087178 | Ga0075435_1000871785 | 141 |
| 283 | 3300009092 | Ga0105250_10176393 | Ga0105250_101763932 | 141 |
| 284 | 3300009098 | Ga0105245_10070474 | Ga0105245_100704742 | 141 |
| 285 | 3300009098 | Ga0105245_10484188 | Ga0105245_104841882 | 141 |
| 286 | 3300009098 | Ga0105245_10929987 | Ga0105245_109299872 | 141 |
| 287 | 3300009101 | Ga0105247_10118533 | Ga0105247_101185334 | 141 |
| 288 | 3300009148 | Ga0105243_10445796 | Ga0105243_104457962 | 141 |
| 289 | 3300009148 | Ga0105243_10541592 | Ga0105243_105415922 | 141 |
| 290 | 3300009174 | Ga0105241_10064090 | Ga0105241_100640905 | 141 |
| 291 | 3300009177 | Ga0105248_10020941 | Ga0105248_100209412 | 141 |
| 292 | 3300009545 | Ga0105237_10019705 | Ga0105237_100197052 | 141 |
| 293 | 3300009545 | Ga0105237_10459415 | Ga0105237_104594152 | 141 |
| 294 | 3300010375 | Ga0105239_10325222 | Ga0105239_103252224 | 141 |
| 295 | 3300011119 | Ga0105246_10130517 | Ga0105246_101305174 | 141 |
| 296 | 3300011119 | Ga0105246_10214800 | Ga0105246_102148004 | 141 |
| 297 | 3300013105 | Ga0157369_11527992 | Ga0157369_115279921 | 141 |
| 298 | 3300013296 | Ga0157374_10532013 | Ga0157374_105320133 | 141 |
| 299 | 3300013296 | Ga0157374_10633030 | Ga0157374_106330302 | 141 |
| 300 | 3300013297 | Ga0157378_10144697 | Ga0157378_101446972 | 141 |
| 301 | 3300013297 | Ga0157378_10147673 | Ga0157378_101476732 | 141 |
| 302 | 3300013306 | Ga0163162_10038417 | Ga0163162_100384175 | 141 |
| 303 | 3300013306 | Ga0163162_10086558 | Ga0163162_100865584 | 141 |
| 304 | 3300013306 | Ga0163162_10455510 | Ga0163162_104555102 | 141 |
| 305 | 3300013308 | Ga0157375_11116547 | Ga0157375_111165472 | 141 |
| 306 | 3300014325 | Ga0163163_10058281 | Ga0163163_100582816 | 141 |
| 307 | 3300014745 | Ga0157377_10102115 | Ga0157377_101021151 | 141 |
| 308 | 3300014968 | Ga0157379_10162863 | Ga0157379_101628634 | 141 |
| 309 | 3300014968 | Ga0157379_10223506 | Ga0157379_102235062 | 141 |
| 310 | 3300025885 | Ga0207653_10064430 | Ga0207653_100644301 | 141 |
| 311 | 3300025900 | Ga0207710_10021793 | Ga0207710_100217932 | 141 |
| 312 | 3300025900 | Ga0207710_10368135 | Ga0207710_103681352 | 141 |
| 313 | 3300025901 | Ga0207688_10152574 | Ga0207688_101525742 | 141 |
| 314 | 3300025903 | Ga0207680_10672501 | Ga0207680_106725012 | 141 |
| 315 | 3300025904 | Ga0207647_10222495 | Ga0207647_102224952 | 141 |
| 316 | 3300025908 | Ga0207643_10050095 | Ga0207643_100500955 | 141 |
| 317 | 3300025911 | Ga0207654_10003362 | Ga0207654_1000336210 | 141 |
| 318 | 3300025914 | Ga0207671_10443051 | Ga0207671_104430513 | 141 |
| 319 | 3300025917 | Ga0207660_10729217 | Ga0207660_107292171 | 141 |
| 320 | 3300025920 | Ga0207649_10459160 | Ga0207649_104591602 | 141 |
| 321 | 3300025923 | Ga0207681_10225047 | Ga0207681_102250473 | 141 |
| 322 | 3300025927 | Ga0207687_10106524 | Ga0207687_101065243 | 141 |
| 323 | 3300025927 | Ga0207687_10385792 | Ga0207687_103857921 | 141 |
| 324 | 3300025931 | Ga0207644_10200635 | Ga0207644_102006352 | 141 |
| 325 | 3300025931 | Ga0207644_10671596 | Ga0207644_106715962 | 141 |
| 326 | 3300025933 | Ga0207706_10050870 | Ga0207706_100508703 | 141 |
| 327 | 3300025934 | Ga0207686_10779655 | Ga0207686_107796552 | 141 |
| 328 | 3300025935 | Ga0207709_10087617 | Ga0207709_100876172 | 141 |
| 329 | 3300025935 | Ga0207709_10222826 | Ga0207709_102228263 | 141 |
| 330 | 3300025940 | Ga0207691_10512795 | Ga0207691_105127952 | 141 |
| 331 | 3300025941 | Ga0207711_10028374 | Ga0207711_100283742 | 141 |
| 332 | 3300025942 | Ga0207689_10115421 | Ga0207689_101154212 | 141 |
| 333 | 3300025944 | Ga0207661_10813694 | Ga0207661_108136943 | 141 |
| 334 | 3300025945 | Ga0207679_10058092 | Ga0207679_100580923 | 141 |
| 335 | 3300025945 | Ga0207679_10320714 | Ga0207679_103207142 | 141 |
| 336 | 3300025945 | Ga0207679_10347950 | Ga0207679_103479502 | 141 |
| 337 | 3300025949 | Ga0207667_10081604 | Ga0207667_100816046 | 141 |
| 338 | 3300025960 | Ga0207651_11096735 | Ga0207651_110967352 | 141 |
| 339 | 3300025972 | Ga0207668_10056922 | Ga0207668_100569222 | 141 |
| 340 | 3300025986 | Ga0207658_11214743 | Ga0207658_112147432 | 141 |
| 341 | 3300026023 | Ga0207677_10058951 | Ga0207677_100589512 | 141 |
| 342 | 3300026035 | Ga0207703_10042864 | Ga0207703_100428646 | 141 |
| 343 | 3300026041 | Ga0207639_11123800 | Ga0207639_111238002 | 141 |
| 344 | 3300026067 | Ga0207678_10049171 | Ga0207678_100491712 | 141 |
| 345 | 3300026067 | Ga0207678_10086523 | Ga0207678_100865232 | 141 |
| 346 | 3300026075 | Ga0207708_10958335 | Ga0207708_109583351 | 141 |
| 347 | 3300026078 | Ga0207702_10449499 | Ga0207702_104494992 | 141 |
| 348 | 3300026078 | Ga0207702_10706647 | Ga0207702_107066472 | 141 |
| 349 | 3300026088 | Ga0207641_10048178 | Ga0207641_100481785 | 141 |
| 350 | 3300026089 | Ga0207648_10318615 | Ga0207648_103186151 | 141 |
| 351 | 3300026095 | Ga0207676_10121531 | Ga0207676_101215315 | 141 |
| 352 | 3300026095 | Ga0207676_10212243 | Ga0207676_102122432 | 141 |
| 353 | 3300026116 | Ga0207674_10043409 | Ga0207674_100434097 | 141 |
| 354 | 3300026121 | Ga0207683_10078559 | Ga0207683_100785594 | 141 |
| 355 | 3300026121 | Ga0207683_10256196 | Ga0207683_102561962 | 141 |
| 356 | 3300026121 | Ga0207683_10379938 | Ga0207683_103799382 | 141 |
| 357 | 3300026142 | Ga0207698_10051950 | Ga0207698_100519502 | 141 |
| 358 | 3300026142 | Ga0207698_10054092 | Ga0207698_100540925 | 141 |
| 359 | 3300027866 | Ga0209813_10053603 | Ga0209813_100536032 | 141 |
| 360 | 3300027866 | Ga0209813_10060064 | Ga0209813_100600642 | 141 |
| 361 | 3300028379 | Ga0268266_10040140 | Ga0268266_100401403 | 141 |
| 362 | 3300028380 | Ga0268265_10113824 | Ga0268265_101138243 | 141 |
| 363 | 3300028380 | Ga0268265_11059051 | Ga0268265_110590512 | 141 |
| 364 | 3300028381 | Ga0268264_11868550 | Ga0268264_118685502 | 141 |
| 365 | 3300030522 | Ga0307512_10165615 | Ga0307512_101656152 | 141 |
| 366 | 3300031507 | Ga0307509_10371502 | Ga0307509_103715022 | 141 |
| 367 | 3300032126 | Ga0307415_100162761 | Ga0307415_1001627612 | 141 |
| 368 | 3300033180 | Ga0307510_10036728 | Ga0307510_100367283 | 141 |
| 369 | 3300035089 | Ga0373944_0009603 | Ga0373944_0009603_1974_2402 | 141 |
| 370 | 3300035116 | Ga0373945_0148279 | Ga0373945_0148279_42_470 | 141 |
| 371 | 3300035116 | Ga0373945_0255021 | Ga0373945_0255021_168_602 | 141 |
| 372 | 3300035117 | Ga0373953_0047024 | Ga0373953_0047024_683_1111 | 141 |
| 373 | 3300035170 | Ga0373943_0043404 | Ga0373943_0043404_1031_1459 | 141 |
| 374 | 3300035171 | Ga0373946_0043799 | Ga0373946_0043799_713_1141 | 141 |
| 375 | 3300035172 | Ga0373955_0057334 | Ga0373955_0057334_1030_1458 | 141 |
| 376 | 3300035692 | Ga0373935_0000493 | Ga0373935_0000493_9981_10409 | 141 |
| 377 | 3300035695 | Ga0373927_0000331 | Ga0373927_0000331_14507_14935 | 141 |
| 378 | 3300035725 | Ga0373947_0002830 | Ga0373947_0002830_2227_2655 | 141 |
| 379 | 3300036401 | Ga0373937_0008766 | Ga0373937_0008766_7600_8028 | 141 |
| 380 | 3300037068 | Ga0373925_0004263 | Ga0373925_0004263_4234_4662 | 141 |
| 381 | 3300037068 | Ga0373925_0182984 | Ga0373925_0182984_512_946 | 141 |
| 382 | 3300037471 | Ga0395905_0675452 | Ga0395905_0675452_39_467 | 141 |
| 383 | 3300039447 | Ga0436361_0297606 | Ga0436361_0297606_286_711 | 141 |
| 384 | 3300039450 | Ga0436363_1655123 | Ga0436363_1655123_451_876 | 141 |
| 385 | 3300041486 | Ga0451807_0093477 | Ga0451807_0093477_243_686 | 141 |
| 386 | 3300044684 | Ga0466966_0553481 | Ga0466966_0553481_245_673 | 141 |
| 387 | 3300046453 | Ga0495627_087526 | Ga0495627_087526_392_820 | 141 |
| 388 | 3300046455 | Ga0495603_0000643 | Ga0495603_0000643_4841_5269 | 141 |
| 389 | 3300046455 | Ga0495603_0037582 | Ga0495603_0037582_486_920 | 141 |
| 390 | 3300046459 | Ga0495629_0000423 | Ga0495629_0000423_27793_28221 | 141 |
| 391 | 3300046461 | Ga0495641_0003178 | Ga0495641_0003178_11641_12069 | 141 |
| 392 | 3300046463 | Ga0495653_0047134 | Ga0495653_0047134_376_804 | 141 |
| 393 | 3300046472 | Ga0495580_0002433 | Ga0495580_0002433_4079_4507 | 141 |
| 394 | 3300046473 | Ga0495582_0000166 | Ga0495582_0000166_26743_27171 | 141 |
| 395 | 3300046475 | Ga0495639_0000306 | Ga0495639_0000306_4869_5297 | 141 |
| 396 | 3300046476 | Ga0495662_0019982 | Ga0495662_0019982_2230_2658 | 141 |
| 397 | 3300046477 | Ga0495664_0005452 | Ga0495664_0005452_1372_1800 | 141 |
| 398 | 3300046491 | Ga0495584_0018933 | Ga0495584_0018933_1866_2300 | 141 |
| 399 | 3300046491 | Ga0495584_0227838 | Ga0495584_0227838_108_536 | 141 |
| 400 | 3300046491 | Ga0495584_0291975 | Ga0495584_0291975_364_792 | 141 |
| 401 | 3300046499 | Ga0495594_0002782 | Ga0495594_0002782_1897_2325 | 141 |
| 402 | 3300046499 | Ga0495594_0075067 | Ga0495594_0075067_1420_1848 | 141 |
| 403 | 3300046511 | Ga0495608_0147841 | Ga0495608_0147841_317_745 | 141 |
| 404 | 3300046516 | Ga0495628_0025658 | Ga0495628_0025658_2028_2456 | 141 |
| 405 | 3300046516 | Ga0495628_0516497 | Ga0495628_0516497_103_531 | 141 |
| 406 | 3300046517 | Ga0495630_0005320 | Ga0495630_0005320_5225_5653 | 141 |
| 407 | 3300046518 | Ga0495631_0036711 | Ga0495631_0036711_67_495 | 141 |
| 408 | 3300046520 | Ga0495637_0198126 | Ga0495637_0198126_269_703 | 141 |
| 409 | 3300046522 | Ga0495643_0145063 | Ga0495643_0145063_632_1060 | 141 |
| 410 | 3300046525 | Ga0495663_0029997 | Ga0495663_0029997_1162_1590 | 141 |
| 411 | 3300046526 | Ga0495666_0031319 | Ga0495666_0031319_1920_2348 | 141 |
| 412 | 3300046529 | Ga0495652_0011395 | Ga0495652_0011395_4907_5335 | 141 |
| 413 | 3300046529 | Ga0495652_0173019 | Ga0495652_0173019_27_455 | 141 |
| 414 | 3300046531 | Ga0495665_0000104 | Ga0495665_0000104_16535_16963 | 141 |
| 415 | 3300046535 | Ga0495586_0090832 | Ga0495586_0090832_975_1403 | 141 |
| 416 | 3300046557 | Ga0495622_0004750 | Ga0495622_0004750_3655_4083 | 141 |
| 417 | 3300046557 | Ga0495622_0033943 | Ga0495622_0033943_1053_1487 | 141 |
| 418 | 3300046557 | Ga0495622_0259627 | Ga0495622_0259627_247_675 | 141 |
| 419 | 3300046559 | Ga0495667_0035722 | Ga0495667_0035722_633_1061 | 141 |
| 420 | 3300046642 | Ga0495634_0003095 | Ga0495634_0003095_5197_5625 | 141 |
| 421 | 3300046663 | Ga0495635_0004351 | Ga0495635_0004351_6705_7133 | 141 |
| 422 | 3300046674 | Ga0495588_0006073 | Ga0495588_0006073_3039_3473 | 141 |
| 423 | 3300046674 | Ga0495588_0343312 | Ga0495588_0343312_88_516 | 141 |
| 424 | 3300046675 | Ga0495657_0186570 | Ga0495657_0186570_675_1103 | 141 |
| 425 | 3300046680 | Ga0495646_0030478 | Ga0495646_0030478_2721_3149 | 141 |
| 426 | 3300046681 | Ga0495647_0000279 | Ga0495647_0000279_12674_13102 | 141 |
| 427 | 3300046681 | Ga0495647_0135440 | Ga0495647_0135440_521_952 | 141 |
| 428 | 3300046683 | Ga0495658_0007144 | Ga0495658_0007144_2626_3054 | 141 |
| 429 | 3300046689 | Ga0495613_0006409 | Ga0495613_0006409_5003_5431 | 141 |
| 430 | 3300046690 | Ga0495624_0003391 | Ga0495624_0003391_1382_1810 | 141 |
| 431 | 3300046809 | Ga0495600_0112015 | Ga0495600_0112015_516_944 | 141 |
| 432 | 3300047315 | Ga0495581_0001274 | Ga0495581_0001274_4869_5297 | 141 |
| 433 | 3300047319 | Ga0495674_0001108 | Ga0495674_0001108_16539_16967 | 141 |
| 434 | 3300047321 | Ga0495676_0018692 | Ga0495676_0018692_2697_3125 | 141 |
| 435 | 3300047322 | Ga0495680_0705176 | Ga0495680_0705176_64_492 | 141 |
| 436 | 3300047446 | Ga0495679_116558 | Ga0495679_116558_11_439 | 141 |
| 437 | 3300047673 | Ga0495593_0000180 | Ga0495593_0000180_26738_27166 | 141 |
| 438 | 3300048091 | Ga0495626_0089026 | Ga0495626_0089026_353_781 | 141 |
| 439 | 3300048903 | Ga0496100_0106485 | Ga0496100_0106485_1491_1919 | 141 |
| 440 | 3300048904 | Ga0496101_0008882 | Ga0496101_0008882_3489_3917 | 141 |
| 441 | 3300048905 | Ga0496102_0007049 | Ga0496102_0007049_270_698 | 141 |
| 442 | 3300048905 | Ga0496102_0208311 | Ga0496102_0208311_684_1112 | 141 |
| 443 | 3300048906 | Ga0496103_0231341 | Ga0496103_0231341_598_1026 | 141 |
| 444 | 3300048907 | Ga0496104_0105809 | Ga0496104_0105809_136_564 | 141 |
| 445 | 3300048908 | Ga0496105_0179549 | Ga0496105_0179549_928_1356 | 141 |
| 446 | 3300048908 | Ga0496105_0682782 | Ga0496105_0682782_42_470 | 141 |
| 447 | 3300048909 | Ga0496106_0046854 | Ga0496106_0046854_1014_1442 | 141 |
| 448 | 3300048909 | Ga0496106_0095010 | Ga0496106_0095010_1500_1928 | 141 |
| 449 | 3300048909 | Ga0496106_0550105 | Ga0496106_0550105_311_739 | 141 |
| 450 | 3300048910 | Ga0496107_0021922 | Ga0496107_0021922_406_834 | 141 |
| 451 | 3300048910 | Ga0496107_0397140 | Ga0496107_0397140_255_683 | 141 |
| 452 | 3300048910 | Ga0496107_1058291 | Ga0496107_1058291_74_508 | 141 |
| 453 | 3300048911 | Ga0496108_0023293 | Ga0496108_0023293_106_534 | 141 |
| 454 | 3300048911 | Ga0496108_0172544 | Ga0496108_0172544_1014_1442 | 141 |
| 455 | 3300048912 | Ga0496109_0051360 | Ga0496109_0051360_106_534 | 141 |
| 456 | 3300048912 | Ga0496109_0573670 | Ga0496109_0573670_576_1004 | 141 |
| 457 | 3300048913 | Ga0496110_0033450 | Ga0496110_0033450_3836_4264 | 141 |
| 458 | 3300048913 | Ga0496110_0383222 | Ga0496110_0383222_519_947 | 141 |
| 459 | 3300048913 | Ga0496110_0883901 | Ga0496110_0883901_30_458 | 141 |
| 460 | 3300048914 | Ga0496111_0071138 | Ga0496111_0071138_1705_2133 | 141 |
| 461 | 3300048914 | Ga0496111_0092490 | Ga0496111_0092490_649_1077 | 141 |
| 462 | 3300048915 | Ga0496112_0020318 | Ga0496112_0020318_5557_5985 | 141 |
| 463 | 3300048915 | Ga0496112_0305009 | Ga0496112_0305009_803_1231 | 141 |
| 464 | 3300048916 | Ga0496113_0121025 | Ga0496113_0121025_946_1374 | 141 |
| 465 | 3300048916 | Ga0496113_0460122 | Ga0496113_0460122_351_779 | 141 |
| 466 | 3300048917 | Ga0496114_0875937 | Ga0496114_0875937_84_512 | 141 |
| 467 | 3300048918 | Ga0496115_0002825 | Ga0496115_0002825_2540_2968 | 141 |
| 468 | 3300048919 | Ga0496116_0291458 | Ga0496116_0291458_236_664 | 141 |
| 469 | 3300048922 | Ga0496119_0231190 | Ga0496119_0231190_209_637 | 141 |
| 470 | 3300048924 | Ga0496121_0244714 | Ga0496121_0244714_685_1113 | 141 |
| 471 | 3300048928 | Ga0496125_0086642 | Ga0496125_0086642_1833_2261 | 141 |
| 472 | 3300049579 | Ga0501043_0417942 | Ga0501043_0417942_139_570 | 141 |
| 473 | 3300049584 | Ga0501068_0500772 | Ga0501068_0500772_74_502 | 141 |
| 474 | 3300049586 | Ga0501070_0435315 | Ga0501070_0435315_253_684 | 141 |
| 475 | 3300049822 | Ga0501035_0179627 | Ga0501035_0179627_323_757 | 141 |
| 476 | 3300049823 | Ga0501044_0388223 | Ga0501044_0388223_408_839 | 141 |
| 477 | 3300050490 | nmdc:mga03n38_89156_c1 | nmdc:mga03n38_89156_c1_422_850 | 141 |
| 478 | 3300050491 | nmdc:mga00v17_124232_c1 | nmdc:mga00v17_124232_c1_377_805 | 141 |
| 479 | 3300050492 | nmdc:mga0yw44_122842_c1 | nmdc:mga0yw44_122842_c1_1236_1664 | 141 |
| 480 | 3300050495 | nmdc:mga04h51_66496_c1 | nmdc:mga04h51_66496_c1_636_1064 | 141 |
| 481 | 3300050496 | nmdc:mga07m45_52186_c1 | nmdc:mga07m45_52186_c1_107_535 | 141 |
| 482 | 3300050511 | nmdc:mga08y16_1736710_c1 | nmdc:mga08y16_1736710_c1_79_507 | 141 |
| 483 | 3300050515 | nmdc:mga0a205_441294_c1 | nmdc:mga0a205_441294_c1_49_477 | 141 |
| 484 | 3300053077 | Ga0495601_0024851 | Ga0495601_0024851_1095_1523 | 141 |
| 485 | 3300053093 | Ga0500651_0273545 | Ga0500651_0273545_396_830 | 141 |
| 486 | 3300053096 | Ga0500641_0004900 | Ga0500641_0004900_2736_3164 | 141 |
| 487 | 3300053096 | Ga0500641_0031435 | Ga0500641_0031435_87_515 | 141 |
| 488 | 3300053119 | Ga0500595_157430 | Ga0500595_157430_179_613 | 141 |
| 489 | 3300053147 | Ga0500589_142002 | Ga0500589_142002_87_515 | 141 |
| 490 | 3300053148 | Ga0500590_198964 | Ga0500590_198964_398_832 | 141 |
| 491 | 3300053178 | Ga0500637_0371650 | Ga0500637_0371650_27_461 | 141 |
| 492 | 3300005329 | Ga0070683_100003964 | Ga0070683_10000396410 | 142 |
| 493 | 3300005329 | Ga0070683_100079622 | Ga0070683_1000796222 | 142 |
| 494 | 3300005336 | Ga0070680_100055170 | Ga0070680_1000551702 | 142 |
| 495 | 3300005336 | Ga0070680_100068558 | Ga0070680_1000685582 | 142 |
| 496 | 3300005341 | Ga0070691_10525261 | Ga0070691_105252611 | 142 |
| 497 | 3300005341 | Ga0070691_10760503 | Ga0070691_107605031 | 142 |
| 498 | 3300005365 | Ga0070688_100982178 | Ga0070688_1009821782 | 142 |
| 499 | 3300005434 | Ga0070709_10073035 | Ga0070709_100730354 | 142 |
| 500 | 3300005436 | Ga0070713_100031026 | Ga0070713_1000310264 | 142 |
| 501 | 3300005436 | Ga0070713_100063352 | Ga0070713_1000633521 | 142 |
| 502 | 3300005437 | Ga0070710_10030040 | Ga0070710_100300403 | 142 |
| 503 | 3300005439 | Ga0070711_100102989 | Ga0070711_1001029892 | 142 |
| 504 | 3300005439 | Ga0070711_100185301 | Ga0070711_1001853013 | 142 |
| 505 | 3300005439 | Ga0070711_100558258 | Ga0070711_1005582582 | 142 |
| 506 | 3300005458 | Ga0070681_10013875 | Ga0070681_100138755 | 142 |
| 507 | 3300005458 | Ga0070681_10044746 | Ga0070681_100447462 | 142 |
| 508 | 3300005458 | Ga0070681_10075021 | Ga0070681_100750216 | 142 |
| 509 | 3300005458 | Ga0070681_11053154 | Ga0070681_110531542 | 142 |
| 510 | 3300005530 | Ga0070679_100006191 | Ga0070679_1000061912 | 142 |
| 511 | 3300005530 | Ga0070679_100142594 | Ga0070679_1001425943 | 142 |
| 512 | 3300005530 | Ga0070679_100607748 | Ga0070679_1006077482 | 142 |
| 513 | 3300005535 | Ga0070684_100013415 | Ga0070684_1000134152 | 142 |
| 514 | 3300005539 | Ga0068853_100346712 | Ga0068853_1003467122 | 142 |
| 515 | 3300005539 | Ga0068853_100503458 | Ga0068853_1005034582 | 142 |
| 516 | 3300005563 | Ga0068855_100131157 | Ga0068855_1001311573 | 142 |
| 517 | 3300005563 | Ga0068855_100163677 | Ga0068855_1001636776 | 142 |
| 518 | 3300005563 | Ga0068855_100452624 | Ga0068855_1004526242 | 142 |
| 519 | 3300005564 | Ga0070664_100360971 | Ga0070664_1003609712 | 142 |
| 520 | 3300005578 | Ga0068854_101554221 | Ga0068854_1015542211 | 142 |
| 521 | 3300005614 | Ga0068856_101835309 | Ga0068856_1018353092 | 142 |
| 522 | 3300005937 | Ga0081455_10006836 | Ga0081455_100068367 | 142 |
| 523 | 3300005983 | Ga0081540_1002541 | Ga0081540_10025412 | 142 |
| 524 | 3300006028 | Ga0070717_10486552 | Ga0070717_104865521 | 142 |
| 525 | 3300006048 | Ga0075363_100200181 | Ga0075363_1002001812 | 142 |
| 526 | 3300006048 | Ga0075363_100607542 | Ga0075363_1006075422 | 142 |
| 527 | 3300006173 | Ga0070716_100074228 | Ga0070716_1000742284 | 142 |
| 528 | 3300006173 | Ga0070716_100181662 | Ga0070716_1001816621 | 142 |
| 529 | 3300006175 | Ga0070712_101548153 | Ga0070712_1015481532 | 142 |
| 530 | 3300006178 | Ga0075367_10014213 | Ga0075367_100142132 | 142 |
| 531 | 3300006178 | Ga0075367_10553360 | Ga0075367_105533602 | 142 |
| 532 | 3300006237 | Ga0097621_100214525 | Ga0097621_1002145253 | 142 |
| 533 | 3300006871 | Ga0075434_100011681 | Ga0075434_1000116813 | 142 |
| 534 | 3300007076 | Ga0075435_100214341 | Ga0075435_1002143411 | 142 |
| 535 | 3300009093 | Ga0105240_10124519 | Ga0105240_101245192 | 142 |
| 536 | 3300009174 | Ga0105241_10274619 | Ga0105241_102746192 | 142 |
| 537 | 3300009176 | Ga0105242_11741590 | Ga0105242_117415901 | 142 |
| 538 | 3300009545 | Ga0105237_10783784 | Ga0105237_107837842 | 142 |
| 539 | 3300009551 | Ga0105238_10099537 | Ga0105238_100995372 | 142 |
| 540 | 3300009551 | Ga0105238_10131256 | Ga0105238_101312562 | 142 |
| 541 | 3300009551 | Ga0105238_10438766 | Ga0105238_104387661 | 142 |
| 542 | 3300009551 | Ga0105238_10452935 | Ga0105238_104529352 | 142 |
| 543 | 3300009551 | Ga0105238_11480337 | Ga0105238_114803371 | 142 |
| 544 | 3300010375 | Ga0105239_11096518 | Ga0105239_110965181 | 142 |
| 545 | 3300010375 | Ga0105239_11662826 | Ga0105239_116628262 | 142 |
| 546 | 3300013104 | Ga0157370_11872048 | Ga0157370_118720481 | 142 |
| 547 | 3300013105 | Ga0157369_10078520 | Ga0157369_100785202 | 142 |
| 548 | 3300013307 | Ga0157372_11290869 | Ga0157372_112908691 | 142 |
| 549 | 3300020070 | Ga0206356_10162217 | Ga0206356_101622171 | 142 |
| 550 | 3300025261 | Ga0209233_1011817 | Ga0209233_10118172 | 142 |
| 551 | 3300025898 | Ga0207692_10025941 | Ga0207692_100259411 | 142 |
| 552 | 3300025906 | Ga0207699_10704524 | Ga0207699_107045242 | 142 |
| 553 | 3300025911 | Ga0207654_10212208 | Ga0207654_102122082 | 142 |
| 554 | 3300025912 | Ga0207707_10000183 | Ga0207707_1000018336 | 142 |
| 555 | 3300025912 | Ga0207707_10322129 | Ga0207707_103221292 | 142 |
| 556 | 3300025912 | Ga0207707_11119159 | Ga0207707_111191592 | 142 |
| 557 | 3300025914 | Ga0207671_10178937 | Ga0207671_101789371 | 142 |
| 558 | 3300025914 | Ga0207671_10982847 | Ga0207671_109828471 | 142 |
| 559 | 3300025916 | Ga0207663_10236845 | Ga0207663_102368452 | 142 |
| 560 | 3300025917 | Ga0207660_10096617 | Ga0207660_100966172 | 142 |
| 561 | 3300025921 | Ga0207652_10038444 | Ga0207652_100384442 | 142 |
| 562 | 3300025921 | Ga0207652_10059768 | Ga0207652_100597684 | 142 |
| 563 | 3300025921 | Ga0207652_10171088 | Ga0207652_101710882 | 142 |
| 564 | 3300025924 | Ga0207694_10111406 | Ga0207694_101114062 | 142 |
| 565 | 3300025924 | Ga0207694_11078741 | Ga0207694_110787411 | 142 |
| 566 | 3300025929 | Ga0207664_10368328 | Ga0207664_103683282 | 142 |
| 567 | 3300025939 | Ga0207665_10048415 | Ga0207665_100484153 | 142 |
| 568 | 3300025944 | Ga0207661_10039177 | Ga0207661_100391772 | 142 |
| 569 | 3300025944 | Ga0207661_10949270 | Ga0207661_109492702 | 142 |
| 570 | 3300025945 | Ga0207679_10630265 | Ga0207679_106302651 | 142 |
| 571 | 3300025949 | Ga0207667_10365346 | Ga0207667_103653463 | 142 |
| 572 | 3300026041 | Ga0207639_10282221 | Ga0207639_102822212 | 142 |
| 573 | 3300026078 | Ga0207702_11540266 | Ga0207702_115402662 | 142 |
| 574 | 3300026116 | Ga0207674_10074949 | Ga0207674_100749493 | 142 |
| 575 | 3300026142 | Ga0207698_11739866 | Ga0207698_117398661 | 142 |
| 576 | 3300027866 | Ga0209813_10034886 | Ga0209813_100348863 | 142 |
| 577 | 3300031456 | Ga0307513_10242857 | Ga0307513_102428572 | 142 |
| 578 | 3300031730 | Ga0307516_10192735 | Ga0307516_101927354 | 142 |
| 579 | 3300031901 | Ga0307406_10500803 | Ga0307406_105008031 | 142 |
| 580 | 3300033180 | Ga0307510_10229328 | Ga0307510_102293282 | 142 |
| 581 | 3300033442 | Ga0315911_1000004 | Ga0315911_1000004322 | 142 |
| 582 | 3300035083 | Ga0373926_0009290 | Ga0373926_0009290_2336_2767 | 142 |
| 583 | 3300035086 | Ga0373934_0068318 | Ga0373934_0068318_282_710 | 142 |
| 584 | 3300035111 | Ga0373923_0046874 | Ga0373923_0046874_500_931 | 142 |
| 585 | 3300035113 | Ga0373936_0017300 | Ga0373936_0017300_494_925 | 142 |
| 586 | 3300035114 | Ga0373939_0541396 | Ga0373939_0541396_40_471 | 142 |
| 587 | 3300035118 | Ga0373954_0103943 | Ga0373954_0103943_395_826 | 142 |
| 588 | 3300035172 | Ga0373955_0024852 | Ga0373955_0024852_510_941 | 142 |
| 589 | 3300035410 | Ga0373924_0112886 | Ga0373924_0112886_656_1087 | 142 |
| 590 | 3300035692 | Ga0373935_0007392 | Ga0373935_0007392_2410_2847 | 142 |
| 591 | 3300035695 | Ga0373927_0819604 | Ga0373927_0819604_70_501 | 142 |
| 592 | 3300035724 | Ga0373933_0393415 | Ga0373933_0393415_13_450 | 142 |
| 593 | 3300036401 | Ga0373937_0071845 | Ga0373937_0071845_744_1181 | 142 |
| 594 | 3300037418 | Ga0395900_0166816 | Ga0395900_0166816_381_812 | 142 |
| 595 | 3300037466 | Ga0395898_0166907 | Ga0395898_0166907_588_1019 | 142 |
| 596 | 3300038443 | Ga0395901_0470988 | Ga0395901_0470988_471_902 | 142 |
| 597 | 3300039437 | Ga0436365_1855944 | Ga0436365_1855944_337_768 | 142 |
| 598 | 3300039450 | Ga0436363_0863724 | Ga0436363_0863724_198_629 | 142 |
| 599 | 3300041453 | Ga0451797_0871558 | Ga0451797_0871558_189_620 | 142 |
| 600 | 3300041492 | Ga0451835_0260168 | Ga0451835_0260168_59_490 | 142 |
| 601 | 3300044683 | Ga0466965_0138651 | Ga0466965_0138651_174_605 | 142 |
| 602 | 3300044706 | Ga0466964_0067938 | Ga0466964_0067938_963_1394 | 142 |
| 603 | 3300044719 | Ga0466971_0153010 | Ga0466971_0153010_517_948 | 142 |
| 604 | 3300044735 | Ga0466968_0395778 | Ga0466968_0395778_151_582 | 142 |
| 605 | 3300045049 | Ga0466959_0013030 | Ga0466959_0013030_3689_4120 | 142 |
| 606 | 3300045976 | Ga0466967_0141055 | Ga0466967_0141055_791_1237 | 142 |
| 607 | 3300045976 | Ga0466967_0165418 | Ga0466967_0165418_1240_1671 | 142 |
| 608 | 3300045976 | Ga0466967_0605290 | Ga0466967_0605290_478_909 | 142 |
| 609 | 3300046454 | Ga0495592_0021816 | Ga0495592_0021816_3140_3571 | 142 |
| 610 | 3300046455 | Ga0495603_0371880 | Ga0495603_0371880_111_542 | 142 |
| 611 | 3300046459 | Ga0495629_0067609 | Ga0495629_0067609_1530_1967 | 142 |
| 612 | 3300046472 | Ga0495580_0001799 | Ga0495580_0001799_12964_13395 | 142 |
| 613 | 3300046475 | Ga0495639_0024678 | Ga0495639_0024678_513_944 | 142 |
| 614 | 3300046476 | Ga0495662_0093108 | Ga0495662_0093108_714_1145 | 142 |
| 615 | 3300046477 | Ga0495664_0002707 | Ga0495664_0002707_248_679 | 142 |
| 616 | 3300046477 | Ga0495664_0091326 | Ga0495664_0091326_1201_1638 | 142 |
| 617 | 3300046477 | Ga0495664_0149781 | Ga0495664_0149781_696_1124 | 142 |
| 618 | 3300046511 | Ga0495608_0194068 | Ga0495608_0194068_255_692 | 142 |
| 619 | 3300046514 | Ga0495618_0013721 | Ga0495618_0013721_1792_2229 | 142 |
| 620 | 3300046516 | Ga0495628_0021914 | Ga0495628_0021914_3270_3707 | 142 |
| 621 | 3300046529 | Ga0495652_0348316 | Ga0495652_0348316_27_464 | 142 |
| 622 | 3300046531 | Ga0495665_0056289 | Ga0495665_0056289_1444_1881 | 142 |
| 623 | 3300046535 | Ga0495586_0192089 | Ga0495586_0192089_394_825 | 142 |
| 624 | 3300046536 | Ga0495587_0422757 | Ga0495587_0422757_119_556 | 142 |
| 625 | 3300046543 | Ga0495645_0014804 | Ga0495645_0014804_888_1319 | 142 |
| 626 | 3300046543 | Ga0495645_0205916 | Ga0495645_0205916_730_1161 | 142 |
| 627 | 3300046559 | Ga0495667_0129327 | Ga0495667_0129327_605_1042 | 142 |
| 628 | 3300046648 | Ga0495611_0045991 | Ga0495611_0045991_315_755 | 142 |
| 629 | 3300046663 | Ga0495635_0243431 | Ga0495635_0243431_278_715 | 142 |
| 630 | 3300046663 | Ga0495635_0930923 | Ga0495635_0930923_61_492 | 142 |
| 631 | 3300046674 | Ga0495588_0042080 | Ga0495588_0042080_453_884 | 142 |
| 632 | 3300046675 | Ga0495657_0194155 | Ga0495657_0194155_531_962 | 142 |
| 633 | 3300046678 | Ga0495599_0034495 | Ga0495599_0034495_1853_2284 | 142 |
| 634 | 3300046679 | Ga0495623_0363689 | Ga0495623_0363689_29_466 | 142 |
| 635 | 3300046681 | Ga0495647_0113762 | Ga0495647_0113762_166_597 | 142 |
| 636 | 3300046683 | Ga0495658_0016130 | Ga0495658_0016130_1594_2025 | 142 |
| 637 | 3300046684 | Ga0495669_0141250 | Ga0495669_0141250_25_459 | 142 |
| 638 | 3300046684 | Ga0495669_0338513 | Ga0495669_0338513_259_690 | 142 |
| 639 | 3300046689 | Ga0495613_0238783 | Ga0495613_0238783_450_887 | 142 |
| 640 | 3300047315 | Ga0495581_0201879 | Ga0495581_0201879_111_542 | 142 |
| 641 | 3300047319 | Ga0495674_0104773 | Ga0495674_0104773_270_701 | 142 |
| 642 | 3300047321 | Ga0495676_0340693 | Ga0495676_0340693_62_493 | 142 |
| 643 | 3300047322 | Ga0495680_0556609 | Ga0495680_0556609_16_447 | 142 |
| 644 | 3300047444 | Ga0495675_0352082 | Ga0495675_0352082_184_615 | 142 |
| 645 | 3300047471 | Ga0495684_0004305 | Ga0495684_0004305_581_1018 | 142 |
| 646 | 3300047673 | Ga0495593_0087193 | Ga0495593_0087193_624_1061 | 142 |
| 647 | 3300048088 | Ga0495602_0712355 | Ga0495602_0712355_19_450 | 142 |
| 648 | 3300048089 | Ga0495614_0132823 | Ga0495614_0132823_349_780 | 142 |
| 649 | 3300048903 | Ga0496100_0203330 | Ga0496100_0203330_368_799 | 142 |
| 650 | 3300048905 | Ga0496102_0293655 | Ga0496102_0293655_431_862 | 142 |
| 651 | 3300048905 | Ga0496102_1236806 | Ga0496102_1236806_196_627 | 142 |
| 652 | 3300048909 | Ga0496106_0440421 | Ga0496106_0440421_138_584 | 142 |
| 653 | 3300048910 | Ga0496107_0131559 | Ga0496107_0131559_1122_1568 | 142 |
| 654 | 3300048922 | Ga0496119_0538281 | Ga0496119_0538281_48_479 | 142 |
| 655 | 3300048924 | Ga0496121_0091430 | Ga0496121_0091430_1466_1912 | 142 |
| 656 | 3300048929 | Ga0496126_0399822 | Ga0496126_0399822_474_905 | 142 |
| 657 | 3300048929 | Ga0496126_0465443 | Ga0496126_0465443_82_528 | 142 |
| 658 | 3300049569 | Ga0501032_0013062 | Ga0501032_0013062_3583_4026 | 142 |
| 659 | 3300049570 | Ga0501033_0038747 | Ga0501033_0038747_697_1140 | 142 |
| 660 | 3300049570 | Ga0501033_0178484 | Ga0501033_0178484_876_1307 | 142 |
| 661 | 3300049572 | Ga0501036_1016100 | Ga0501036_1016100_208_651 | 142 |
| 662 | 3300049578 | Ga0501042_0003793 | Ga0501042_0003793_43_486 | 142 |
| 663 | 3300049579 | Ga0501043_0042848 | Ga0501043_0042848_451_894 | 142 |
| 664 | 3300049580 | Ga0501046_0014785 | Ga0501046_0014785_3018_3449 | 142 |
| 665 | 3300049580 | Ga0501046_0098249 | Ga0501046_0098249_668_1111 | 142 |
| 666 | 3300049581 | Ga0501047_0006243 | Ga0501047_0006243_4607_5038 | 142 |
| 667 | 3300049581 | Ga0501047_0273890 | Ga0501047_0273890_368_811 | 142 |
| 668 | 3300049582 | Ga0501048_0241639 | Ga0501048_0241639_758_1201 | 142 |
| 669 | 3300049583 | Ga0501067_0004029 | Ga0501067_0004029_210_653 | 142 |
| 670 | 3300049584 | Ga0501068_0021789 | Ga0501068_0021789_2182_2625 | 142 |
| 671 | 3300049585 | Ga0501069_0018680 | Ga0501069_0018680_530_973 | 142 |
| 672 | 3300049586 | Ga0501070_0006105 | Ga0501070_0006105_8144_8575 | 142 |
| 673 | 3300049586 | Ga0501070_0039330 | Ga0501070_0039330_519_962 | 142 |
| 674 | 3300049589 | Ga0501073_0019684 | Ga0501073_0019684_2174_2605 | 142 |
| 675 | 3300049590 | Ga0501074_0024471 | Ga0501074_0024471_2230_2661 | 142 |
| 676 | 3300049590 | Ga0501074_0030015 | Ga0501074_0030015_3329_3772 | 142 |
| 677 | 3300049592 | Ga0501076_0214954 | Ga0501076_0214954_534_977 | 142 |
| 678 | 3300049741 | Ga0501079_0022539 | Ga0501079_0022539_384_827 | 142 |
| 679 | 3300049742 | Ga0501080_0003847 | Ga0501080_0003847_2485_2916 | 142 |
| 680 | 3300049823 | Ga0501044_0025532 | Ga0501044_0025532_2437_2868 | 142 |
| 681 | 3300049823 | Ga0501044_0053556 | Ga0501044_0053556_2054_2497 | 142 |
| 682 | 3300050490 | nmdc:mga03n38_256831_c1 | nmdc:mga03n38_256831_c1_165_599 | 142 |
| 683 | 3300050494 | nmdc:mga06z11_694435_c1 | nmdc:mga06z11_694435_c1_129_563 | 142 |
| 684 | 3300050495 | nmdc:mga04h51_245177_c1 | nmdc:mga04h51_245177_c1_210_644 | 142 |
| 685 | 3300050512 | nmdc:mga0n895_42303_c1 | nmdc:mga0n895_42303_c1_2367_2798 | 142 |
| 686 | 3300050513 | nmdc:mga0rr50_166033_c1 | nmdc:mga0rr50_166033_c1_182_613 | 142 |
| 687 | 3300053077 | Ga0495601_0010823 | Ga0495601_0010823_1389_1820 | 142 |
| 688 | 3300053077 | Ga0495601_0101899 | Ga0495601_0101899_696_1124 | 142 |
| 689 | 3300053078 | Ga0495612_0011616 | Ga0495612_0011616_294_725 | 142 |
| 690 | 3300053078 | Ga0495612_0054027 | Ga0495612_0054027_207_638 | 142 |
| 691 | 3300053085 | Ga0495619_0111129 | Ga0495619_0111129_1004_1441 | 142 |
| 692 | 3300053090 | Ga0500646_0071520 | Ga0500646_0071520_274_714 | 142 |
| 693 | 3300053092 | Ga0500583_0257118 | Ga0500583_0257118_151_591 | 142 |
| 694 | 3300053130 | Ga0500642_0419472 | Ga0500642_0419472_56_496 | 142 |
| 695 | 3300053142 | Ga0500577_0183766 | Ga0500577_0183766_89_529 | 142 |
| 696 | iso_pu_bacteria | 2513237096 | 2513655812 | 142 |
| 697 | iso_pu_bacteria | 2513237137 | 2513856692 | 142 |
| 698 | iso_pu_bacteria | 2513237145 | 2513917275 | 142 |
| 699 | iso_pu_bacteria | 2517572143 | 2517895441 | 142 |
| 700 | iso_pu_bacteria | 2524023228 | 2524539616 | 142 |
| 701 | iso_pu_bacteria | 2667528175 | 2671122117 | 142 |
| 702 | iso_pu_bacteria | 2791355197 | 2793069420 | 142 |
| 703 | iso_pu_bacteria | 2885374607 | 2885382175 | 142 |
| 704 | iso_pu_bacteria | 2903748898 | 2903753913 | 142 |
| 705 | iso_pu_bacteria | 2904690495 | 2904698786 | 142 |
| 706 | iso_pu_bacteria | 2904699407 | 2904710906 | 142 |
| 707 | iso_pu_bacteria | 2906610324 | 2906615939 | 142 |
| 708 | iso_pu_bacteria | 2906635258 | 2906639035 | 142 |
| 709 | iso_pu_bacteria | 2906660503 | 2906662083 | 142 |
| 710 | iso_pu_bacteria | 2908739725 | 2908740953 | 142 |
| 711 | iso_pu_bacteria | 2922425934 | 2922432089 | 142 |
| 712 | iso_pu_bacteria | 2935630451 | 2935631034 | 142 |
| 713 | iso_pu_bacteria | 2941507105 | 2941507686 | 142 |
| 714 | iso_pu_bacteria | 2941515067 | 2941516113 | 142 |
| 715 | iso_pu_bacteria | 2941523033 | 2941523179 | 142 |
| 716 | iso_pu_bacteria | 3005474847 | 3005476888 | 142 |
| 717 | iso_pu_bacteria | 8006933436 | 8006934529 | 142 |
| 718 | iso_pu_bacteria | 8006973647 | 8006974499 | 142 |
| 719 | iso_pu_bacteria | 8019565922 | 8019574224 | 142 |
| 720 | 3300005327 | Ga0070658_10412460 | Ga0070658_104124602 | 143 |
| 721 | 3300005329 | Ga0070683_100164572 | Ga0070683_1001645723 | 143 |
| 722 | 3300005336 | Ga0070680_100022993 | Ga0070680_1000229932 | 143 |
| 723 | 3300005336 | Ga0070680_100497560 | Ga0070680_1004975602 | 143 |
| 724 | 3300005336 | Ga0070680_100938049 | Ga0070680_1009380491 | 143 |
| 725 | 3300005339 | Ga0070660_100012040 | Ga0070660_1000120406 | 143 |
| 726 | 3300005341 | Ga0070691_10031624 | Ga0070691_100316242 | 143 |
| 727 | 3300005344 | Ga0070661_100059734 | Ga0070661_1000597343 | 143 |
| 728 | 3300005344 | Ga0070661_100994451 | Ga0070661_1009944511 | 143 |
| 729 | 3300005366 | Ga0070659_100172418 | Ga0070659_1001724183 | 143 |
| 730 | 3300005366 | Ga0070659_100242989 | Ga0070659_1002429892 | 143 |
| 731 | 3300005367 | Ga0070667_100741837 | Ga0070667_1007418372 | 143 |
| 732 | 3300005434 | Ga0070709_10023329 | Ga0070709_100233292 | 143 |
| 733 | 3300005435 | Ga0070714_100042125 | Ga0070714_1000421253 | 143 |
| 734 | 3300005435 | Ga0070714_100157305 | Ga0070714_1001573052 | 143 |
| 735 | 3300005436 | Ga0070713_100002836 | Ga0070713_1000028368 | 143 |
| 736 | 3300005437 | Ga0070710_10000933 | Ga0070710_100009337 | 143 |
| 737 | 3300005439 | Ga0070711_100016753 | Ga0070711_1000167531 | 143 |
| 738 | 3300005439 | Ga0070711_101947039 | Ga0070711_1019470391 | 143 |
| 739 | 3300005441 | Ga0070700_100893457 | Ga0070700_1008934572 | 143 |
| 740 | 3300005445 | Ga0070708_100539136 | Ga0070708_1005391361 | 143 |
| 741 | 3300005455 | Ga0070663_100386757 | Ga0070663_1003867572 | 143 |
| 742 | 3300005457 | Ga0070662_100711961 | Ga0070662_1007119611 | 143 |
| 743 | 3300005458 | Ga0070681_10109202 | Ga0070681_101092022 | 143 |
| 744 | 3300005458 | Ga0070681_10748817 | Ga0070681_107488172 | 143 |
| 745 | 3300005471 | Ga0070698_101561736 | Ga0070698_1015617361 | 143 |
| 746 | 3300005530 | Ga0070679_100055570 | Ga0070679_1000555706 | 143 |
| 747 | 3300005535 | Ga0070684_100072576 | Ga0070684_1000725763 | 143 |
| 748 | 3300005536 | Ga0070697_100043484 | Ga0070697_1000434842 | 143 |
| 749 | 3300005539 | Ga0068853_100013662 | Ga0068853_1000136624 | 143 |
| 750 | 3300005563 | Ga0068855_100117221 | Ga0068855_1001172212 | 143 |
| 751 | 3300005563 | Ga0068855_100128245 | Ga0068855_1001282452 | 143 |
| 752 | 3300005577 | Ga0068857_100057180 | Ga0068857_1000571803 | 143 |
| 753 | 3300005578 | Ga0068854_100098929 | Ga0068854_1000989292 | 143 |
| 754 | 3300005578 | Ga0068854_100517428 | Ga0068854_1005174281 | 143 |
| 755 | 3300005614 | Ga0068856_100000217 | Ga0068856_10000021714 | 143 |
| 756 | 3300005614 | Ga0068856_100084670 | Ga0068856_1000846703 | 143 |
| 757 | 3300005614 | Ga0068856_100991027 | Ga0068856_1009910271 | 143 |
| 758 | 3300005616 | Ga0068852_100009784 | Ga0068852_1000097842 | 143 |
| 759 | 3300005616 | Ga0068852_100046151 | Ga0068852_1000461514 | 143 |
| 760 | 3300005834 | Ga0068851_10007939 | Ga0068851_100079392 | 143 |
| 761 | 3300006028 | Ga0070717_10000851 | Ga0070717_1000085110 | 143 |
| 762 | 3300006028 | Ga0070717_10002091 | Ga0070717_1000209114 | 143 |
| 763 | 3300006038 | Ga0075365_10444706 | Ga0075365_104447062 | 143 |
| 764 | 3300006163 | Ga0070715_10004429 | Ga0070715_100044294 | 143 |
| 765 | 3300006173 | Ga0070716_100010202 | Ga0070716_1000102021 | 143 |
| 766 | 3300006175 | Ga0070712_102033410 | Ga0070712_1020334101 | 143 |
| 767 | 3300007265 | Ga0099794_10008914 | Ga0099794_100089146 | 143 |
| 768 | 3300007265 | Ga0099794_10030714 | Ga0099794_100307144 | 143 |
| 769 | 3300007265 | Ga0099794_10160171 | Ga0099794_101601712 | 143 |
| 770 | 3300007788 | Ga0099795_10034354 | Ga0099795_100343543 | 143 |
| 771 | 3300007788 | Ga0099795_10117919 | Ga0099795_101179191 | 143 |
| 772 | 3300009093 | Ga0105240_10099064 | Ga0105240_100990643 | 143 |
| 773 | 3300009093 | Ga0105240_10654067 | Ga0105240_106540672 | 143 |
| 774 | 3300009101 | Ga0105247_10604256 | Ga0105247_106042562 | 143 |
| 775 | 3300009174 | Ga0105241_10592683 | Ga0105241_105926832 | 143 |
| 776 | 3300009545 | Ga0105237_10048626 | Ga0105237_100486263 | 143 |
| 777 | 3300009551 | Ga0105238_10054925 | Ga0105238_100549252 | 143 |
| 778 | 3300009553 | Ga0105249_11935997 | Ga0105249_119359971 | 143 |
| 779 | 3300010159 | Ga0099796_10015444 | Ga0099796_100154442 | 143 |
| 780 | 3300010159 | Ga0099796_10067998 | Ga0099796_100679982 | 143 |
| 781 | 3300010375 | Ga0105239_10075551 | Ga0105239_100755512 | 143 |
| 782 | 3300013104 | Ga0157370_10059963 | Ga0157370_100599632 | 143 |
| 783 | 3300013105 | Ga0157369_10048194 | Ga0157369_100481942 | 143 |
| 784 | 3300013105 | Ga0157369_10379284 | Ga0157369_103792842 | 143 |
| 785 | 3300013296 | Ga0157374_10318448 | Ga0157374_103184481 | 143 |
| 786 | 3300013307 | Ga0157372_10533060 | Ga0157372_105330602 | 143 |
| 787 | 3300014497 | Ga0182008_10254125 | Ga0182008_102541251 | 143 |
| 788 | 3300025321 | Ga0207656_10004848 | Ga0207656_100048482 | 143 |
| 789 | 3300025898 | Ga0207692_10002049 | Ga0207692_100020499 | 143 |
| 790 | 3300025905 | Ga0207685_10108629 | Ga0207685_101086291 | 143 |
| 791 | 3300025906 | Ga0207699_10004105 | Ga0207699_100041052 | 143 |
| 792 | 3300025909 | Ga0207705_10123978 | Ga0207705_101239782 | 143 |
| 793 | 3300025912 | Ga0207707_10021814 | Ga0207707_100218142 | 143 |
| 794 | 3300025913 | Ga0207695_10092385 | Ga0207695_100923852 | 143 |
| 795 | 3300025913 | Ga0207695_10425958 | Ga0207695_104259582 | 143 |
| 796 | 3300025914 | Ga0207671_10188167 | Ga0207671_101881672 | 143 |
| 797 | 3300025915 | Ga0207693_10000269 | Ga0207693_1000026923 | 143 |
| 798 | 3300025915 | Ga0207693_11275601 | Ga0207693_112756011 | 143 |
| 799 | 3300025916 | Ga0207663_10000096 | Ga0207663_1000009625 | 143 |
| 800 | 3300025917 | Ga0207660_10023670 | Ga0207660_100236703 | 143 |
| 801 | 3300025917 | Ga0207660_10479831 | Ga0207660_104798311 | 143 |
| 802 | 3300025919 | Ga0207657_10006462 | Ga0207657_100064624 | 143 |
| 803 | 3300025920 | Ga0207649_10222504 | Ga0207649_102225042 | 143 |
| 804 | 3300025921 | Ga0207652_10020826 | Ga0207652_100208263 | 143 |
| 805 | 3300025921 | Ga0207652_10088398 | Ga0207652_100883982 | 143 |
| 806 | 3300025921 | Ga0207652_11077526 | Ga0207652_110775262 | 143 |
| 807 | 3300025924 | Ga0207694_10025960 | Ga0207694_100259602 | 143 |
| 808 | 3300025928 | Ga0207700_10030762 | Ga0207700_100307623 | 143 |
| 809 | 3300025929 | Ga0207664_10202826 | Ga0207664_102028263 | 143 |
| 810 | 3300025932 | Ga0207690_10046304 | Ga0207690_100463042 | 143 |
| 811 | 3300025932 | Ga0207690_10230175 | Ga0207690_102301752 | 143 |
| 812 | 3300025939 | Ga0207665_10000104 | Ga0207665_1000010416 | 143 |
| 813 | 3300025944 | Ga0207661_10113555 | Ga0207661_101135553 | 143 |
| 814 | 3300025945 | Ga0207679_10421523 | Ga0207679_104215231 | 143 |
| 815 | 3300025949 | Ga0207667_10060913 | Ga0207667_100609133 | 143 |
| 816 | 3300025949 | Ga0207667_10111120 | Ga0207667_101111202 | 143 |
| 817 | 3300025981 | Ga0207640_10059871 | Ga0207640_100598712 | 143 |
| 818 | 3300025981 | Ga0207640_10229976 | Ga0207640_102299762 | 143 |
| 819 | 3300025981 | Ga0207640_10583733 | Ga0207640_105837331 | 143 |
| 820 | 3300025986 | Ga0207658_10646311 | Ga0207658_106463111 | 143 |
| 821 | 3300026041 | Ga0207639_10016671 | Ga0207639_100166713 | 143 |
| 822 | 3300026078 | Ga0207702_10001581 | Ga0207702_1000158125 | 143 |
| 823 | 3300026078 | Ga0207702_10710806 | Ga0207702_107108062 | 143 |
| 824 | 3300026088 | Ga0207641_12419811 | Ga0207641_124198111 | 143 |
| 825 | 3300026116 | Ga0207674_10026698 | Ga0207674_100266982 | 143 |
| 826 | 3300026142 | Ga0207698_10017298 | Ga0207698_100172982 | 143 |
| 827 | 3300026142 | Ga0207698_10021472 | Ga0207698_100214723 | 143 |
| 828 | 3300027512 | Ga0209179_1004354 | Ga0209179_10043543 | 143 |
| 829 | 3300027671 | Ga0209588_1007193 | Ga0209588_10071935 | 143 |
| 830 | 3300028794 | Ga0307515_10370212 | Ga0307515_103702123 | 143 |
| 831 | 3300030760 | Ga0265762_1021234 | Ga0265762_10212342 | 143 |
| 832 | 3300030763 | Ga0265763_1039418 | Ga0265763_10394181 | 143 |
| 833 | 3300031238 | Ga0265332_10220541 | Ga0265332_102205412 | 143 |
| 834 | 3300031250 | Ga0265331_10006331 | Ga0265331_100063313 | 143 |
| 835 | 3300031344 | Ga0265316_10498635 | Ga0265316_104986351 | 143 |
| 836 | 3300031616 | Ga0307508_10097824 | Ga0307508_100978241 | 143 |
| 837 | 3300031711 | Ga0265314_10155411 | Ga0265314_101554112 | 143 |
| 838 | 3300031712 | Ga0265342_10002958 | Ga0265342_100029586 | 143 |
| 839 | 3300035111 | Ga0373923_0042643 | Ga0373923_0042643_331_765 | 143 |
| 840 | 3300035117 | Ga0373953_0064513 | Ga0373953_0064513_180_614 | 143 |
| 841 | 3300035118 | Ga0373954_0056287 | Ga0373954_0056287_1107_1541 | 143 |
| 842 | 3300035118 | Ga0373954_0621327 | Ga0373954_0621327_24_458 | 143 |
| 843 | 3300035119 | Ga0373956_0015097 | Ga0373956_0015097_1134_1568 | 143 |
| 844 | 3300035120 | Ga0373957_0058898 | Ga0373957_0058898_336_770 | 143 |
| 845 | 3300035120 | Ga0373957_0231513 | Ga0373957_0231513_37_471 | 143 |
| 846 | 3300035171 | Ga0373946_0139035 | Ga0373946_0139035_90_524 | 143 |
| 847 | 3300035172 | Ga0373955_0033080 | Ga0373955_0033080_1749_2183 | 143 |
| 848 | 3300035410 | Ga0373924_0031722 | Ga0373924_0031722_440_874 | 143 |
| 849 | 3300035691 | Ga0373931_0031876 | Ga0373931_0031876_1188_1622 | 143 |
| 850 | 3300035692 | Ga0373935_0040922 | Ga0373935_0040922_1253_1687 | 143 |
| 851 | 3300035695 | Ga0373927_0012394 | Ga0373927_0012394_581_1015 | 143 |
| 852 | 3300035724 | Ga0373933_0000272 | Ga0373933_0000272_10090_10527 | 143 |
| 853 | 3300035724 | Ga0373933_0038006 | Ga0373933_0038006_770_1204 | 143 |
| 854 | 3300035725 | Ga0373947_0021069 | Ga0373947_0021069_2048_2482 | 143 |
| 855 | 3300035725 | Ga0373947_0076095 | Ga0373947_0076095_1389_1823 | 143 |
| 856 | 3300036401 | Ga0373937_0042265 | Ga0373937_0042265_734_1168 | 143 |
| 857 | 3300036401 | Ga0373937_0276180 | Ga0373937_0276180_1111_1545 | 143 |
| 858 | 3300036401 | Ga0373937_1266934 | Ga0373937_1266934_213_647 | 143 |
| 859 | 3300037068 | Ga0373925_0222747 | Ga0373925_0222747_128_562 | 143 |
| 860 | 3300037068 | Ga0373925_0421026 | Ga0373925_0421026_257_691 | 143 |
| 861 | 3300038443 | Ga0395901_0941018 | Ga0395901_0941018_354_818 | 143 |
| 862 | 3300044656 | Ga0466969_0197166 | Ga0466969_0197166_188_622 | 143 |
| 863 | 3300045049 | Ga0466959_0042527 | Ga0466959_0042527_1167_1601 | 143 |
| 864 | 3300046454 | Ga0495592_0006330 | Ga0495592_0006330_3263_3697 | 143 |
| 865 | 3300046455 | Ga0495603_0037079 | Ga0495603_0037079_1543_1977 | 143 |
| 866 | 3300046455 | Ga0495603_0037349 | Ga0495603_0037349_1260_1694 | 143 |
| 867 | 3300046455 | Ga0495603_0199261 | Ga0495603_0199261_681_1115 | 143 |
| 868 | 3300046459 | Ga0495629_0179129 | Ga0495629_0179129_302_736 | 143 |
| 869 | 3300046462 | Ga0495651_0030654 | Ga0495651_0030654_3138_3572 | 143 |
| 870 | 3300046462 | Ga0495651_0089382 | Ga0495651_0089382_799_1233 | 143 |
| 871 | 3300046463 | Ga0495653_0170875 | Ga0495653_0170875_652_1086 | 143 |
| 872 | 3300046475 | Ga0495639_0084506 | Ga0495639_0084506_171_605 | 143 |
| 873 | 3300046477 | Ga0495664_0091908 | Ga0495664_0091908_481_915 | 143 |
| 874 | 3300046477 | Ga0495664_0450544 | Ga0495664_0450544_178_612 | 143 |
| 875 | 3300046499 | Ga0495594_0415687 | Ga0495594_0415687_219_653 | 143 |
| 876 | 3300046507 | Ga0495606_0001165 | Ga0495606_0001165_29570_30004 | 143 |
| 877 | 3300046511 | Ga0495608_0082145 | Ga0495608_0082145_1102_1536 | 143 |
| 878 | 3300046514 | Ga0495618_0166950 | Ga0495618_0166950_336_770 | 143 |
| 879 | 3300046516 | Ga0495628_0066757 | Ga0495628_0066757_1822_2256 | 143 |
| 880 | 3300046517 | Ga0495630_0128189 | Ga0495630_0128189_818_1252 | 143 |
| 881 | 3300046529 | Ga0495652_0138197 | Ga0495652_0138197_612_1046 | 143 |
| 882 | 3300046533 | Ga0495640_0043096 | Ga0495640_0043096_1560_1994 | 143 |
| 883 | 3300046535 | Ga0495586_0287379 | Ga0495586_0287379_171_605 | 143 |
| 884 | 3300046543 | Ga0495645_0021320 | Ga0495645_0021320_3964_4398 | 143 |
| 885 | 3300046559 | Ga0495667_0089330 | Ga0495667_0089330_1454_1888 | 143 |
| 886 | 3300046642 | Ga0495634_0154436 | Ga0495634_0154436_788_1222 | 143 |
| 887 | 3300046663 | Ga0495635_0104833 | Ga0495635_0104833_805_1239 | 143 |
| 888 | 3300046663 | Ga0495635_0560539 | Ga0495635_0560539_250_684 | 143 |
| 889 | 3300046674 | Ga0495588_0148096 | Ga0495588_0148096_382_816 | 143 |
| 890 | 3300046675 | Ga0495657_0077257 | Ga0495657_0077257_1097_1531 | 143 |
| 891 | 3300046678 | Ga0495599_0104592 | Ga0495599_0104592_993_1427 | 143 |
| 892 | 3300046679 | Ga0495623_0043027 | Ga0495623_0043027_1720_2154 | 143 |
| 893 | 3300046679 | Ga0495623_0303048 | Ga0495623_0303048_139_573 | 143 |
| 894 | 3300046679 | Ga0495623_0318098 | Ga0495623_0318098_324_758 | 143 |
| 895 | 3300046680 | Ga0495646_0128197 | Ga0495646_0128197_583_1017 | 143 |
| 896 | 3300046689 | Ga0495613_0252560 | Ga0495613_0252560_155_589 | 143 |
| 897 | 3300046690 | Ga0495624_0033966 | Ga0495624_0033966_1688_2122 | 143 |
| 898 | 3300046809 | Ga0495600_0153077 | Ga0495600_0153077_799_1233 | 143 |
| 899 | 3300047315 | Ga0495581_0251889 | Ga0495581_0251889_71_505 | 143 |
| 900 | 3300047315 | Ga0495581_0480552 | Ga0495581_0480552_145_579 | 143 |
| 901 | 3300047317 | Ga0495604_0265313 | Ga0495604_0265313_456_890 | 143 |
| 902 | 3300047319 | Ga0495674_0099668 | Ga0495674_0099668_824_1258 | 143 |
| 903 | 3300047320 | Ga0495672_0135540 | Ga0495672_0135540_812_1246 | 143 |
| 904 | 3300047322 | Ga0495680_0052972 | Ga0495680_0052972_2062_2496 | 143 |
| 905 | 3300047444 | Ga0495675_0056324 | Ga0495675_0056324_556_990 | 143 |
| 906 | 3300047471 | Ga0495684_0063256 | Ga0495684_0063256_738_1172 | 143 |
| 907 | 3300047673 | Ga0495593_0161747 | Ga0495593_0161747_79_513 | 143 |
| 908 | 3300048088 | Ga0495602_0166728 | Ga0495602_0166728_868_1302 | 143 |
| 909 | 3300048088 | Ga0495602_0341173 | Ga0495602_0341173_567_1001 | 143 |
| 910 | 3300048088 | Ga0495602_0473899 | Ga0495602_0473899_251_685 | 143 |
| 911 | 3300048904 | Ga0496101_0182288 | Ga0496101_0182288_129_563 | 143 |
| 912 | 3300048904 | Ga0496101_0478768 | Ga0496101_0478768_172_606 | 143 |
| 913 | 3300048907 | Ga0496104_0038703 | Ga0496104_0038703_2326_2760 | 143 |
| 914 | 3300048907 | Ga0496104_0888238 | Ga0496104_0888238_65_499 | 143 |
| 915 | 3300048909 | Ga0496106_0012499 | Ga0496106_0012499_3561_4031 | 143 |
| 916 | 3300048911 | Ga0496108_0003612 | Ga0496108_0003612_3291_3761 | 143 |
| 917 | 3300048911 | Ga0496108_0633283 | Ga0496108_0633283_184_618 | 143 |
| 918 | 3300048912 | Ga0496109_0000166 | Ga0496109_0000166_51988_52458 | 143 |
| 919 | 3300048912 | Ga0496109_0020611 | Ga0496109_0020611_459_893 | 143 |
| 920 | 3300048913 | Ga0496110_0019876 | Ga0496110_0019876_754_1188 | 143 |
| 921 | 3300048913 | Ga0496110_0244401 | Ga0496110_0244401_261_731 | 143 |
| 922 | 3300048913 | Ga0496110_0664587 | Ga0496110_0664587_94_528 | 143 |
| 923 | 3300048914 | Ga0496111_0500419 | Ga0496111_0500419_245_679 | 143 |
| 924 | 3300048914 | Ga0496111_0583190 | Ga0496111_0583190_150_584 | 143 |
| 925 | 3300048915 | Ga0496112_0001913 | Ga0496112_0001913_12330_12800 | 143 |
| 926 | 3300048915 | Ga0496112_0009707 | Ga0496112_0009707_7230_7664 | 143 |
| 927 | 3300048915 | Ga0496112_0053396 | Ga0496112_0053396_1585_2019 | 143 |
| 928 | 3300048915 | Ga0496112_0395307 | Ga0496112_0395307_481_915 | 143 |
| 929 | 3300048915 | Ga0496112_1641239 | Ga0496112_1641239_17_451 | 143 |
| 930 | 3300048916 | Ga0496113_0061810 | Ga0496113_0061810_293_763 | 143 |
| 931 | 3300048916 | Ga0496113_0254192 | Ga0496113_0254192_451_885 | 143 |
| 932 | 3300048917 | Ga0496114_0579553 | Ga0496114_0579553_166_600 | 143 |
| 933 | 3300048918 | Ga0496115_0029552 | Ga0496115_0029552_1704_2138 | 143 |
| 934 | 3300048918 | Ga0496115_0076639 | Ga0496115_0076639_1359_1793 | 143 |
| 935 | 3300048918 | Ga0496115_0120072 | Ga0496115_0120072_475_909 | 143 |
| 936 | 3300048918 | Ga0496115_0744133 | Ga0496115_0744133_131_565 | 143 |
| 937 | 3300048920 | Ga0496117_0278837 | Ga0496117_0278837_384_818 | 143 |
| 938 | 3300048921 | Ga0496118_0167681 | Ga0496118_0167681_467_901 | 143 |
| 939 | 3300048921 | Ga0496118_0312399 | Ga0496118_0312399_170_604 | 143 |
| 940 | 3300048924 | Ga0496121_0001158 | Ga0496121_0001158_2307_2741 | 143 |
| 941 | 3300048924 | Ga0496121_0007126 | Ga0496121_0007126_4512_4946 | 143 |
| 942 | 3300048929 | Ga0496126_0010775 | Ga0496126_0010775_3997_4431 | 143 |
| 943 | 3300048929 | Ga0496126_0032384 | Ga0496126_0032384_2210_2644 | 143 |
| 944 | 3300048929 | Ga0496126_0305003 | Ga0496126_0305003_86_520 | 143 |
| 945 | 3300048929 | Ga0496126_0368144 | Ga0496126_0368144_511_945 | 143 |
| 946 | 3300048929 | Ga0496126_0369924 | Ga0496126_0369924_103_537 | 143 |
| 947 | 3300049568 | Ga0501031_0045495 | Ga0501031_0045495_815_1261 | 143 |
| 948 | 3300049568 | Ga0501031_0960207 | Ga0501031_0960207_36_482 | 143 |
| 949 | 3300049569 | Ga0501032_0075408 | Ga0501032_0075408_1174_1620 | 143 |
| 950 | 3300049569 | Ga0501032_0080439 | Ga0501032_0080439_1594_2040 | 143 |
| 951 | 3300049569 | Ga0501032_0169164 | Ga0501032_0169164_255_704 | 143 |
| 952 | 3300049570 | Ga0501033_0000749 | Ga0501033_0000749_22098_22544 | 143 |
| 953 | 3300049570 | Ga0501033_0115213 | Ga0501033_0115213_768_1217 | 143 |
| 954 | 3300049570 | Ga0501033_0276716 | Ga0501033_0276716_622_1071 | 143 |
| 955 | 3300049571 | Ga0501034_0383805 | Ga0501034_0383805_422_871 | 143 |
| 956 | 3300049571 | Ga0501034_0417586 | Ga0501034_0417586_343_789 | 143 |
| 957 | 3300049572 | Ga0501036_0005560 | Ga0501036_0005560_9448_9894 | 143 |
| 958 | 3300049572 | Ga0501036_0110617 | Ga0501036_0110617_807_1241 | 143 |
| 959 | 3300049572 | Ga0501036_0395148 | Ga0501036_0395148_209_658 | 143 |
| 960 | 3300049572 | Ga0501036_0668271 | Ga0501036_0668271_15_464 | 143 |
| 961 | 3300049572 | Ga0501036_0695152 | Ga0501036_0695152_197_646 | 143 |
| 962 | 3300049573 | Ga0501037_0001094 | Ga0501037_0001094_10612_11058 | 143 |
| 963 | 3300049573 | Ga0501037_0059496 | Ga0501037_0059496_2042_2506 | 143 |
| 964 | 3300049573 | Ga0501037_0403535 | Ga0501037_0403535_292_741 | 143 |
| 965 | 3300049574 | Ga0501038_0002752 | Ga0501038_0002752_10719_11168 | 143 |
| 966 | 3300049574 | Ga0501038_0014983 | Ga0501038_0014983_4469_4915 | 143 |
| 967 | 3300049574 | Ga0501038_0241022 | Ga0501038_0241022_852_1298 | 143 |
| 968 | 3300049575 | Ga0501039_0076203 | Ga0501039_0076203_1750_2196 | 143 |
| 969 | 3300049575 | Ga0501039_0107283 | Ga0501039_0107283_1241_1690 | 143 |
| 970 | 3300049576 | Ga0501040_0040480 | Ga0501040_0040480_2436_2885 | 143 |
| 971 | 3300049577 | Ga0501041_0472820 | Ga0501041_0472820_152_598 | 143 |
| 972 | 3300049578 | Ga0501042_0081614 | Ga0501042_0081614_1470_1916 | 143 |
| 973 | 3300049579 | Ga0501043_0010172 | Ga0501043_0010172_3970_4416 | 143 |
| 974 | 3300049579 | Ga0501043_0036335 | Ga0501043_0036335_284_733 | 143 |
| 975 | 3300049579 | Ga0501043_0690282 | Ga0501043_0690282_258_707 | 143 |
| 976 | 3300049580 | Ga0501046_0102565 | Ga0501046_0102565_534_980 | 143 |
| 977 | 3300049581 | Ga0501047_0331051 | Ga0501047_0331051_898_1347 | 143 |
| 978 | 3300049581 | Ga0501047_0864291 | Ga0501047_0864291_160_609 | 143 |
| 979 | 3300049584 | Ga0501068_0092548 | Ga0501068_0092548_1150_1596 | 143 |
| 980 | 3300049585 | Ga0501069_0357985 | Ga0501069_0357985_60_494 | 143 |
| 981 | 3300049586 | Ga0501070_0880607 | Ga0501070_0880607_111_560 | 143 |
| 982 | 3300049587 | Ga0501071_0243514 | Ga0501071_0243514_754_1203 | 143 |
| 983 | 3300049587 | Ga0501071_0413273 | Ga0501071_0413273_102_548 | 143 |
| 984 | 3300049591 | Ga0501075_0190110 | Ga0501075_0190110_119_568 | 143 |
| 985 | 3300049744 | Ga0501083_0444738 | Ga0501083_0444738_168_617 | 143 |
| 986 | 3300049822 | Ga0501035_0008258 | Ga0501035_0008258_219_665 | 143 |
| 987 | 3300049822 | Ga0501035_0040311 | Ga0501035_0040311_1513_1977 | 143 |
| 988 | 3300049822 | Ga0501035_0095868 | Ga0501035_0095868_511_960 | 143 |
| 989 | 3300049823 | Ga0501044_0078732 | Ga0501044_0078732_1870_2304 | 143 |
| 990 | 3300049823 | Ga0501044_0185359 | Ga0501044_0185359_383_832 | 143 |
| 991 | 3300049823 | Ga0501044_1425381 | Ga0501044_1425381_25_459 | 143 |
| 992 | 3300049824 | Ga0501045_0727895 | Ga0501045_0727895_81_530 | 143 |
| 993 | 3300053077 | Ga0495601_0277602 | Ga0495601_0277602_456_890 | 143 |
| 994 | 3300053078 | Ga0495612_0036334 | Ga0495612_0036334_1253_1687 | 143 |
| 995 | 3300053078 | Ga0495612_0324273 | Ga0495612_0324273_239_673 | 143 |
| 996 | 3300053083 | Ga0495655_0167158 | Ga0495655_0167158_191_625 | 143 |
| 997 | 3300053084 | Ga0495595_0132181 | Ga0495595_0132181_203_637 | 143 |
| 998 | 3300053085 | Ga0495619_0185497 | Ga0495619_0185497_456_890 | 143 |
| 999 | 3300053085 | Ga0495619_0374245 | Ga0495619_0374245_18_452 | 143 |
| 1000 | 3300053086 | Ga0500578_0380689 | Ga0500578_0380689_186_620 | 143 |
| 1001 | 3300053093 | Ga0500651_0000751 | Ga0500651_0000751_13219_13653 | 143 |
| 1002 | 3300053093 | Ga0500651_0749059 | Ga0500651_0749059_71_505 | 143 |
| 1003 | 3300053094 | Ga0500566_0411937 | Ga0500566_0411937_102_536 | 143 |
| 1004 | 3300053104 | Ga0500556_0291440 | Ga0500556_0291440_127_561 | 143 |
| 1005 | 3300053119 | Ga0500595_001428 | Ga0500595_001428_11346_11780 | 143 |
| 1006 | 3300053119 | Ga0500595_002631 | Ga0500595_002631_6475_6909 | 143 |
| 1007 | 3300053119 | Ga0500595_005379 | Ga0500595_005379_69_503 | 143 |
| 1008 | 3300053119 | Ga0500595_058497 | Ga0500595_058497_669_1103 | 143 |
| 1009 | 3300053130 | Ga0500642_0001478 | Ga0500642_0001478_4474_4908 | 143 |
| 1010 | 3300053139 | Ga0500568_0047112 | Ga0500568_0047112_1174_1608 | 143 |
| 1011 | 3300053139 | Ga0500568_0056655 | Ga0500568_0056655_697_1131 | 143 |
| 1012 | 3300053150 | Ga0500603_000998 | Ga0500603_000998_1486_1920 | 143 |
| 1013 | 3300053150 | Ga0500603_013970 | Ga0500603_013970_619_1053 | 143 |
| 1014 | 3300053177 | Ga0500636_0047345 | Ga0500636_0047345_1780_2214 | 143 |
| 1015 | 3300053177 | Ga0500636_0183142 | Ga0500636_0183142_232_666 | 143 |
| 1016 | 3300053178 | Ga0500637_0001776 | Ga0500637_0001776_4308_4742 | 143 |
| 1017 | 3300001979 | JGI24740J21852_10084309 | JGI24740J21852_100843091 | 144 |
| 1018 | 3300005455 | Ga0070663_100334579 | Ga0070663_1003345791 | 144 |
| 1019 | 3300005539 | Ga0068853_100055331 | Ga0068853_1000553312 | 144 |
| 1020 | 3300005539 | Ga0068853_100108774 | Ga0068853_1001087742 | 144 |
| 1021 | 3300005563 | Ga0068855_100015735 | Ga0068855_1000157355 | 144 |
| 1022 | 3300005563 | Ga0068855_100081934 | Ga0068855_1000819343 | 144 |
| 1023 | 3300005577 | Ga0068857_100020118 | Ga0068857_1000201182 | 144 |
| 1024 | 3300005577 | Ga0068857_100042440 | Ga0068857_1000424402 | 144 |
| 1025 | 3300005578 | Ga0068854_100009074 | Ga0068854_1000090742 | 144 |
| 1026 | 3300005614 | Ga0068856_100003953 | Ga0068856_1000039536 | 144 |
| 1027 | 3300005616 | Ga0068852_100023356 | Ga0068852_1000233566 | 144 |
| 1028 | 3300005834 | Ga0068851_10001080 | Ga0068851_100010803 | 144 |
| 1029 | 3300009093 | Ga0105240_10005613 | Ga0105240_1000561314 | 144 |
| 1030 | 3300009093 | Ga0105240_10016416 | Ga0105240_100164164 | 144 |
| 1031 | 3300009174 | Ga0105241_10002158 | Ga0105241_1000215815 | 144 |
| 1032 | 3300009174 | Ga0105241_10096656 | Ga0105241_100966562 | 144 |
| 1033 | 3300009545 | Ga0105237_10102579 | Ga0105237_101025792 | 144 |
| 1034 | 3300009545 | Ga0105237_10354544 | Ga0105237_103545441 | 144 |
| 1035 | 3300010375 | Ga0105239_10038407 | Ga0105239_100384072 | 144 |
| 1036 | 3300013297 | Ga0157378_10010055 | Ga0157378_100100558 | 144 |
| 1037 | 3300025321 | Ga0207656_10008610 | Ga0207656_100086102 | 144 |
| 1038 | 3300025904 | Ga0207647_10060817 | Ga0207647_100608171 | 144 |
| 1039 | 3300025911 | Ga0207654_10000358 | Ga0207654_100003588 | 144 |
| 1040 | 3300025913 | Ga0207695_10002150 | Ga0207695_1000215014 | 144 |
| 1041 | 3300025914 | Ga0207671_10234716 | Ga0207671_102347162 | 144 |
| 1042 | 3300025924 | Ga0207694_10000491 | Ga0207694_1000049119 | 144 |
| 1043 | 3300025924 | Ga0207694_10090730 | Ga0207694_100907302 | 144 |
| 1044 | 3300025949 | Ga0207667_10032720 | Ga0207667_100327203 | 144 |
| 1045 | 3300025949 | Ga0207667_10041172 | Ga0207667_100411723 | 144 |
| 1046 | 3300025981 | Ga0207640_10735439 | Ga0207640_107354391 | 144 |
| 1047 | 3300026041 | Ga0207639_10052074 | Ga0207639_100520743 | 144 |
| 1048 | 3300026041 | Ga0207639_10353301 | Ga0207639_103533012 | 144 |
| 1049 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003298 | 144 |
| 1050 | 3300026116 | Ga0207674_10010369 | Ga0207674_1001036910 | 144 |
| 1051 | 3300026116 | Ga0207674_10013847 | Ga0207674_100138473 | 144 |
| 1052 | 3300026142 | Ga0207698_10300379 | Ga0207698_103003792 | 144 |
| 1053 | 3300049568 | Ga0501031_0001969 | Ga0501031_0001969_11734_12177 | 144 |
| 1054 | 3300049569 | Ga0501032_0000088 | Ga0501032_0000088_20774_21217 | 144 |
| 1055 | 3300049570 | Ga0501033_0002046 | Ga0501033_0002046_1324_1767 | 144 |
| 1056 | 3300049571 | Ga0501034_0000332 | Ga0501034_0000332_70953_71396 | 144 |
| 1057 | 3300049572 | Ga0501036_0000233 | Ga0501036_0000233_34325_34768 | 144 |
| 1058 | 3300049574 | Ga0501038_0000049 | Ga0501038_0000049_31625_32068 | 144 |
| 1059 | 3300049575 | Ga0501039_0002402 | Ga0501039_0002402_2255_2728 | 144 |
| 1060 | 3300049579 | Ga0501043_0000740 | Ga0501043_0000740_26121_26564 | 144 |
| 1061 | 3300049580 | Ga0501046_0028098 | Ga0501046_0028098_723_1166 | 144 |
| 1062 | 3300049581 | Ga0501047_0000875 | Ga0501047_0000875_11197_11640 | 144 |
| 1063 | 3300049582 | Ga0501048_0006667 | Ga0501048_0006667_1262_1705 | 144 |
| 1064 | 3300049583 | Ga0501067_0000622 | Ga0501067_0000622_13327_13770 | 144 |
| 1065 | 3300049584 | Ga0501068_0004203 | Ga0501068_0004203_1520_1963 | 144 |
| 1066 | 3300049585 | Ga0501069_0284198 | Ga0501069_0284198_27_470 | 144 |
| 1067 | 3300049586 | Ga0501070_0004157 | Ga0501070_0004157_213_656 | 144 |
| 1068 | 3300049588 | Ga0501072_0036419 | Ga0501072_0036419_142_585 | 144 |
| 1069 | 3300049589 | Ga0501073_0003598 | Ga0501073_0003598_2832_3275 | 144 |
| 1070 | 3300049590 | Ga0501074_0006273 | Ga0501074_0006273_8058_8501 | 144 |
| 1071 | 3300049592 | Ga0501076_1409130 | Ga0501076_1409130_57_530 | 144 |
| 1072 | 3300049741 | Ga0501079_0003748 | Ga0501079_0003748_4223_4666 | 144 |
| 1073 | 3300049742 | Ga0501080_0000343 | Ga0501080_0000343_26062_26505 | 144 |
| 1074 | 3300049744 | Ga0501083_0000724 | Ga0501083_0000724_15109_15582 | 144 |
| 1075 | 3300049822 | Ga0501035_0000442 | Ga0501035_0000442_43415_43858 | 144 |
| 1076 | 3300049823 | Ga0501044_0000182 | Ga0501044_0000182_21517_21960 | 144 |
| 1077 | 3300049824 | Ga0501045_0039733 | Ga0501045_0039733_2701_3144 | 144 |
| 1078 | 3300054114 | Ga0501084_0008620 | Ga0501084_0008620_7838_8311 | 144 |
| 1079 | 3300060353 | Ga0501082_0019978 | Ga0501082_0019978_2959_3402 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5dm5-assembly1.cif.gz_E | crystal structure of the hexameric thioesterase y2039 from yersinia pestis | 0.9677 | 18 | 137 |
| 5dm5-assembly1.cif.gz_D | crystal structure of the hexameric thioesterase y2039 from yersinia pestis | 0.9557 | 16 | 137 |
| 5dm5-assembly1.cif.gz_F | crystal structure of the hexameric thioesterase y2039 from yersinia pestis | 0.9543 | 18 | 137 |
| 5dm5-assembly1.cif.gz_B | crystal structure of the hexameric thioesterase y2039 from yersinia pestis | 0.9543 | 18 | 137 |
| 3bjk-assembly1.cif.gz_D | crystal structure of hi0827, a hexameric broad specificity acyl-coenzyme a thioesterase: the asp44ala mutant enzyme | 0.9503 | 19 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5dm5A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.949 | 16 | 132 | 3.10.129.10 |
| 1nngB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9471 | 19 | 140 | 3.10.129.10 |
| 3b7kC02 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9423 | 24 | 126 | 3.10.129.10 |
| 5dm5A00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9412 | 16 | 132 | 3.10.129.10 |
| 3d6lA00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.9387 | 20 | 137 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N2QXF4-F1-model_v4 | Acyl-CoA thioesterase | 0.986 | 16 | 137 |
GO:0005829
GO:0006637 GO:0009062 GO:0052816 |
| AF-A0A240E9R3-F1-model_v4 | Acyl-CoA thioesterase YciA | 0.9786 | 14 | 138 |
GO:0005829
GO:0006637 GO:0009062 GO:0052816 |
| AF-A0A356IIP3-F1-model_v4 | Acyl-CoA thioesterase | 0.9756 | 20 | 140 |
GO:0005829
GO:0006637 GO:0009062 GO:0052816 |
| AF-A0A4Q2R961-F1-model_v4 | Acyl-CoA thioester hydrolase YciA | 0.975 | 15 | 139 |
GO:0005829
GO:0006637 GO:0009062 GO:0052816 |
| AF-A0A7Y8N2W3-F1-model_v4 | deleted | 0.9744 | 20 | 140 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar