F489555

General Info

Members Datasets Scaffolds Average Seq Length
1075 490 922 250

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100009516|Ga0068852_1000095166
Length 276
Sequence MPDTPRSSHCLEIRRNKIRNKIKDMLSIKNLQARIEEKQILKGINLDIKAGEVHAIMGPNGSGKSTLASVLAGRSEYEVTGGSVEFLGKDLLELSPEERAGEGIFLAFQYPVEIPGLTTTNFIKTAVNEVRKYRGQEPYDAVQFLKLMREKMAMVEINQSLLSRSLNEGFSGGEKKRNEIFQMAMLEPKLAILDETDSGLDIDAIRIVANGVNKLRSKDNAVLVVTHYQRLLDYIVPDFVHVLYNGRIVKSGTKELALELEERGYDFIKNEVGQEA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
7 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
8 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
9 2547132181 Kosakonia sacchari SP1 Isolate Stem
10 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
11 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
12 2561511199 Enterobacter sp. R4-368 Isolate Nodule
13 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
14 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
15 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
16 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
17 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
18 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
19 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
20 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
21 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
22 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
23 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
24 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
25 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
26 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
27 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
28 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
29 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
30 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
31 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
32 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
33 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
34 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
35 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
36 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
37 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
38 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
39 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
40 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
41 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
42 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
43 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
44 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
45 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
46 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
47 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
48 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
49 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
50 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
51 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
52 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
53 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
54 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
55 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
56 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
57 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
58 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
59 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
60 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
61 2636415599 Klebsiella variicola DX120E Isolate Unclassified
62 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
63 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
64 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
65 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
66 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
67 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
68 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
69 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
70 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
71 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
72 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
73 2738541278 Niastella sp. CF465 Isolate Unclassified
74 2751185917 Enterobacter sp. HK169 Isolate Unclassified
75 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
76 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
77 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
78 2775507074 Klebsiella sp. D5A Isolate Unclassified
79 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
80 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
81 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
82 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
83 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
84 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
85 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
86 2818991444 Filimonas endophytica 3197 Isolate Unclassified
87 2821118458 Enterobacter asburiae 609 Isolate Unclassified
88 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
89 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
90 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
91 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
92 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
93 2847085930 Erwinia persicina B64 Isolate Bulb
94 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
95 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
96 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
97 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
98 2865014394 Pantoea sp. R-71966 Isolate Unclassified
99 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
100 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
101 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
102 2876601092 Pantoea endophytica 596 Isolate Unclassified
103 2881247448 Flavobacterium beibuense RSKm HC5 Isolate Rhizosphere
104 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
105 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
106 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
107 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
108 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
109 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
110 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
111 2904504865 Serratia marcescens 1822 Isolate Unclassified
112 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
113 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
114 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
115 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
116 2919150387 Rahnella aceris 1817 Isolate Unclassified
117 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
118 2927143783 Rahnella sp. 2050 Isolate Unclassified
119 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
120 2932406140 Serratia sp. 2723 Isolate Rhizosphere
121 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
122 2937539931 Pantoea sp. LS15 Isolate Unclassified
123 2937967321 Serratia sp. YC16 Isolate Unclassified
124 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
125 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
126 2939577877 Serratia sp. 509 Isolate Rhizosphere
127 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
128 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
129 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
130 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
131 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
132 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
133 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
134 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
135 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
136 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
137 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
138 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
139 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
140 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
141 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
142 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
143 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
144 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
145 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
146 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
147 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
148 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
149 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
150 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
151 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
152 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
153 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
154 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
155 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
156 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
157 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
158 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
159 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
160 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
161 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
162 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
163 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
164 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
165 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
166 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
167 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
168 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
169 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
170 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
171 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
172 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
173 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
174 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
175 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
176 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
177 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
178 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
179 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
180 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
184 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
185 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
186 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
187 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
188 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
189 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
190 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
191 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
192 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
193 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
194 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
195 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
196 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
197 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
198 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
199 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
200 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
201 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
202 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
203 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
204 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
205 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
206 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
207 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
208 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
209 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
210 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
211 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
212 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
213 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
214 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
215 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
216 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
217 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
218 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
219 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
220 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
221 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
222 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
223 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
224 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
225 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
226 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
227 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
228 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
229 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
230 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
231 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
232 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
233 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
234 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
235 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
236 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
237 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
238 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
239 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
240 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
241 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
242 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
243 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
244 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
245 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
246 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
247 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
248 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
249 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
250 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
251 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
252 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
253 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
254 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
255 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
256 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
257 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
258 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
259 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
260 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
261 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
262 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
263 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
264 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
266 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
267 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
268 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
269 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
271 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
325 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
331 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
332 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
333 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
334 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
335 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
336 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
337 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
338 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
339 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
340 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
341 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
342 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
343 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
344 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
345 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
346 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
347 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
348 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
349 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
350 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
351 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
352 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
353 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
354 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
355 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
356 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
357 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
358 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
359 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
360 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
361 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
362 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
363 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
364 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
365 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
366 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
367 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
368 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
369 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
370 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
371 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
372 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
373 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
374 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
375 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
376 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
377 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
378 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
379 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
380 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
381 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
382 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
383 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
384 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
385 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
386 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
387 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
388 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
389 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
390 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
391 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
392 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
393 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
394 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
395 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
396 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
397 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
398 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
399 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
400 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
401 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
402 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
403 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
404 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
405 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
406 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
407 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
408 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
409 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
410 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
411 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
412 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
413 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
414 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
415 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
416 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
417 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
418 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
419 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
420 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
421 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
422 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
423 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
424 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
425 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
426 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
427 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
428 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
429 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
430 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
431 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
432 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
433 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
434 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
435 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
438 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
439 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
440 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
443 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
444 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
445 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
446 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
447 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
448 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
449 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
450 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
451 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
452 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
453 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
454 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
455 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
456 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
457 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
458 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
459 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
463 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
464 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
465 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
466 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
467 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
468 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
469 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
470 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
471 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
472 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
473 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
474 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
475 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
476 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
477 640753048 Serratia proteamaculans 568 Isolate Endosphere
478 8004592986 Serratia sp. S119 Isolate Unclassified
479 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
480 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
481 8018221730 Enterobacter sp. CM29 Isolate Unclassified
482 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
483 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
484 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
485 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
486 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
487 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
488 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
489 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
490 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.12
Metatranscriptomes 0.56
Isolates 14.33

Biome Distribution

Category Percentage (%)
Aerial Root 0.37
Bulb 0.09
Endosphere 3.91
Nodule 1.95
Rhizoplane 7.07
Rhizosphere 69.77
Stem 0.09
Stem Tuber 0.47
Unclassified 16.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C2598 2010549000 Bacteria 1601
2 SwRhRL2b_contig_182090 2162886007 Bacteria 9021
3 SwRhRL2b_contig_535415 2162886007 Bacteria 1126
4 JGI24739J22299_10003080 3300001989 Bacteria 6366
5 JGI25162J39368_1000112 3300002737 Bacteria 89231
6 JGI25162J39368_1001236 3300002737 Bacteria 14718
7 JGI25163J39215_1000031 3300002771 Bacteria 65095
8 JGI25163J39215_1000055 3300002771 Bacteria 51174
9 JGI25164J39214_1000094 3300002772 Bacteria 89231
10 JGI25152J39213_1000343 3300002773 Bacteria 29576
11 rootH1_10003827 3300003316 Bacteria 6423
12 rootH1_10032207 3300003316 Bacteria 2231
13 rootL2_10037931 3300003322 Bacteria 8826
14 rootH1_10005693 3300003323 Bacteria 32459
15 rootH1_10018400 3300003323 Bacteria 7594
16 rootH1_10091743 3300003316 Bacteria 7093
17 rootH1_10091743 3300003323 Bacteria 2062
18 rootH1_10120495 3300003323 Bacteria 5324
19 Ga0055538_1000076 3300003751 Bacteria 89231
20 Ga0055539_1000115 3300003752 Bacteria 89231
21 Ga0055533_1000121 3300003756 Bacteria 89231
22 Ga0055525_1000159 3300003759 Bacteria 89231
23 Ga0055531_10000087 3300003794 Bacteria 101553
24 Ga0055541_1000077 3300003841 Bacteria 89231
25 Ga0058692_1000232 3300003856 Bacteria 32057
26 Ga0058692_1001974 3300003856 Bacteria 7144
27 Ga0058692_1002212 3300003856 Bacteria 6631
28 Ga0058692_1002227 3300003856 Bacteria 6592
29 Ga0058692_1002355 3300003856 Bacteria 6362
30 Ga0058692_1006223 3300003856 Bacteria 3302
31 Ga0058692_1011593 3300003856 Bacteria 2122
32 Ga0058692_1011852 3300003856 Bacteria 2090
33 Ga0065714_10086305 3300005288 Bacteria 2107
34 Ga0065704_10000270 3300005289 Bacteria 61602
35 Ga0065704_10001131 3300005289 Bacteria 9351
36 Ga0065704_10001222 3300005289 Bacteria 11254
37 Ga0065704_10108828 3300005289 Bacteria 2017
38 Ga0065704_10124612 3300005289 Bacteria 1715
39 Ga0065704_10170720 3300005289 Bacteria 1292
40 Ga0065712_10079171 3300005290 Bacteria 3242
41 Ga0070658_10188664 3300005327 Bacteria 1737
42 Ga0070676_10016642 3300005328 Bacteria 4066
43 Ga0070676_10210624 3300005328 Bacteria 1279
44 Ga0070683_100001617 3300005329 Bacteria 17421
45 Ga0070683_100002162 3300005329 Bacteria 15546
46 Ga0070683_100057546 3300005329 Bacteria 3612
47 Ga0070683_100234185 3300005329 Bacteria 1746
48 Ga0070690_100103651 3300005330 Bacteria 1889
49 Ga0070690_100585778 3300005330 Bacteria 845
50 Ga0070670_100084846 3300005331 Bacteria 2721
51 Ga0070670_100130580 3300005331 Bacteria 2169
52 Ga0070670_100334396 3300005331 Bacteria 1329
53 Ga0068869_100002709 3300005334 Bacteria 10721
54 Ga0068869_100010369 3300005334 Bacteria 6077
55 Ga0068869_100017858 3300005334 Bacteria 4820
56 Ga0068869_100043183 3300005334 Bacteria 3237
57 Ga0068869_100144321 3300005334 Bacteria 1841
58 Ga0070666_10000031 3300005335 Bacteria 132089
59 Ga0070666_10009553 3300005335 Bacteria 6050
60 Ga0070666_10417803 3300005335 Bacteria 966
61 Ga0070680_100001731 3300005336 Bacteria 16032
62 Ga0070682_100001468 3300005337 Bacteria 13211
63 Ga0068868_100007514 3300005338 Bacteria 7764
64 Ga0068868_100033134 3300005338 Bacteria 3980
65 Ga0068868_100043882 3300005338 Bacteria 3493
66 Ga0068868_100054588 3300005338 Bacteria 3149
67 Ga0068868_100079649 3300005338 Bacteria 2624
68 Ga0070660_100144238 3300005339 Bacteria 1912
69 Ga0070660_100193236 3300005339 Bacteria 1649
70 Ga0070660_100327507 3300005339 Bacteria 1259
71 Ga0070691_10034684 3300005341 Bacteria 2376
72 Ga0070661_100001586 3300005344 Bacteria 15775
73 Ga0070668_100025488 3300005347 Bacteria 4483
74 Ga0070668_100115638 3300005347 Bacteria 2138
75 Ga0070669_100224023 3300005353 Bacteria 1488
76 Ga0070669_100497565 3300005353 Bacteria 1011
77 Ga0070675_100057888 3300005354 Bacteria 3195
78 Ga0070671_100193397 3300005355 Bacteria 1724
79 Ga0070671_100233095 3300005355 Bacteria 1562
80 Ga0070671_100427751 3300005355 Bacteria 1134
81 Ga0070674_100079535 3300005356 Bacteria 2339
82 Ga0070674_100313810 3300005356 Bacteria 1254
83 Ga0070673_100201735 3300005364 Bacteria 1713
84 Ga0070673_100362119 3300005364 Bacteria 1289
85 Ga0070673_100445067 3300005364 Bacteria 1165
86 Ga0070673_100770317 3300005364 Bacteria 887
87 Ga0070688_100009950 3300005365 Bacteria 5225
88 Ga0070688_100069908 3300005365 Bacteria 2243
89 Ga0070659_100012249 3300005366 Bacteria 6357
90 Ga0070659_100016158 3300005366 Bacteria 5600
91 Ga0070659_100037129 3300005366 Bacteria 3798
92 Ga0070659_100037542 3300005366 Bacteria 3777
93 Ga0070659_100186550 3300005366 Bacteria 1704
94 Ga0070659_100207224 3300005366 Bacteria 1615
95 Ga0070667_100046365 3300005367 Bacteria 3656
96 Ga0070667_100708258 3300005367 Bacteria 932
97 Ga0070713_100163466 3300005436 Bacteria 1989
98 Ga0070678_100051008 3300005456 Bacteria 2996
99 Ga0070678_100057426 3300005456 Bacteria 2851
100 Ga0070662_100024310 3300005457 Bacteria 4172
101 Ga0070662_100028844 3300005457 Bacteria 3867
102 Ga0070662_100032828 3300005457 Bacteria 3651
103 Ga0070662_100094369 3300005457 Bacteria 2253
104 Ga0070662_100593419 3300005457 Bacteria 931
105 Ga0068867_100194794 3300005459 Bacteria 1619
106 Ga0068867_100468326 3300005459 Bacteria 1077
107 Ga0070685_10005488 3300005466 Bacteria 6426
108 Ga0070679_100014552 3300005530 Bacteria 7558
109 Ga0070684_100022943 3300005535 Bacteria 5212
110 Ga0070684_100833454 3300005535 Bacteria 863
111 Ga0068853_100004621 3300005539 Bacteria 10681
112 Ga0068853_100052273 3300005539 Bacteria 3520
113 Ga0068853_100065389 3300005539 Bacteria 3156
114 Ga0068853_100211933 3300005539 Bacteria 1766
115 Ga0068853_100409270 3300005539 Bacteria 1271
116 Ga0068853_100724119 3300005539 Bacteria 950
117 Ga0070672_100101886 3300005543 Bacteria 2330
118 Ga0070672_100457001 3300005543 Bacteria 1100
119 Ga0070693_100028255 3300005547 Bacteria 3048
120 Ga0070693_100064846 3300005547 Bacteria 2133
121 Ga0070665_100000595 3300005548 Bacteria 50263
122 Ga0070665_100121491 3300005548 Bacteria 2613
123 Ga0070665_100123066 3300005548 Bacteria 2596
124 Ga0070665_100224624 3300005548 Bacteria 1878
125 Ga0070704_100417679 3300005549 Bacteria 1148
126 Ga0068855_100020960 3300005563 Bacteria 7838
127 Ga0068855_100290088 3300005563 Bacteria 1814
128 Ga0070664_100003065 3300005564 Bacteria 13514
129 Ga0070664_100003911 3300005564 Bacteria 12021
130 Ga0070664_100036401 3300005564 Bacteria 4135
131 Ga0070664_100045037 3300005564 Bacteria 3726
132 Ga0070664_100046767 3300005564 Bacteria 3656
133 Ga0070664_100124501 3300005564 Bacteria 2260
134 Ga0070664_100330431 3300005564 Bacteria 1383
135 Ga0068857_100052473 3300005577 Bacteria 3618
136 Ga0068857_100228405 3300005577 Bacteria 1701
137 Ga0068857_100900642 3300005577 Bacteria 848
138 Ga0068854_100057524 3300005578 Bacteria 2805
139 Ga0068854_100178465 3300005578 Bacteria 1657
140 Ga0068854_100346939 3300005578 Bacteria 1214
141 Ga0070702_100227063 3300005615 Bacteria 1252
142 Ga0068852_100009516 3300005616 Bacteria 7221
143 Ga0068852_100038782 3300005616 Bacteria 4006
144 Ga0068852_100045464 3300005616 Bacteria 3734
145 Ga0068852_100082650 3300005616 Bacteria 2854
146 Ga0068859_100000045 3300005617 Bacteria 143607
147 Ga0068859_100086353 3300005617 Bacteria 3184
148 Ga0068859_100107186 3300005617 Bacteria 2854
149 Ga0068859_100198675 3300005617 Bacteria 2090
150 Ga0068859_100491051 3300005617 Bacteria 1323
151 Ga0068864_100046141 3300005618 Bacteria 3738
152 Ga0068864_100056094 3300005618 Bacteria 3404
153 Ga0068864_100064644 3300005618 Bacteria 3173
154 Ga0068864_100233016 3300005618 Bacteria 1704
155 Ga0068864_100531215 3300005618 Bacteria 1135
156 Ga0068866_10024317 3300005718 Bacteria 2830
157 Ga0068866_10298216 3300005718 Bacteria 1005
158 Ga0068861_100033570 3300005719 Bacteria 3787
159 Ga0068851_10023513 3300005834 Bacteria 3013
160 Ga0068863_100002071 3300005841 Bacteria 19895
161 Ga0068863_100013056 3300005841 Bacteria 8012
162 Ga0068863_100162903 3300005841 Bacteria 2138
163 Ga0068858_100002469 3300005842 Bacteria 18659
164 Ga0068858_100054897 3300005842 Bacteria 3684
165 Ga0068860_100004776 3300005843 Bacteria 13806
166 Ga0068860_100058267 3300005843 Bacteria 3672
167 Ga0068860_100268699 3300005843 Bacteria 1664
168 Ga0068860_100422375 3300005843 Bacteria 1322
169 Ga0068862_100216931 3300005844 Bacteria 1731
170 Ga0075364_10067598 3300006051 Bacteria 2349
171 Ga0075364_10079981 3300006051 Bacteria 2160
172 Ga0075364_10163379 3300006051 Bacteria 1503
173 Ga0075432_10014587 3300006058 Bacteria 2676
174 Ga0070715_10024227 3300006163 Bacteria 2388
175 Ga0075366_10132706 3300006195 Bacteria 1503
176 Ga0097621_100003567 3300006237 Bacteria 10753
177 Ga0097621_100022063 3300006237 Bacteria 4938
178 Ga0097621_100126339 3300006237 Bacteria 2173
179 Ga0097621_100212845 3300006237 Bacteria 1682
180 Ga0097621_100464888 3300006237 Bacteria 1141
181 Ga0097621_100698364 3300006237 Bacteria 934
182 Ga0068871_100047223 3300006358 Bacteria 3471
183 Ga0068871_100157398 3300006358 Bacteria 1941
184 Ga0068871_100553513 3300006358 Bacteria 1042
185 Ga0075428_100097302 3300006844 Bacteria 3209
186 Ga0075431_100005705 3300006847 Bacteria 12302
187 Ga0075429_100015656 3300006880 Bacteria 6571
188 Ga0068865_100131123 3300006881 Bacteria 1878
189 Ga0068865_100610952 3300006881 Bacteria 923
190 Ga0097620_100000045 3300006931 Bacteria 143607
191 Ga0097620_100086354 3300006931 Bacteria 3184
192 Ga0097620_100107183 3300006931 Bacteria 2854
193 Ga0097620_100198669 3300006931 Bacteria 2090
194 Ga0097620_100483806 3300006931 Bacteria 1333
195 Ga0097620_100491040 3300006931 Bacteria 1323
196 Ga0079104_1000535 3300006946 Bacteria 40052
197 Ga0079104_1000611 3300006946 Bacteria 35208
198 Ga0079104_1000775 3300006946 Bacteria 27286
199 Ga0079104_1001375 3300006946 Bacteria 16606
200 Ga0079104_1001480 3300006946 Bacteria 15648
201 Ga0079104_1002577 3300006946 Bacteria 9535
202 Ga0079104_1002634 3300006946 Bacteria 9364
203 Ga0079104_1006112 3300006946 Bacteria 4647
204 Ga0079104_1013219 3300006946 Bacteria 2555
205 Ga0105251_10000752 3300009011 Bacteria 29611
206 Ga0105251_10001038 3300009011 Bacteria 24371
207 Ga0105251_10002124 3300009011 Bacteria 15933
208 Ga0105251_10002144 3300009011 Bacteria 15866
209 Ga0105251_10010747 3300009011 Bacteria 5281
210 Ga0105251_10013713 3300009011 Bacteria 4519
211 Ga0105251_10024581 3300009011 Bacteria 3092
212 Ga0105251_10024734 3300009011 Bacteria 3081
213 Ga0105251_10053907 3300009011 Bacteria 1911
214 Ga0105251_10064353 3300009011 Bacteria 1719
215 Ga0105251_10088665 3300009011 Bacteria 1423
216 Ga0105251_10098236 3300009011 Bacteria 1340
217 Ga0105244_10000104 3300009036 Bacteria 86815
218 Ga0105244_10000222 3300009036 Bacteria 58959
219 Ga0105244_10000330 3300009036 Bacteria 44986
220 Ga0105244_10000354 3300009036 Bacteria 42971
221 Ga0105244_10000586 3300009036 Bacteria 32689
222 Ga0105244_10000865 3300009036 Bacteria 25591
223 Ga0105244_10001499 3300009036 Bacteria 18722
224 Ga0105244_10003307 3300009036 Bacteria 11606
225 Ga0105244_10010356 3300009036 Bacteria 5657
226 Ga0105244_10020096 3300009036 Bacteria 3713
227 Ga0105244_10024280 3300009036 Bacteria 3310
228 Ga0105244_10052901 3300009036 Bacteria 2066
229 Ga0105244_10101605 3300009036 Bacteria 1406
230 Ga0105244_10110086 3300009036 Bacteria 1341
231 Ga0105244_10221170 3300009036 Bacteria 888
232 Ga0105250_10000001 3300009092 Bacteria 617357
233 Ga0105250_10000195 3300009092 Bacteria 51515
234 Ga0105250_10000253 3300009092 Bacteria 44276
235 Ga0105250_10000448 3300009092 Bacteria 29733
236 Ga0105250_10003065 3300009092 Bacteria 8061
237 Ga0105250_10010162 3300009092 Bacteria 3928
238 Ga0105250_10020296 3300009092 Bacteria 2687
239 Ga0105240_10000859 3300009093 Bacteria 54758
240 Ga0105240_10016428 3300009093 Bacteria 10021
241 Ga0111539_10171523 3300009094 Bacteria 2534
242 Ga0105247_10000138 3300009101 Bacteria 70791
243 Ga0114129_10025420 3300009147 Bacteria 8390
244 Ga0105243_10066237 3300009148 Bacteria 2904
245 Ga0105243_10173822 3300009148 Bacteria 1868
246 Ga0105241_10000002 3300009174 Bacteria 869480
247 Ga0105241_10000591 3300009174 Bacteria 27316
248 Ga0105241_10027307 3300009174 Bacteria 4251
249 Ga0105241_10155556 3300009174 Bacteria 1874
250 Ga0105241_10237075 3300009174 Bacteria 1540
251 Ga0105241_10243849 3300009174 Bacteria 1520
252 Ga0105242_10064347 3300009176 Bacteria 3023
253 Ga0105242_10152313 3300009176 Bacteria 2017
254 Ga0105248_10316285 3300009177 Bacteria 1758
255 Ga0105248_10686998 3300009177 Bacteria 1155
256 Ga0105237_10002015 3300009545 Bacteria 25851
257 Ga0105237_10137985 3300009545 Bacteria 2433
258 Ga0105237_10355448 3300009545 Bacteria 1469
259 Ga0105238_10507117 3300009551 Bacteria 1208
260 Ga0105249_10000870 3300009553 Bacteria 26875
261 Ga0105249_10257618 3300009553 Bacteria 1732
262 Ga0105249_10684109 3300009553 Bacteria 1085
263 Ga0105239_10347780 3300010375 Bacteria 1674
264 Ga0105239_10607058 3300010375 Bacteria 1248
265 Ga0105246_10037568 3300011119 Bacteria 3250
266 Ga0105246_10076809 3300011119 Bacteria 2367
267 Ga0105246_10212563 3300011119 Bacteria 1510
268 Ga0105246_10254171 3300011119 Bacteria 1396
269 Ga0105246_10810141 3300011119 Bacteria 832
270 Ga0157373_10000500 3300013100 Bacteria 30895
271 Ga0157373_10000783 3300013100 Bacteria 24475
272 Ga0157373_10005917 3300013100 Bacteria 9152
273 Ga0157373_10188835 3300013100 Bacteria 1452
274 Ga0157371_10000099 3300013102 Bacteria 133829
275 Ga0157371_10001578 3300013102 Bacteria 23400
276 Ga0157371_10002572 3300013102 Bacteria 17215
277 Ga0157371_10016739 3300013102 Bacteria 5462
278 Ga0157371_10020580 3300013102 Bacteria 4855
279 Ga0157371_10025659 3300013102 Bacteria 4291
280 Ga0157371_10026882 3300013102 Bacteria 4178
281 Ga0157371_10074128 3300013102 Bacteria 2410
282 Ga0157371_10075013 3300013102 Bacteria 2395
283 Ga0157371_10085380 3300013102 Bacteria 2236
284 Ga0157370_10000234 3300013104 Bacteria 70723
285 Ga0157370_10004098 3300013104 Bacteria 16897
286 Ga0157370_10006551 3300013104 Bacteria 12824
287 Ga0157370_10015259 3300013104 Bacteria 7818
288 Ga0157370_10059676 3300013104 Bacteria 3624
289 Ga0157370_10202539 3300013104 Bacteria 1841
290 Ga0157370_10214236 3300013104 Bacteria 1785
291 Ga0157370_10267333 3300013104 Bacteria 1580
292 Ga0157370_10391271 3300013104 Bacteria 1280
293 Ga0157369_10030301 3300013105 Bacteria 5967
294 Ga0157369_10032764 3300013105 Bacteria 5711
295 Ga0157369_10062171 3300013105 Bacteria 4024
296 Ga0157369_10171903 3300013105 Bacteria 2283
297 Ga0157369_10298718 3300013105 Bacteria 1675
298 Ga0157374_10000607 3300013296 Bacteria 31733
299 Ga0157374_10003134 3300013296 Bacteria 13893
300 Ga0157374_10021708 3300013296 Bacteria 5717
301 Ga0157374_10079115 3300013296 Bacteria 3115
302 Ga0157374_10317926 3300013296 Bacteria 1542
303 Ga0157374_10437749 3300013296 Bacteria 1308
304 Ga0157378_10006056 3300013297 Bacteria 10594
305 Ga0157378_10006383 3300013297 Bacteria 10310
306 Ga0157378_10037001 3300013297 Bacteria 4321
307 Ga0157378_10044926 3300013297 Bacteria 3924
308 Ga0157378_10350813 3300013297 Bacteria 1441
309 Ga0163162_10002494 3300013306 Bacteria 17393
310 Ga0163162_10021357 3300013306 Bacteria 6374
311 Ga0163162_10035335 3300013306 Bacteria 4977
312 Ga0163162_10061435 3300013306 Bacteria 3795
313 Ga0163162_10132924 3300013306 Bacteria 2598
314 Ga0163162_10195546 3300013306 Bacteria 2151
315 Ga0157372_10007775 3300013307 Bacteria 11386
316 Ga0157372_10014588 3300013307 Bacteria 8406
317 Ga0157372_10023900 3300013307 Bacteria 6631
318 Ga0157372_10083160 3300013307 Bacteria 3626
319 Ga0157372_10108661 3300013307 Bacteria 3175
320 Ga0157372_10144319 3300013307 Bacteria 2745
321 Ga0157372_10150426 3300013307 Bacteria 2686
322 Ga0157372_10282713 3300013307 Bacteria 1929
323 Ga0157372_10284671 3300013307 Bacteria 1922
324 Ga0157372_10372592 3300013307 Bacteria 1664
325 Ga0157372_10572863 3300013307 Bacteria 1316
326 Ga0157372_10803964 3300013307 Bacteria 1092
327 Ga0157372_10975451 3300013307 Bacteria 982
328 Ga0157372_11373910 3300013307 Bacteria 814
329 Ga0157372_11374089 3300013307 Bacteria 814
330 Ga0157375_10010451 3300013308 Bacteria 8167
331 Ga0157375_10016076 3300013308 Bacteria 6713
332 Ga0157375_10022934 3300013308 Bacteria 5752
333 Ga0157375_10036441 3300013308 Bacteria 4706
334 Ga0157375_10188032 3300013308 Bacteria 2219
335 Ga0157375_10194138 3300013308 Bacteria 2185
336 Ga0163163_10000078 3300014325 Bacteria 107017
337 Ga0163163_10000266 3300014325 Bacteria 52427
338 Ga0163163_10016683 3300014325 Bacteria 6831
339 Ga0163163_10057979 3300014325 Bacteria 3829
340 Ga0163163_10155883 3300014325 Bacteria 2328
341 Ga0163163_10233170 3300014325 Bacteria 1890
342 Ga0157380_10000704 3300014326 Bacteria 20846
343 Ga0157380_10013755 3300014326 Bacteria 5908
344 Ga0157380_10165053 3300014326 Bacteria 1929
345 Ga0157380_10470941 3300014326 Bacteria 1212
346 Ga0157377_10023420 3300014745 Bacteria 3272
347 Ga0157377_10073178 3300014745 Bacteria 1985
348 Ga0157379_10397977 3300014968 Bacteria 1266
349 Ga0157376_10057433 3300014969 Bacteria 3255
350 Ga0157376_10090091 3300014969 Bacteria 2654
351 Ga0157376_10117263 3300014969 Bacteria 2354
352 Ga0157376_10328331 3300014969 Bacteria 1457
353 Ga0157376_10421650 3300014969 Bacteria 1295
354 Ga0182006_1000047 3300015261 Bacteria 187006
355 Ga0182006_1008119 3300015261 Bacteria 4764
356 Ga0182007_10004870 3300015262 Bacteria 5999
357 Ga0183366_1001 3300015679 Bacteria 2743932
358 Ga0183370_1001 3300015680 Bacteria 2743932
359 Ga0183369_1001 3300015685 Bacteria 2743932
360 Ga0183368_1001 3300015687 Bacteria 2743932
361 Ga0163161_10114482 3300017792 Bacteria 2020
362 Ga0163161_10137372 3300017792 Bacteria 1849
363 Ga0163161_10211080 3300017792 Bacteria 1500
364 Ga0206351_10347196 3300020077 Bacteria 4528
365 Ga0213876_10000055 3300021384 Bacteria 136037
366 Ga0224712_10176051 3300022467 Bacteria 962
367 Ga0209760_100104 3300025207 Bacteria 65129
368 Ga0209784_100001 3300025224 Bacteria 3600592
369 Ga0209566_100001 3300025225 Bacteria 3600765
370 Ga0209674_100002 3300025226 Bacteria 3600592
371 Ga0209563_100008 3300025230 Bacteria 1554545
372 Ga0207427_100135 3300025231 Bacteria 89851
373 Ga0209437_100007 3300025233 Bacteria 938377
374 Ga0209437_100109 3300025233 Bacteria 217031
375 Ga0209437_100111 3300025233 Bacteria 214944
376 Ga0209677_100004 3300025253 Bacteria 1554545
377 Ga0209129_1000004 3300025258 Bacteria 884499
378 Ga0209257_1000006 3300025304 Bacteria 1570111
379 Ga0207656_10001167 3300025321 Bacteria 8636
380 Ga0207656_10145007 3300025321 Bacteria 1121
381 Ga0207696_1000001 3300025711 Bacteria 2579611
382 Ga0207696_1000028 3300025711 Bacteria 400424
383 Ga0207696_1000086 3300025711 Bacteria 194626
384 Ga0207696_1000116 3300025711 Bacteria 148125
385 Ga0207696_1000174 3300025711 Bacteria 102229
386 Ga0207696_1000235 3300025711 Bacteria 77526
387 Ga0207696_1000439 3300025711 Bacteria 37274
388 Ga0207696_1001155 3300025711 Bacteria 15182
389 Ga0207696_1004856 3300025711 Bacteria 5696
390 Ga0207696_1039799 3300025711 Bacteria 1380
391 Ga0207655_1000001 3300025728 Bacteria 1866413
392 Ga0207655_1000004 3300025728 Bacteria 1021221
393 Ga0207655_1000009 3300025728 Bacteria 664676
394 Ga0207655_1000037 3300025728 Bacteria 354473
395 Ga0207655_1000089 3300025728 Bacteria 204720
396 Ga0207655_1000426 3300025728 Bacteria 56714
397 Ga0207655_1000647 3300025728 Bacteria 41615
398 Ga0207655_1000741 3300025728 Bacteria 36714
399 Ga0207655_1002099 3300025728 Bacteria 16702
400 Ga0207655_1003187 3300025728 Bacteria 12363
401 Ga0207655_1005530 3300025728 Bacteria 8571
402 Ga0207655_1041906 3300025728 Bacteria 1956
403 Ga0207655_1061571 3300025728 Bacteria 1447
404 Ga0207713_1000001 3300025735 Bacteria 2295391
405 Ga0207713_1000002 3300025735 Bacteria 1061749
406 Ga0207713_1000003 3300025735 Bacteria 860698
407 Ga0207713_1000012 3300025735 Bacteria 501860
408 Ga0207713_1001881 3300025735 Bacteria 15941
409 Ga0207713_1001893 3300025735 Bacteria 15874
410 Ga0207713_1010034 3300025735 Bacteria 5280
411 Ga0207713_1012581 3300025735 Bacteria 4509
412 Ga0207713_1020048 3300025735 Bacteria 3253
413 Ga0207713_1021384 3300025735 Bacteria 3102
414 Ga0207713_1022401 3300025735 Bacteria 3000
415 Ga0207713_1025865 3300025735 Bacteria 2701
416 Ga0207713_1043857 3300025735 Bacteria 1844
417 Ga0207713_1051983 3300025735 Bacteria 1626
418 Ga0207713_1062442 3300025735 Bacteria 1412
419 Ga0207713_1062803 3300025735 Bacteria 1406
420 Ga0207713_1073257 3300025735 Bacteria 1257
421 Ga0207713_1114844 3300025735 Bacteria 910
422 Ga0207682_10013296 3300025893 Bacteria 3207
423 Ga0207642_10110967 3300025899 Bacteria 1396
424 Ga0207710_10000052 3300025900 Bacteria 181113
425 Ga0207710_10039366 3300025900 Bacteria 2092
426 Ga0207688_10019542 3300025901 Bacteria 3693
427 Ga0207688_10087378 3300025901 Bacteria 1787
428 Ga0207680_10000627 3300025903 Bacteria 16642
429 Ga0207680_10413530 3300025903 Bacteria 954
430 Ga0207647_10000951 3300025904 Bacteria 22412
431 Ga0207685_10248628 3300025905 Bacteria 859
432 Ga0207645_10000263 3300025907 Bacteria 43560
433 Ga0207645_10211058 3300025907 Bacteria 1279
434 Ga0207643_10009659 3300025908 Bacteria 5180
435 Ga0207643_10115001 3300025908 Bacteria 1588
436 Ga0207705_10215007 3300025909 Bacteria 1459
437 Ga0207705_10559955 3300025909 Bacteria 889
438 Ga0207654_10000005 3300025911 Bacteria 869492
439 Ga0207654_10002808 3300025911 Bacteria 8835
440 Ga0207654_10165487 3300025911 Bacteria 1432
441 Ga0207654_10263986 3300025911 Bacteria 1159
442 Ga0207654_10373532 3300025911 Bacteria 986
443 Ga0207707_10001133 3300025912 Bacteria 25238
444 Ga0207695_10000697 3300025913 Bacteria 65760
445 Ga0207695_10149398 3300025913 Bacteria 2277
446 Ga0207671_10001627 3300025914 Bacteria 25569
447 Ga0207657_10057255 3300025919 Bacteria 3360
448 Ga0207657_10186973 3300025919 Bacteria 1672
449 Ga0207681_10298752 3300025923 Bacteria 1273
450 Ga0207694_10360978 3300025924 Bacteria 1204
451 Ga0207650_10010602 3300025925 Bacteria 6329
452 Ga0207650_10012259 3300025925 Bacteria 5916
453 Ga0207650_10095777 3300025925 Bacteria 2276
454 Ga0207659_10081239 3300025926 Bacteria 2396
455 Ga0207644_10146786 3300025931 Bacteria 1822
456 Ga0207644_10510666 3300025931 Bacteria 992
457 Ga0207690_10007814 3300025932 Bacteria 6350
458 Ga0207690_10041973 3300025932 Bacteria 3001
459 Ga0207690_10110114 3300025932 Bacteria 1982
460 Ga0207706_10028711 3300025933 Bacteria 4966
461 Ga0207706_10036759 3300025933 Bacteria 4350
462 Ga0207706_10061454 3300025933 Bacteria 3308
463 Ga0207706_10175285 3300025933 Bacteria 1884
464 Ga0207686_10183326 3300025934 Bacteria 1486
465 Ga0207709_10117671 3300025935 Bacteria 1789
466 Ga0207709_10172431 3300025935 Bacteria 1519
467 Ga0207670_10242954 3300025936 Bacteria 1388
468 Ga0207670_10266294 3300025936 Bacteria 1330
469 Ga0207669_10208796 3300025937 Bacteria 1423
470 Ga0207704_10412162 3300025938 Bacteria 1069
471 Ga0207691_10124593 3300025940 Bacteria 2281
472 Ga0207691_10146860 3300025940 Bacteria 2075
473 Ga0207691_10490483 3300025940 Bacteria 1044
474 Ga0207711_10433756 3300025941 Bacteria 1223
475 Ga0207689_10000740 3300025942 Bacteria 31390
476 Ga0207689_10001881 3300025942 Bacteria 19847
477 Ga0207689_10004215 3300025942 Bacteria 13071
478 Ga0207689_10004731 3300025942 Bacteria 12272
479 Ga0207689_10008743 3300025942 Bacteria 8808
480 Ga0207689_10156765 3300025942 Bacteria 1877
481 Ga0207661_10002099 3300025944 Bacteria 13715
482 Ga0207661_10076603 3300025944 Bacteria 2747
483 Ga0207661_10116912 3300025944 Bacteria 2264
484 Ga0207661_10197014 3300025944 Bacteria 1769
485 Ga0207661_10707570 3300025944 Bacteria 927
486 Ga0207679_10004222 3300025945 Bacteria 8925
487 Ga0207679_10006055 3300025945 Bacteria 7625
488 Ga0207679_10056047 3300025945 Bacteria 2908
489 Ga0207679_10121017 3300025945 Bacteria 2084
490 Ga0207679_10346529 3300025945 Bacteria 1293
491 Ga0207667_10074165 3300025949 Bacteria 3535
492 Ga0207667_10130253 3300025949 Bacteria 2591
493 Ga0207667_10140052 3300025949 Bacteria 2491
494 Ga0207667_10189282 3300025949 Bacteria 2112
495 Ga0207651_10148948 3300025960 Bacteria 1819
496 Ga0207651_10231980 3300025960 Bacteria 1499
497 Ga0207712_10004692 3300025961 Bacteria 8639
498 Ga0207712_10305212 3300025961 Bacteria 1308
499 Ga0207668_10005192 3300025972 Bacteria 7662
500 Ga0207668_10116960 3300025972 Bacteria 2011
501 Ga0207640_10129225 3300025981 Bacteria 1823
502 Ga0207658_10069120 3300025986 Bacteria 2667
503 Ga0207658_10466273 3300025986 Bacteria 1120
504 Ga0207677_10042463 3300026023 Bacteria 3015
505 Ga0207677_10084549 3300026023 Bacteria 2288
506 Ga0207677_10376986 3300026023 Bacteria 1196
507 Ga0207703_10003137 3300026035 Bacteria 13955
508 Ga0207703_10242993 3300026035 Bacteria 1619
509 Ga0207703_10379941 3300026035 Bacteria 1306
510 Ga0207639_10013711 3300026041 Bacteria 5682
511 Ga0207641_10000146 3300026088 Bacteria 100666
512 Ga0207641_10004565 3300026088 Bacteria 11968
513 Ga0207641_10023870 3300026088 Bacteria 5041
514 Ga0207641_10132465 3300026088 Bacteria 2240
515 Ga0207641_10538102 3300026088 Bacteria 1138
516 Ga0207648_10007679 3300026089 Bacteria 10553
517 Ga0207648_10026554 3300026089 Bacteria 5144
518 Ga0207648_10349172 3300026089 Bacteria 1333
519 Ga0207676_10053281 3300026095 Bacteria 3166
520 Ga0207676_10081556 3300026095 Bacteria 2628
521 Ga0207676_10105893 3300026095 Bacteria 2342
522 Ga0207676_10287519 3300026095 Bacteria 1495
523 Ga0207676_10520557 3300026095 Bacteria 1132
524 Ga0207676_10750257 3300026095 Bacteria 949
525 Ga0207674_10003943 3300026116 Bacteria 18057
526 Ga0207674_10076295 3300026116 Bacteria 3360
527 Ga0207674_10348043 3300026116 Bacteria 1433
528 Ga0207675_100033135 3300026118 Bacteria 4813
529 Ga0207675_100209283 3300026118 Bacteria 1875
530 Ga0207675_100212710 3300026118 Bacteria 1860
531 Ga0207683_10001367 3300026121 Bacteria 22059
532 Ga0207683_10039890 3300026121 Bacteria 4096
533 Ga0207683_10271032 3300026121 Bacteria 1550
534 Ga0207698_10016396 3300026142 Bacteria 4992
535 Ga0207698_10098006 3300026142 Bacteria 2421
536 Ga0207698_10290463 3300026142 Bacteria 1517
537 Ga0207698_10346190 3300026142 Bacteria 1402
538 Ga0207698_10444367 3300026142 Bacteria 1250
539 Ga0209281_1000001 3300027111 Bacteria 1933496
540 Ga0209281_1000003 3300027111 Bacteria 1260089
541 Ga0209281_1000130 3300027111 Bacteria 191756
542 Ga0209281_1000394 3300027111 Bacteria 68048
543 Ga0209281_1000428 3300027111 Bacteria 62540
544 Ga0209281_1000598 3300027111 Bacteria 41043
545 Ga0209281_1000713 3300027111 Bacteria 33360
546 Ga0209281_1001045 3300027111 Bacteria 20990
547 Ga0209281_1001234 3300027111 Bacteria 16952
548 Ga0209281_1002684 3300027111 Bacteria 6726
549 Ga0209281_1002778 3300027111 Bacteria 6484
550 Ga0209371_1000001 3300027312 Bacteria 2771503
551 Ga0209371_1000002 3300027312 Bacteria 1551985
552 Ga0209371_1000041 3300027312 Bacteria 340377
553 Ga0209371_1000122 3300027312 Bacteria 132545
554 Ga0209371_1000188 3300027312 Bacteria 90102
555 Ga0209371_1000492 3300027312 Bacteria 38527
556 Ga0209371_1000862 3300027312 Bacteria 24564
557 Ga0209371_1001378 3300027312 Bacteria 16753
558 Ga0209371_1001914 3300027312 Bacteria 12710
559 Ga0209371_1002701 3300027312 Bacteria 9581
560 Ga0209371_1003845 3300027312 Bacteria 6961
561 Ga0209371_1004166 3300027312 Bacteria 6457
562 Ga0209371_1017918 3300027312 Bacteria 1817
563 Ga0209371_1022638 3300027312 Bacteria 1497
564 Ga0209995_1011204 3300027471 Bacteria 1457
565 Ga0268266_10001643 3300028379 Bacteria 25908
566 Ga0268266_10091894 3300028379 Bacteria 2662
567 Ga0268266_10490007 3300028379 Bacteria 1173
568 Ga0268265_10318611 3300028380 Bacteria 1407
569 Ga0268264_10004639 3300028381 Bacteria 11675
570 Ga0268264_10244334 3300028381 Bacteria 1664
571 Ga0268264_10362372 3300028381 Bacteria 1383
572 Ga0265323_10000155 3300028653 Bacteria 40398
573 Ga0307515_10000024 3300028794 Bacteria 393119
574 Ga0265338_10000829 3300028800 Bacteria 52134
575 Ga0265338_10022306 3300028800 Bacteria 6560
576 Ga0268256_1000001 3300030500 Bacteria 2771065
577 Ga0268256_1000002 3300030500 Bacteria 1535763
578 Ga0268256_1000003 3300030500 Bacteria 1289401
579 Ga0268256_1000048 3300030500 Bacteria 312298
580 Ga0268256_1000051 3300030500 Bacteria 283626
581 Ga0268256_1000718 3300030500 Bacteria 24564
582 Ga0268256_1000844 3300030500 Bacteria 21767
583 Ga0268256_1001182 3300030500 Bacteria 16753
584 Ga0268256_1001381 3300030500 Bacteria 14764
585 Ga0268256_1003561 3300030500 Bacteria 6961
586 Ga0268256_1003845 3300030500 Bacteria 6547
587 Ga0268256_1004889 3300030500 Bacteria 5409
588 Ga0268256_1020005 3300030500 Bacteria 1817
589 Ga0268256_1025573 3300030500 Bacteria 1497
590 Ga0265340_10006768 3300031247 Bacteria 6272
591 Ga0265327_10002353 3300031251 Bacteria 20149
592 Ga0307509_10069970 3300031507 Bacteria 3666
593 Ga0307408_100021623 3300031548 Bacteria 4357
594 Ga0307408_100199309 3300031548 Bacteria 1619
595 Ga0265342_10043736 3300031712 Bacteria 2702
596 Ga0316576_10301370 3300031727 Bacteria 1198
597 Ga0316578_10073968 3300031728 Bacteria 2020
598 Ga0316578_10166887 3300031728 Bacteria 1327
599 Ga0307516_10183073 3300031730 Bacteria 1827
600 Ga0316577_10093444 3300031733 Bacteria 1684
601 Ga0307413_10162424 3300031824 Bacteria 1571
602 Ga0307413_10403361 3300031824 Bacteria 1072
603 Ga0307410_10133007 3300031852 Bacteria 1830
604 Ga0307412_10082115 3300031911 Bacteria 2231
605 Ga0307412_10673094 3300031911 Bacteria 885
606 Ga0307416_100046890 3300032002 Bacteria 3415
607 Ga0307414_10000349 3300032004 Bacteria 25834
608 Ga0307414_10354929 3300032004 Bacteria 1260
609 Ga0307411_10076805 3300032005 Bacteria 2284
610 Ga0307411_10211510 3300032005 Bacteria 1498
611 Ga0307415_100058197 3300032126 Bacteria 2660
612 Ga0373953_0046563 3300035117 Bacteria 1742
613 Ga0373957_0078731 3300035120 Bacteria 1299
614 Ga0373955_0133452 3300035172 Bacteria 1451
615 Ga0373937_0211631 3300036401 Bacteria 1824
616 Ga0316584_0373164 3300036712 Bacteria 1021
617 Ga0395900_0032101 3300037418 Bacteria 5399
618 Ga0395900_0204509 3300037418 Bacteria 1996
619 Ga0395900_0231681 3300037418 Bacteria 1857
620 Ga0395905_0000001 3300037471 Bacteria 2037079
621 Ga0395905_0001509 3300037471 Bacteria 27821
622 Ga0395905_0321487 3300037471 Bacteria 1437
623 Ga0395905_0326249 3300037471 Bacteria 1425
624 Ga0395901_0073626 3300038443 Bacteria 3563
625 Ga0395901_0354010 3300038443 Bacteria 1515
626 Ga0436365_0971002 3300039437 Bacteria 167792
627 Ga0439436_0001403 3300041404 Bacteria 6962
628 Ga0439438_000001 3300041405 Bacteria 1263568
629 Ga0439438_000780 3300041405 Bacteria 14167
630 Ga0439438_025837 3300041405 Bacteria 1596
631 Ga0439439_0036952 3300041406 Bacteria 1258
632 Ga0439447_001075 3300041407 Bacteria 9908
633 Ga0439466_0000047 3300041411 Bacteria 48861
634 Ga0451793_0325768 3300041452 Bacteria 836
635 Ga0451795_0027072 3300041456 Bacteria 2684
636 Ga0451798_0517438 3300041458 Bacteria 832
637 Ga0451798_0974364 3300041458 Bacteria 1182
638 Ga0451807_2513161 3300041486 Bacteria 1602
639 Ga0439432_010616 3300042006 Bacteria 3185
640 Ga0439432_011524 3300042006 Bacteria 3046
641 Ga0439432_013991 3300042006 Bacteria 2718
642 Ga0439449_0001549 3300042007 Bacteria 9004
643 Ga0439449_0061628 3300042007 Bacteria 1384
644 Ga0439452_000001 3300042010 Bacteria 1725439
645 Ga0439452_000002 3300042010 Bacteria 1377577
646 Ga0439452_000008 3300042010 Bacteria 569877
647 Ga0439452_000142 3300042010 Bacteria 54077
648 Ga0439452_000298 3300042010 Bacteria 31875
649 Ga0439457_004175 3300042014 Bacteria 3810
650 Ga0439457_013437 3300042014 Bacteria 1841
651 Ga0439463_006887 3300042016 Bacteria 2806
652 Ga0450907_000190 3300042146 Bacteria 22431
653 Ga0439464_0011759 3300042439 Bacteria 2322
654 Ga0451577_0083417 3300042876 Bacteria 2851
655 Ga0466972_0000028 3300044658 Bacteria 171140
656 Ga0466972_0125101 3300044658 Bacteria 1212
657 Ga0466981_0000002 3300044669 Bacteria 313036
658 Ga0453683_0079495 3300044673 Bacteria 2054
659 Ga0453683_0152767 3300044673 Bacteria 1459
660 Ga0466966_0341366 3300044684 Bacteria 900
661 Ga0453684_0023018 3300044712 Bacteria 9207
662 Ga0453684_0086272 3300044712 Bacteria 3896
663 Ga0453684_0092605 3300044712 Bacteria 3725
664 Ga0453684_0104488 3300044712 Bacteria 3457
665 Ga0453684_0865566 3300044712 Bacteria 970
666 Ga0451576_1038951 3300045051 Bacteria 858
667 Ga0495617_040590 3300046452 Bacteria 1556
668 Ga0495627_000116 3300046453 Bacteria 99916
669 Ga0495592_0276160 3300046454 Bacteria 1100
670 Ga0495591_000013 3300046458 Bacteria 268106
671 Ga0495591_000100 3300046458 Bacteria 99473
672 Ga0495591_035053 3300046458 Bacteria 1471
673 Ga0495638_0013681 3300046460 Bacteria 5513
674 Ga0495650_0000005 3300046471 Bacteria 766553
675 Ga0495650_0000090 3300046471 Bacteria 232897
676 Ga0495650_0000187 3300046471 Bacteria 136554
677 Ga0495584_0011311 3300046491 Bacteria 4571
678 Ga0495585_0011587 3300046492 Bacteria 5213
679 Ga0495606_0003762 3300046507 Bacteria 15779
680 Ga0495618_0103054 3300046514 Bacteria 1827
681 Ga0495630_0008093 3300046517 Bacteria 7557
682 Ga0495630_0216452 3300046517 Bacteria 1462
683 Ga0495632_0176716 3300046519 Bacteria 979
684 Ga0495637_0123931 3300046520 Bacteria 992
685 Ga0495643_0034513 3300046522 Bacteria 2791
686 Ga0495644_0000573 3300046523 Bacteria 15420
687 Ga0495648_0002343 3300046524 Bacteria 17587
688 Ga0495648_0009258 3300046524 Bacteria 7655
689 Ga0495654_0000041 3300046530 Bacteria 174733
690 Ga0495654_0000173 3300046530 Bacteria 63665
691 Ga0495654_0001003 3300046530 Bacteria 20737
692 Ga0495654_0052850 3300046530 Bacteria 1976
693 Ga0495597_0001631 3300046542 Bacteria 15710
694 Ga0495633_0131575 3300046558 Bacteria 1158
695 Ga0495667_0005807 3300046559 Bacteria 8363
696 Ga0495625_0016408 3300046660 Bacteria 5831
697 Ga0495588_0003244 3300046674 Bacteria 7055
698 Ga0495613_0014269 3300046689 Bacteria 5896
699 Ga0495671_0009709 3300046692 Bacteria 5365
700 Ga0495649_0001886 3300046694 Bacteria 15339
701 Ga0495649_0009622 3300046694 Bacteria 5729
702 Ga0495589_0000004 3300046794 Bacteria 439891
703 Ga0495589_0005519 3300046794 Bacteria 6671
704 Ga0495660_0000028 3300046810 Bacteria 244534
705 Ga0495660_0000171 3300046810 Bacteria 70062
706 Ga0495660_0053644 3300046810 Bacteria 2187
707 Ga0495604_0368024 3300047317 Bacteria 952
708 Ga0495672_0000002 3300047320 Bacteria 740116
709 Ga0495672_0000020 3300047320 Bacteria 432845
710 Ga0495672_0000043 3300047320 Bacteria 266893
711 Ga0495672_0015649 3300047320 Bacteria 5141
712 Ga0495679_000282 3300047446 Bacteria 42194
713 Ga0495679_029528 3300047446 Bacteria 1787
714 Ga0495679_049639 3300047446 Bacteria 1265
715 Ga0495673_0000070 3300047469 Bacteria 217453
716 Ga0495673_0000167 3300047469 Bacteria 111793
717 Ga0495681_0021707 3300047470 Bacteria 3452
718 Ga0495681_0092896 3300047470 Bacteria 1329
719 Ga0496100_0004919 3300048903 Bacteria 7138
720 Ga0496101_0000163 3300048904 Bacteria 56805
721 Ga0496101_0254290 3300048904 Bacteria 1369
722 Ga0496102_0049801 3300048905 Bacteria 3812
723 Ga0496103_0068478 3300048906 Bacteria 2218
724 Ga0496104_0000555 3300048907 Bacteria 31796
725 Ga0496104_0048174 3300048907 Bacteria 4018
726 Ga0496104_0579797 3300048907 Bacteria 1032
727 Ga0496105_0031796 3300048908 Bacteria 4328
728 Ga0496108_0705674 3300048911 Bacteria 875
729 Ga0496110_0152210 3300048913 Bacteria 2095
730 Ga0496110_0165676 3300048913 Bacteria 2004
731 Ga0496110_0256833 3300048913 Bacteria 1591
732 Ga0496111_0114285 3300048914 Bacteria 1990
733 Ga0496115_0010820 3300048918 Bacteria 6823
734 Ga0496115_0257228 3300048918 Bacteria 1436
735 Ga0496116_0000001 3300048919 Bacteria 1501681
736 Ga0496116_0000122 3300048919 Bacteria 162802
737 Ga0496116_0000277 3300048919 Bacteria 89271
738 Ga0496116_0001125 3300048919 Bacteria 31904
739 Ga0496116_0008548 3300048919 Bacteria 8868
740 Ga0496116_0012630 3300048919 Bacteria 6879
741 Ga0496116_0015585 3300048919 Bacteria 6002
742 Ga0496116_0100569 3300048919 Bacteria 1728
743 Ga0496116_0106631 3300048919 Bacteria 1658
744 Ga0496117_0000004 3300048920 Bacteria 877131
745 Ga0496117_0000165 3300048920 Bacteria 139029
746 Ga0496117_0000399 3300048920 Bacteria 74064
747 Ga0496117_0002525 3300048920 Bacteria 22922
748 Ga0496117_0003424 3300048920 Bacteria 18450
749 Ga0496117_0004066 3300048920 Bacteria 16424
750 Ga0496117_0008180 3300048920 Bacteria 9980
751 Ga0496117_0020640 3300048920 Bacteria 5364
752 Ga0496117_0034148 3300048920 Bacteria 3837
753 Ga0496117_0034335 3300048920 Bacteria 3822
754 Ga0496117_0060036 3300048920 Bacteria 2623
755 Ga0496117_0068843 3300048920 Bacteria 2387
756 Ga0496117_0070832 3300048920 Bacteria 2339
757 Ga0496117_0073597 3300048920 Bacteria 2278
758 Ga0496118_0000007 3300048921 Bacteria 650986
759 Ga0496118_0000015 3300048921 Bacteria 551359
760 Ga0496118_0001126 3300048921 Bacteria 41304
761 Ga0496118_0002525 3300048921 Bacteria 24537
762 Ga0496118_0002850 3300048921 Bacteria 22564
763 Ga0496118_0005269 3300048921 Bacteria 14761
764 Ga0496118_0012799 3300048921 Bacteria 8007
765 Ga0496118_0021142 3300048921 Bacteria 5738
766 Ga0496118_0026635 3300048921 Bacteria 4917
767 Ga0496118_0027827 3300048921 Bacteria 4775
768 Ga0496118_0036738 3300048921 Bacteria 3954
769 Ga0496118_0176208 3300048921 Bacteria 1298
770 Ga0496119_0000066 3300048922 Bacteria 162680
771 Ga0496119_0000095 3300048922 Bacteria 129683
772 Ga0496119_0000911 3300048922 Bacteria 38310
773 Ga0496119_0001499 3300048922 Bacteria 27950
774 Ga0496119_0001967 3300048922 Bacteria 23367
775 Ga0496119_0002594 3300048922 Bacteria 19628
776 Ga0496119_0004815 3300048922 Bacteria 13237
777 Ga0496119_0012013 3300048922 Bacteria 7086
778 Ga0496119_0019406 3300048922 Bacteria 5009
779 Ga0496119_0024425 3300048922 Bacteria 4252
780 Ga0496119_0027666 3300048922 Bacteria 3890
781 Ga0496119_0031972 3300048922 Bacteria 3515
782 Ga0496119_0037015 3300048922 Bacteria 3176
783 Ga0496119_0039110 3300048922 Bacteria 3051
784 Ga0496120_0000076 3300048923 Bacteria 163121
785 Ga0496120_0000380 3300048923 Bacteria 71773
786 Ga0496120_0000928 3300048923 Bacteria 40566
787 Ga0496120_0001267 3300048923 Bacteria 31661
788 Ga0496120_0002342 3300048923 Bacteria 19477
789 Ga0496120_0003408 3300048923 Bacteria 14539
790 Ga0496120_0003965 3300048923 Bacteria 12868
791 Ga0496120_0011139 3300048923 Bacteria 6204
792 Ga0496120_0015425 3300048923 Bacteria 5041
793 Ga0496120_0025816 3300048923 Bacteria 3641
794 Ga0496120_0044450 3300048923 Bacteria 2580
795 Ga0496120_0050891 3300048923 Bacteria 2369
796 Ga0496121_0002250 3300048924 Bacteria 30081
797 Ga0496121_0003016 3300048924 Bacteria 24450
798 Ga0496121_0025828 3300048924 Bacteria 5557
799 Ga0496121_0025872 3300048924 Bacteria 5552
800 Ga0496121_0042151 3300048924 Bacteria 3976
801 Ga0496121_0187043 3300048924 Bacteria 1488
802 Ga0496121_0247971 3300048924 Bacteria 1236
803 Ga0496122_0000005 3300048925 Bacteria 630659
804 Ga0496122_0000058 3300048925 Bacteria 248805
805 Ga0496122_0000738 3300048925 Bacteria 63772
806 Ga0496122_0004902 3300048925 Bacteria 16231
807 Ga0496122_0014702 3300048925 Bacteria 7546
808 Ga0496122_0021615 3300048925 Bacteria 5751
809 Ga0496122_0022320 3300048925 Bacteria 5630
810 Ga0496122_0025084 3300048925 Bacteria 5194
811 Ga0496122_0050089 3300048925 Bacteria 3188
812 Ga0496122_0059356 3300048925 Bacteria 2824
813 Ga0496122_0061607 3300048925 Bacteria 2752
814 Ga0496122_0082194 3300048925 Bacteria 2238
815 Ga0496122_0104116 3300048925 Bacteria 1886
816 Ga0496123_0000008 3300048926 Bacteria 630628
817 Ga0496123_0000044 3300048926 Bacteria 253396
818 Ga0496123_0001322 3300048926 Bacteria 35015
819 Ga0496123_0002433 3300048926 Bacteria 23152
820 Ga0496123_0006525 3300048926 Bacteria 11270
821 Ga0496123_0011748 3300048926 Bacteria 7546
822 Ga0496123_0020012 3300048926 Bacteria 5253
823 Ga0496123_0022150 3300048926 Bacteria 4907
824 Ga0496123_0022151 3300048926 Bacteria 4907
825 Ga0496123_0044729 3300048926 Bacteria 3024
826 Ga0496123_0081598 3300048926 Bacteria 1964
827 Ga0496124_0000105 3300048927 Bacteria 176783
828 Ga0496124_0000107 3300048927 Bacteria 168020
829 Ga0496124_0000196 3300048927 Bacteria 119375
830 Ga0496124_0000564 3300048927 Bacteria 62677
831 Ga0496124_0001459 3300048927 Bacteria 34893
832 Ga0496124_0012635 3300048927 Bacteria 8309
833 Ga0496124_0023875 3300048927 Bacteria 5570
834 Ga0496124_0037841 3300048927 Bacteria 4193
835 Ga0496124_0075693 3300048927 Bacteria 2780
836 Ga0496124_0133342 3300048927 Bacteria 1970
837 Ga0496124_0139172 3300048927 Bacteria 1917
838 Ga0496124_0141534 3300048927 Bacteria 1897
839 Ga0496124_0248184 3300048927 Bacteria 1318
840 Ga0496124_0309144 3300048927 Bacteria 1137
841 Ga0496125_0000009 3300048928 Bacteria 677678
842 Ga0496125_0000103 3300048928 Bacteria 201675
843 Ga0496125_0001712 3300048928 Bacteria 30528
844 Ga0496125_0005660 3300048928 Bacteria 13790
845 Ga0496125_0007075 3300048928 Bacteria 11984
846 Ga0496125_0017105 3300048928 Bacteria 6928
847 Ga0496125_0024785 3300048928 Bacteria 5507
848 Ga0496125_0040085 3300048928 Bacteria 4022
849 Ga0496125_0081332 3300048928 Bacteria 2475
850 Ga0496126_0000399 3300048929 Bacteria 89026
851 Ga0496126_0000779 3300048929 Bacteria 57561
852 Ga0496126_0002347 3300048929 Bacteria 25872
853 Ga0496126_0020256 3300048929 Bacteria 6528
854 Ga0496126_0064326 3300048929 Bacteria 3286
855 Ga0496126_0092871 3300048929 Bacteria 2650
856 Ga0496126_0093341 3300048929 Bacteria 2642
857 Ga0496126_0117465 3300048929 Bacteria 2310
858 Ga0496126_0118871 3300048929 Bacteria 2294
859 Ga0496126_0177426 3300048929 Bacteria 1811
860 Ga0496126_0263834 3300048929 Bacteria 1431
861 Ga0496126_0270448 3300048929 Bacteria 1410
862 Ga0501308_010410 3300049128 Bacteria 1033
863 Ga0501305_001184 3300049161 Bacteria 2481
864 Ga0495678_000591 3300049459 Bacteria 34139
865 Ga0495678_014148 3300049459 Bacteria 3717
866 Ga0495682_0000001 3300049460 Bacteria 1559116
867 Ga0501315_012408 3300049531 Bacteria 1054
868 Ga0501323_000094 3300049539 Bacteria 4699
869 Ga0501031_0003536 3300049568 Bacteria 10030
870 Ga0501031_0019137 3300049568 Bacteria 4457
871 Ga0501032_0007698 3300049569 Bacteria 7853
872 Ga0501032_0192352 3300049569 Bacteria 1333
873 Ga0501033_0000199 3300049570 Bacteria 57341
874 Ga0501034_0000506 3300049571 Bacteria 62858
875 Ga0501034_0066200 3300049571 Bacteria 3626
876 Ga0501034_0376554 3300049571 Bacteria 1345
877 Ga0501036_0017191 3300049572 Bacteria 6046
878 Ga0501036_0087559 3300049572 Bacteria 2632
879 Ga0501037_0012707 3300049573 Bacteria 6201
880 Ga0501037_0023483 3300049573 Bacteria 4560
881 Ga0501038_0004083 3300049574 Bacteria 13581
882 Ga0501038_0072829 3300049574 Bacteria 2910
883 Ga0501039_0002895 3300049575 Bacteria 12839
884 Ga0501039_0108703 3300049575 Bacteria 2167
885 Ga0501043_0008259 3300049579 Bacteria 8202
886 Ga0501043_0023673 3300049579 Bacteria 4816
887 Ga0501043_0249241 3300049579 Bacteria 1368
888 Ga0501046_0020279 3300049580 Bacteria 5501
889 Ga0501047_0072084 3300049581 Bacteria 3325
890 Ga0501047_0171986 3300049581 Bacteria 2035
891 Ga0501069_0063534 3300049585 Bacteria 2062
892 Ga0501072_0308475 3300049588 Bacteria 1258
893 Ga0501199_002418 3300049650 Bacteria 1745
894 Ga0501207_020946 3300049654 Bacteria 1047
895 Ga0501238_004979 3300049671 Bacteria 1674
896 Ga0501257_011545 3300049686 Bacteria 2017
897 Ga0501264_000987 3300049761 Bacteria 3465
898 Ga0501035_0001435 3300049822 Bacteria 24437
899 Ga0501035_0079391 3300049822 Bacteria 2899
900 Ga0501044_0005001 3300049823 Bacteria 14799
901 Ga0501044_0032991 3300049823 Bacteria 5442
902 Ga0501044_0040028 3300049823 Bacteria 4887
903 Ga0501044_0235991 3300049823 Bacteria 1774
904 Ga0501045_0000745 3300049824 Bacteria 20812
905 Ga0501226_008295 3300049853 Bacteria 1160
906 nmdc:mga00v17_159762_c1 3300050491 Bacteria 1450
907 nmdc:mga00v17_177317_c1 3300050491 Bacteria 1375
908 nmdc:mga0k408_1666_c3 3300050493 Bacteria 3919
909 nmdc:mga05p37_106817_c1 3300050507 Bacteria 3444
910 nmdc:mga05p37_202163_c1 3300050507 Bacteria 2405
911 nmdc:mga09592_61110_c1 3300050508 Bacteria 3186
912 nmdc:mga06r32_13230_c1 3300050510 Bacteria 7472
913 Ga0495601_0094389 3300053077 Bacteria 1928
914 Ga0500578_0000919 3300053086 Bacteria 33045
915 Ga0500621_000003 3300053126 Bacteria 596975
916 Ga0500642_0081867 3300053130 Bacteria 1484
917 Ga0500568_0031940 3300053139 Bacteria 2168
918 Ga0500588_0005614 3300053146 Bacteria 2796
919 Ga0500616_0037732 3300053153 Bacteria 2614
920 Ga0500616_0046016 3300053153 Bacteria 2321
921 Ga0500622_0002124 3300053156 Bacteria 14761
922 Ga0500636_0110383 3300053177 Bacteria 1555

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036712 Ga0316584_0373164 Ga0316584_0373164_275_967 226
2 3300044712 Ga0453684_0104488 Ga0453684_0104488_447_1196 227
3 3300003316 rootH1_10003827 rootH1_100038278 231
4 3300003322 rootL2_10037931 rootL2_100379313 231
5 3300003323 rootH1_10005693 rootH1_1000569311 231
6 3300003323 rootH1_10018400 rootH1_100184008 231
7 3300003323 rootH1_10120495 rootH1_101204954 231
8 3300005548 Ga0070665_100123066 Ga0070665_1001230661 232
9 3300053139 Ga0500568_0031940 Ga0500568_0031940_1230_1985 232
10 3300053153 Ga0500616_0037732 Ga0500616_0037732_691_1449 232
11 3300041405 Ga0439438_000780 Ga0439438_000780_5546_6250 234
12 3300053130 Ga0500642_0081867 Ga0500642_0081867_243_998 235
13 3300005539 Ga0068853_100409270 Ga0068853_1004092701 238
14 3300047470 Ga0495681_0092896 Ga0495681_0092896_333_1058 241
15 iso_pu_bacteria 2738541278 2738729116 243
16 iso_pu_bacteria 2818991444 2819587191 243
17 iso_pu_bacteria 2833640130 2833641385 243
18 iso_pu_bacteria 2881247448 2881248947 243
19 iso_pu_bacteria 2911138879 2911140585 243
20 iso_pu_bacteria 8055097453 8055099871 243
21 iso_pu_bacteria 2506520007 2506578190 244
22 iso_pu_bacteria 2506520008 2506583328 244
23 iso_pu_bacteria 2508501071 2508852207 244
24 iso_pu_bacteria 2511231025 2511378921 244
25 iso_pu_bacteria 2511231035 2511437154 244
26 iso_pu_bacteria 2537561728 2538425773 244
27 iso_pu_bacteria 2547132181 2547695172 244
28 iso_pu_bacteria 2547132416 2548648354 244
29 iso_pu_bacteria 2554235234 2555257426 244
30 iso_pu_bacteria 2561511199 2562462966 244
31 iso_pu_bacteria 2585427591 2585825447 244
32 iso_pu_bacteria 2585427592 2585832071 244
33 iso_pu_bacteria 2599185169 2599408927 244
34 iso_pu_bacteria 2599185299 2599925465 244
35 iso_pu_bacteria 2600255254 2601522556 244
36 iso_pu_bacteria 2600255255 2601527583 244
37 iso_pu_bacteria 2600255256 2601535280 244
38 iso_pu_bacteria 2600255257 2601540843 244
39 iso_pu_bacteria 2600255280 2601614414 244
40 iso_pu_bacteria 2600255281 2601619134 244
41 iso_pu_bacteria 2600255287 2601642246 244
42 iso_pu_bacteria 2600255288 2601647108 244
43 iso_pu_bacteria 2600255289 2601652561 244
44 iso_pu_bacteria 2600255290 2601657887 244
45 iso_pu_bacteria 2600255291 2601662069 244
46 iso_pu_bacteria 2600255298 2601695027 244
47 iso_pu_bacteria 2600255299 2601699699 244
48 iso_pu_bacteria 2600255300 2601706406 244
49 iso_pu_bacteria 2600255301 2601710712 244
50 iso_pu_bacteria 2600255302 2601715726 244
51 iso_pu_bacteria 2600255303 2601720050 244
52 iso_pu_bacteria 2600255304 2601726132 244
53 iso_pu_bacteria 2600255305 2601730673 244
54 iso_pu_bacteria 2600255306 2601735689 244
55 iso_pu_bacteria 2600255307 2601740957 244
56 iso_pu_bacteria 2600255309 2601750887 244
57 iso_pu_bacteria 2600255310 2601758462 244
58 iso_pu_bacteria 2600255311 2601764572 244
59 iso_pu_bacteria 2600255392 2602018141 244
60 iso_pu_bacteria 2602042046 2603638185 244
61 iso_pu_bacteria 2602042047 2603642693 244
62 iso_pu_bacteria 2602042052 2603659431 244
63 iso_pu_bacteria 2602042053 2603664706 244
64 iso_pu_bacteria 2602042066 2603698263 244
65 iso_pu_bacteria 2602042067 2603703283 244
66 iso_pu_bacteria 2602042103 2603838065 244
67 iso_pu_bacteria 2602042104 2603843143 244
68 iso_pu_bacteria 2602042105 2603848216 244
69 iso_pu_bacteria 2602042106 2603853291 244
70 iso_pu_bacteria 2602042109 2603867235 244
71 iso_pu_bacteria 2602042110 2603871342 244
72 iso_pu_bacteria 2602042111 2603876273 244
73 iso_pu_bacteria 2603880178 2606048535 244
74 iso_pu_bacteria 2603880184 2606069133 244
75 iso_pu_bacteria 2603880202 2606144955 244
76 iso_pu_bacteria 2603880211 2606175936 244
77 iso_pu_bacteria 2608642108 2608669280 244
78 iso_pu_bacteria 2609459761 2609913477 244
79 iso_pu_bacteria 2636415599 2637224798 244
80 iso_pu_bacteria 2648501693 2650898800 244
81 iso_pu_bacteria 2654587920 2656275236 244
82 iso_pu_bacteria 2667528172 2671103220 244
83 iso_pu_bacteria 2667528173 2671109826 244
84 iso_pu_bacteria 2671180115 2671588313 244
85 iso_pu_bacteria 2675903046 2676406067 244
86 iso_pu_bacteria 2681812866 2681997633 244
87 iso_pu_bacteria 2681812869 2682006845 244
88 iso_pu_bacteria 2684622997 2686353184 244
89 iso_pu_bacteria 2687453601 2689444740 244
90 iso_pu_bacteria 2711768156 2712469818 244
91 iso_pu_bacteria 2751185917 2753855711 244
92 iso_pu_bacteria 2765235842 2765588704 244
93 iso_pu_bacteria 2772190666 2772438794 244
94 iso_pu_bacteria 2775506706 2775538711 244
95 iso_pu_bacteria 2775507074 2777022177 244
96 iso_pu_bacteria 2791354903 2791922472 244
97 iso_pu_bacteria 2791355010 2792314818 244
98 iso_pu_bacteria 2791355275 2793405753 244
99 iso_pu_bacteria 2806310673 2807179446 244
100 iso_pu_bacteria 2808606414 2809123765 244
101 iso_pu_bacteria 2811995292 2813729161 244
102 iso_pu_bacteria 2814123068 2814696727 244
103 iso_pu_bacteria 2821118458 2821119517 244
104 iso_pu_bacteria 2823373977 2823374493 244
105 iso_pu_bacteria 2844425489 2844427263 244
106 iso_pu_bacteria 2844528606 2844530817 244
107 iso_pu_bacteria 2846540461 2846544407 244
108 iso_pu_bacteria 2847085930 2847087812 244
109 iso_pu_bacteria 2847797336 2847800037 244
110 iso_pu_bacteria 2852103415 2852107781 244
111 iso_pu_bacteria 2855195626 2855195969 244
112 iso_pu_bacteria 2858466076 2858468945 244
113 iso_pu_bacteria 2865014394 2865015106 244
114 iso_pu_bacteria 2869551831 2869554140 244
115 iso_pu_bacteria 2871272651 2871272756 244
116 iso_pu_bacteria 2871282230 2871286326 244
117 iso_pu_bacteria 2876601092 2876604395 244
118 iso_pu_bacteria 2881609920 2881610077 244
119 iso_pu_bacteria 2884086401 2884089084 244
120 iso_pu_bacteria 2888366609 2888368815 244
121 iso_pu_bacteria 2888373701 2888378483 244
122 iso_pu_bacteria 2891670763 2891672933 244
123 iso_pu_bacteria 2900051742 2900052697 244
124 iso_pu_bacteria 2904474040 2904478177 244
125 iso_pu_bacteria 2904504865 2904504985 244
126 iso_pu_bacteria 2904513164 2904514314 244
127 iso_pu_bacteria 2908669403 2908670036 244
128 iso_pu_bacteria 2919108558 2919108622 244
129 iso_pu_bacteria 2919150387 2919155305 244
130 iso_pu_bacteria 2923634449 2923634584 244
131 iso_pu_bacteria 2927143783 2927147983 244
132 iso_pu_bacteria 2927833300 2927834367 244
133 iso_pu_bacteria 2932406140 2932408198 244
134 iso_pu_bacteria 2935625433 2935626900 244
135 iso_pu_bacteria 2937539931 2937540290 244
136 iso_pu_bacteria 2937967321 2937967408 244
137 iso_pu_bacteria 2939568625 2939568908 244
138 iso_pu_bacteria 2939573065 2939573836 244
139 iso_pu_bacteria 2939577877 2939578655 244
140 iso_pu_bacteria 2939602548 2939603466 244
141 iso_pu_bacteria 2939607340 2939607716 244
142 iso_pu_bacteria 2939617950 2939619357 244
143 iso_pu_bacteria 2939642701 2939644045 244
144 iso_pu_bacteria 2945874760 2945877464 244
145 iso_pu_bacteria 2945951305 2945953151 244
146 iso_pu_bacteria 2969079654 2969081778 244
147 iso_pu_bacteria 2971820967 2971823190 244
148 iso_pu_bacteria 2974310843 2974312377 244
149 iso_pu_bacteria 2974435778 2974438234 244
150 iso_pu_bacteria 2978975091 2978975674 244
151 iso_pu_bacteria 2984494565 2984496469 244
152 iso_pu_bacteria 2984559226 2984564203 244
153 iso_pu_bacteria 2984595703 2984596938 244
154 iso_pu_bacteria 2990261002 2990261890 244
155 iso_pu_bacteria 3000376612 3000378722 244
156 iso_pu_bacteria 640753048 640937717 244
157 iso_pu_bacteria 8004592986 8004595702 244
158 iso_pu_bacteria 8015394850 8015396362 244
159 iso_pu_bacteria 8016733728 8016736079 244
160 iso_pu_bacteria 8018221730 8018222313 244
161 iso_pu_bacteria 8018405270 8018408406 244
162 iso_pu_bacteria 8019499862 8019502824 244
163 iso_pu_bacteria 8019504834 8019506241 244
164 iso_pu_bacteria 8054844752 8054845640 244
165 iso_pu_bacteria 8054849141 8054853018 244
166 iso_pu_bacteria 8055087960 8055091037 244
167 iso_pu_bacteria 8055092621 8055094458 244
168 iso_pu_bacteria 8057304971 8057309464 244
169 3300041456 Ga0451795_0027072 Ga0451795_0027072_1756_2499 245
170 3300005366 Ga0070659_100016158 Ga0070659_1000161582 246
171 3300009094 Ga0111539_10171523 Ga0111539_101715232 246
172 3300025949 Ga0207667_10130253 Ga0207667_101302533 246
173 3300028800 Ga0265338_10022306 Ga0265338_100223063 246
174 3300031247 Ga0265340_10006768 Ga0265340_100067685 246
175 3300044712 Ga0453684_0023018 Ga0453684_0023018_3792_4547 246
176 3300045051 Ga0451576_1038951 Ga0451576_1038951_43_798 246
177 3300003316 rootH1_10032207 rootH1_100322072 247
178 3300003323 rootH1_10091743 rootH1_100917432 247
179 3300003794 Ga0055531_10000087 Ga0055531_1000008734 247
180 3300005288 Ga0065714_10086305 Ga0065714_100863052 247
181 3300005290 Ga0065712_10079171 Ga0065712_100791712 247
182 3300005327 Ga0070658_10188664 Ga0070658_101886642 247
183 3300005328 Ga0070676_10016642 Ga0070676_100166423 247
184 3300005328 Ga0070676_10210624 Ga0070676_102106241 247
185 3300005329 Ga0070683_100001617 Ga0070683_10000161710 247
186 3300005329 Ga0070683_100002162 Ga0070683_10000216210 247
187 3300005329 Ga0070683_100057546 Ga0070683_1000575462 247
188 3300005329 Ga0070683_100234185 Ga0070683_1002341851 247
189 3300005330 Ga0070690_100103651 Ga0070690_1001036512 247
190 3300005330 Ga0070690_100585778 Ga0070690_1005857781 247
191 3300005331 Ga0070670_100084846 Ga0070670_1000848462 247
192 3300005331 Ga0070670_100130580 Ga0070670_1001305802 247
193 3300005331 Ga0070670_100334396 Ga0070670_1003343962 247
194 3300005334 Ga0068869_100002709 Ga0068869_10000270912 247
195 3300005334 Ga0068869_100010369 Ga0068869_1000103692 247
196 3300005334 Ga0068869_100017858 Ga0068869_1000178581 247
197 3300005334 Ga0068869_100043183 Ga0068869_1000431832 247
198 3300005334 Ga0068869_100144321 Ga0068869_1001443211 247
199 3300005335 Ga0070666_10000031 Ga0070666_1000003184 247
200 3300005335 Ga0070666_10009553 Ga0070666_100095532 247
201 3300005335 Ga0070666_10417803 Ga0070666_104178031 247
202 3300005336 Ga0070680_100001731 Ga0070680_1000017312 247
203 3300005337 Ga0070682_100001468 Ga0070682_1000014682 247
204 3300005338 Ga0068868_100007514 Ga0068868_1000075143 247
205 3300005338 Ga0068868_100033134 Ga0068868_1000331343 247
206 3300005338 Ga0068868_100043882 Ga0068868_1000438823 247
207 3300005338 Ga0068868_100054588 Ga0068868_1000545883 247
208 3300005338 Ga0068868_100079649 Ga0068868_1000796492 247
209 3300005339 Ga0070660_100144238 Ga0070660_1001442382 247
210 3300005339 Ga0070660_100193236 Ga0070660_1001932362 247
211 3300005341 Ga0070691_10034684 Ga0070691_100346842 247
212 3300005344 Ga0070661_100001586 Ga0070661_1000015864 247
213 3300005347 Ga0070668_100115638 Ga0070668_1001156382 247
214 3300005353 Ga0070669_100224023 Ga0070669_1002240232 247
215 3300005353 Ga0070669_100497565 Ga0070669_1004975651 247
216 3300005354 Ga0070675_100057888 Ga0070675_1000578882 247
217 3300005355 Ga0070671_100193397 Ga0070671_1001933971 247
218 3300005355 Ga0070671_100233095 Ga0070671_1002330952 247
219 3300005355 Ga0070671_100427751 Ga0070671_1004277512 247
220 3300005356 Ga0070674_100079535 Ga0070674_1000795352 247
221 3300005356 Ga0070674_100313810 Ga0070674_1003138102 247
222 3300005364 Ga0070673_100201735 Ga0070673_1002017352 247
223 3300005364 Ga0070673_100362119 Ga0070673_1003621192 247
224 3300005364 Ga0070673_100445067 Ga0070673_1004450671 247
225 3300005364 Ga0070673_100770317 Ga0070673_1007703171 247
226 3300005365 Ga0070688_100009950 Ga0070688_1000099506 247
227 3300005365 Ga0070688_100069908 Ga0070688_1000699082 247
228 3300005366 Ga0070659_100012249 Ga0070659_1000122492 247
229 3300005366 Ga0070659_100037542 Ga0070659_1000375421 247
230 3300005366 Ga0070659_100186550 Ga0070659_1001865502 247
231 3300005366 Ga0070659_100207224 Ga0070659_1002072242 247
232 3300005367 Ga0070667_100046365 Ga0070667_1000463653 247
233 3300005367 Ga0070667_100708258 Ga0070667_1007082581 247
234 3300005436 Ga0070713_100163466 Ga0070713_1001634662 247
235 3300005456 Ga0070678_100051008 Ga0070678_1000510083 247
236 3300005456 Ga0070678_100057426 Ga0070678_1000574262 247
237 3300005457 Ga0070662_100024310 Ga0070662_1000243102 247
238 3300005457 Ga0070662_100028844 Ga0070662_1000288443 247
239 3300005457 Ga0070662_100032828 Ga0070662_1000328283 247
240 3300005457 Ga0070662_100094369 Ga0070662_1000943692 247
241 3300005457 Ga0070662_100593419 Ga0070662_1005934191 247
242 3300005459 Ga0068867_100194794 Ga0068867_1001947942 247
243 3300005459 Ga0068867_100468326 Ga0068867_1004683261 247
244 3300005466 Ga0070685_10005488 Ga0070685_100054883 247
245 3300005530 Ga0070679_100014552 Ga0070679_1000145526 247
246 3300005535 Ga0070684_100022943 Ga0070684_1000229432 247
247 3300005535 Ga0070684_100833454 Ga0070684_1008334541 247
248 3300005539 Ga0068853_100004621 Ga0068853_1000046217 247
249 3300005539 Ga0068853_100052273 Ga0068853_1000522733 247
250 3300005539 Ga0068853_100065389 Ga0068853_1000653893 247
251 3300005539 Ga0068853_100211933 Ga0068853_1002119332 247
252 3300005539 Ga0068853_100724119 Ga0068853_1007241191 247
253 3300005543 Ga0070672_100101886 Ga0070672_1001018862 247
254 3300005543 Ga0070672_100457001 Ga0070672_1004570012 247
255 3300005547 Ga0070693_100028255 Ga0070693_1000282553 247
256 3300005547 Ga0070693_100064846 Ga0070693_1000648462 247
257 3300005548 Ga0070665_100121491 Ga0070665_1001214913 247
258 3300005548 Ga0070665_100224624 Ga0070665_1002246242 247
259 3300005549 Ga0070704_100417679 Ga0070704_1004176791 247
260 3300005563 Ga0068855_100020960 Ga0068855_1000209602 247
261 3300005563 Ga0068855_100290088 Ga0068855_1002900882 247
262 3300005564 Ga0070664_100003065 Ga0070664_10000306511 247
263 3300005564 Ga0070664_100003911 Ga0070664_1000039113 247
264 3300005564 Ga0070664_100036401 Ga0070664_1000364015 247
265 3300005564 Ga0070664_100045037 Ga0070664_1000450372 247
266 3300005564 Ga0070664_100046767 Ga0070664_1000467673 247
267 3300005564 Ga0070664_100124501 Ga0070664_1001245012 247
268 3300005564 Ga0070664_100330431 Ga0070664_1003304311 247
269 3300005577 Ga0068857_100052473 Ga0068857_1000524733 247
270 3300005577 Ga0068857_100228405 Ga0068857_1002284052 247
271 3300005577 Ga0068857_100900642 Ga0068857_1009006421 247
272 3300005578 Ga0068854_100057524 Ga0068854_1000575243 247
273 3300005578 Ga0068854_100178465 Ga0068854_1001784652 247
274 3300005578 Ga0068854_100346939 Ga0068854_1003469391 247
275 3300005615 Ga0070702_100227063 Ga0070702_1002270631 247
276 3300005616 Ga0068852_100009516 Ga0068852_1000095166 247
277 3300005616 Ga0068852_100038782 Ga0068852_1000387822 247
278 3300005616 Ga0068852_100045464 Ga0068852_1000454644 247
279 3300005616 Ga0068852_100082650 Ga0068852_1000826502 247
280 3300005617 Ga0068859_100000045 Ga0068859_10000004552 247
281 3300005617 Ga0068859_100086353 Ga0068859_1000863532 247
282 3300005617 Ga0068859_100107186 Ga0068859_1001071862 247
283 3300005617 Ga0068859_100198675 Ga0068859_1001986752 247
284 3300005617 Ga0068859_100491051 Ga0068859_1004910512 247
285 3300005618 Ga0068864_100046141 Ga0068864_1000461414 247
286 3300005618 Ga0068864_100056094 Ga0068864_1000560942 247
287 3300005618 Ga0068864_100064644 Ga0068864_1000646443 247
288 3300005618 Ga0068864_100233016 Ga0068864_1002330162 247
289 3300005618 Ga0068864_100531215 Ga0068864_1005312152 247
290 3300005718 Ga0068866_10024317 Ga0068866_100243171 247
291 3300005718 Ga0068866_10298216 Ga0068866_102982162 247
292 3300005719 Ga0068861_100033570 Ga0068861_1000335703 247
293 3300005834 Ga0068851_10023513 Ga0068851_100235133 247
294 3300005841 Ga0068863_100002071 Ga0068863_10000207119 247
295 3300005841 Ga0068863_100013056 Ga0068863_1000130565 247
296 3300005841 Ga0068863_100162903 Ga0068863_1001629032 247
297 3300005842 Ga0068858_100002469 Ga0068858_1000024694 247
298 3300005842 Ga0068858_100054897 Ga0068858_1000548972 247
299 3300005843 Ga0068860_100004776 Ga0068860_10000477612 247
300 3300005843 Ga0068860_100058267 Ga0068860_1000582674 247
301 3300005843 Ga0068860_100268699 Ga0068860_1002686992 247
302 3300005843 Ga0068860_100422375 Ga0068860_1004223751 247
303 3300005844 Ga0068862_100216931 Ga0068862_1002169312 247
304 3300006163 Ga0070715_10024227 Ga0070715_100242272 247
305 3300006237 Ga0097621_100003567 Ga0097621_1000035678 247
306 3300006237 Ga0097621_100022063 Ga0097621_1000220633 247
307 3300006237 Ga0097621_100126339 Ga0097621_1001263392 247
308 3300006237 Ga0097621_100212845 Ga0097621_1002128452 247
309 3300006237 Ga0097621_100464888 Ga0097621_1004648881 247
310 3300006237 Ga0097621_100698364 Ga0097621_1006983641 247
311 3300006358 Ga0068871_100047223 Ga0068871_1000472233 247
312 3300006358 Ga0068871_100157398 Ga0068871_1001573982 247
313 3300006358 Ga0068871_100553513 Ga0068871_1005535131 247
314 3300006844 Ga0075428_100097302 Ga0075428_1000973022 247
315 3300006847 Ga0075431_100005705 Ga0075431_10000570510 247
316 3300006880 Ga0075429_100015656 Ga0075429_1000156566 247
317 3300006881 Ga0068865_100131123 Ga0068865_1001311232 247
318 3300006881 Ga0068865_100610952 Ga0068865_1006109521 247
319 3300006931 Ga0097620_100000045 Ga0097620_10000004589 247
320 3300006931 Ga0097620_100086354 Ga0097620_1000863542 247
321 3300006931 Ga0097620_100107183 Ga0097620_1001071832 247
322 3300006931 Ga0097620_100198669 Ga0097620_1001986691 247
323 3300006931 Ga0097620_100483806 Ga0097620_1004838062 247
324 3300006931 Ga0097620_100491040 Ga0097620_1004910402 247
325 3300009093 Ga0105240_10000859 Ga0105240_1000085946 247
326 3300009093 Ga0105240_10016428 Ga0105240_100164289 247
327 3300009147 Ga0114129_10025420 Ga0114129_100254208 247
328 3300009174 Ga0105241_10000591 Ga0105241_100005919 247
329 3300009174 Ga0105241_10027307 Ga0105241_100273074 247
330 3300009174 Ga0105241_10155556 Ga0105241_101555562 247
331 3300009174 Ga0105241_10237075 Ga0105241_102370752 247
332 3300009174 Ga0105241_10243849 Ga0105241_102438492 247
333 3300009176 Ga0105242_10064347 Ga0105242_100643472 247
334 3300009176 Ga0105242_10152313 Ga0105242_101523131 247
335 3300009177 Ga0105248_10316285 Ga0105248_103162852 247
336 3300009177 Ga0105248_10686998 Ga0105248_106869982 247
337 3300009545 Ga0105237_10002015 Ga0105237_1000201519 247
338 3300009545 Ga0105237_10137985 Ga0105237_101379852 247
339 3300009545 Ga0105237_10355448 Ga0105237_103554482 247
340 3300009551 Ga0105238_10507117 Ga0105238_105071171 247
341 3300009553 Ga0105249_10000870 Ga0105249_1000087024 247
342 3300009553 Ga0105249_10257618 Ga0105249_102576182 247
343 3300009553 Ga0105249_10684109 Ga0105249_106841092 247
344 3300010375 Ga0105239_10347780 Ga0105239_103477802 247
345 3300010375 Ga0105239_10607058 Ga0105239_106070582 247
346 3300011119 Ga0105246_10037568 Ga0105246_100375682 247
347 3300011119 Ga0105246_10076809 Ga0105246_100768092 247
348 3300013100 Ga0157373_10188835 Ga0157373_101888352 247
349 3300013102 Ga0157371_10020580 Ga0157371_100205803 247
350 3300013102 Ga0157371_10025659 Ga0157371_100256592 247
351 3300013102 Ga0157371_10085380 Ga0157371_100853803 247
352 3300013104 Ga0157370_10004098 Ga0157370_100040983 247
353 3300013104 Ga0157370_10059676 Ga0157370_100596762 247
354 3300013104 Ga0157370_10202539 Ga0157370_102025392 247
355 3300013104 Ga0157370_10267333 Ga0157370_102673332 247
356 3300013104 Ga0157370_10391271 Ga0157370_103912711 247
357 3300013105 Ga0157369_10062171 Ga0157369_100621713 247
358 3300013105 Ga0157369_10171903 Ga0157369_101719033 247
359 3300013105 Ga0157369_10298718 Ga0157369_102987182 247
360 3300013296 Ga0157374_10000607 Ga0157374_1000060718 247
361 3300013296 Ga0157374_10003134 Ga0157374_100031349 247
362 3300013296 Ga0157374_10021708 Ga0157374_100217083 247
363 3300013296 Ga0157374_10079115 Ga0157374_100791152 247
364 3300013296 Ga0157374_10317926 Ga0157374_103179261 247
365 3300013296 Ga0157374_10437749 Ga0157374_104377492 247
366 3300013297 Ga0157378_10006056 Ga0157378_100060563 247
367 3300013297 Ga0157378_10006383 Ga0157378_100063836 247
368 3300013297 Ga0157378_10037001 Ga0157378_100370013 247
369 3300013297 Ga0157378_10044926 Ga0157378_100449262 247
370 3300013297 Ga0157378_10350813 Ga0157378_103508132 247
371 3300013306 Ga0163162_10002494 Ga0163162_100024949 247
372 3300013306 Ga0163162_10021357 Ga0163162_100213572 247
373 3300013306 Ga0163162_10132924 Ga0163162_101329242 247
374 3300013306 Ga0163162_10195546 Ga0163162_101955462 247
375 3300013307 Ga0157372_10108661 Ga0157372_101086613 247
376 3300013307 Ga0157372_10144319 Ga0157372_101443192 247
377 3300013307 Ga0157372_10282713 Ga0157372_102827131 247
378 3300013307 Ga0157372_10284671 Ga0157372_102846712 247
379 3300013307 Ga0157372_10372592 Ga0157372_103725922 247
380 3300013307 Ga0157372_10572863 Ga0157372_105728632 247
381 3300013307 Ga0157372_10803964 Ga0157372_108039642 247
382 3300013307 Ga0157372_10975451 Ga0157372_109754512 247
383 3300013308 Ga0157375_10010451 Ga0157375_100104514 247
384 3300013308 Ga0157375_10016076 Ga0157375_100160769 247
385 3300013308 Ga0157375_10022934 Ga0157375_100229342 247
386 3300013308 Ga0157375_10036441 Ga0157375_100364414 247
387 3300013308 Ga0157375_10188032 Ga0157375_101880321 247
388 3300013308 Ga0157375_10194138 Ga0157375_101941382 247
389 3300014325 Ga0163163_10000078 Ga0163163_1000007829 247
390 3300014325 Ga0163163_10000266 Ga0163163_1000026620 247
391 3300014325 Ga0163163_10016683 Ga0163163_100166833 247
392 3300014325 Ga0163163_10057979 Ga0163163_100579792 247
393 3300014325 Ga0163163_10155883 Ga0163163_101558832 247
394 3300014325 Ga0163163_10233170 Ga0163163_102331702 247
395 3300014326 Ga0157380_10000704 Ga0157380_1000070414 247
396 3300014326 Ga0157380_10013755 Ga0157380_100137553 247
397 3300014326 Ga0157380_10165053 Ga0157380_101650532 247
398 3300014326 Ga0157380_10470941 Ga0157380_104709412 247
399 3300014745 Ga0157377_10023420 Ga0157377_100234202 247
400 3300014745 Ga0157377_10073178 Ga0157377_100731783 247
401 3300014968 Ga0157379_10397977 Ga0157379_103979771 247
402 3300014969 Ga0157376_10057433 Ga0157376_100574332 247
403 3300014969 Ga0157376_10090091 Ga0157376_100900912 247
404 3300014969 Ga0157376_10117263 Ga0157376_101172632 247
405 3300014969 Ga0157376_10328331 Ga0157376_103283311 247
406 3300014969 Ga0157376_10421650 Ga0157376_104216501 247
407 3300017792 Ga0163161_10114482 Ga0163161_101144822 247
408 3300017792 Ga0163161_10211080 Ga0163161_102110802 247
409 3300020077 Ga0206351_10347196 Ga0206351_103471962 247
410 3300022467 Ga0224712_10176051 Ga0224712_101760511 247
411 3300025304 Ga0209257_1000006 Ga0209257_1000006359 247
412 3300025321 Ga0207656_10001167 Ga0207656_100011672 247
413 3300025321 Ga0207656_10145007 Ga0207656_101450072 247
414 3300025893 Ga0207682_10013296 Ga0207682_100132962 247
415 3300025899 Ga0207642_10110967 Ga0207642_101109672 247
416 3300025900 Ga0207710_10039366 Ga0207710_100393662 247
417 3300025901 Ga0207688_10019542 Ga0207688_100195423 247
418 3300025901 Ga0207688_10087378 Ga0207688_100873782 247
419 3300025903 Ga0207680_10000627 Ga0207680_100006271 247
420 3300025903 Ga0207680_10413530 Ga0207680_104135301 247
421 3300025904 Ga0207647_10000951 Ga0207647_100009515 247
422 3300025905 Ga0207685_10248628 Ga0207685_102486281 247
423 3300025907 Ga0207645_10000263 Ga0207645_1000026339 247
424 3300025907 Ga0207645_10211058 Ga0207645_102110582 247
425 3300025908 Ga0207643_10009659 Ga0207643_100096593 247
426 3300025908 Ga0207643_10115001 Ga0207643_101150012 247
427 3300025909 Ga0207705_10215007 Ga0207705_102150072 247
428 3300025909 Ga0207705_10559955 Ga0207705_105599551 247
429 3300025911 Ga0207654_10002808 Ga0207654_1000280810 247
430 3300025911 Ga0207654_10165487 Ga0207654_101654872 247
431 3300025911 Ga0207654_10263986 Ga0207654_102639862 247
432 3300025911 Ga0207654_10373532 Ga0207654_103735321 247
433 3300025912 Ga0207707_10001133 Ga0207707_1000113320 247
434 3300025913 Ga0207695_10000697 Ga0207695_1000069715 247
435 3300025913 Ga0207695_10149398 Ga0207695_101493983 247
436 3300025914 Ga0207671_10001627 Ga0207671_1000162718 247
437 3300025919 Ga0207657_10057255 Ga0207657_100572552 247
438 3300025919 Ga0207657_10186973 Ga0207657_101869732 247
439 3300025923 Ga0207681_10298752 Ga0207681_102987521 247
440 3300025924 Ga0207694_10360978 Ga0207694_103609782 247
441 3300025925 Ga0207650_10010602 Ga0207650_100106025 247
442 3300025925 Ga0207650_10012259 Ga0207650_100122595 247
443 3300025925 Ga0207650_10095777 Ga0207650_100957771 247
444 3300025926 Ga0207659_10081239 Ga0207659_100812392 247
445 3300025931 Ga0207644_10146786 Ga0207644_101467861 247
446 3300025931 Ga0207644_10510666 Ga0207644_105106661 247
447 3300025932 Ga0207690_10007814 Ga0207690_100078142 247
448 3300025932 Ga0207690_10041973 Ga0207690_100419733 247
449 3300025933 Ga0207706_10028711 Ga0207706_100287113 247
450 3300025933 Ga0207706_10036759 Ga0207706_100367592 247
451 3300025933 Ga0207706_10061454 Ga0207706_100614543 247
452 3300025933 Ga0207706_10175285 Ga0207706_101752852 247
453 3300025934 Ga0207686_10183326 Ga0207686_101833261 247
454 3300025936 Ga0207670_10242954 Ga0207670_102429542 247
455 3300025936 Ga0207670_10266294 Ga0207670_102662942 247
456 3300025937 Ga0207669_10208796 Ga0207669_102087961 247
457 3300025938 Ga0207704_10412162 Ga0207704_104121621 247
458 3300025940 Ga0207691_10124593 Ga0207691_101245932 247
459 3300025940 Ga0207691_10146860 Ga0207691_101468602 247
460 3300025940 Ga0207691_10490483 Ga0207691_104904831 247
461 3300025941 Ga0207711_10433756 Ga0207711_104337562 247
462 3300025942 Ga0207689_10000740 Ga0207689_1000074023 247
463 3300025942 Ga0207689_10001881 Ga0207689_1000188110 247
464 3300025942 Ga0207689_10004215 Ga0207689_1000421513 247
465 3300025942 Ga0207689_10004731 Ga0207689_1000473110 247
466 3300025942 Ga0207689_10008743 Ga0207689_100087432 247
467 3300025942 Ga0207689_10156765 Ga0207689_101567652 247
468 3300025944 Ga0207661_10002099 Ga0207661_100020998 247
469 3300025944 Ga0207661_10076603 Ga0207661_100766032 247
470 3300025944 Ga0207661_10116912 Ga0207661_101169122 247
471 3300025944 Ga0207661_10197014 Ga0207661_101970142 247
472 3300025944 Ga0207661_10707570 Ga0207661_107075701 247
473 3300025945 Ga0207679_10004222 Ga0207679_100042224 247
474 3300025945 Ga0207679_10006055 Ga0207679_100060551 247
475 3300025945 Ga0207679_10056047 Ga0207679_100560473 247
476 3300025945 Ga0207679_10121017 Ga0207679_101210172 247
477 3300025945 Ga0207679_10346529 Ga0207679_103465291 247
478 3300025949 Ga0207667_10074165 Ga0207667_100741656 247
479 3300025949 Ga0207667_10140052 Ga0207667_101400523 247
480 3300025949 Ga0207667_10189282 Ga0207667_101892822 247
481 3300025960 Ga0207651_10148948 Ga0207651_101489482 247
482 3300025960 Ga0207651_10231980 Ga0207651_102319802 247
483 3300025961 Ga0207712_10004692 Ga0207712_100046928 247
484 3300025961 Ga0207712_10305212 Ga0207712_103052122 247
485 3300025972 Ga0207668_10116960 Ga0207668_101169602 247
486 3300025981 Ga0207640_10129225 Ga0207640_101292252 247
487 3300025986 Ga0207658_10069120 Ga0207658_100691202 247
488 3300025986 Ga0207658_10466273 Ga0207658_104662732 247
489 3300026023 Ga0207677_10042463 Ga0207677_100424631 247
490 3300026023 Ga0207677_10084549 Ga0207677_100845491 247
491 3300026023 Ga0207677_10376986 Ga0207677_103769862 247
492 3300026035 Ga0207703_10003137 Ga0207703_1000313713 247
493 3300026035 Ga0207703_10242993 Ga0207703_102429932 247
494 3300026035 Ga0207703_10379941 Ga0207703_103799412 247
495 3300026041 Ga0207639_10013711 Ga0207639_100137114 247
496 3300026088 Ga0207641_10000146 Ga0207641_1000014647 247
497 3300026088 Ga0207641_10004565 Ga0207641_100045653 247
498 3300026088 Ga0207641_10023870 Ga0207641_100238707 247
499 3300026088 Ga0207641_10132465 Ga0207641_101324652 247
500 3300026088 Ga0207641_10538102 Ga0207641_105381022 247
501 3300026089 Ga0207648_10007679 Ga0207648_100076792 247
502 3300026089 Ga0207648_10026554 Ga0207648_100265541 247
503 3300026089 Ga0207648_10349172 Ga0207648_103491722 247
504 3300026095 Ga0207676_10053281 Ga0207676_100532812 247
505 3300026095 Ga0207676_10081556 Ga0207676_100815563 247
506 3300026095 Ga0207676_10105893 Ga0207676_101058932 247
507 3300026095 Ga0207676_10287519 Ga0207676_102875192 247
508 3300026095 Ga0207676_10520557 Ga0207676_105205572 247
509 3300026095 Ga0207676_10750257 Ga0207676_107502572 247
510 3300026116 Ga0207674_10003943 Ga0207674_1000394310 247
511 3300026116 Ga0207674_10348043 Ga0207674_103480432 247
512 3300026118 Ga0207675_100033135 Ga0207675_1000331354 247
513 3300026118 Ga0207675_100209283 Ga0207675_1002092832 247
514 3300026118 Ga0207675_100212710 Ga0207675_1002127102 247
515 3300026121 Ga0207683_10001367 Ga0207683_100013675 247
516 3300026121 Ga0207683_10039890 Ga0207683_100398903 247
517 3300026121 Ga0207683_10271032 Ga0207683_102710322 247
518 3300026142 Ga0207698_10016396 Ga0207698_100163963 247
519 3300026142 Ga0207698_10098006 Ga0207698_100980062 247
520 3300026142 Ga0207698_10346190 Ga0207698_103461902 247
521 3300026142 Ga0207698_10444367 Ga0207698_104443672 247
522 3300027471 Ga0209995_1011204 Ga0209995_10112042 247
523 3300028379 Ga0268266_10091894 Ga0268266_100918943 247
524 3300028379 Ga0268266_10490007 Ga0268266_104900072 247
525 3300028380 Ga0268265_10318611 Ga0268265_103186112 247
526 3300028381 Ga0268264_10004639 Ga0268264_100046399 247
527 3300028381 Ga0268264_10244334 Ga0268264_102443342 247
528 3300028381 Ga0268264_10362372 Ga0268264_103623722 247
529 3300028653 Ga0265323_10000155 Ga0265323_1000015541 247
530 3300028794 Ga0307515_10000024 Ga0307515_1000002492 247
531 3300031251 Ga0265327_10002353 Ga0265327_1000235322 247
532 3300031507 Ga0307509_10069970 Ga0307509_100699702 247
533 3300031548 Ga0307408_100021623 Ga0307408_1000216232 247
534 3300031548 Ga0307408_100199309 Ga0307408_1001993092 247
535 3300031712 Ga0265342_10043736 Ga0265342_100437361 247
536 3300031727 Ga0316576_10301370 Ga0316576_103013702 247
537 3300031730 Ga0307516_10183073 Ga0307516_101830732 247
538 3300031824 Ga0307413_10162424 Ga0307413_101624242 247
539 3300031824 Ga0307413_10403361 Ga0307413_104033612 247
540 3300031852 Ga0307410_10133007 Ga0307410_101330072 247
541 3300031911 Ga0307412_10082115 Ga0307412_100821152 247
542 3300031911 Ga0307412_10673094 Ga0307412_106730941 247
543 3300032002 Ga0307416_100046890 Ga0307416_1000468902 247
544 3300032004 Ga0307414_10000349 Ga0307414_1000034912 247
545 3300032004 Ga0307414_10354929 Ga0307414_103549292 247
546 3300032005 Ga0307411_10211510 Ga0307411_102115102 247
547 3300032126 Ga0307415_100058197 Ga0307415_1000581972 247
548 3300035117 Ga0373953_0046563 Ga0373953_0046563_144_908 247
549 3300035120 Ga0373957_0078731 Ga0373957_0078731_403_1167 247
550 3300035172 Ga0373955_0133452 Ga0373955_0133452_114_878 247
551 3300036401 Ga0373937_0211631 Ga0373937_0211631_824_1588 247
552 3300037418 Ga0395900_0032101 Ga0395900_0032101_3634_4398 247
553 3300037418 Ga0395900_0204509 Ga0395900_0204509_770_1528 247
554 3300037418 Ga0395900_0231681 Ga0395900_0231681_770_1540 247
555 3300037471 Ga0395905_0000001 Ga0395905_0000001_1009483_1010235 247
556 3300037471 Ga0395905_0001509 Ga0395905_0001509_23643_24413 247
557 3300037471 Ga0395905_0321487 Ga0395905_0321487_599_1369 247
558 3300037471 Ga0395905_0326249 Ga0395905_0326249_232_987 247
559 3300038443 Ga0395901_0073626 Ga0395901_0073626_2401_3162 247
560 3300038443 Ga0395901_0354010 Ga0395901_0354010_288_1052 247
561 3300041404 Ga0439436_0001403 Ga0439436_0001403_2409_3167 247
562 3300041406 Ga0439439_0036952 Ga0439439_0036952_220_978 247
563 3300041452 Ga0451793_0325768 Ga0451793_0325768_21_785 247
564 3300041458 Ga0451798_0517438 Ga0451798_0517438_20_784 247
565 3300041458 Ga0451798_0974364 Ga0451798_0974364_321_1079 247
566 3300041486 Ga0451807_2513161 Ga0451807_2513161_617_1381 247
567 3300042007 Ga0439449_0001549 Ga0439449_0001549_4997_5761 247
568 3300042007 Ga0439449_0061628 Ga0439449_0061628_98_856 247
569 3300042014 Ga0439457_004175 Ga0439457_004175_251_1009 247
570 3300042014 Ga0439457_013437 Ga0439457_013437_846_1610 247
571 3300042876 Ga0451577_0083417 Ga0451577_0083417_594_1358 247
572 3300044658 Ga0466972_0000028 Ga0466972_0000028_131945_132703 247
573 3300044658 Ga0466972_0125101 Ga0466972_0125101_77_841 247
574 3300044673 Ga0453683_0079495 Ga0453683_0079495_980_1744 247
575 3300044673 Ga0453683_0152767 Ga0453683_0152767_572_1333 247
576 3300044684 Ga0466966_0341366 Ga0466966_0341366_88_846 247
577 3300044712 Ga0453684_0086272 Ga0453684_0086272_1411_2175 247
578 3300044712 Ga0453684_0092605 Ga0453684_0092605_254_1018 247
579 3300044712 Ga0453684_0865566 Ga0453684_0865566_89_847 247
580 3300046454 Ga0495592_0276160 Ga0495592_0276160_21_785 247
581 3300046514 Ga0495618_0103054 Ga0495618_0103054_236_1000 247
582 3300046517 Ga0495630_0008093 Ga0495630_0008093_1675_2439 247
583 3300046517 Ga0495630_0216452 Ga0495630_0216452_58_819 247
584 3300046558 Ga0495633_0131575 Ga0495633_0131575_127_891 247
585 3300046559 Ga0495667_0005807 Ga0495667_0005807_4738_5511 247
586 3300046689 Ga0495613_0014269 Ga0495613_0014269_2634_3407 247
587 3300047317 Ga0495604_0368024 Ga0495604_0368024_76_840 247
588 3300047320 Ga0495672_0015649 Ga0495672_0015649_160_939 247
589 3300048911 Ga0496108_0705674 Ga0496108_0705674_17_775 247
590 3300048913 Ga0496110_0165676 Ga0496110_0165676_266_1030 247
591 3300048913 Ga0496110_0256833 Ga0496110_0256833_152_916 247
592 3300048914 Ga0496111_0114285 Ga0496111_0114285_877_1641 247
593 3300048918 Ga0496115_0010820 Ga0496115_0010820_2726_3478 247
594 3300048918 Ga0496115_0257228 Ga0496115_0257228_236_1000 247
595 3300048927 Ga0496124_0037841 Ga0496124_0037841_1832_2599 247
596 3300049128 Ga0501308_010410 Ga0501308_010410_50_805 247
597 3300049161 Ga0501305_001184 Ga0501305_001184_1708_2463 247
598 3300049531 Ga0501315_012408 Ga0501315_012408_72_827 247
599 3300049539 Ga0501323_000094 Ga0501323_000094_2393_3148 247
600 3300049568 Ga0501031_0003536 Ga0501031_0003536_5871_6617 247
601 3300049568 Ga0501031_0019137 Ga0501031_0019137_1485_2249 247
602 3300049569 Ga0501032_0007698 Ga0501032_0007698_6619_7365 247
603 3300049569 Ga0501032_0192352 Ga0501032_0192352_526_1290 247
604 3300049570 Ga0501033_0000199 Ga0501033_0000199_47848_48594 247
605 3300049571 Ga0501034_0000506 Ga0501034_0000506_12065_12811 247
606 3300049571 Ga0501034_0066200 Ga0501034_0066200_1336_2100 247
607 3300049571 Ga0501034_0376554 Ga0501034_0376554_438_1202 247
608 3300049572 Ga0501036_0017191 Ga0501036_0017191_4340_5104 247
609 3300049572 Ga0501036_0087559 Ga0501036_0087559_342_1106 247
610 3300049573 Ga0501037_0012707 Ga0501037_0012707_3936_4682 247
611 3300049573 Ga0501037_0023483 Ga0501037_0023483_2715_3479 247
612 3300049574 Ga0501038_0004083 Ga0501038_0004083_4595_5359 247
613 3300049574 Ga0501038_0072829 Ga0501038_0072829_635_1381 247
614 3300049575 Ga0501039_0002895 Ga0501039_0002895_1505_2251 247
615 3300049575 Ga0501039_0108703 Ga0501039_0108703_46_810 247
616 3300049579 Ga0501043_0008259 Ga0501043_0008259_7432_8178 247
617 3300049579 Ga0501043_0023673 Ga0501043_0023673_1828_2592 247
618 3300049579 Ga0501043_0249241 Ga0501043_0249241_385_1143 247
619 3300049580 Ga0501046_0020279 Ga0501046_0020279_2396_3160 247
620 3300049581 Ga0501047_0072084 Ga0501047_0072084_2373_3119 247
621 3300049585 Ga0501069_0063534 Ga0501069_0063534_1213_1968 247
622 3300049588 Ga0501072_0308475 Ga0501072_0308475_480_1244 247
623 3300049650 Ga0501199_002418 Ga0501199_002418_658_1413 247
624 3300049654 Ga0501207_020946 Ga0501207_020946_107_865 247
625 3300049671 Ga0501238_004979 Ga0501238_004979_29_784 247
626 3300049686 Ga0501257_011545 Ga0501257_011545_926_1684 247
627 3300049761 Ga0501264_000987 Ga0501264_000987_2147_2902 247
628 3300049822 Ga0501035_0001435 Ga0501035_0001435_20385_21131 247
629 3300049822 Ga0501035_0079391 Ga0501035_0079391_1636_2400 247
630 3300049823 Ga0501044_0005001 Ga0501044_0005001_5026_5772 247
631 3300049823 Ga0501044_0032991 Ga0501044_0032991_1975_2742 247
632 3300049823 Ga0501044_0040028 Ga0501044_0040028_131_895 247
633 3300049823 Ga0501044_0235991 Ga0501044_0235991_228_992 247
634 3300049824 Ga0501045_0000745 Ga0501045_0000745_10567_11313 247
635 3300049853 Ga0501226_008295 Ga0501226_008295_320_1075 247
636 3300050507 nmdc:mga05p37_106817_c1 nmdc:mga05p37_106817_c1_374_1138 247
637 3300050507 nmdc:mga05p37_202163_c1 nmdc:mga05p37_202163_c1_1593_2357 247
638 3300050508 nmdc:mga09592_61110_c1 nmdc:mga09592_61110_c1_1466_2230 247
639 3300050510 nmdc:mga06r32_13230_c1 nmdc:mga06r32_13230_c1_794_1558 247
640 3300053086 Ga0500578_0000919 Ga0500578_0000919_25363_26121 247
641 3300053146 Ga0500588_0005614 Ga0500588_0005614_1168_1926 247
642 3300053153 Ga0500616_0046016 Ga0500616_0046016_1065_1820 247
643 3300053156 Ga0500622_0002124 Ga0500622_0002124_5536_6291 247
644 3300053177 Ga0500636_0110383 Ga0500636_0110383_743_1501 247
645 2010549000 RicEn_C2598 RicEn_47740 248
646 2162886007 SwRhRL2b_contig_182090 SwRhRL2b_0378.00007120 248
647 2162886007 SwRhRL2b_contig_535415 SwRhRL2b_0553.00002210 248
648 3300001989 JGI24739J22299_10003080 JGI24739J22299_100030802 248
649 3300002737 JGI25162J39368_1000112 JGI25162J39368_100011240 248
650 3300002737 JGI25162J39368_1001236 JGI25162J39368_100123616 248
651 3300002771 JGI25163J39215_1000031 JGI25163J39215_100003116 248
652 3300002771 JGI25163J39215_1000055 JGI25163J39215_10000555 248
653 3300002772 JGI25164J39214_1000094 JGI25164J39214_100009440 248
654 3300002773 JGI25152J39213_1000343 JGI25152J39213_100034317 248
655 3300003751 Ga0055538_1000076 Ga0055538_100007640 248
656 3300003752 Ga0055539_1000115 Ga0055539_100011540 248
657 3300003756 Ga0055533_1000121 Ga0055533_100012148 248
658 3300003759 Ga0055525_1000159 Ga0055525_100015940 248
659 3300003841 Ga0055541_1000077 Ga0055541_100007740 248
660 3300003856 Ga0058692_1000232 Ga0058692_100023227 248
661 3300003856 Ga0058692_1001974 Ga0058692_10019742 248
662 3300003856 Ga0058692_1002212 Ga0058692_10022123 248
663 3300003856 Ga0058692_1002227 Ga0058692_10022276 248
664 3300003856 Ga0058692_1002355 Ga0058692_10023552 248
665 3300003856 Ga0058692_1006223 Ga0058692_10062231 248
666 3300003856 Ga0058692_1011593 Ga0058692_10115932 248
667 3300003856 Ga0058692_1011852 Ga0058692_10118521 248
668 3300005289 Ga0065704_10000270 Ga0065704_1000027047 248
669 3300005289 Ga0065704_10001131 Ga0065704_100011315 248
670 3300005289 Ga0065704_10001222 Ga0065704_100012223 248
671 3300005289 Ga0065704_10108828 Ga0065704_101088281 248
672 3300005289 Ga0065704_10124612 Ga0065704_101246122 248
673 3300005289 Ga0065704_10170720 Ga0065704_101707202 248
674 3300005339 Ga0070660_100327507 Ga0070660_1003275072 248
675 3300005347 Ga0070668_100025488 Ga0070668_1000254882 248
676 3300005366 Ga0070659_100037129 Ga0070659_1000371292 248
677 3300005548 Ga0070665_100000595 Ga0070665_10000059535 248
678 3300006051 Ga0075364_10067598 Ga0075364_100675982 248
679 3300006051 Ga0075364_10079981 Ga0075364_100799812 248
680 3300006051 Ga0075364_10163379 Ga0075364_101633792 248
681 3300006058 Ga0075432_10014587 Ga0075432_100145872 248
682 3300006195 Ga0075366_10132706 Ga0075366_101327062 248
683 3300006946 Ga0079104_1000535 Ga0079104_100053533 248
684 3300006946 Ga0079104_1000611 Ga0079104_10006116 248
685 3300006946 Ga0079104_1000775 Ga0079104_10007756 248
686 3300006946 Ga0079104_1001375 Ga0079104_10013759 248
687 3300006946 Ga0079104_1001480 Ga0079104_10014806 248
688 3300006946 Ga0079104_1002577 Ga0079104_100257711 248
689 3300006946 Ga0079104_1002634 Ga0079104_10026346 248
690 3300006946 Ga0079104_1006112 Ga0079104_10061123 248
691 3300006946 Ga0079104_1013219 Ga0079104_10132192 248
692 3300009011 Ga0105251_10000752 Ga0105251_100007526 248
693 3300009011 Ga0105251_10001038 Ga0105251_1000103817 248
694 3300009011 Ga0105251_10002124 Ga0105251_100021248 248
695 3300009011 Ga0105251_10002144 Ga0105251_100021448 248
696 3300009011 Ga0105251_10010747 Ga0105251_100107476 248
697 3300009011 Ga0105251_10013713 Ga0105251_100137135 248
698 3300009011 Ga0105251_10024581 Ga0105251_100245812 248
699 3300009011 Ga0105251_10024734 Ga0105251_100247342 248
700 3300009011 Ga0105251_10053907 Ga0105251_100539072 248
701 3300009011 Ga0105251_10064353 Ga0105251_100643532 248
702 3300009011 Ga0105251_10088665 Ga0105251_100886651 248
703 3300009011 Ga0105251_10098236 Ga0105251_100982362 248
704 3300009036 Ga0105244_10000104 Ga0105244_1000010435 248
705 3300009036 Ga0105244_10000222 Ga0105244_1000022252 248
706 3300009036 Ga0105244_10000330 Ga0105244_100003306 248
707 3300009036 Ga0105244_10000354 Ga0105244_100003547 248
708 3300009036 Ga0105244_10000586 Ga0105244_100005866 248
709 3300009036 Ga0105244_10000865 Ga0105244_100008656 248
710 3300009036 Ga0105244_10001499 Ga0105244_1000149912 248
711 3300009036 Ga0105244_10003307 Ga0105244_100033074 248
712 3300009036 Ga0105244_10010356 Ga0105244_100103562 248
713 3300009036 Ga0105244_10020096 Ga0105244_100200963 248
714 3300009036 Ga0105244_10024280 Ga0105244_100242802 248
715 3300009036 Ga0105244_10052901 Ga0105244_100529012 248
716 3300009036 Ga0105244_10101605 Ga0105244_101016051 248
717 3300009036 Ga0105244_10110086 Ga0105244_101100862 248
718 3300009036 Ga0105244_10221170 Ga0105244_102211702 248
719 3300009092 Ga0105250_10000001 Ga0105250_10000001540 248
720 3300009092 Ga0105250_10000195 Ga0105250_100001956 248
721 3300009092 Ga0105250_10000253 Ga0105250_1000025337 248
722 3300009092 Ga0105250_10000448 Ga0105250_1000044824 248
723 3300009092 Ga0105250_10003065 Ga0105250_100030654 248
724 3300009092 Ga0105250_10010162 Ga0105250_100101623 248
725 3300009092 Ga0105250_10020296 Ga0105250_100202963 248
726 3300009101 Ga0105247_10000138 Ga0105247_1000013863 248
727 3300009148 Ga0105243_10066237 Ga0105243_100662372 248
728 3300009148 Ga0105243_10173822 Ga0105243_101738222 248
729 3300009174 Ga0105241_10000002 Ga0105241_10000002538 248
730 3300011119 Ga0105246_10212563 Ga0105246_102125632 248
731 3300011119 Ga0105246_10254171 Ga0105246_102541712 248
732 3300011119 Ga0105246_10810141 Ga0105246_108101411 248
733 3300013100 Ga0157373_10000500 Ga0157373_100005009 248
734 3300013100 Ga0157373_10000783 Ga0157373_1000078329 248
735 3300013100 Ga0157373_10005917 Ga0157373_100059172 248
736 3300013102 Ga0157371_10000099 Ga0157371_1000009958 248
737 3300013102 Ga0157371_10001578 Ga0157371_100015789 248
738 3300013102 Ga0157371_10002572 Ga0157371_1000257211 248
739 3300013102 Ga0157371_10016739 Ga0157371_100167392 248
740 3300013102 Ga0157371_10026882 Ga0157371_100268823 248
741 3300013102 Ga0157371_10074128 Ga0157371_100741281 248
742 3300013102 Ga0157371_10075013 Ga0157371_100750132 248
743 3300013104 Ga0157370_10000234 Ga0157370_1000023449 248
744 3300013104 Ga0157370_10006551 Ga0157370_100065515 248
745 3300013104 Ga0157370_10015259 Ga0157370_100152596 248
746 3300013104 Ga0157370_10214236 Ga0157370_102142362 248
747 3300013105 Ga0157369_10030301 Ga0157369_100303014 248
748 3300013105 Ga0157369_10032764 Ga0157369_100327642 248
749 3300013306 Ga0163162_10035335 Ga0163162_100353355 248
750 3300013306 Ga0163162_10061435 Ga0163162_100614352 248
751 3300013307 Ga0157372_10007775 Ga0157372_100077757 248
752 3300013307 Ga0157372_10014588 Ga0157372_100145885 248
753 3300013307 Ga0157372_10023900 Ga0157372_100239005 248
754 3300013307 Ga0157372_10083160 Ga0157372_100831602 248
755 3300013307 Ga0157372_10150426 Ga0157372_101504262 248
756 3300013307 Ga0157372_11373910 Ga0157372_113739101 248
757 3300013307 Ga0157372_11374089 Ga0157372_113740891 248
758 3300015261 Ga0182006_1000047 Ga0182006_100004794 248
759 3300015261 Ga0182006_1008119 Ga0182006_10081193 248
760 3300015262 Ga0182007_10004870 Ga0182007_100048702 248
761 3300015679 Ga0183366_1001 Ga0183366_10011090 248
762 3300015680 Ga0183370_1001 Ga0183370_10011090 248
763 3300015685 Ga0183369_1001 Ga0183369_10011090 248
764 3300015687 Ga0183368_1001 Ga0183368_10011090 248
765 3300017792 Ga0163161_10137372 Ga0163161_101373722 248
766 3300021384 Ga0213876_10000055 Ga0213876_10000055116 248
767 3300025207 Ga0209760_100104 Ga0209760_10010451 248
768 3300025224 Ga0209784_100001 Ga0209784_1000011425 248
769 3300025225 Ga0209566_100001 Ga0209566_1000011425 248
770 3300025226 Ga0209674_100002 Ga0209674_1000021425 248
771 3300025230 Ga0209563_100008 Ga0209563_1000081428 248
772 3300025231 Ga0207427_100135 Ga0207427_10013551 248
773 3300025233 Ga0209437_100007 Ga0209437_100007880 248
774 3300025233 Ga0209437_100109 Ga0209437_10010995 248
775 3300025233 Ga0209437_100111 Ga0209437_10011195 248
776 3300025253 Ga0209677_100004 Ga0209677_1000041428 248
777 3300025258 Ga0209129_1000004 Ga0209129_100000465 248
778 3300025711 Ga0207696_1000001 Ga0207696_10000011028 248
779 3300025711 Ga0207696_1000028 Ga0207696_1000028146 248
780 3300025711 Ga0207696_1000086 Ga0207696_1000086131 248
781 3300025711 Ga0207696_1000116 Ga0207696_100011627 248
782 3300025711 Ga0207696_1000174 Ga0207696_100017451 248
783 3300025711 Ga0207696_1000235 Ga0207696_100023542 248
784 3300025711 Ga0207696_1000439 Ga0207696_100043916 248
785 3300025711 Ga0207696_1001155 Ga0207696_100115513 248
786 3300025711 Ga0207696_1004856 Ga0207696_10048562 248
787 3300025711 Ga0207696_1039799 Ga0207696_10397992 248
788 3300025728 Ga0207655_1000001 Ga0207655_10000011137 248
789 3300025728 Ga0207655_1000004 Ga0207655_1000004948 248
790 3300025728 Ga0207655_1000009 Ga0207655_1000009334 248
791 3300025728 Ga0207655_1000037 Ga0207655_1000037205 248
792 3300025728 Ga0207655_1000089 Ga0207655_10000896 248
793 3300025728 Ga0207655_1000426 Ga0207655_10004266 248
794 3300025728 Ga0207655_1000647 Ga0207655_10006474 248
795 3300025728 Ga0207655_1000741 Ga0207655_100074126 248
796 3300025728 Ga0207655_1002099 Ga0207655_100209914 248
797 3300025728 Ga0207655_1003187 Ga0207655_10031878 248
798 3300025728 Ga0207655_1005530 Ga0207655_10055305 248
799 3300025728 Ga0207655_1041906 Ga0207655_10419062 248
800 3300025728 Ga0207655_1061571 Ga0207655_10615712 248
801 3300025735 Ga0207713_1000001 Ga0207713_1000001918 248
802 3300025735 Ga0207713_1000002 Ga0207713_10000021017 248
803 3300025735 Ga0207713_1000003 Ga0207713_100000328 248
804 3300025735 Ga0207713_1000012 Ga0207713_100001230 248
805 3300025735 Ga0207713_1001881 Ga0207713_10018818 248
806 3300025735 Ga0207713_1001893 Ga0207713_10018938 248
807 3300025735 Ga0207713_1010034 Ga0207713_10100343 248
808 3300025735 Ga0207713_1012581 Ga0207713_10125812 248
809 3300025735 Ga0207713_1020048 Ga0207713_10200482 248
810 3300025735 Ga0207713_1021384 Ga0207713_10213843 248
811 3300025735 Ga0207713_1022401 Ga0207713_10224013 248
812 3300025735 Ga0207713_1025865 Ga0207713_10258651 248
813 3300025735 Ga0207713_1043857 Ga0207713_10438572 248
814 3300025735 Ga0207713_1051983 Ga0207713_10519832 248
815 3300025735 Ga0207713_1062442 Ga0207713_10624422 248
816 3300025735 Ga0207713_1062803 Ga0207713_10628031 248
817 3300025735 Ga0207713_1073257 Ga0207713_10732572 248
818 3300025735 Ga0207713_1114844 Ga0207713_11148442 248
819 3300025900 Ga0207710_10000052 Ga0207710_10000052180 248
820 3300025911 Ga0207654_10000005 Ga0207654_10000005537 248
821 3300025932 Ga0207690_10110114 Ga0207690_101101142 248
822 3300025935 Ga0207709_10117671 Ga0207709_101176712 248
823 3300025935 Ga0207709_10172431 Ga0207709_101724312 248
824 3300025972 Ga0207668_10005192 Ga0207668_100051925 248
825 3300026116 Ga0207674_10076295 Ga0207674_100762952 248
826 3300026142 Ga0207698_10290463 Ga0207698_102904632 248
827 3300027111 Ga0209281_1000001 Ga0209281_1000001863 248
828 3300027111 Ga0209281_1000003 Ga0209281_1000003167 248
829 3300027111 Ga0209281_1000130 Ga0209281_1000130154 248
830 3300027111 Ga0209281_1000394 Ga0209281_100039441 248
831 3300027111 Ga0209281_1000428 Ga0209281_100042857 248
832 3300027111 Ga0209281_1000598 Ga0209281_100059833 248
833 3300027111 Ga0209281_1000713 Ga0209281_100071327 248
834 3300027111 Ga0209281_1001045 Ga0209281_10010458 248
835 3300027111 Ga0209281_1001234 Ga0209281_100123411 248
836 3300027111 Ga0209281_1002684 Ga0209281_10026842 248
837 3300027111 Ga0209281_1002778 Ga0209281_10027783 248
838 3300027312 Ga0209371_1000001 Ga0209371_10000011011 248
839 3300027312 Ga0209371_1000002 Ga0209371_1000002164 248
840 3300027312 Ga0209371_1000041 Ga0209371_1000041198 248
841 3300027312 Ga0209371_1000122 Ga0209371_10001226 248
842 3300027312 Ga0209371_1000188 Ga0209371_100018876 248
843 3300027312 Ga0209371_1000492 Ga0209371_100049231 248
844 3300027312 Ga0209371_1000862 Ga0209371_10008625 248
845 3300027312 Ga0209371_1001378 Ga0209371_10013785 248
846 3300027312 Ga0209371_1001914 Ga0209371_10019145 248
847 3300027312 Ga0209371_1002701 Ga0209371_10027015 248
848 3300027312 Ga0209371_1003845 Ga0209371_10038456 248
849 3300027312 Ga0209371_1004166 Ga0209371_10041662 248
850 3300027312 Ga0209371_1017918 Ga0209371_10179181 248
851 3300027312 Ga0209371_1022638 Ga0209371_10226382 248
852 3300028379 Ga0268266_10001643 Ga0268266_1000164321 248
853 3300028800 Ga0265338_10000829 Ga0265338_1000082917 248
854 3300030500 Ga0268256_1000001 Ga0268256_10000011630 248
855 3300030500 Ga0268256_1000002 Ga0268256_10000021301 248
856 3300030500 Ga0268256_1000003 Ga0268256_10000031022 248
857 3300030500 Ga0268256_1000048 Ga0268256_1000048311 248
858 3300030500 Ga0268256_1000051 Ga0268256_10000516 248
859 3300030500 Ga0268256_1000718 Ga0268256_100071817 248
860 3300030500 Ga0268256_1000844 Ga0268256_100084411 248
861 3300030500 Ga0268256_1001182 Ga0268256_10011825 248
862 3300030500 Ga0268256_1001381 Ga0268256_10013819 248
863 3300030500 Ga0268256_1003561 Ga0268256_10035616 248
864 3300030500 Ga0268256_1003845 Ga0268256_10038452 248
865 3300030500 Ga0268256_1004889 Ga0268256_10048893 248
866 3300030500 Ga0268256_1020005 Ga0268256_10200052 248
867 3300030500 Ga0268256_1025573 Ga0268256_10255732 248
868 3300031728 Ga0316578_10073968 Ga0316578_100739682 248
869 3300031728 Ga0316578_10166887 Ga0316578_101668872 248
870 3300031733 Ga0316577_10093444 Ga0316577_100934442 248
871 3300032005 Ga0307411_10076805 Ga0307411_100768052 248
872 3300039437 Ga0436365_0971002 Ga0436365_0971002_53137_53883 248
873 3300041405 Ga0439438_000001 Ga0439438_000001_715212_715958 248
874 3300041405 Ga0439438_025837 Ga0439438_025837_408_1154 248
875 3300041407 Ga0439447_001075 Ga0439447_001075_5303_6049 248
876 3300041411 Ga0439466_0000047 Ga0439466_0000047_23704_24450 248
877 3300042006 Ga0439432_010616 Ga0439432_010616_184_930 248
878 3300042006 Ga0439432_011524 Ga0439432_011524_2261_3007 248
879 3300042006 Ga0439432_013991 Ga0439432_013991_1437_2183 248
880 3300042010 Ga0439452_000001 Ga0439452_000001_655136_655882 248
881 3300042010 Ga0439452_000002 Ga0439452_000002_1280228_1280974 248
882 3300042010 Ga0439452_000008 Ga0439452_000008_4283_5029 248
883 3300042010 Ga0439452_000142 Ga0439452_000142_4280_5026 248
884 3300042010 Ga0439452_000298 Ga0439452_000298_4054_4800 248
885 3300042016 Ga0439463_006887 Ga0439463_006887_1088_1834 248
886 3300042146 Ga0450907_000190 Ga0450907_000190_4608_5354 248
887 3300042439 Ga0439464_0011759 Ga0439464_0011759_996_1742 248
888 3300044669 Ga0466981_0000002 Ga0466981_0000002_122647_123393 248
889 3300046452 Ga0495617_040590 Ga0495617_040590_610_1356 248
890 3300046453 Ga0495627_000116 Ga0495627_000116_5967_6713 248
891 3300046458 Ga0495591_000013 Ga0495591_000013_162393_163139 248
892 3300046458 Ga0495591_000100 Ga0495591_000100_627_1373 248
893 3300046458 Ga0495591_035053 Ga0495591_035053_285_1031 248
894 3300046460 Ga0495638_0013681 Ga0495638_0013681_10_756 248
895 3300046471 Ga0495650_0000005 Ga0495650_0000005_712950_713696 248
896 3300046471 Ga0495650_0000090 Ga0495650_0000090_105134_105880 248
897 3300046471 Ga0495650_0000187 Ga0495650_0000187_43777_44523 248
898 3300046491 Ga0495584_0011311 Ga0495584_0011311_3037_3783 248
899 3300046492 Ga0495585_0011587 Ga0495585_0011587_79_825 248
900 3300046507 Ga0495606_0003762 Ga0495606_0003762_9784_10530 248
901 3300046519 Ga0495632_0176716 Ga0495632_0176716_167_913 248
902 3300046520 Ga0495637_0123931 Ga0495637_0123931_94_840 248
903 3300046522 Ga0495643_0034513 Ga0495643_0034513_533_1279 248
904 3300046523 Ga0495644_0000573 Ga0495644_0000573_3452_4198 248
905 3300046524 Ga0495648_0002343 Ga0495648_0002343_3810_4556 248
906 3300046524 Ga0495648_0009258 Ga0495648_0009258_4413_5159 248
907 3300046530 Ga0495654_0000041 Ga0495654_0000041_166343_167089 248
908 3300046530 Ga0495654_0000173 Ga0495654_0000173_50448_51194 248
909 3300046530 Ga0495654_0001003 Ga0495654_0001003_8306_9052 248
910 3300046530 Ga0495654_0052850 Ga0495654_0052850_304_1050 248
911 3300046542 Ga0495597_0001631 Ga0495597_0001631_9438_10184 248
912 3300046660 Ga0495625_0016408 Ga0495625_0016408_4603_5349 248
913 3300046674 Ga0495588_0003244 Ga0495588_0003244_4601_5347 248
914 3300046692 Ga0495671_0009709 Ga0495671_0009709_863_1609 248
915 3300046694 Ga0495649_0001886 Ga0495649_0001886_5886_6632 248
916 3300046694 Ga0495649_0009622 Ga0495649_0009622_829_1575 248
917 3300046794 Ga0495589_0000004 Ga0495589_0000004_43434_44180 248
918 3300046794 Ga0495589_0005519 Ga0495589_0005519_5472_6218 248
919 3300046810 Ga0495660_0000028 Ga0495660_0000028_172488_173234 248
920 3300046810 Ga0495660_0000171 Ga0495660_0000171_44447_45193 248
921 3300046810 Ga0495660_0053644 Ga0495660_0053644_1402_2148 248
922 3300047320 Ga0495672_0000002 Ga0495672_0000002_530983_531729 248
923 3300047320 Ga0495672_0000020 Ga0495672_0000020_240588_241334 248
924 3300047320 Ga0495672_0000043 Ga0495672_0000043_108408_109154 248
925 3300047446 Ga0495679_000282 Ga0495679_000282_37042_37788 248
926 3300047446 Ga0495679_029528 Ga0495679_029528_396_1142 248
927 3300047446 Ga0495679_049639 Ga0495679_049639_501_1247 248
928 3300047469 Ga0495673_0000070 Ga0495673_0000070_207896_208642 248
929 3300047469 Ga0495673_0000167 Ga0495673_0000167_34838_35584 248
930 3300047470 Ga0495681_0021707 Ga0495681_0021707_621_1367 248
931 3300048903 Ga0496100_0004919 Ga0496100_0004919_3747_4493 248
932 3300048904 Ga0496101_0000163 Ga0496101_0000163_1081_1827 248
933 3300048904 Ga0496101_0254290 Ga0496101_0254290_466_1212 248
934 3300048905 Ga0496102_0049801 Ga0496102_0049801_1714_2460 248
935 3300048906 Ga0496103_0068478 Ga0496103_0068478_1012_1758 248
936 3300048907 Ga0496104_0000555 Ga0496104_0000555_14074_14820 248
937 3300048907 Ga0496104_0048174 Ga0496104_0048174_2905_3651 248
938 3300048907 Ga0496104_0579797 Ga0496104_0579797_153_899 248
939 3300048908 Ga0496105_0031796 Ga0496105_0031796_1074_1820 248
940 3300048913 Ga0496110_0152210 Ga0496110_0152210_915_1661 248
941 3300048919 Ga0496116_0000001 Ga0496116_0000001_437914_438660 248
942 3300048919 Ga0496116_0000122 Ga0496116_0000122_45501_46247 248
943 3300048919 Ga0496116_0000277 Ga0496116_0000277_39124_39870 248
944 3300048919 Ga0496116_0001125 Ga0496116_0001125_4118_4864 248
945 3300048919 Ga0496116_0008548 Ga0496116_0008548_6510_7256 248
946 3300048919 Ga0496116_0012630 Ga0496116_0012630_4119_4865 248
947 3300048919 Ga0496116_0015585 Ga0496116_0015585_3107_3853 248
948 3300048919 Ga0496116_0100569 Ga0496116_0100569_379_1125 248
949 3300048919 Ga0496116_0106631 Ga0496116_0106631_736_1482 248
950 3300048920 Ga0496117_0000004 Ga0496117_0000004_75821_76567 248
951 3300048920 Ga0496117_0000165 Ga0496117_0000165_103788_104534 248
952 3300048920 Ga0496117_0000399 Ga0496117_0000399_38798_39544 248
953 3300048920 Ga0496117_0002525 Ga0496117_0002525_313_1059 248
954 3300048920 Ga0496117_0003424 Ga0496117_0003424_13571_14317 248
955 3300048920 Ga0496117_0004066 Ga0496117_0004066_1095_1841 248
956 3300048920 Ga0496117_0008180 Ga0496117_0008180_436_1182 248
957 3300048920 Ga0496117_0020640 Ga0496117_0020640_481_1227 248
958 3300048920 Ga0496117_0034148 Ga0496117_0034148_621_1367 248
959 3300048920 Ga0496117_0034335 Ga0496117_0034335_669_1415 248
960 3300048920 Ga0496117_0060036 Ga0496117_0060036_1209_1955 248
961 3300048920 Ga0496117_0068843 Ga0496117_0068843_1573_2319 248
962 3300048920 Ga0496117_0070832 Ga0496117_0070832_513_1259 248
963 3300048920 Ga0496117_0073597 Ga0496117_0073597_1317_2063 248
964 3300048921 Ga0496118_0000007 Ga0496118_0000007_60445_61191 248
965 3300048921 Ga0496118_0000015 Ga0496118_0000015_501562_502308 248
966 3300048921 Ga0496118_0001126 Ga0496118_0001126_36073_36819 248
967 3300048921 Ga0496118_0002525 Ga0496118_0002525_11657_12403 248
968 3300048921 Ga0496118_0002850 Ga0496118_0002850_15792_16538 248
969 3300048921 Ga0496118_0005269 Ga0496118_0005269_2345_3091 248
970 3300048921 Ga0496118_0012799 Ga0496118_0012799_4284_5030 248
971 3300048921 Ga0496118_0021142 Ga0496118_0021142_21_767 248
972 3300048921 Ga0496118_0026635 Ga0496118_0026635_4151_4897 248
973 3300048921 Ga0496118_0027827 Ga0496118_0027827_2767_3513 248
974 3300048921 Ga0496118_0036738 Ga0496118_0036738_2560_3306 248
975 3300048921 Ga0496118_0176208 Ga0496118_0176208_532_1278 248
976 3300048922 Ga0496119_0000066 Ga0496119_0000066_4283_5029 248
977 3300048922 Ga0496119_0000095 Ga0496119_0000095_50907_51653 248
978 3300048922 Ga0496119_0000911 Ga0496119_0000911_1463_2209 248
979 3300048922 Ga0496119_0001499 Ga0496119_0001499_4366_5112 248
980 3300048922 Ga0496119_0001967 Ga0496119_0001967_18367_19113 248
981 3300048922 Ga0496119_0002594 Ga0496119_0002594_4233_4979 248
982 3300048922 Ga0496119_0004815 Ga0496119_0004815_4488_5234 248
983 3300048922 Ga0496119_0012013 Ga0496119_0012013_702_1448 248
984 3300048922 Ga0496119_0019406 Ga0496119_0019406_130_876 248
985 3300048922 Ga0496119_0024425 Ga0496119_0024425_513_1259 248
986 3300048922 Ga0496119_0027666 Ga0496119_0027666_1051_1797 248
987 3300048922 Ga0496119_0031972 Ga0496119_0031972_1379_2125 248
988 3300048922 Ga0496119_0037015 Ga0496119_0037015_484_1230 248
989 3300048922 Ga0496119_0039110 Ga0496119_0039110_1561_2307 248
990 3300048923 Ga0496120_0000076 Ga0496120_0000076_36105_36851 248
991 3300048923 Ga0496120_0000380 Ga0496120_0000380_18075_18821 248
992 3300048923 Ga0496120_0000928 Ga0496120_0000928_35533_36279 248
993 3300048923 Ga0496120_0001267 Ga0496120_0001267_6521_7267 248
994 3300048923 Ga0496120_0002342 Ga0496120_0002342_4488_5234 248
995 3300048923 Ga0496120_0003408 Ga0496120_0003408_1634_2380 248
996 3300048923 Ga0496120_0003965 Ga0496120_0003965_4094_4840 248
997 3300048923 Ga0496120_0011139 Ga0496120_0011139_755_1501 248
998 3300048923 Ga0496120_0015425 Ga0496120_0015425_4146_4892 248
999 3300048923 Ga0496120_0025816 Ga0496120_0025816_1051_1797 248
1000 3300048923 Ga0496120_0044450 Ga0496120_0044450_820_1566 248
1001 3300048923 Ga0496120_0050891 Ga0496120_0050891_1488_2234 248
1002 3300048924 Ga0496121_0002250 Ga0496121_0002250_25202_25948 248
1003 3300048924 Ga0496121_0003016 Ga0496121_0003016_7533_8279 248
1004 3300048924 Ga0496121_0025828 Ga0496121_0025828_1908_2654 248
1005 3300048924 Ga0496121_0025872 Ga0496121_0025872_664_1410 248
1006 3300048924 Ga0496121_0042151 Ga0496121_0042151_54_800 248
1007 3300048924 Ga0496121_0187043 Ga0496121_0187043_694_1440 248
1008 3300048924 Ga0496121_0247971 Ga0496121_0247971_136_882 248
1009 3300048925 Ga0496122_0000005 Ga0496122_0000005_39575_40321 248
1010 3300048925 Ga0496122_0000058 Ga0496122_0000058_85393_86139 248
1011 3300048925 Ga0496122_0000738 Ga0496122_0000738_35047_35793 248
1012 3300048925 Ga0496122_0004902 Ga0496122_0004902_11238_11984 248
1013 3300048925 Ga0496122_0014702 Ga0496122_0014702_262_1008 248
1014 3300048925 Ga0496122_0021615 Ga0496122_0021615_2229_2975 248
1015 3300048925 Ga0496122_0022320 Ga0496122_0022320_711_1457 248
1016 3300048925 Ga0496122_0025084 Ga0496122_0025084_4139_4885 248
1017 3300048925 Ga0496122_0050089 Ga0496122_0050089_844_1590 248
1018 3300048925 Ga0496122_0059356 Ga0496122_0059356_1739_2485 248
1019 3300048925 Ga0496122_0061607 Ga0496122_0061607_957_1703 248
1020 3300048925 Ga0496122_0082194 Ga0496122_0082194_1439_2185 248
1021 3300048925 Ga0496122_0104116 Ga0496122_0104116_55_801 248
1022 3300048926 Ga0496123_0000008 Ga0496123_0000008_590308_591054 248
1023 3300048926 Ga0496123_0000044 Ga0496123_0000044_85393_86139 248
1024 3300048926 Ga0496123_0001322 Ga0496123_0001322_30042_30788 248
1025 3300048926 Ga0496123_0002433 Ga0496123_0002433_4253_4999 248
1026 3300048926 Ga0496123_0006525 Ga0496123_0006525_606_1352 248
1027 3300048926 Ga0496123_0011748 Ga0496123_0011748_262_1008 248
1028 3300048926 Ga0496123_0020012 Ga0496123_0020012_4143_4889 248
1029 3300048926 Ga0496123_0022150 Ga0496123_0022150_57_803 248
1030 3300048926 Ga0496123_0022151 Ga0496123_0022151_4105_4851 248
1031 3300048926 Ga0496123_0044729 Ga0496123_0044729_926_1672 248
1032 3300048926 Ga0496123_0081598 Ga0496123_0081598_509_1255 248
1033 3300048927 Ga0496124_0000105 Ga0496124_0000105_59256_60002 248
1034 3300048927 Ga0496124_0000107 Ga0496124_0000107_71867_72613 248
1035 3300048927 Ga0496124_0000196 Ga0496124_0000196_67231_67977 248
1036 3300048927 Ga0496124_0000564 Ga0496124_0000564_4377_5123 248
1037 3300048927 Ga0496124_0001459 Ga0496124_0001459_29752_30498 248
1038 3300048927 Ga0496124_0012635 Ga0496124_0012635_1595_2341 248
1039 3300048927 Ga0496124_0023875 Ga0496124_0023875_680_1426 248
1040 3300048927 Ga0496124_0075693 Ga0496124_0075693_1999_2745 248
1041 3300048927 Ga0496124_0133342 Ga0496124_0133342_11_757 248
1042 3300048927 Ga0496124_0139172 Ga0496124_0139172_151_897 248
1043 3300048927 Ga0496124_0141534 Ga0496124_0141534_1132_1878 248
1044 3300048927 Ga0496124_0248184 Ga0496124_0248184_285_1031 248
1045 3300048927 Ga0496124_0309144 Ga0496124_0309144_130_876 248
1046 3300048928 Ga0496125_0000009 Ga0496125_0000009_571167_571913 248
1047 3300048928 Ga0496125_0000103 Ga0496125_0000103_104334_105080 248
1048 3300048928 Ga0496125_0001712 Ga0496125_0001712_12190_12936 248
1049 3300048928 Ga0496125_0005660 Ga0496125_0005660_927_1673 248
1050 3300048928 Ga0496125_0007075 Ga0496125_0007075_4317_5063 248
1051 3300048928 Ga0496125_0017105 Ga0496125_0017105_4094_4840 248
1052 3300048928 Ga0496125_0024785 Ga0496125_0024785_4126_4872 248
1053 3300048928 Ga0496125_0040085 Ga0496125_0040085_371_1117 248
1054 3300048928 Ga0496125_0081332 Ga0496125_0081332_231_977 248
1055 3300048929 Ga0496126_0000399 Ga0496126_0000399_39002_39748 248
1056 3300048929 Ga0496126_0000779 Ga0496126_0000779_40912_41658 248
1057 3300048929 Ga0496126_0002347 Ga0496126_0002347_4135_4881 248
1058 3300048929 Ga0496126_0020256 Ga0496126_0020256_3895_4641 248
1059 3300048929 Ga0496126_0064326 Ga0496126_0064326_2234_2980 248
1060 3300048929 Ga0496126_0092871 Ga0496126_0092871_1623_2369 248
1061 3300048929 Ga0496126_0093341 Ga0496126_0093341_412_1158 248
1062 3300048929 Ga0496126_0117465 Ga0496126_0117465_416_1162 248
1063 3300048929 Ga0496126_0118871 Ga0496126_0118871_1314_2060 248
1064 3300048929 Ga0496126_0177426 Ga0496126_0177426_756_1502 248
1065 3300048929 Ga0496126_0263834 Ga0496126_0263834_410_1156 248
1066 3300048929 Ga0496126_0270448 Ga0496126_0270448_62_808 248
1067 3300049459 Ga0495678_000591 Ga0495678_000591_5585_6331 248
1068 3300049459 Ga0495678_014148 Ga0495678_014148_883_1629 248
1069 3300049460 Ga0495682_0000001 Ga0495682_0000001_1302734_1303480 248
1070 3300049581 Ga0501047_0171986 Ga0501047_0171986_356_1156 248
1071 3300050491 nmdc:mga00v17_159762_c1 nmdc:mga00v17_159762_c1_10_756 248
1072 3300050491 nmdc:mga00v17_177317_c1 nmdc:mga00v17_177317_c1_198_944 248
1073 3300050493 nmdc:mga0k408_1666_c3 nmdc:mga0k408_1666_c3_297_1043 248
1074 3300053077 Ga0495601_0094389 Ga0495601_0094389_1047_1802 248
1075 3300053126 Ga0500621_000003 Ga0500621_000003_134222_134968 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

41

198

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9525 1 230
2zu0-assembly1.cif.gz_C crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis 0.9459 1 243
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9291 1 230
2d3w-assembly1.cif.gz_C crystal structure of escherichia coli sufc, an atpase compenent of the suf iron-sulfur cluster assembly machinery 0.9275 1 243
2zu0-assembly1.cif.gz_C crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis 0.9275 1 243
ID Description Score Start End Superfamily
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9549 2 247 3.40.50.300
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9362 2 247 3.40.50.300
af_Q8ILW0_99_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9274 1 243 3.40.50.300
af_Q60350_5_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8901 1 244 3.40.50.300
af_Q60350_5_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8796 1 244 3.40.50.300
ID Description Score Start End GO Terms
AF-Q2IA12-F1-model_v4 Chloroplast Ycf16-like transporter 0.9622 2 147 GO:0005524
GO:0016887
AF-A0A2D9VEB8-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9589 1 155 GO:0005524
GO:0016887
AF-A0A351MIF7-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9488 2 248 GO:0005524
GO:0016887
AF-A0A2D9VEB8-F1-model_v4 Fe-S cluster assembly ATPase SufC 0.9471 1 155 GO:0005524
GO:0016887
AF-J6IIC2-F1-model_v4 FeS assembly ATPase SufC 0.9442 2 246 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.53 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map