F489453
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1069 | 317 | 2134 | 230 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10010541|Ga0070709_100105413 |
| Length | 260 |
| Sequence | VTNLVNDSASGGEPRKRIAVFLLDDHEVVRRGVGDVLEAEPDITVVGEAGTASSALARIPALKPDVAVLDVRLPDGDGVSVCREIRSRMPEVACLMLTSFGDDEALFDAIMAGAAGYVLKQIRGTDLVGAVRTVASGQSMLDPRAASQLMARLRGQSSRRDPLAGLSSQERKILELIGEGLTNRQIGERMFLAEKTVKNYVSGLFAKLGMERRTQAAAYAVRVFGDHHDGQGGHSHLGPGAGDMAGERLAAGASAASPAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 85 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 89 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 91 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 140 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 143 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 144 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 147 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 150 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 151 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 152 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031666 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 156 | 3300031667 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 157 | 3300031686 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 158 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 164 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 165 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 166 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 167 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 168 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 169 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 170 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 171 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 172 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 174 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 176 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 182 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 191 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 196 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 208 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 209 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 212 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 218 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 281 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 282 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 283 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 284 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 285 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 288 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 289 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 290 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 295 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 310 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 311 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 312 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 313 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 314 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 315 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 316 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 317 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.16 |
| Metatranscriptomes | 3.09 |
| Isolates | 0.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.09 |
| Nodule | 0 |
| Rhizoplane | 6.55 |
| Rhizosphere | 89.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070709_10010541 | 3300005434 | Bacteria | 5122 |
| 2 | JGI24743J22301_10070235 | 3300001991 | Bacteria | 730 |
| 3 | Ga0070658_10019068 | 3300005327 | Bacteria | 5494 |
| 4 | Ga0070658_10027167 | 3300005327 | Bacteria | 4594 |
| 5 | Ga0070658_10441438 | 3300005327 | Bacteria | 1121 |
| 6 | Ga0070683_100067065 | 3300005329 | Bacteria | 3342 |
| 7 | Ga0070683_100322006 | 3300005329 | Bacteria | 1471 |
| 8 | Ga0070683_100470682 | 3300005329 | Bacteria | 1200 |
| 9 | Ga0070666_10324903 | 3300005335 | Bacteria | 1098 |
| 10 | Ga0070680_100020013 | 3300005336 | Bacteria | 5305 |
| 11 | Ga0070680_100247502 | 3300005336 | Bacteria | 1507 |
| 12 | Ga0070682_100030166 | 3300005337 | Bacteria | 3271 |
| 13 | Ga0070682_100175908 | 3300005337 | Bacteria | 1491 |
| 14 | Ga0068868_100310046 | 3300005338 | Bacteria | 1342 |
| 15 | Ga0070660_100047169 | 3300005339 | Bacteria | 3305 |
| 16 | Ga0070660_100192508 | 3300005339 | Bacteria | 1652 |
| 17 | Ga0070660_100210415 | 3300005339 | Bacteria | 1579 |
| 18 | Ga0070660_100660333 | 3300005339 | Bacteria | 876 |
| 19 | Ga0070691_10168970 | 3300005341 | Bacteria | 1132 |
| 20 | Ga0070661_100109838 | 3300005344 | Bacteria | 2058 |
| 21 | Ga0070661_100506553 | 3300005344 | Bacteria | 967 |
| 22 | Ga0070692_10110227 | 3300005345 | Bacteria | 1521 |
| 23 | Ga0070692_10194858 | 3300005345 | Bacteria | 1183 |
| 24 | Ga0070668_100002765 | 3300005347 | Bacteria | 12891 |
| 25 | Ga0070668_100631310 | 3300005347 | Bacteria | 940 |
| 26 | Ga0070675_100527905 | 3300005354 | Bacteria | 1066 |
| 27 | Ga0070673_100468456 | 3300005364 | Bacteria | 1135 |
| 28 | Ga0070659_100301970 | 3300005366 | Bacteria | 1335 |
| 29 | Ga0070659_100536987 | 3300005366 | Bacteria | 1000 |
| 30 | Ga0070709_10000135 | 3300005434 | Bacteria | 49189 |
| 31 | Ga0070709_10001265 | 3300005434 | Bacteria | 13838 |
| 32 | Ga0070709_10002530 | 3300005434 | Bacteria | 9893 |
| 33 | Ga0070709_10140193 | 3300005434 | Bacteria | 1660 |
| 34 | Ga0070709_10191229 | 3300005434 | Bacteria | 1444 |
| 35 | Ga0070709_10305188 | 3300005434 | Bacteria | 1163 |
| 36 | Ga0070714_100000876 | 3300005435 | Bacteria | 21365 |
| 37 | Ga0070714_100003346 | 3300005435 | Bacteria | 11957 |
| 38 | Ga0070714_100003679 | 3300005435 | Bacteria | 11482 |
| 39 | Ga0070714_100004557 | 3300005435 | Bacteria | 10447 |
| 40 | Ga0070714_100006698 | 3300005435 | Bacteria | 8922 |
| 41 | Ga0070714_100006766 | 3300005435 | Bacteria | 8887 |
| 42 | Ga0070714_100023998 | 3300005435 | Bacteria | 5016 |
| 43 | Ga0070714_100027929 | 3300005435 | Bacteria | 4676 |
| 44 | Ga0070714_100043584 | 3300005435 | Bacteria | 3795 |
| 45 | Ga0070714_100055179 | 3300005435 | Bacteria | 3395 |
| 46 | Ga0070714_100056258 | 3300005435 | Bacteria | 3364 |
| 47 | Ga0070714_100062927 | 3300005435 | Bacteria | 3189 |
| 48 | Ga0070714_100074307 | 3300005435 | Bacteria | 2946 |
| 49 | Ga0070714_100078948 | 3300005435 | Bacteria | 2861 |
| 50 | Ga0070714_100434023 | 3300005435 | Bacteria | 1246 |
| 51 | Ga0070714_100442660 | 3300005435 | Bacteria | 1233 |
| 52 | Ga0070714_100528371 | 3300005435 | Bacteria | 1127 |
| 53 | Ga0070714_100754886 | 3300005435 | Bacteria | 941 |
| 54 | Ga0070713_100000929 | 3300005436 | Bacteria | 18713 |
| 55 | Ga0070713_100003752 | 3300005436 | Bacteria | 10054 |
| 56 | Ga0070713_100007473 | 3300005436 | Bacteria | 7674 |
| 57 | Ga0070713_100010175 | 3300005436 | Bacteria | 6784 |
| 58 | Ga0070713_100016002 | 3300005436 | Bacteria | 5628 |
| 59 | Ga0070713_100050923 | 3300005436 | Bacteria | 3423 |
| 60 | Ga0070713_100087645 | 3300005436 | Bacteria | 2670 |
| 61 | Ga0070713_100214108 | 3300005436 | Bacteria | 1746 |
| 62 | Ga0070713_100338481 | 3300005436 | Bacteria | 1393 |
| 63 | Ga0070713_100354131 | 3300005436 | Bacteria | 1362 |
| 64 | Ga0070710_10000292 | 3300005437 | Bacteria | 23726 |
| 65 | Ga0070710_10001213 | 3300005437 | Bacteria | 12200 |
| 66 | Ga0070710_10003283 | 3300005437 | Bacteria | 7673 |
| 67 | Ga0070710_10022670 | 3300005437 | Bacteria | 3288 |
| 68 | Ga0070710_10040432 | 3300005437 | Bacteria | 2571 |
| 69 | Ga0070710_10042186 | 3300005437 | Bacteria | 2521 |
| 70 | Ga0070710_10116106 | 3300005437 | Bacteria | 1614 |
| 71 | Ga0070710_10126925 | 3300005437 | Bacteria | 1551 |
| 72 | Ga0070710_10149951 | 3300005437 | Bacteria | 1437 |
| 73 | Ga0070701_10199126 | 3300005438 | Bacteria | 1183 |
| 74 | Ga0070711_100001302 | 3300005439 | Bacteria | 13571 |
| 75 | Ga0070711_100003513 | 3300005439 | Bacteria | 9146 |
| 76 | Ga0070711_100006598 | 3300005439 | Bacteria | 7008 |
| 77 | Ga0070711_100092320 | 3300005439 | Bacteria | 2184 |
| 78 | Ga0070705_100127244 | 3300005440 | Bacteria | 1656 |
| 79 | Ga0070705_100257076 | 3300005440 | Bacteria | 1229 |
| 80 | Ga0070705_100464211 | 3300005440 | Bacteria | 953 |
| 81 | Ga0070708_100024548 | 3300005445 | Bacteria | 5145 |
| 82 | Ga0070708_100054523 | 3300005445 | Bacteria | 3551 |
| 83 | Ga0070708_100064380 | 3300005445 | Bacteria | 3285 |
| 84 | Ga0070708_100113564 | 3300005445 | Bacteria | 2491 |
| 85 | Ga0070708_100122998 | 3300005445 | Bacteria | 2395 |
| 86 | Ga0070708_100151226 | 3300005445 | Bacteria | 2159 |
| 87 | Ga0070708_100161868 | 3300005445 | Bacteria | 2085 |
| 88 | Ga0070708_100266755 | 3300005445 | Bacteria | 1610 |
| 89 | Ga0070708_100311554 | 3300005445 | Bacteria | 1482 |
| 90 | Ga0070708_100663491 | 3300005445 | Bacteria | 982 |
| 91 | Ga0070708_100730331 | 3300005445 | Bacteria | 932 |
| 92 | Ga0070663_100005549 | 3300005455 | Bacteria | 7505 |
| 93 | Ga0070663_100112608 | 3300005455 | Bacteria | 2047 |
| 94 | Ga0070678_100066069 | 3300005456 | Bacteria | 2688 |
| 95 | Ga0070678_100080520 | 3300005456 | Bacteria | 2467 |
| 96 | Ga0070678_100156862 | 3300005456 | Bacteria | 1839 |
| 97 | Ga0070678_100327934 | 3300005456 | Bacteria | 1309 |
| 98 | Ga0070706_100012158 | 3300005467 | Bacteria | 7980 |
| 99 | Ga0070706_100016163 | 3300005467 | Bacteria | 6892 |
| 100 | Ga0070706_100072517 | 3300005467 | Bacteria | 3186 |
| 101 | Ga0070706_100079961 | 3300005467 | Bacteria | 3026 |
| 102 | Ga0070706_100130046 | 3300005467 | Bacteria | 2349 |
| 103 | Ga0070706_100160426 | 3300005467 | Bacteria | 2099 |
| 104 | Ga0070706_100170757 | 3300005467 | Bacteria | 2030 |
| 105 | Ga0070707_100006197 | 3300005468 | Bacteria | 11136 |
| 106 | Ga0070707_100038796 | 3300005468 | Bacteria | 4550 |
| 107 | Ga0070707_100045512 | 3300005468 | Bacteria | 4200 |
| 108 | Ga0070707_100102530 | 3300005468 | Bacteria | 2772 |
| 109 | Ga0070707_100125668 | 3300005468 | Bacteria | 2492 |
| 110 | Ga0070707_100226629 | 3300005468 | Bacteria | 1820 |
| 111 | Ga0070707_100228584 | 3300005468 | Bacteria | 1811 |
| 112 | Ga0070707_100274638 | 3300005468 | Bacteria | 1638 |
| 113 | Ga0070707_100649249 | 3300005468 | Bacteria | 1018 |
| 114 | Ga0070698_100001112 | 3300005471 | Bacteria | 29679 |
| 115 | Ga0070698_100005647 | 3300005471 | Bacteria | 13693 |
| 116 | Ga0070698_100019100 | 3300005471 | Bacteria | 7204 |
| 117 | Ga0070698_100021612 | 3300005471 | Bacteria | 6738 |
| 118 | Ga0070698_100156479 | 3300005471 | Bacteria | 2225 |
| 119 | Ga0070698_100166430 | 3300005471 | Bacteria | 2147 |
| 120 | Ga0070698_100542271 | 3300005471 | Bacteria | 1102 |
| 121 | Ga0070699_100000729 | 3300005518 | Bacteria | 30443 |
| 122 | Ga0070679_100003860 | 3300005530 | Bacteria | 13768 |
| 123 | Ga0070679_100069739 | 3300005530 | Bacteria | 3506 |
| 124 | Ga0070679_100118973 | 3300005530 | Bacteria | 2626 |
| 125 | Ga0070679_100144341 | 3300005530 | Bacteria | 2358 |
| 126 | Ga0070684_100074673 | 3300005535 | Bacteria | 2989 |
| 127 | Ga0070684_100209076 | 3300005535 | Bacteria | 1778 |
| 128 | Ga0070697_100005019 | 3300005536 | Bacteria | 10167 |
| 129 | Ga0068853_100119896 | 3300005539 | Bacteria | 2345 |
| 130 | Ga0070672_100471689 | 3300005543 | Bacteria | 1083 |
| 131 | Ga0070686_100094529 | 3300005544 | Bacteria | 2006 |
| 132 | Ga0070696_100024799 | 3300005546 | Bacteria | 4075 |
| 133 | Ga0070665_100028430 | 3300005548 | Bacteria | 5630 |
| 134 | Ga0070665_100537786 | 3300005548 | Bacteria | 1180 |
| 135 | Ga0068855_100003675 | 3300005563 | Bacteria | 18765 |
| 136 | Ga0068855_100058253 | 3300005563 | Bacteria | 4525 |
| 137 | Ga0068857_100167057 | 3300005577 | Bacteria | 1999 |
| 138 | Ga0068857_100213641 | 3300005577 | Bacteria | 1761 |
| 139 | Ga0068857_100439894 | 3300005577 | Bacteria | 1218 |
| 140 | Ga0068857_100866884 | 3300005577 | Bacteria | 865 |
| 141 | Ga0068854_100276546 | 3300005578 | Bacteria | 1350 |
| 142 | Ga0068856_100140798 | 3300005614 | Bacteria | 2419 |
| 143 | Ga0068856_100183391 | 3300005614 | Bacteria | 2107 |
| 144 | Ga0068856_100278279 | 3300005614 | Bacteria | 1690 |
| 145 | Ga0068856_100364041 | 3300005614 | Bacteria | 1464 |
| 146 | Ga0068852_100026604 | 3300005616 | Bacteria | 4706 |
| 147 | Ga0068852_100906535 | 3300005616 | Bacteria | 899 |
| 148 | Ga0068861_100660636 | 3300005719 | Bacteria | 967 |
| 149 | Ga0068870_10259524 | 3300005840 | Bacteria | 1081 |
| 150 | Ga0068870_10709228 | 3300005840 | Bacteria | 695 |
| 151 | Ga0068863_100235921 | 3300005841 | Bacteria | 1765 |
| 152 | Ga0068858_100222605 | 3300005842 | Bacteria | 1787 |
| 153 | Ga0068860_100020303 | 3300005843 | Bacteria | 6434 |
| 154 | Ga0068860_100992665 | 3300005843 | Bacteria | 857 |
| 155 | Ga0068862_100817927 | 3300005844 | Bacteria | 911 |
| 156 | Ga0081455_10028886 | 3300005937 | Bacteria | 5061 |
| 157 | Ga0081455_10409815 | 3300005937 | Bacteria | 938 |
| 158 | Ga0081540_1000103 | 3300005983 | Bacteria | 91274 |
| 159 | Ga0081540_1000130 | 3300005983 | Bacteria | 80050 |
| 160 | Ga0070717_10002393 | 3300006028 | Bacteria | 13226 |
| 161 | Ga0070717_10010873 | 3300006028 | Bacteria | 6890 |
| 162 | Ga0070717_10022805 | 3300006028 | Bacteria | 4952 |
| 163 | Ga0070717_10029301 | 3300006028 | Bacteria | 4414 |
| 164 | Ga0070717_10035437 | 3300006028 | Bacteria | 4039 |
| 165 | Ga0070717_10065911 | 3300006028 | Bacteria | 3011 |
| 166 | Ga0070717_10074834 | 3300006028 | Bacteria | 2832 |
| 167 | Ga0070717_10079326 | 3300006028 | Bacteria | 2752 |
| 168 | Ga0070717_10263055 | 3300006028 | Bacteria | 1526 |
| 169 | Ga0070717_10358925 | 3300006028 | Bacteria | 1304 |
| 170 | Ga0070715_10000255 | 3300006163 | Bacteria | 12867 |
| 171 | Ga0070715_10011521 | 3300006163 | Bacteria | 3187 |
| 172 | Ga0070715_10013066 | 3300006163 | Bacteria | 3041 |
| 173 | Ga0070715_10018662 | 3300006163 | Bacteria | 2647 |
| 174 | Ga0070715_10049240 | 3300006163 | Bacteria | 1805 |
| 175 | Ga0070716_100001078 | 3300006173 | Bacteria | 11955 |
| 176 | Ga0070716_100005226 | 3300006173 | Bacteria | 6274 |
| 177 | Ga0070716_100005653 | 3300006173 | Bacteria | 6072 |
| 178 | Ga0070716_100037766 | 3300006173 | Bacteria | 2671 |
| 179 | Ga0070716_100202120 | 3300006173 | Bacteria | 1322 |
| 180 | Ga0070712_100018127 | 3300006175 | Bacteria | 4568 |
| 181 | Ga0070712_100025150 | 3300006175 | Bacteria | 3954 |
| 182 | Ga0070712_100046585 | 3300006175 | Bacteria | 2998 |
| 183 | Ga0070712_100050808 | 3300006175 | Bacteria | 2886 |
| 184 | Ga0070712_100063668 | 3300006175 | Bacteria | 2612 |
| 185 | Ga0070712_100123023 | 3300006175 | Bacteria | 1955 |
| 186 | Ga0070712_100281065 | 3300006175 | Bacteria | 1341 |
| 187 | Ga0070712_100436970 | 3300006175 | Bacteria | 1087 |
| 188 | Ga0070712_100591178 | 3300006175 | Bacteria | 939 |
| 189 | Ga0070712_100674773 | 3300006175 | Bacteria | 879 |
| 190 | Ga0070712_100700525 | 3300006175 | Bacteria | 863 |
| 191 | Ga0075433_10028568 | 3300006852 | Bacteria | 4743 |
| 192 | Ga0075433_10051337 | 3300006852 | Bacteria | 3591 |
| 193 | Ga0075433_10401172 | 3300006852 | Bacteria | 1210 |
| 194 | Ga0075434_100007625 | 3300006871 | Bacteria | 10013 |
| 195 | Ga0075434_100008042 | 3300006871 | Bacteria | 9778 |
| 196 | Ga0075434_100078182 | 3300006871 | Bacteria | 3304 |
| 197 | Ga0075436_100031792 | 3300006914 | Bacteria | 3636 |
| 198 | Ga0075436_100337997 | 3300006914 | Bacteria | 1084 |
| 199 | Ga0075436_100455571 | 3300006914 | Bacteria | 932 |
| 200 | Ga0075435_100004503 | 3300007076 | Bacteria | 9579 |
| 201 | Ga0075435_100078422 | 3300007076 | Bacteria | 2708 |
| 202 | Ga0075435_100243047 | 3300007076 | Bacteria | 1531 |
| 203 | Ga0075435_100442782 | 3300007076 | Bacteria | 1120 |
| 204 | Ga0105240_10007777 | 3300009093 | Bacteria | 15496 |
| 205 | Ga0105240_10241580 | 3300009093 | Bacteria | 2093 |
| 206 | Ga0111539_10047678 | 3300009094 | Bacteria | 5119 |
| 207 | Ga0105245_10045968 | 3300009098 | Bacteria | 3900 |
| 208 | Ga0105245_10278576 | 3300009098 | Bacteria | 1634 |
| 209 | Ga0105247_10061240 | 3300009101 | Bacteria | 2333 |
| 210 | Ga0114129_10005099 | 3300009147 | Bacteria | 18498 |
| 211 | Ga0114129_10322768 | 3300009147 | Bacteria | 2052 |
| 212 | Ga0105243_10156438 | 3300009148 | Bacteria | 1960 |
| 213 | Ga0105243_10200630 | 3300009148 | Bacteria | 1749 |
| 214 | Ga0105243_10511658 | 3300009148 | Bacteria | 1140 |
| 215 | Ga0105242_10324564 | 3300009176 | Bacteria | 1413 |
| 216 | Ga0105242_10498852 | 3300009176 | Bacteria | 1157 |
| 217 | Ga0105248_10383261 | 3300009177 | Bacteria | 1583 |
| 218 | Ga0105237_10184819 | 3300009545 | Bacteria | 2084 |
| 219 | Ga0105238_10273249 | 3300009551 | Bacteria | 1670 |
| 220 | Ga0105238_10331082 | 3300009551 | Bacteria | 1510 |
| 221 | Ga0105238_10388520 | 3300009551 | Bacteria | 1388 |
| 222 | Ga0105238_10650636 | 3300009551 | Bacteria | 1064 |
| 223 | Ga0105249_10406098 | 3300009553 | Bacteria | 1393 |
| 224 | Ga0105249_10527985 | 3300009553 | Bacteria | 1228 |
| 225 | Ga0105239_10867999 | 3300010375 | Bacteria | 1035 |
| 226 | Ga0105246_10043535 | 3300011119 | Bacteria | 3047 |
| 227 | Ga0105246_10250241 | 3300011119 | Bacteria | 1406 |
| 228 | Ga0157343_1005224 | 3300012488 | Bacteria | 835 |
| 229 | Ga0157373_10368541 | 3300013100 | Bacteria | 1026 |
| 230 | Ga0157371_10138349 | 3300013102 | Bacteria | 1734 |
| 231 | Ga0157370_10018593 | 3300013104 | Bacteria | 6986 |
| 232 | Ga0157370_10019457 | 3300013104 | Bacteria | 6810 |
| 233 | Ga0157370_10199558 | 3300013104 | Bacteria | 1856 |
| 234 | Ga0157369_10006138 | 3300013105 | Bacteria | 13943 |
| 235 | Ga0157369_10010683 | 3300013105 | Bacteria | 10448 |
| 236 | Ga0157369_10014330 | 3300013105 | Bacteria | 8953 |
| 237 | Ga0157369_10051322 | 3300013105 | Bacteria | 4463 |
| 238 | Ga0157369_10200696 | 3300013105 | Bacteria | 2094 |
| 239 | Ga0157369_10207531 | 3300013105 | Bacteria | 2054 |
| 240 | Ga0157369_10268349 | 3300013105 | Bacteria | 1779 |
| 241 | Ga0157369_10425079 | 3300013105 | Bacteria | 1377 |
| 242 | Ga0157369_10538257 | 3300013105 | Bacteria | 1207 |
| 243 | Ga0157369_10723962 | 3300013105 | Bacteria | 1024 |
| 244 | Ga0157369_11226764 | 3300013105 | Bacteria | 765 |
| 245 | Ga0157374_10100418 | 3300013296 | Bacteria | 2774 |
| 246 | Ga0157374_10156334 | 3300013296 | Bacteria | 2219 |
| 247 | Ga0157374_10638624 | 3300013296 | Bacteria | 1076 |
| 248 | Ga0157374_10925550 | 3300013296 | Bacteria | 890 |
| 249 | Ga0157372_10382916 | 3300013307 | Bacteria | 1639 |
| 250 | Ga0157372_10393051 | 3300013307 | Bacteria | 1616 |
| 251 | Ga0157372_10516537 | 3300013307 | Bacteria | 1392 |
| 252 | Ga0157379_10477127 | 3300014968 | Bacteria | 1154 |
| 253 | Ga0157376_10125435 | 3300014969 | Bacteria | 2282 |
| 254 | Ga0157376_10168148 | 3300014969 | Bacteria | 1994 |
| 255 | Ga0197907_10035628 | 3300020069 | Bacteria | 1247 |
| 256 | Ga0197907_10139501 | 3300020069 | Bacteria | 1035 |
| 257 | Ga0197907_10762157 | 3300020069 | Bacteria | 1247 |
| 258 | Ga0206356_10054100 | 3300020070 | Bacteria | 862 |
| 259 | Ga0206349_1640098 | 3300020075 | Bacteria | 1749 |
| 260 | Ga0206355_1658166 | 3300020076 | Bacteria | 1306 |
| 261 | Ga0206351_10099922 | 3300020077 | Bacteria | 1040 |
| 262 | Ga0206351_10242669 | 3300020077 | Bacteria | 6194 |
| 263 | Ga0206351_10825820 | 3300020077 | Bacteria | 912 |
| 264 | Ga0206354_10920257 | 3300020081 | Bacteria | 1555 |
| 265 | Ga0206354_11626196 | 3300020081 | Bacteria | 1265 |
| 266 | Ga0206353_10200660 | 3300020082 | Bacteria | 2684 |
| 267 | Ga0206353_10769160 | 3300020082 | Bacteria | 1505 |
| 268 | Ga0206353_11819336 | 3300020082 | Bacteria | 2259 |
| 269 | Ga0206353_11848666 | 3300020082 | Bacteria | 7107 |
| 270 | Ga0213875_10000485 | 3300021388 | Bacteria | 33939 |
| 271 | Ga0213875_10001030 | 3300021388 | Bacteria | 19784 |
| 272 | Ga0213875_10004119 | 3300021388 | Bacteria | 8061 |
| 273 | Ga0213875_10119531 | 3300021388 | Bacteria | 1231 |
| 274 | Ga0224712_10021488 | 3300022467 | Bacteria | 2209 |
| 275 | Ga0224712_10041525 | 3300022467 | Bacteria | 1737 |
| 276 | Ga0224712_10173690 | 3300022467 | Bacteria | 968 |
| 277 | Ga0228598_1023408 | 3300024227 | Bacteria | 1215 |
| 278 | Ga0207692_10000513 | 3300025898 | Bacteria | 13703 |
| 279 | Ga0207692_10002081 | 3300025898 | Bacteria | 7648 |
| 280 | Ga0207692_10002757 | 3300025898 | Bacteria | 6770 |
| 281 | Ga0207692_10004411 | 3300025898 | Bacteria | 5569 |
| 282 | Ga0207692_10050271 | 3300025898 | Bacteria | 2107 |
| 283 | Ga0207692_10114231 | 3300025898 | Bacteria | 1502 |
| 284 | Ga0207692_10325867 | 3300025898 | Bacteria | 941 |
| 285 | Ga0207692_10466260 | 3300025898 | Bacteria | 797 |
| 286 | Ga0207685_10004862 | 3300025905 | Bacteria | 3474 |
| 287 | Ga0207685_10007066 | 3300025905 | Bacteria | 3104 |
| 288 | Ga0207685_10022322 | 3300025905 | Bacteria | 2137 |
| 289 | Ga0207685_10228053 | 3300025905 | Bacteria | 890 |
| 290 | Ga0207699_10000398 | 3300025906 | Bacteria | 22442 |
| 291 | Ga0207699_10000640 | 3300025906 | Bacteria | 16963 |
| 292 | Ga0207699_10001707 | 3300025906 | Bacteria | 10405 |
| 293 | Ga0207699_10040823 | 3300025906 | Bacteria | 2676 |
| 294 | Ga0207699_10066630 | 3300025906 | Bacteria | 2186 |
| 295 | Ga0207643_10261272 | 3300025908 | Bacteria | 1069 |
| 296 | Ga0207705_10051953 | 3300025909 | Bacteria | 2950 |
| 297 | Ga0207705_10227591 | 3300025909 | Bacteria | 1417 |
| 298 | Ga0207684_10004970 | 3300025910 | Bacteria | 12399 |
| 299 | Ga0207684_10013951 | 3300025910 | Bacteria | 6941 |
| 300 | Ga0207684_10040034 | 3300025910 | Bacteria | 3973 |
| 301 | Ga0207684_10127047 | 3300025910 | Bacteria | 2188 |
| 302 | Ga0207684_10196275 | 3300025910 | Bacteria | 1741 |
| 303 | Ga0207684_10307063 | 3300025910 | Bacteria | 1368 |
| 304 | Ga0207654_10245255 | 3300025911 | Bacteria | 1199 |
| 305 | Ga0207707_10033436 | 3300025912 | Bacteria | 4500 |
| 306 | Ga0207707_10062431 | 3300025912 | Bacteria | 3242 |
| 307 | Ga0207707_10094415 | 3300025912 | Bacteria | 2613 |
| 308 | Ga0207695_10014617 | 3300025913 | Bacteria | 9283 |
| 309 | Ga0207695_10529116 | 3300025913 | Bacteria | 1060 |
| 310 | Ga0207671_10660064 | 3300025914 | Bacteria | 833 |
| 311 | Ga0207693_10004303 | 3300025915 | Bacteria | 12057 |
| 312 | Ga0207693_10023999 | 3300025915 | Bacteria | 4841 |
| 313 | Ga0207693_10025688 | 3300025915 | Bacteria | 4668 |
| 314 | Ga0207693_10062289 | 3300025915 | Bacteria | 2922 |
| 315 | Ga0207693_10102425 | 3300025915 | Bacteria | 2245 |
| 316 | Ga0207693_10150033 | 3300025915 | Bacteria | 1833 |
| 317 | Ga0207693_10164570 | 3300025915 | Bacteria | 1746 |
| 318 | Ga0207693_10404670 | 3300025915 | Bacteria | 1067 |
| 319 | Ga0207663_10001861 | 3300025916 | Bacteria | 9981 |
| 320 | Ga0207663_10007756 | 3300025916 | Bacteria | 5588 |
| 321 | Ga0207663_10013410 | 3300025916 | Bacteria | 4454 |
| 322 | Ga0207660_10063046 | 3300025917 | Bacteria | 2671 |
| 323 | Ga0207662_10132289 | 3300025918 | Bacteria | 1574 |
| 324 | Ga0207657_10050386 | 3300025919 | Bacteria | 3624 |
| 325 | Ga0207657_10056915 | 3300025919 | Bacteria | 3372 |
| 326 | Ga0207657_10202813 | 3300025919 | Bacteria | 1595 |
| 327 | Ga0207652_10012809 | 3300025921 | Bacteria | 6781 |
| 328 | Ga0207652_10027724 | 3300025921 | Bacteria | 4723 |
| 329 | Ga0207652_10082744 | 3300025921 | Bacteria | 2809 |
| 330 | Ga0207652_10225832 | 3300025921 | Bacteria | 1687 |
| 331 | Ga0207646_10002286 | 3300025922 | Bacteria | 22759 |
| 332 | Ga0207646_10002860 | 3300025922 | Bacteria | 20047 |
| 333 | Ga0207646_10008897 | 3300025922 | Bacteria | 10001 |
| 334 | Ga0207646_10196833 | 3300025922 | Bacteria | 1820 |
| 335 | Ga0207646_10229098 | 3300025922 | Bacteria | 1679 |
| 336 | Ga0207694_10468723 | 3300025924 | Bacteria | 1053 |
| 337 | Ga0207694_10607923 | 3300025924 | Bacteria | 920 |
| 338 | Ga0207694_10795546 | 3300025924 | Bacteria | 799 |
| 339 | Ga0207687_10288232 | 3300025927 | Bacteria | 1319 |
| 340 | Ga0207687_10457877 | 3300025927 | Bacteria | 1059 |
| 341 | Ga0207700_10000812 | 3300025928 | Bacteria | 18071 |
| 342 | Ga0207700_10001889 | 3300025928 | Bacteria | 11889 |
| 343 | Ga0207700_10002281 | 3300025928 | Bacteria | 11009 |
| 344 | Ga0207700_10004320 | 3300025928 | Bacteria | 8358 |
| 345 | Ga0207700_10008564 | 3300025928 | Bacteria | 6347 |
| 346 | Ga0207700_10010553 | 3300025928 | Bacteria | 5837 |
| 347 | Ga0207700_10014302 | 3300025928 | Bacteria | 5196 |
| 348 | Ga0207700_10017449 | 3300025928 | Bacteria | 4795 |
| 349 | Ga0207700_10026367 | 3300025928 | Bacteria | 4050 |
| 350 | Ga0207700_10034078 | 3300025928 | Bacteria | 3651 |
| 351 | Ga0207700_10034433 | 3300025928 | Bacteria | 3636 |
| 352 | Ga0207700_10039333 | 3300025928 | Bacteria | 3442 |
| 353 | Ga0207700_10040856 | 3300025928 | Bacteria | 3388 |
| 354 | Ga0207700_10147551 | 3300025928 | Bacteria | 1940 |
| 355 | Ga0207700_10182351 | 3300025928 | Bacteria | 1759 |
| 356 | Ga0207664_10000765 | 3300025929 | Bacteria | 21788 |
| 357 | Ga0207664_10000771 | 3300025929 | Bacteria | 21685 |
| 358 | Ga0207664_10000939 | 3300025929 | Bacteria | 19590 |
| 359 | Ga0207664_10003924 | 3300025929 | Bacteria | 9997 |
| 360 | Ga0207664_10004915 | 3300025929 | Bacteria | 9083 |
| 361 | Ga0207664_10004934 | 3300025929 | Bacteria | 9073 |
| 362 | Ga0207664_10005706 | 3300025929 | Bacteria | 8506 |
| 363 | Ga0207664_10005902 | 3300025929 | Bacteria | 8378 |
| 364 | Ga0207664_10019119 | 3300025929 | Bacteria | 5058 |
| 365 | Ga0207664_10019315 | 3300025929 | Bacteria | 5035 |
| 366 | Ga0207664_10022154 | 3300025929 | Bacteria | 4739 |
| 367 | Ga0207664_10032513 | 3300025929 | Bacteria | 3999 |
| 368 | Ga0207664_10069344 | 3300025929 | Bacteria | 2835 |
| 369 | Ga0207664_10071539 | 3300025929 | Bacteria | 2794 |
| 370 | Ga0207664_10097492 | 3300025929 | Bacteria | 2422 |
| 371 | Ga0207664_10182691 | 3300025929 | Bacteria | 1801 |
| 372 | Ga0207664_10246841 | 3300025929 | Bacteria | 1556 |
| 373 | Ga0207664_10283067 | 3300025929 | Bacteria | 1455 |
| 374 | Ga0207664_10337089 | 3300025929 | Bacteria | 1333 |
| 375 | Ga0207664_10389100 | 3300025929 | Bacteria | 1239 |
| 376 | Ga0207664_10413691 | 3300025929 | Bacteria | 1200 |
| 377 | Ga0207664_10483762 | 3300025929 | Bacteria | 1107 |
| 378 | Ga0207664_10630831 | 3300025929 | Bacteria | 963 |
| 379 | Ga0207644_10063331 | 3300025931 | Bacteria | 2685 |
| 380 | Ga0207690_10098230 | 3300025932 | Bacteria | 2085 |
| 381 | Ga0207690_10565882 | 3300025932 | Bacteria | 925 |
| 382 | Ga0207706_10090119 | 3300025933 | Bacteria | 2696 |
| 383 | Ga0207686_10228765 | 3300025934 | Bacteria | 1347 |
| 384 | Ga0207704_10147233 | 3300025938 | Bacteria | 1656 |
| 385 | Ga0207665_10001933 | 3300025939 | Bacteria | 13938 |
| 386 | Ga0207665_10009998 | 3300025939 | Bacteria | 6229 |
| 387 | Ga0207665_10011289 | 3300025939 | Bacteria | 5862 |
| 388 | Ga0207665_10051131 | 3300025939 | Bacteria | 2780 |
| 389 | Ga0207665_10130971 | 3300025939 | Bacteria | 1780 |
| 390 | Ga0207665_10162515 | 3300025939 | Bacteria | 1607 |
| 391 | Ga0207665_10179907 | 3300025939 | Bacteria | 1531 |
| 392 | Ga0207691_10122839 | 3300025940 | Bacteria | 2299 |
| 393 | Ga0207689_10022270 | 3300025942 | Bacteria | 5327 |
| 394 | Ga0207661_10009603 | 3300025944 | Bacteria | 6946 |
| 395 | Ga0207661_10021010 | 3300025944 | Bacteria | 4888 |
| 396 | Ga0207661_10048711 | 3300025944 | Bacteria | 3369 |
| 397 | Ga0207667_10049669 | 3300025949 | Bacteria | 4429 |
| 398 | Ga0207667_10053071 | 3300025949 | Bacteria | 4267 |
| 399 | Ga0207667_10191588 | 3300025949 | Bacteria | 2098 |
| 400 | Ga0207668_10012489 | 3300025972 | Bacteria | 5200 |
| 401 | Ga0207668_10444794 | 3300025972 | Bacteria | 1105 |
| 402 | Ga0207677_10991396 | 3300026023 | Bacteria | 761 |
| 403 | Ga0207703_10134988 | 3300026035 | Bacteria | 2135 |
| 404 | Ga0207639_10169491 | 3300026041 | Bacteria | 1847 |
| 405 | Ga0207678_10012201 | 3300026067 | Bacteria | 7547 |
| 406 | Ga0207678_10013981 | 3300026067 | Bacteria | 7055 |
| 407 | Ga0207678_10075322 | 3300026067 | Bacteria | 2891 |
| 408 | Ga0207678_10100422 | 3300026067 | Bacteria | 2472 |
| 409 | Ga0207678_10188634 | 3300026067 | Bacteria | 1761 |
| 410 | Ga0207678_10443145 | 3300026067 | Bacteria | 1128 |
| 411 | Ga0207702_10020304 | 3300026078 | Bacteria | 5503 |
| 412 | Ga0207702_10089279 | 3300026078 | Bacteria | 2695 |
| 413 | Ga0207702_10417796 | 3300026078 | Bacteria | 1296 |
| 414 | Ga0207641_10165904 | 3300026088 | Bacteria | 2011 |
| 415 | Ga0207641_10647820 | 3300026088 | Bacteria | 1037 |
| 416 | Ga0207676_10247945 | 3300026095 | Bacteria | 1601 |
| 417 | Ga0207674_10222785 | 3300026116 | Bacteria | 1834 |
| 418 | Ga0207674_10368365 | 3300026116 | Bacteria | 1389 |
| 419 | Ga0207674_10395085 | 3300026116 | Bacteria | 1336 |
| 420 | Ga0207683_10005302 | 3300026121 | Bacteria | 11056 |
| 421 | Ga0207683_10045233 | 3300026121 | Bacteria | 3849 |
| 422 | Ga0207683_10148853 | 3300026121 | Bacteria | 2112 |
| 423 | Ga0265357_1001605 | 3300028023 | Bacteria | 1698 |
| 424 | Ga0268266_10084515 | 3300028379 | Bacteria | 2772 |
| 425 | Ga0268266_10283742 | 3300028379 | Bacteria | 1540 |
| 426 | Ga0268264_10650597 | 3300028381 | Bacteria | 1043 |
| 427 | Ga0265337_1000318 | 3300028556 | Bacteria | 25702 |
| 428 | Ga0265326_10013500 | 3300028558 | Bacteria | 2388 |
| 429 | Ga0265319_1003114 | 3300028563 | Bacteria | 8761 |
| 430 | Ga0265334_10001069 | 3300028573 | Bacteria | 13408 |
| 431 | Ga0265323_10002263 | 3300028653 | Bacteria | 8935 |
| 432 | Ga0265336_10003038 | 3300028666 | Bacteria | 6694 |
| 433 | Ga0265336_10005397 | 3300028666 | Bacteria | 4721 |
| 434 | Ga0265336_10017292 | 3300028666 | Bacteria | 2349 |
| 435 | Ga0307515_10006481 | 3300028794 | Bacteria | 23417 |
| 436 | Ga0307515_10061573 | 3300028794 | Bacteria | 5320 |
| 437 | Ga0265338_10000127 | 3300028800 | Bacteria | 139864 |
| 438 | Ga0265338_10000887 | 3300028800 | Bacteria | 50439 |
| 439 | Ga0265338_10006971 | 3300028800 | Bacteria | 14197 |
| 440 | Ga0265338_10009496 | 3300028800 | Bacteria | 11589 |
| 441 | Ga0265338_10012718 | 3300028800 | Bacteria | 9573 |
| 442 | Ga0265324_10004303 | 3300029957 | Bacteria | 6494 |
| 443 | Ga0265777_101856 | 3300030877 | Bacteria | 1173 |
| 444 | Ga0265776_103552 | 3300030880 | Bacteria | 764 |
| 445 | Ga0265760_10014273 | 3300031090 | Bacteria | 2275 |
| 446 | Ga0265760_10039655 | 3300031090 | Bacteria | 1402 |
| 447 | Ga0265760_10132585 | 3300031090 | Bacteria | 807 |
| 448 | Ga0265332_10000734 | 3300031238 | Bacteria | 20426 |
| 449 | Ga0265320_10005829 | 3300031240 | Bacteria | 7848 |
| 450 | Ga0265325_10008273 | 3300031241 | Bacteria | 6145 |
| 451 | Ga0265340_10004992 | 3300031247 | Bacteria | 7375 |
| 452 | Ga0265339_10014531 | 3300031249 | Bacteria | 4743 |
| 453 | Ga0265316_10028560 | 3300031344 | Bacteria | 4600 |
| 454 | Ga0307408_100033866 | 3300031548 | Bacteria | 3573 |
| 455 | Ga0307408_100051964 | 3300031548 | Bacteria | 2955 |
| 456 | Ga0307408_100052971 | 3300031548 | Bacteria | 2929 |
| 457 | Ga0265313_10013502 | 3300031595 | Bacteria | 4897 |
| 458 | Ga0310105_104307 | 3300031666 | Bacteria | 1600 |
| 459 | Ga0310111_121143 | 3300031667 | Bacteria | 791 |
| 460 | Ga0310119_108127 | 3300031686 | Bacteria | 1285 |
| 461 | Ga0265314_10028985 | 3300031711 | Bacteria | 4119 |
| 462 | Ga0265342_10019702 | 3300031712 | Bacteria | 4342 |
| 463 | Ga0307405_10144105 | 3300031731 | Bacteria | 1666 |
| 464 | Ga0307405_10188515 | 3300031731 | Bacteria | 1487 |
| 465 | Ga0307405_10330421 | 3300031731 | Bacteria | 1168 |
| 466 | Ga0307518_10000657 | 3300031838 | Bacteria | 25969 |
| 467 | Ga0307410_10010519 | 3300031852 | Bacteria | 5247 |
| 468 | Ga0307410_10024284 | 3300031852 | Bacteria | 3785 |
| 469 | Ga0307410_10025544 | 3300031852 | Bacteria | 3708 |
| 470 | Ga0307410_10079471 | 3300031852 | Bacteria | 2298 |
| 471 | Ga0307406_10545402 | 3300031901 | Bacteria | 948 |
| 472 | Ga0307407_10035278 | 3300031903 | Bacteria | 2747 |
| 473 | Ga0307407_10048165 | 3300031903 | Bacteria | 2424 |
| 474 | Ga0307412_10551956 | 3300031911 | Bacteria | 968 |
| 475 | Ga0307412_10722364 | 3300031911 | Bacteria | 857 |
| 476 | Ga0307409_100056916 | 3300031995 | Bacteria | 3026 |
| 477 | Ga0307409_100178314 | 3300031995 | Bacteria | 1878 |
| 478 | Ga0307409_100254817 | 3300031995 | Bacteria | 1607 |
| 479 | Ga0307409_100682447 | 3300031995 | Bacteria | 1024 |
| 480 | Ga0307409_100711869 | 3300031995 | Bacteria | 1004 |
| 481 | Ga0307416_100018930 | 3300032002 | Bacteria | 4867 |
| 482 | Ga0307416_100052350 | 3300032002 | Bacteria | 3268 |
| 483 | Ga0307416_100059920 | 3300032002 | Bacteria | 3096 |
| 484 | Ga0307416_100129365 | 3300032002 | Bacteria | 2269 |
| 485 | Ga0307416_100180228 | 3300032002 | Bacteria | 1979 |
| 486 | Ga0307416_100327538 | 3300032002 | Bacteria | 1538 |
| 487 | Ga0307414_10018542 | 3300032004 | Bacteria | 4289 |
| 488 | Ga0307414_10153787 | 3300032004 | Bacteria | 1818 |
| 489 | Ga0307414_10689350 | 3300032004 | Bacteria | 924 |
| 490 | Ga0307411_10235844 | 3300032005 | Bacteria | 1429 |
| 491 | Ga0307415_100014934 | 3300032126 | Bacteria | 4583 |
| 492 | Ga0307415_100022425 | 3300032126 | Bacteria | 3896 |
| 493 | Ga0307415_100047305 | 3300032126 | Bacteria | 2895 |
| 494 | Ga0307415_100118178 | 3300032126 | Bacteria | 1982 |
| 495 | Ga0307415_100178508 | 3300032126 | Bacteria | 1663 |
| 496 | Ga0307507_10049795 | 3300033179 | Bacteria | 4053 |
| 497 | Ga0373958_0007766 | 3300034819 | Bacteria | 1719 |
| 498 | Ga0373926_0001872 | 3300035083 | Bacteria | 6559 |
| 499 | Ga0373926_0038864 | 3300035083 | Bacteria | 1696 |
| 500 | Ga0373926_0052855 | 3300035083 | Bacteria | 1469 |
| 501 | Ga0373934_0000165 | 3300035086 | Bacteria | 24127 |
| 502 | Ga0373934_0012715 | 3300035086 | Bacteria | 3178 |
| 503 | Ga0373934_0022630 | 3300035086 | Bacteria | 2425 |
| 504 | Ga0373934_0032141 | 3300035086 | Bacteria | 2057 |
| 505 | Ga0373934_0032769 | 3300035086 | Bacteria | 2039 |
| 506 | Ga0373934_0044429 | 3300035086 | Bacteria | 1756 |
| 507 | Ga0373934_0049241 | 3300035086 | Bacteria | 1668 |
| 508 | Ga0373944_0000345 | 3300035089 | Bacteria | 10451 |
| 509 | Ga0373949_0011260 | 3300035090 | Bacteria | 1968 |
| 510 | Ga0373952_0015366 | 3300035092 | Bacteria | 1545 |
| 511 | Ga0373923_0009580 | 3300035111 | Bacteria | 3501 |
| 512 | Ga0373923_0013437 | 3300035111 | Bacteria | 3053 |
| 513 | Ga0373923_0055176 | 3300035111 | Bacteria | 1674 |
| 514 | Ga0373923_0113084 | 3300035111 | Bacteria | 1207 |
| 515 | Ga0373936_0000448 | 3300035113 | Bacteria | 13805 |
| 516 | Ga0373936_0001537 | 3300035113 | Bacteria | 8404 |
| 517 | Ga0373936_0018143 | 3300035113 | Bacteria | 2715 |
| 518 | Ga0373936_0039864 | 3300035113 | Bacteria | 1880 |
| 519 | Ga0373945_0000682 | 3300035116 | Bacteria | 9796 |
| 520 | Ga0373953_0000062 | 3300035117 | Bacteria | 27440 |
| 521 | Ga0373953_0013157 | 3300035117 | Bacteria | 2948 |
| 522 | Ga0373953_0047949 | 3300035117 | Bacteria | 1719 |
| 523 | Ga0373954_0007167 | 3300035118 | Bacteria | 4868 |
| 524 | Ga0373954_0021224 | 3300035118 | Bacteria | 2939 |
| 525 | Ga0373954_0036457 | 3300035118 | Bacteria | 2283 |
| 526 | Ga0373954_0039715 | 3300035118 | Bacteria | 2191 |
| 527 | Ga0373954_0061848 | 3300035118 | Bacteria | 1768 |
| 528 | Ga0373956_0000061 | 3300035119 | Bacteria | 37279 |
| 529 | Ga0373956_0029111 | 3300035119 | Bacteria | 2407 |
| 530 | Ga0373956_0030168 | 3300035119 | Bacteria | 2368 |
| 531 | Ga0373956_0030579 | 3300035119 | Bacteria | 2355 |
| 532 | Ga0373956_0066933 | 3300035119 | Bacteria | 1634 |
| 533 | Ga0373956_0081202 | 3300035119 | Bacteria | 1488 |
| 534 | Ga0373956_0170712 | 3300035119 | Bacteria | 1026 |
| 535 | Ga0373957_0000042 | 3300035120 | Bacteria | 33397 |
| 536 | Ga0373957_0013829 | 3300035120 | Bacteria | 2747 |
| 537 | Ga0373957_0037156 | 3300035120 | Bacteria | 1818 |
| 538 | Ga0373957_0068612 | 3300035120 | Bacteria | 1383 |
| 539 | Ga0373957_0105112 | 3300035120 | Bacteria | 1133 |
| 540 | Ga0373960_0161888 | 3300035121 | Bacteria | 771 |
| 541 | Ga0373943_0000127 | 3300035170 | Bacteria | 28810 |
| 542 | Ga0373943_0018233 | 3300035170 | Bacteria | 3223 |
| 543 | Ga0373943_0051452 | 3300035170 | Bacteria | 2028 |
| 544 | Ga0373946_0000467 | 3300035171 | Bacteria | 13372 |
| 545 | Ga0373946_0047740 | 3300035171 | Bacteria | 1779 |
| 546 | Ga0373946_0094167 | 3300035171 | Bacteria | 1332 |
| 547 | Ga0373955_0000106 | 3300035172 | Bacteria | 33578 |
| 548 | Ga0373955_0008015 | 3300035172 | Bacteria | 4882 |
| 549 | Ga0373955_0013101 | 3300035172 | Bacteria | 4000 |
| 550 | Ga0373955_0072504 | 3300035172 | Bacteria | 1929 |
| 551 | Ga0373955_0210032 | 3300035172 | Bacteria | 1160 |
| 552 | Ga0373955_0255352 | 3300035172 | Bacteria | 1051 |
| 553 | Ga0373955_0352651 | 3300035172 | Bacteria | 891 |
| 554 | Ga0373962_0012829 | 3300035242 | Bacteria | 2116 |
| 555 | Ga0373924_0001200 | 3300035410 | Bacteria | 8307 |
| 556 | Ga0373924_0003026 | 3300035410 | Bacteria | 5728 |
| 557 | Ga0373924_0006330 | 3300035410 | Bacteria | 4237 |
| 558 | Ga0373924_0007278 | 3300035410 | Bacteria | 3991 |
| 559 | Ga0373931_0195222 | 3300035691 | Bacteria | 1206 |
| 560 | Ga0373935_0000083 | 3300035692 | Bacteria | 41413 |
| 561 | Ga0373935_0007518 | 3300035692 | Bacteria | 6522 |
| 562 | Ga0373935_0021882 | 3300035692 | Bacteria | 3915 |
| 563 | Ga0373935_0035072 | 3300035692 | Bacteria | 3130 |
| 564 | Ga0373935_0115500 | 3300035692 | Bacteria | 1787 |
| 565 | Ga0373935_0122408 | 3300035692 | Bacteria | 1739 |
| 566 | Ga0373935_0293636 | 3300035692 | Bacteria | 1147 |
| 567 | Ga0373935_0371545 | 3300035692 | Bacteria | 1023 |
| 568 | Ga0373935_0423605 | 3300035692 | Bacteria | 958 |
| 569 | Ga0373935_0553927 | 3300035692 | Bacteria | 838 |
| 570 | Ga0373935_0690063 | 3300035692 | Bacteria | 750 |
| 571 | Ga0373927_0008507 | 3300035695 | Bacteria | 6903 |
| 572 | Ga0373927_0040668 | 3300035695 | Bacteria | 3016 |
| 573 | Ga0373927_0125554 | 3300035695 | Bacteria | 1675 |
| 574 | Ga0373933_0000046 | 3300035724 | Bacteria | 76647 |
| 575 | Ga0373933_0000764 | 3300035724 | Bacteria | 19666 |
| 576 | Ga0373933_0005963 | 3300035724 | Bacteria | 6630 |
| 577 | Ga0373933_0010125 | 3300035724 | Bacteria | 5162 |
| 578 | Ga0373933_0010818 | 3300035724 | Bacteria | 5006 |
| 579 | Ga0373933_0015066 | 3300035724 | Bacteria | 4309 |
| 580 | Ga0373933_0020037 | 3300035724 | Bacteria | 3787 |
| 581 | Ga0373933_0038363 | 3300035724 | Bacteria | 2814 |
| 582 | Ga0373933_0410757 | 3300035724 | Bacteria | 883 |
| 583 | Ga0373947_0000013 | 3300035725 | Bacteria | 145159 |
| 584 | Ga0373947_0007926 | 3300035725 | Bacteria | 6125 |
| 585 | Ga0373947_0031865 | 3300035725 | Bacteria | 3105 |
| 586 | Ga0373947_0036654 | 3300035725 | Bacteria | 2909 |
| 587 | Ga0373947_0045765 | 3300035725 | Bacteria | 2619 |
| 588 | Ga0373947_0063994 | 3300035725 | Bacteria | 2242 |
| 589 | Ga0373947_0209585 | 3300035725 | Bacteria | 1278 |
| 590 | Ga0373947_0243985 | 3300035725 | Bacteria | 1186 |
| 591 | Ga0310104_08455 | 3300036242 | Bacteria | 857 |
| 592 | Ga0373937_0000115 | 3300036401 | Bacteria | 76660 |
| 593 | Ga0373937_0002923 | 3300036401 | Bacteria | 14281 |
| 594 | Ga0373937_0009930 | 3300036401 | Bacteria | 8299 |
| 595 | Ga0373937_0015807 | 3300036401 | Bacteria | 6685 |
| 596 | Ga0373937_0018604 | 3300036401 | Bacteria | 6205 |
| 597 | Ga0373937_0078781 | 3300036401 | Bacteria | 3045 |
| 598 | Ga0373937_0082411 | 3300036401 | Bacteria | 2976 |
| 599 | Ga0373937_0113042 | 3300036401 | Bacteria | 2526 |
| 600 | Ga0373937_0129547 | 3300036401 | Bacteria | 2356 |
| 601 | Ga0373937_0149465 | 3300036401 | Bacteria | 2188 |
| 602 | Ga0373937_0288264 | 3300036401 | Bacteria | 1551 |
| 603 | Ga0265778_011012 | 3300036457 | Bacteria | 1037 |
| 604 | Ga0265778_014753 | 3300036457 | Bacteria | 925 |
| 605 | Ga0265778_018811 | 3300036457 | Bacteria | 841 |
| 606 | Ga0265778_025861 | 3300036457 | Bacteria | 743 |
| 607 | Ga0372808_010397 | 3300036459 | Bacteria | 1309 |
| 608 | Ga0372808_013298 | 3300036459 | Bacteria | 1172 |
| 609 | Ga0373925_0000006 | 3300037068 | Bacteria | 278942 |
| 610 | Ga0373925_0013192 | 3300037068 | Bacteria | 5982 |
| 611 | Ga0373925_0015172 | 3300037068 | Bacteria | 5570 |
| 612 | Ga0373925_0020550 | 3300037068 | Bacteria | 4808 |
| 613 | Ga0373925_0026483 | 3300037068 | Bacteria | 4242 |
| 614 | Ga0373925_0044387 | 3300037068 | Bacteria | 3300 |
| 615 | Ga0373925_0141086 | 3300037068 | Bacteria | 1886 |
| 616 | Ga0373925_0157988 | 3300037068 | Bacteria | 1784 |
| 617 | Ga0373925_0337715 | 3300037068 | Bacteria | 1221 |
| 618 | Ga0395899_0083803 | 3300037312 | Bacteria | 2318 |
| 619 | Ga0395899_0357733 | 3300037312 | Bacteria | 975 |
| 620 | Ga0395900_0054575 | 3300037418 | Bacteria | 4114 |
| 621 | Ga0395900_0082987 | 3300037418 | Bacteria | 3293 |
| 622 | Ga0395900_0092673 | 3300037418 | Bacteria | 3104 |
| 623 | Ga0395898_0018007 | 3300037466 | Bacteria | 7206 |
| 624 | Ga0395898_0018475 | 3300037466 | Bacteria | 7108 |
| 625 | Ga0395898_0144371 | 3300037466 | Bacteria | 2278 |
| 626 | Ga0395898_0493466 | 3300037466 | Bacteria | 1165 |
| 627 | Ga0395905_0220082 | 3300037471 | Bacteria | 1777 |
| 628 | Ga0436364_0037108 | 3300037853 | Bacteria | 71393 |
| 629 | Ga0436364_0117635 | 3300037853 | Bacteria | 37947 |
| 630 | Ga0436364_0303129 | 3300037853 | Bacteria | 102080 |
| 631 | Ga0436364_0367672 | 3300037853 | Bacteria | 2271 |
| 632 | Ga0436364_0564335 | 3300037853 | Bacteria | 2111 |
| 633 | Ga0436364_0609944 | 3300037853 | Bacteria | 826 |
| 634 | Ga0395901_0018489 | 3300038443 | Bacteria | 7115 |
| 635 | Ga0395901_0056756 | 3300038443 | Bacteria | 4073 |
| 636 | Ga0436365_1828923 | 3300039437 | Bacteria | 1624 |
| 637 | Ga0436360_0262833 | 3300039438 | Bacteria | 959 |
| 638 | Ga0436360_1222117 | 3300039438 | Bacteria | 827 |
| 639 | Ga0436361_0002952 | 3300039447 | Bacteria | 847 |
| 640 | Ga0436361_0005383 | 3300039447 | Bacteria | 902 |
| 641 | Ga0436363_0317296 | 3300039450 | Bacteria | 2274 |
| 642 | Ga0436363_1049305 | 3300039450 | Bacteria | 1360 |
| 643 | Ga0436363_1128805 | 3300039450 | Bacteria | 2051 |
| 644 | Ga0436362_0056396 | 3300039453 | Bacteria | 762 |
| 645 | Ga0436362_1050687 | 3300039453 | Bacteria | 1377 |
| 646 | Ga0436362_1130435 | 3300039453 | Bacteria | 857 |
| 647 | Ga0451791_0777094 | 3300041451 | Bacteria | 4813 |
| 648 | Ga0451793_0570611 | 3300041452 | Bacteria | 11405 |
| 649 | Ga0451797_0898786 | 3300041453 | Bacteria | 1400 |
| 650 | Ga0451795_0973011 | 3300041456 | Bacteria | 2589 |
| 651 | Ga0451800_0530642 | 3300041459 | Bacteria | 799 |
| 652 | Ga0451843_0695364 | 3300041509 | Bacteria | 7969 |
| 653 | Ga0451853_2506132 | 3300041512 | Bacteria | 2912 |
| 654 | Ga0466965_0228532 | 3300044683 | Bacteria | 993 |
| 655 | Ga0466966_0300108 | 3300044684 | Bacteria | 965 |
| 656 | Ga0466961_0245966 | 3300044693 | Bacteria | 1099 |
| 657 | Ga0466963_0017558 | 3300044694 | Bacteria | 4462 |
| 658 | Ga0466963_0076171 | 3300044694 | Bacteria | 2265 |
| 659 | Ga0466963_0137736 | 3300044694 | Bacteria | 1690 |
| 660 | Ga0466971_0245579 | 3300044719 | Bacteria | 852 |
| 661 | Ga0466968_0135462 | 3300044735 | Bacteria | 1123 |
| 662 | Ga0466970_0064859 | 3300044765 | Bacteria | 1959 |
| 663 | Ga0466970_0180247 | 3300044765 | Bacteria | 1172 |
| 664 | Ga0466957_0050098 | 3300044842 | Bacteria | 2541 |
| 665 | Ga0466957_0172828 | 3300044842 | Bacteria | 1408 |
| 666 | Ga0466957_0286495 | 3300044842 | Bacteria | 1104 |
| 667 | Ga0466960_0316841 | 3300044901 | Bacteria | 882 |
| 668 | Ga0466960_0547183 | 3300044901 | Bacteria | 682 |
| 669 | Ga0466959_0482100 | 3300045049 | Bacteria | 839 |
| 670 | Ga0466958_0217978 | 3300045836 | Bacteria | 1217 |
| 671 | Ga0466958_0618926 | 3300045836 | Bacteria | 704 |
| 672 | Ga0466967_0009950 | 3300045976 | Bacteria | 7099 |
| 673 | Ga0466967_0024778 | 3300045976 | Bacteria | 4938 |
| 674 | Ga0466967_0075539 | 3300045976 | Bacteria | 3029 |
| 675 | Ga0466967_0206356 | 3300045976 | Bacteria | 1863 |
| 676 | Ga0466967_0234827 | 3300045976 | Bacteria | 1747 |
| 677 | Ga0466967_0350413 | 3300045976 | Bacteria | 1429 |
| 678 | Ga0466967_0655418 | 3300045976 | Bacteria | 1038 |
| 679 | Ga0466967_0769870 | 3300045976 | Bacteria | 955 |
| 680 | Ga0495592_0000166 | 3300046454 | Bacteria | 58865 |
| 681 | Ga0495592_0015558 | 3300046454 | Bacteria | 5772 |
| 682 | Ga0495592_0055960 | 3300046454 | Bacteria | 2916 |
| 683 | Ga0495592_0096440 | 3300046454 | Bacteria | 2114 |
| 684 | Ga0495592_0124689 | 3300046454 | Bacteria | 1809 |
| 685 | Ga0495592_0260506 | 3300046454 | Bacteria | 1142 |
| 686 | Ga0495603_0115365 | 3300046455 | Bacteria | 1566 |
| 687 | Ga0495629_0002265 | 3300046459 | Bacteria | 14832 |
| 688 | Ga0495629_0002959 | 3300046459 | Bacteria | 12934 |
| 689 | Ga0495629_0039481 | 3300046459 | Bacteria | 3322 |
| 690 | Ga0495641_0002211 | 3300046461 | Bacteria | 15517 |
| 691 | Ga0495641_0006393 | 3300046461 | Bacteria | 7644 |
| 692 | Ga0495641_0016080 | 3300046461 | Bacteria | 3955 |
| 693 | Ga0495641_0026755 | 3300046461 | Bacteria | 2811 |
| 694 | Ga0495641_0064513 | 3300046461 | Bacteria | 1650 |
| 695 | Ga0495651_0000067 | 3300046462 | Bacteria | 76665 |
| 696 | Ga0495651_0001741 | 3300046462 | Bacteria | 16787 |
| 697 | Ga0495651_0003120 | 3300046462 | Bacteria | 12783 |
| 698 | Ga0495651_0006413 | 3300046462 | Bacteria | 9003 |
| 699 | Ga0495651_0011288 | 3300046462 | Bacteria | 6867 |
| 700 | Ga0495651_0017640 | 3300046462 | Bacteria | 5524 |
| 701 | Ga0495651_0044041 | 3300046462 | Bacteria | 3459 |
| 702 | Ga0495651_0059181 | 3300046462 | Bacteria | 2938 |
| 703 | Ga0495651_0144457 | 3300046462 | Bacteria | 1721 |
| 704 | Ga0495651_0187785 | 3300046462 | Bacteria | 1457 |
| 705 | Ga0495653_0002855 | 3300046463 | Bacteria | 13808 |
| 706 | Ga0495653_0003019 | 3300046463 | Bacteria | 13492 |
| 707 | Ga0495653_0008818 | 3300046463 | Bacteria | 8257 |
| 708 | Ga0495653_0009962 | 3300046463 | Bacteria | 7776 |
| 709 | Ga0495653_0049954 | 3300046463 | Bacteria | 3218 |
| 710 | Ga0495653_0065592 | 3300046463 | Bacteria | 2732 |
| 711 | Ga0495653_0068170 | 3300046463 | Bacteria | 2669 |
| 712 | Ga0495653_0130307 | 3300046463 | Bacteria | 1781 |
| 713 | Ga0495653_0155901 | 3300046463 | Bacteria | 1590 |
| 714 | Ga0495580_0004032 | 3300046472 | Bacteria | 12391 |
| 715 | Ga0495580_0495234 | 3300046472 | Bacteria | 816 |
| 716 | Ga0495582_0028806 | 3300046473 | Bacteria | 3048 |
| 717 | Ga0495582_0029531 | 3300046473 | Bacteria | 3009 |
| 718 | Ga0495582_0244517 | 3300046473 | Bacteria | 1028 |
| 719 | Ga0495639_0001164 | 3300046475 | Bacteria | 11894 |
| 720 | Ga0495639_0023650 | 3300046475 | Bacteria | 2702 |
| 721 | Ga0495639_0033106 | 3300046475 | Bacteria | 2307 |
| 722 | Ga0495639_0099476 | 3300046475 | Bacteria | 1372 |
| 723 | Ga0495662_0001369 | 3300046476 | Bacteria | 12057 |
| 724 | Ga0495662_0022367 | 3300046476 | Bacteria | 3053 |
| 725 | Ga0495662_0033107 | 3300046476 | Bacteria | 2498 |
| 726 | Ga0495662_0033556 | 3300046476 | Bacteria | 2480 |
| 727 | Ga0495662_0035004 | 3300046476 | Bacteria | 2424 |
| 728 | Ga0495662_0058791 | 3300046476 | Bacteria | 1857 |
| 729 | Ga0495662_0218166 | 3300046476 | Bacteria | 940 |
| 730 | Ga0495664_0001129 | 3300046477 | Bacteria | 13837 |
| 731 | Ga0495664_0008813 | 3300046477 | Bacteria | 5635 |
| 732 | Ga0495664_0018782 | 3300046477 | Bacteria | 3966 |
| 733 | Ga0495664_0025488 | 3300046477 | Bacteria | 3443 |
| 734 | Ga0495664_0055824 | 3300046477 | Bacteria | 2349 |
| 735 | Ga0495664_0100952 | 3300046477 | Bacteria | 1738 |
| 736 | Ga0495664_0181696 | 3300046477 | Bacteria | 1275 |
| 737 | Ga0495664_0441646 | 3300046477 | Bacteria | 779 |
| 738 | Ga0495594_0015879 | 3300046499 | Bacteria | 3961 |
| 739 | Ga0495594_0212143 | 3300046499 | Bacteria | 1104 |
| 740 | Ga0495607_0027343 | 3300046501 | Bacteria | 3528 |
| 741 | Ga0495608_0000095 | 3300046511 | Bacteria | 64067 |
| 742 | Ga0495608_0001055 | 3300046511 | Bacteria | 19397 |
| 743 | Ga0495608_0056758 | 3300046511 | Bacteria | 2585 |
| 744 | Ga0495608_0068711 | 3300046511 | Bacteria | 2316 |
| 745 | Ga0495608_0084913 | 3300046511 | Bacteria | 2053 |
| 746 | Ga0495608_0105356 | 3300046511 | Bacteria | 1815 |
| 747 | Ga0495608_0140033 | 3300046511 | Bacteria | 1544 |
| 748 | Ga0495618_0005027 | 3300046514 | Bacteria | 8079 |
| 749 | Ga0495618_0030791 | 3300046514 | Bacteria | 3353 |
| 750 | Ga0495618_0041188 | 3300046514 | Bacteria | 2908 |
| 751 | Ga0495618_0078116 | 3300046514 | Bacteria | 2109 |
| 752 | Ga0495618_0189755 | 3300046514 | Bacteria | 1303 |
| 753 | Ga0495618_0205363 | 3300046514 | Bacteria | 1246 |
| 754 | Ga0495618_0211030 | 3300046514 | Bacteria | 1227 |
| 755 | Ga0495618_0263348 | 3300046514 | Bacteria | 1079 |
| 756 | Ga0495628_0000916 | 3300046516 | Bacteria | 27072 |
| 757 | Ga0495628_0008790 | 3300046516 | Bacteria | 8644 |
| 758 | Ga0495628_0025055 | 3300046516 | Bacteria | 4877 |
| 759 | Ga0495628_0059190 | 3300046516 | Bacteria | 3008 |
| 760 | Ga0495628_0069739 | 3300046516 | Bacteria | 2742 |
| 761 | Ga0495628_0101958 | 3300046516 | Bacteria | 2214 |
| 762 | Ga0495628_0224043 | 3300046516 | Bacteria | 1411 |
| 763 | Ga0495628_0248900 | 3300046516 | Bacteria | 1327 |
| 764 | Ga0495628_0277448 | 3300046516 | Bacteria | 1245 |
| 765 | Ga0495630_0016843 | 3300046517 | Bacteria | 5347 |
| 766 | Ga0495630_0052920 | 3300046517 | Bacteria | 3039 |
| 767 | Ga0495630_0149607 | 3300046517 | Bacteria | 1776 |
| 768 | Ga0495630_0165725 | 3300046517 | Bacteria | 1682 |
| 769 | Ga0495630_0233228 | 3300046517 | Bacteria | 1406 |
| 770 | Ga0495630_0266924 | 3300046517 | Bacteria | 1307 |
| 771 | Ga0495630_0277890 | 3300046517 | Bacteria | 1279 |
| 772 | Ga0495630_0301553 | 3300046517 | Bacteria | 1224 |
| 773 | Ga0495630_0709376 | 3300046517 | Bacteria | 769 |
| 774 | Ga0495666_0009075 | 3300046526 | Bacteria | 4976 |
| 775 | Ga0495666_0114680 | 3300046526 | Bacteria | 1264 |
| 776 | Ga0495666_0228179 | 3300046526 | Bacteria | 851 |
| 777 | Ga0495652_0000337 | 3300046529 | Bacteria | 55658 |
| 778 | Ga0495652_0005021 | 3300046529 | Bacteria | 12535 |
| 779 | Ga0495652_0007308 | 3300046529 | Bacteria | 10187 |
| 780 | Ga0495652_0028603 | 3300046529 | Bacteria | 4902 |
| 781 | Ga0495652_0077310 | 3300046529 | Bacteria | 2759 |
| 782 | Ga0495652_0124303 | 3300046529 | Bacteria | 2052 |
| 783 | Ga0495652_0143248 | 3300046529 | Bacteria | 1877 |
| 784 | Ga0495652_0145468 | 3300046529 | Bacteria | 1858 |
| 785 | Ga0495652_0215581 | 3300046529 | Bacteria | 1446 |
| 786 | Ga0495652_0235454 | 3300046529 | Bacteria | 1366 |
| 787 | Ga0495665_0003362 | 3300046531 | Bacteria | 8676 |
| 788 | Ga0495665_0004591 | 3300046531 | Bacteria | 7452 |
| 789 | Ga0495640_0003965 | 3300046533 | Bacteria | 11849 |
| 790 | Ga0495640_0004351 | 3300046533 | Bacteria | 11308 |
| 791 | Ga0495640_0006745 | 3300046533 | Bacteria | 9060 |
| 792 | Ga0495640_0020499 | 3300046533 | Bacteria | 4865 |
| 793 | Ga0495640_0036929 | 3300046533 | Bacteria | 3449 |
| 794 | Ga0495640_0258620 | 3300046533 | Bacteria | 1088 |
| 795 | Ga0495586_0012351 | 3300046535 | Bacteria | 4530 |
| 796 | Ga0495587_0000078 | 3300046536 | Bacteria | 76639 |
| 797 | Ga0495587_0004576 | 3300046536 | Bacteria | 9087 |
| 798 | Ga0495587_0015551 | 3300046536 | Bacteria | 4748 |
| 799 | Ga0495587_0025015 | 3300046536 | Bacteria | 3652 |
| 800 | Ga0495587_0052225 | 3300046536 | Bacteria | 2412 |
| 801 | Ga0495587_0109646 | 3300046536 | Bacteria | 1586 |
| 802 | Ga0495587_0173389 | 3300046536 | Bacteria | 1224 |
| 803 | Ga0495645_0003438 | 3300046543 | Bacteria | 10736 |
| 804 | Ga0495645_0036732 | 3300046543 | Bacteria | 3570 |
| 805 | Ga0495645_0054572 | 3300046543 | Bacteria | 2903 |
| 806 | Ga0495645_0102750 | 3300046543 | Bacteria | 2031 |
| 807 | Ga0495645_0131842 | 3300046543 | Bacteria | 1750 |
| 808 | Ga0495645_0148684 | 3300046543 | Bacteria | 1629 |
| 809 | Ga0495645_0175675 | 3300046543 | Bacteria | 1471 |
| 810 | Ga0495645_0199943 | 3300046543 | Bacteria | 1356 |
| 811 | Ga0495645_0202898 | 3300046543 | Bacteria | 1343 |
| 812 | Ga0495645_0276561 | 3300046543 | Bacteria | 1106 |
| 813 | Ga0495667_0000122 | 3300046559 | Bacteria | 56141 |
| 814 | Ga0495667_0000189 | 3300046559 | Bacteria | 42070 |
| 815 | Ga0495667_0004398 | 3300046559 | Bacteria | 9506 |
| 816 | Ga0495667_0007120 | 3300046559 | Bacteria | 7584 |
| 817 | Ga0495667_0007839 | 3300046559 | Bacteria | 7236 |
| 818 | Ga0495667_0089644 | 3300046559 | Bacteria | 1993 |
| 819 | Ga0495667_0127099 | 3300046559 | Bacteria | 1644 |
| 820 | Ga0495667_0162688 | 3300046559 | Bacteria | 1435 |
| 821 | Ga0495667_0228140 | 3300046559 | Bacteria | 1187 |
| 822 | Ga0495634_0011114 | 3300046642 | Bacteria | 6565 |
| 823 | Ga0495634_0013313 | 3300046642 | Bacteria | 5945 |
| 824 | Ga0495634_0033802 | 3300046642 | Bacteria | 3511 |
| 825 | Ga0495634_0073656 | 3300046642 | Bacteria | 2245 |
| 826 | Ga0495634_0080022 | 3300046642 | Bacteria | 2139 |
| 827 | Ga0495634_0095768 | 3300046642 | Bacteria | 1922 |
| 828 | Ga0495634_0137063 | 3300046642 | Bacteria | 1556 |
| 829 | Ga0495634_0169949 | 3300046642 | Bacteria | 1370 |
| 830 | Ga0495634_0254443 | 3300046642 | Bacteria | 1073 |
| 831 | Ga0495635_0006820 | 3300046663 | Bacteria | 7980 |
| 832 | Ga0495635_0017697 | 3300046663 | Bacteria | 4977 |
| 833 | Ga0495635_0027490 | 3300046663 | Bacteria | 3956 |
| 834 | Ga0495635_0028679 | 3300046663 | Bacteria | 3869 |
| 835 | Ga0495635_0116269 | 3300046663 | Bacteria | 1825 |
| 836 | Ga0495635_0124494 | 3300046663 | Bacteria | 1758 |
| 837 | Ga0495635_0126290 | 3300046663 | Bacteria | 1744 |
| 838 | Ga0495635_0265272 | 3300046663 | Bacteria | 1155 |
| 839 | Ga0495635_0475443 | 3300046663 | Bacteria | 824 |
| 840 | Ga0495661_0050042 | 3300046665 | Bacteria | 2532 |
| 841 | Ga0495657_0000098 | 3300046675 | Bacteria | 76618 |
| 842 | Ga0495657_0002783 | 3300046675 | Bacteria | 14541 |
| 843 | Ga0495657_0008034 | 3300046675 | Bacteria | 8089 |
| 844 | Ga0495657_0026798 | 3300046675 | Bacteria | 4078 |
| 845 | Ga0495657_0034763 | 3300046675 | Bacteria | 3498 |
| 846 | Ga0495657_0039045 | 3300046675 | Bacteria | 3264 |
| 847 | Ga0495657_0056772 | 3300046675 | Bacteria | 2605 |
| 848 | Ga0495657_0087146 | 3300046675 | Bacteria | 2009 |
| 849 | Ga0495657_0219374 | 3300046675 | Bacteria | 1153 |
| 850 | Ga0495657_0227726 | 3300046675 | Bacteria | 1128 |
| 851 | Ga0495599_0000115 | 3300046678 | Bacteria | 53313 |
| 852 | Ga0495599_0000177 | 3300046678 | Bacteria | 42049 |
| 853 | Ga0495599_0001503 | 3300046678 | Bacteria | 13421 |
| 854 | Ga0495599_0009217 | 3300046678 | Bacteria | 6023 |
| 855 | Ga0495599_0045654 | 3300046678 | Bacteria | 2747 |
| 856 | Ga0495599_0117479 | 3300046678 | Bacteria | 1654 |
| 857 | Ga0495599_0130116 | 3300046678 | Bacteria | 1563 |
| 858 | Ga0495599_0241140 | 3300046678 | Bacteria | 1102 |
| 859 | Ga0495623_0000184 | 3300046679 | Bacteria | 39482 |
| 860 | Ga0495623_0013148 | 3300046679 | Bacteria | 5366 |
| 861 | Ga0495623_0026732 | 3300046679 | Bacteria | 3713 |
| 862 | Ga0495623_0055269 | 3300046679 | Bacteria | 2503 |
| 863 | Ga0495623_0067712 | 3300046679 | Bacteria | 2228 |
| 864 | Ga0495623_0102113 | 3300046679 | Bacteria | 1746 |
| 865 | Ga0495623_0108227 | 3300046679 | Bacteria | 1687 |
| 866 | Ga0495646_0004406 | 3300046680 | Bacteria | 8867 |
| 867 | Ga0495646_0007946 | 3300046680 | Bacteria | 6742 |
| 868 | Ga0495646_0030532 | 3300046680 | Bacteria | 3365 |
| 869 | Ga0495646_0031214 | 3300046680 | Bacteria | 3321 |
| 870 | Ga0495646_0039835 | 3300046680 | Bacteria | 2895 |
| 871 | Ga0495646_0127778 | 3300046680 | Bacteria | 1433 |
| 872 | Ga0495646_0136375 | 3300046680 | Bacteria | 1376 |
| 873 | Ga0495646_0174349 | 3300046680 | Bacteria | 1183 |
| 874 | Ga0495646_0183385 | 3300046680 | Bacteria | 1147 |
| 875 | Ga0495646_0206820 | 3300046680 | Bacteria | 1067 |
| 876 | Ga0495646_0254515 | 3300046680 | Bacteria | 939 |
| 877 | Ga0495647_0017856 | 3300046681 | Bacteria | 2517 |
| 878 | Ga0495658_0012461 | 3300046683 | Bacteria | 4307 |
| 879 | Ga0495658_0040676 | 3300046683 | Bacteria | 2585 |
| 880 | Ga0495658_0116344 | 3300046683 | Bacteria | 1612 |
| 881 | Ga0495613_0004810 | 3300046689 | Bacteria | 10134 |
| 882 | Ga0495613_0015231 | 3300046689 | Bacteria | 5715 |
| 883 | Ga0495613_0241684 | 3300046689 | Bacteria | 1262 |
| 884 | Ga0495624_0018370 | 3300046690 | Bacteria | 4676 |
| 885 | Ga0495624_0029789 | 3300046690 | Bacteria | 3559 |
| 886 | Ga0495624_0047687 | 3300046690 | Bacteria | 2721 |
| 887 | Ga0495600_0002753 | 3300046809 | Bacteria | 10187 |
| 888 | Ga0495600_0028120 | 3300046809 | Bacteria | 3637 |
| 889 | Ga0495600_0050502 | 3300046809 | Bacteria | 2714 |
| 890 | Ga0495600_0060176 | 3300046809 | Bacteria | 2480 |
| 891 | Ga0495600_0075592 | 3300046809 | Bacteria | 2199 |
| 892 | Ga0495600_0133828 | 3300046809 | Bacteria | 1611 |
| 893 | Ga0495600_0214261 | 3300046809 | Bacteria | 1233 |
| 894 | Ga0495600_0235202 | 3300046809 | Bacteria | 1168 |
| 895 | Ga0495581_0009279 | 3300047315 | Bacteria | 5694 |
| 896 | Ga0495581_0098371 | 3300047315 | Bacteria | 1699 |
| 897 | Ga0495581_0385200 | 3300047315 | Bacteria | 818 |
| 898 | Ga0495604_0000142 | 3300047317 | Bacteria | 61620 |
| 899 | Ga0495604_0002956 | 3300047317 | Bacteria | 13606 |
| 900 | Ga0495604_0010319 | 3300047317 | Bacteria | 7399 |
| 901 | Ga0495604_0050516 | 3300047317 | Bacteria | 3228 |
| 902 | Ga0495604_0051177 | 3300047317 | Bacteria | 3203 |
| 903 | Ga0495604_0271680 | 3300047317 | Bacteria | 1148 |
| 904 | Ga0495604_0307677 | 3300047317 | Bacteria | 1062 |
| 905 | Ga0495604_0323823 | 3300047317 | Bacteria | 1029 |
| 906 | Ga0495674_0003502 | 3300047319 | Bacteria | 15276 |
| 907 | Ga0495674_0010298 | 3300047319 | Bacteria | 8851 |
| 908 | Ga0495674_0057991 | 3300047319 | Bacteria | 3387 |
| 909 | Ga0495674_0061807 | 3300047319 | Bacteria | 3263 |
| 910 | Ga0495674_0094221 | 3300047319 | Bacteria | 2554 |
| 911 | Ga0495674_0122790 | 3300047319 | Bacteria | 2193 |
| 912 | Ga0495674_0184252 | 3300047319 | Bacteria | 1737 |
| 913 | Ga0495674_0399716 | 3300047319 | Bacteria | 1109 |
| 914 | Ga0495676_0008370 | 3300047321 | Bacteria | 9487 |
| 915 | Ga0495676_0023985 | 3300047321 | Bacteria | 5287 |
| 916 | Ga0495676_0059141 | 3300047321 | Bacteria | 3012 |
| 917 | Ga0495676_0135898 | 3300047321 | Bacteria | 1768 |
| 918 | Ga0495680_0000111 | 3300047322 | Bacteria | 76638 |
| 919 | Ga0495680_0004282 | 3300047322 | Bacteria | 13690 |
| 920 | Ga0495680_0005094 | 3300047322 | Bacteria | 12403 |
| 921 | Ga0495680_0005872 | 3300047322 | Bacteria | 11484 |
| 922 | Ga0495680_0010139 | 3300047322 | Bacteria | 8421 |
| 923 | Ga0495680_0014651 | 3300047322 | Bacteria | 6781 |
| 924 | Ga0495680_0020748 | 3300047322 | Bacteria | 5517 |
| 925 | Ga0495680_0035570 | 3300047322 | Bacteria | 4010 |
| 926 | Ga0495680_0042483 | 3300047322 | Bacteria | 3606 |
| 927 | Ga0495680_0058725 | 3300047322 | Bacteria | 2972 |
| 928 | Ga0495680_0066318 | 3300047322 | Bacteria | 2763 |
| 929 | Ga0495680_0204475 | 3300047322 | Bacteria | 1415 |
| 930 | Ga0495675_0001489 | 3300047444 | Bacteria | 14176 |
| 931 | Ga0495675_0040589 | 3300047444 | Bacteria | 2965 |
| 932 | Ga0495675_0093748 | 3300047444 | Bacteria | 1883 |
| 933 | Ga0495684_0002270 | 3300047471 | Bacteria | 15409 |
| 934 | Ga0495684_0003204 | 3300047471 | Bacteria | 12832 |
| 935 | Ga0495684_0008149 | 3300047471 | Bacteria | 8107 |
| 936 | Ga0495684_0014213 | 3300047471 | Bacteria | 6125 |
| 937 | Ga0495684_0016512 | 3300047471 | Bacteria | 5685 |
| 938 | Ga0495684_0025479 | 3300047471 | Bacteria | 4545 |
| 939 | Ga0495684_0101894 | 3300047471 | Bacteria | 2170 |
| 940 | Ga0495684_0133356 | 3300047471 | Bacteria | 1864 |
| 941 | Ga0495593_0002166 | 3300047673 | Bacteria | 11744 |
| 942 | Ga0495593_0091666 | 3300047673 | Bacteria | 1564 |
| 943 | Ga0495593_0229754 | 3300047673 | Bacteria | 930 |
| 944 | Ga0495602_0000820 | 3300048088 | Bacteria | 29788 |
| 945 | Ga0495602_0004405 | 3300048088 | Bacteria | 14696 |
| 946 | Ga0495602_0008286 | 3300048088 | Bacteria | 10861 |
| 947 | Ga0495602_0026182 | 3300048088 | Bacteria | 5630 |
| 948 | Ga0495602_0055984 | 3300048088 | Bacteria | 3470 |
| 949 | Ga0495602_0074611 | 3300048088 | Bacteria | 2882 |
| 950 | Ga0495602_0445132 | 3300048088 | Bacteria | 915 |
| 951 | Ga0495614_0001134 | 3300048089 | Bacteria | 11457 |
| 952 | Ga0496101_0089050 | 3300048904 | Bacteria | 2293 |
| 953 | Ga0496102_0033671 | 3300048905 | Bacteria | 4606 |
| 954 | Ga0496102_0047351 | 3300048905 | Bacteria | 3906 |
| 955 | Ga0496102_0151084 | 3300048905 | Bacteria | 2182 |
| 956 | Ga0496102_0400745 | 3300048905 | Bacteria | 1290 |
| 957 | Ga0496102_0750462 | 3300048905 | Bacteria | 899 |
| 958 | Ga0496103_0045631 | 3300048906 | Bacteria | 2704 |
| 959 | Ga0496104_0004882 | 3300048907 | Bacteria | 11689 |
| 960 | Ga0496104_0005898 | 3300048907 | Bacteria | 10729 |
| 961 | Ga0496104_0966441 | 3300048907 | Bacteria | 756 |
| 962 | Ga0496105_0002449 | 3300048908 | Bacteria | 13426 |
| 963 | Ga0496105_0005053 | 3300048908 | Bacteria | 9994 |
| 964 | Ga0496105_0009106 | 3300048908 | Bacteria | 7745 |
| 965 | Ga0496105_0095805 | 3300048908 | Bacteria | 2451 |
| 966 | Ga0496105_0656734 | 3300048908 | Bacteria | 809 |
| 967 | Ga0496106_0120979 | 3300048909 | Bacteria | 2046 |
| 968 | Ga0496106_0181377 | 3300048909 | Bacteria | 1671 |
| 969 | Ga0496106_0295182 | 3300048909 | Bacteria | 1299 |
| 970 | Ga0496106_0693877 | 3300048909 | Bacteria | 812 |
| 971 | Ga0496107_0071031 | 3300048910 | Bacteria | 2529 |
| 972 | Ga0496107_0099752 | 3300048910 | Bacteria | 2128 |
| 973 | Ga0496108_0010097 | 3300048911 | Bacteria | 7661 |
| 974 | Ga0496108_0023008 | 3300048911 | Bacteria | 5127 |
| 975 | Ga0496108_0044634 | 3300048911 | Bacteria | 3699 |
| 976 | Ga0496108_0048489 | 3300048911 | Bacteria | 3551 |
| 977 | Ga0496108_0077587 | 3300048911 | Bacteria | 2810 |
| 978 | Ga0496108_0084430 | 3300048911 | Bacteria | 2695 |
| 979 | Ga0496108_0270569 | 3300048911 | Bacteria | 1479 |
| 980 | Ga0496108_0372406 | 3300048911 | Bacteria | 1247 |
| 981 | Ga0496109_0021509 | 3300048912 | Bacteria | 5704 |
| 982 | Ga0496109_0051181 | 3300048912 | Bacteria | 3761 |
| 983 | Ga0496109_0136576 | 3300048912 | Bacteria | 2291 |
| 984 | Ga0496109_0178551 | 3300048912 | Bacteria | 1993 |
| 985 | Ga0496109_0247544 | 3300048912 | Bacteria | 1678 |
| 986 | Ga0496110_0001460 | 3300048913 | Bacteria | 17145 |
| 987 | Ga0496110_0058374 | 3300048913 | Bacteria | 3399 |
| 988 | Ga0496110_0074566 | 3300048913 | Bacteria | 3013 |
| 989 | Ga0496110_0076390 | 3300048913 | Bacteria | 2978 |
| 990 | Ga0496110_0180169 | 3300048913 | Bacteria | 1919 |
| 991 | Ga0496110_0184032 | 3300048913 | Bacteria | 1897 |
| 992 | Ga0496110_0189103 | 3300048913 | Bacteria | 1870 |
| 993 | Ga0496110_0317571 | 3300048913 | Bacteria | 1419 |
| 994 | Ga0496110_0446269 | 3300048913 | Bacteria | 1179 |
| 995 | Ga0496110_0454220 | 3300048913 | Bacteria | 1168 |
| 996 | Ga0496110_0911045 | 3300048913 | Bacteria | 785 |
| 997 | Ga0496111_0001687 | 3300048914 | Bacteria | 12867 |
| 998 | Ga0496111_0029524 | 3300048914 | Bacteria | 3895 |
| 999 | Ga0496111_0034819 | 3300048914 | Bacteria | 3597 |
| 1000 | Ga0496111_0212428 | 3300048914 | Bacteria | 1437 |
| 1001 | Ga0496111_0361233 | 3300048914 | Bacteria | 1075 |
| 1002 | Ga0496111_0374359 | 3300048914 | Bacteria | 1053 |
| 1003 | Ga0496112_0000184 | 3300048915 | Bacteria | 40185 |
| 1004 | Ga0496112_0092630 | 3300048915 | Bacteria | 2992 |
| 1005 | Ga0496112_0109660 | 3300048915 | Bacteria | 2730 |
| 1006 | Ga0496112_0120011 | 3300048915 | Bacteria | 2599 |
| 1007 | Ga0496112_0323102 | 3300048915 | Bacteria | 1487 |
| 1008 | Ga0496113_0003802 | 3300048916 | Bacteria | 9131 |
| 1009 | Ga0496113_0009108 | 3300048916 | Bacteria | 6505 |
| 1010 | Ga0496113_0542018 | 3300048916 | Bacteria | 933 |
| 1011 | Ga0496114_0087446 | 3300048917 | Bacteria | 2642 |
| 1012 | Ga0496114_0309857 | 3300048917 | Bacteria | 1394 |
| 1013 | Ga0496114_0498460 | 3300048917 | Bacteria | 1077 |
| 1014 | Ga0496115_0006393 | 3300048918 | Bacteria | 8634 |
| 1015 | Ga0496115_0016211 | 3300048918 | Bacteria | 5670 |
| 1016 | Ga0496115_0045292 | 3300048918 | Bacteria | 3511 |
| 1017 | Ga0496119_0070317 | 3300048922 | Bacteria | 2053 |
| 1018 | Ga0496120_0122420 | 3300048923 | Bacteria | 1343 |
| 1019 | Ga0496126_0061346 | 3300048929 | Bacteria | 3378 |
| 1020 | Ga0496126_0160793 | 3300048929 | Bacteria | 1919 |
| 1021 | Ga0496126_0161341 | 3300048929 | Bacteria | 1915 |
| 1022 | Ga0496126_0352785 | 3300048929 | Bacteria | 1203 |
| 1023 | Ga0501038_0332506 | 3300049574 | Bacteria | 1186 |
| 1024 | Ga0501040_0191297 | 3300049576 | Bacteria | 1452 |
| 1025 | Ga0501081_0263068 | 3300049743 | Bacteria | 1261 |
| 1026 | Ga0501044_0138400 | 3300049823 | Bacteria | 2424 |
| 1027 | nmdc:mga05p37_48767_c1 | 3300050507 | Bacteria | 5208 |
| 1028 | nmdc:mga0n895_126015_c1 | 3300050512 | Bacteria | 2585 |
| 1029 | nmdc:mga0n895_281445_c1 | 3300050512 | Bacteria | 1687 |
| 1030 | nmdc:mga0n895_6775_c1 | 3300050512 | Bacteria | 9774 |
| 1031 | nmdc:mga0n895_78977_c1 | 3300050512 | Bacteria | 3276 |
| 1032 | nmdc:mga0rr50_24008_c1 | 3300050513 | Bacteria | 4217 |
| 1033 | nmdc:mga0rr50_31795_c1 | 3300050513 | Bacteria | 3753 |
| 1034 | nmdc:mga0rr50_768369_c1 | 3300050513 | Bacteria | 822 |
| 1035 | nmdc:mga08x19_14122_c1 | 3300050514 | Bacteria | 4840 |
| 1036 | nmdc:mga08x19_20251_c1 | 3300050514 | Bacteria | 4096 |
| 1037 | nmdc:mga0a205_130722_c1 | 3300050515 | Bacteria | 2411 |
| 1038 | nmdc:mga0a205_45417_c1 | 3300050515 | Bacteria | 4236 |
| 1039 | Ga0495601_0002036 | 3300053077 | Bacteria | 11349 |
| 1040 | Ga0495601_0053364 | 3300053077 | Bacteria | 2555 |
| 1041 | Ga0495601_0088569 | 3300053077 | Bacteria | 1990 |
| 1042 | Ga0495601_0108858 | 3300053077 | Bacteria | 1793 |
| 1043 | Ga0495601_0131991 | 3300053077 | Bacteria | 1627 |
| 1044 | Ga0495601_0132087 | 3300053077 | Bacteria | 1626 |
| 1045 | Ga0495601_0150587 | 3300053077 | Bacteria | 1519 |
| 1046 | Ga0495601_0181150 | 3300053077 | Bacteria | 1377 |
| 1047 | Ga0495612_0003599 | 3300053078 | Bacteria | 6424 |
| 1048 | Ga0495612_0003737 | 3300053078 | Bacteria | 6324 |
| 1049 | Ga0495595_0000738 | 3300053084 | Bacteria | 12412 |
| 1050 | Ga0495595_0004179 | 3300053084 | Bacteria | 5803 |
| 1051 | Ga0495595_0052581 | 3300053084 | Bacteria | 1890 |
| 1052 | Ga0495619_0003457 | 3300053085 | Bacteria | 10192 |
| 1053 | Ga0495619_0014222 | 3300053085 | Bacteria | 5027 |
| 1054 | Ga0495619_0018280 | 3300053085 | Bacteria | 4448 |
| 1055 | Ga0495619_0019112 | 3300053085 | Bacteria | 4354 |
| 1056 | Ga0495619_0108272 | 3300053085 | Bacteria | 1897 |
| 1057 | Ga0495619_0128523 | 3300053085 | Bacteria | 1740 |
| 1058 | Ga0500559_0015887 | 3300053136 | Bacteria | 3178 |
| 1059 | Ga0466962_0370843 | 3300061719 | Bacteria | 714 |
| 1060 | 2623500986 | 2622736605 | Bacteria | 4992138 |
| 1061 | 2644013345 | 2643221601 | Bacteria | 7493239 |
| 1062 | 2644175659 | 2643221631 | Bacteria | 8168043 |
| 1063 | 2863073084 | 2863067949 | Bacteria | 8541735 |
| 1064 | 2866614834 | 2866612099 | Bacteria | 7543886 |
| 1065 | 2866616499 | 2866612099 | Bacteria | 7543886 |
| 1066 | 2917742712 | 2917736166 | Bacteria | 9690793 |
| 1067 | 8003323747 | 8003314358 | Bacteria | 10575343 |
| 1068 | Ga0070709_10010541 | |||
| 1069 | JGI24743J22301_10070235 | |||
| 1070 | Ga0070658_10019068 | |||
| 1071 | Ga0070658_10027167 | |||
| 1072 | Ga0070658_10441438 | |||
| 1073 | Ga0070683_100067065 | |||
| 1074 | Ga0070683_100322006 | |||
| 1075 | Ga0070683_100470682 | |||
| 1076 | Ga0070666_10324903 | |||
| 1077 | Ga0070680_100020013 | |||
| 1078 | Ga0070680_100247502 | |||
| 1079 | Ga0070682_100030166 | |||
| 1080 | Ga0070682_100175908 | |||
| 1081 | Ga0068868_100310046 | |||
| 1082 | Ga0070660_100047169 | |||
| 1083 | Ga0070660_100192508 | |||
| 1084 | Ga0070660_100210415 | |||
| 1085 | Ga0070660_100660333 | |||
| 1086 | Ga0070691_10168970 | |||
| 1087 | Ga0070661_100109838 | |||
| 1088 | Ga0070661_100506553 | |||
| 1089 | Ga0070692_10110227 | |||
| 1090 | Ga0070692_10194858 | |||
| 1091 | Ga0070668_100002765 | |||
| 1092 | Ga0070668_100631310 | |||
| 1093 | Ga0070675_100527905 | |||
| 1094 | Ga0070673_100468456 | |||
| 1095 | Ga0070659_100301970 | |||
| 1096 | Ga0070659_100536987 | |||
| 1097 | Ga0070709_10000135 | |||
| 1098 | Ga0070709_10001265 | |||
| 1099 | Ga0070709_10002530 | |||
| 1100 | Ga0070709_10140193 | |||
| 1101 | Ga0070709_10191229 | |||
| 1102 | Ga0070709_10305188 | |||
| 1103 | Ga0070714_100000876 | |||
| 1104 | Ga0070714_100003346 | |||
| 1105 | Ga0070714_100003679 | |||
| 1106 | Ga0070714_100004557 | |||
| 1107 | Ga0070714_100006698 | |||
| 1108 | Ga0070714_100006766 | |||
| 1109 | Ga0070714_100023998 | |||
| 1110 | Ga0070714_100027929 | |||
| 1111 | Ga0070714_100043584 | |||
| 1112 | Ga0070714_100055179 | |||
| 1113 | Ga0070714_100056258 | |||
| 1114 | Ga0070714_100062927 | |||
| 1115 | Ga0070714_100074307 | |||
| 1116 | Ga0070714_100078948 | |||
| 1117 | Ga0070714_100434023 | |||
| 1118 | Ga0070714_100442660 | |||
| 1119 | Ga0070714_100528371 | |||
| 1120 | Ga0070714_100754886 | |||
| 1121 | Ga0070713_100000929 | |||
| 1122 | Ga0070713_100003752 | |||
| 1123 | Ga0070713_100007473 | |||
| 1124 | Ga0070713_100010175 | |||
| 1125 | Ga0070713_100016002 | |||
| 1126 | Ga0070713_100050923 | |||
| 1127 | Ga0070713_100087645 | |||
| 1128 | Ga0070713_100214108 | |||
| 1129 | Ga0070713_100338481 | |||
| 1130 | Ga0070713_100354131 | |||
| 1131 | Ga0070710_10000292 | |||
| 1132 | Ga0070710_10001213 | |||
| 1133 | Ga0070710_10003283 | |||
| 1134 | Ga0070710_10022670 | |||
| 1135 | Ga0070710_10040432 | |||
| 1136 | Ga0070710_10042186 | |||
| 1137 | Ga0070710_10116106 | |||
| 1138 | Ga0070710_10126925 | |||
| 1139 | Ga0070710_10149951 | |||
| 1140 | Ga0070701_10199126 | |||
| 1141 | Ga0070711_100001302 | |||
| 1142 | Ga0070711_100003513 | |||
| 1143 | Ga0070711_100006598 | |||
| 1144 | Ga0070711_100092320 | |||
| 1145 | Ga0070705_100127244 | |||
| 1146 | Ga0070705_100257076 | |||
| 1147 | Ga0070705_100464211 | |||
| 1148 | Ga0070708_100024548 | |||
| 1149 | Ga0070708_100054523 | |||
| 1150 | Ga0070708_100064380 | |||
| 1151 | Ga0070708_100113564 | |||
| 1152 | Ga0070708_100122998 | |||
| 1153 | Ga0070708_100151226 | |||
| 1154 | Ga0070708_100161868 | |||
| 1155 | Ga0070708_100266755 | |||
| 1156 | Ga0070708_100311554 | |||
| 1157 | Ga0070708_100663491 | |||
| 1158 | Ga0070708_100730331 | |||
| 1159 | Ga0070663_100005549 | |||
| 1160 | Ga0070663_100112608 | |||
| 1161 | Ga0070678_100066069 | |||
| 1162 | Ga0070678_100080520 | |||
| 1163 | Ga0070678_100156862 | |||
| 1164 | Ga0070678_100327934 | |||
| 1165 | Ga0070706_100012158 | |||
| 1166 | Ga0070706_100016163 | |||
| 1167 | Ga0070706_100072517 | |||
| 1168 | Ga0070706_100079961 | |||
| 1169 | Ga0070706_100130046 | |||
| 1170 | Ga0070706_100160426 | |||
| 1171 | Ga0070706_100170757 | |||
| 1172 | Ga0070707_100006197 | |||
| 1173 | Ga0070707_100038796 | |||
| 1174 | Ga0070707_100045512 | |||
| 1175 | Ga0070707_100102530 | |||
| 1176 | Ga0070707_100125668 | |||
| 1177 | Ga0070707_100226629 | |||
| 1178 | Ga0070707_100228584 | |||
| 1179 | Ga0070707_100274638 | |||
| 1180 | Ga0070707_100649249 | |||
| 1181 | Ga0070698_100001112 | |||
| 1182 | Ga0070698_100005647 | |||
| 1183 | Ga0070698_100019100 | |||
| 1184 | Ga0070698_100021612 | |||
| 1185 | Ga0070698_100156479 | |||
| 1186 | Ga0070698_100166430 | |||
| 1187 | Ga0070698_100542271 | |||
| 1188 | Ga0070699_100000729 | |||
| 1189 | Ga0070679_100003860 | |||
| 1190 | Ga0070679_100069739 | |||
| 1191 | Ga0070679_100118973 | |||
| 1192 | Ga0070679_100144341 | |||
| 1193 | Ga0070684_100074673 | |||
| 1194 | Ga0070684_100209076 | |||
| 1195 | Ga0070697_100005019 | |||
| 1196 | Ga0068853_100119896 | |||
| 1197 | Ga0070672_100471689 | |||
| 1198 | Ga0070686_100094529 | |||
| 1199 | Ga0070696_100024799 | |||
| 1200 | Ga0070665_100028430 | |||
| 1201 | Ga0070665_100537786 | |||
| 1202 | Ga0068855_100003675 | |||
| 1203 | Ga0068855_100058253 | |||
| 1204 | Ga0068857_100167057 | |||
| 1205 | Ga0068857_100213641 | |||
| 1206 | Ga0068857_100439894 | |||
| 1207 | Ga0068857_100866884 | |||
| 1208 | Ga0068854_100276546 | |||
| 1209 | Ga0068856_100140798 | |||
| 1210 | Ga0068856_100183391 | |||
| 1211 | Ga0068856_100278279 | |||
| 1212 | Ga0068856_100364041 | |||
| 1213 | Ga0068852_100026604 | |||
| 1214 | Ga0068852_100906535 | |||
| 1215 | Ga0068861_100660636 | |||
| 1216 | Ga0068870_10259524 | |||
| 1217 | Ga0068870_10709228 | |||
| 1218 | Ga0068863_100235921 | |||
| 1219 | Ga0068858_100222605 | |||
| 1220 | Ga0068860_100020303 | |||
| 1221 | Ga0068860_100992665 | |||
| 1222 | Ga0068862_100817927 | |||
| 1223 | Ga0081455_10028886 | |||
| 1224 | Ga0081455_10409815 | |||
| 1225 | Ga0081540_1000103 | |||
| 1226 | Ga0081540_1000130 | |||
| 1227 | Ga0070717_10002393 | |||
| 1228 | Ga0070717_10010873 | |||
| 1229 | Ga0070717_10022805 | |||
| 1230 | Ga0070717_10029301 | |||
| 1231 | Ga0070717_10035437 | |||
| 1232 | Ga0070717_10065911 | |||
| 1233 | Ga0070717_10074834 | |||
| 1234 | Ga0070717_10079326 | |||
| 1235 | Ga0070717_10263055 | |||
| 1236 | Ga0070717_10358925 | |||
| 1237 | Ga0070715_10000255 | |||
| 1238 | Ga0070715_10011521 | |||
| 1239 | Ga0070715_10013066 | |||
| 1240 | Ga0070715_10018662 | |||
| 1241 | Ga0070715_10049240 | |||
| 1242 | Ga0070716_100001078 | |||
| 1243 | Ga0070716_100005226 | |||
| 1244 | Ga0070716_100005653 | |||
| 1245 | Ga0070716_100037766 | |||
| 1246 | Ga0070716_100202120 | |||
| 1247 | Ga0070712_100018127 | |||
| 1248 | Ga0070712_100025150 | |||
| 1249 | Ga0070712_100046585 | |||
| 1250 | Ga0070712_100050808 | |||
| 1251 | Ga0070712_100063668 | |||
| 1252 | Ga0070712_100123023 | |||
| 1253 | Ga0070712_100281065 | |||
| 1254 | Ga0070712_100436970 | |||
| 1255 | Ga0070712_100591178 | |||
| 1256 | Ga0070712_100674773 | |||
| 1257 | Ga0070712_100700525 | |||
| 1258 | Ga0075433_10028568 | |||
| 1259 | Ga0075433_10051337 | |||
| 1260 | Ga0075433_10401172 | |||
| 1261 | Ga0075434_100007625 | |||
| 1262 | Ga0075434_100008042 | |||
| 1263 | Ga0075434_100078182 | |||
| 1264 | Ga0075436_100031792 | |||
| 1265 | Ga0075436_100337997 | |||
| 1266 | Ga0075436_100455571 | |||
| 1267 | Ga0075435_100004503 | |||
| 1268 | Ga0075435_100078422 | |||
| 1269 | Ga0075435_100243047 | |||
| 1270 | Ga0075435_100442782 | |||
| 1271 | Ga0105240_10007777 | |||
| 1272 | Ga0105240_10241580 | |||
| 1273 | Ga0111539_10047678 | |||
| 1274 | Ga0105245_10045968 | |||
| 1275 | Ga0105245_10278576 | |||
| 1276 | Ga0105247_10061240 | |||
| 1277 | Ga0114129_10005099 | |||
| 1278 | Ga0114129_10322768 | |||
| 1279 | Ga0105243_10156438 | |||
| 1280 | Ga0105243_10200630 | |||
| 1281 | Ga0105243_10511658 | |||
| 1282 | Ga0105242_10324564 | |||
| 1283 | Ga0105242_10498852 | |||
| 1284 | Ga0105248_10383261 | |||
| 1285 | Ga0105237_10184819 | |||
| 1286 | Ga0105238_10273249 | |||
| 1287 | Ga0105238_10331082 | |||
| 1288 | Ga0105238_10388520 | |||
| 1289 | Ga0105238_10650636 | |||
| 1290 | Ga0105249_10406098 | |||
| 1291 | Ga0105249_10527985 | |||
| 1292 | Ga0105239_10867999 | |||
| 1293 | Ga0105246_10043535 | |||
| 1294 | Ga0105246_10250241 | |||
| 1295 | Ga0157343_1005224 | |||
| 1296 | Ga0157373_10368541 | |||
| 1297 | Ga0157371_10138349 | |||
| 1298 | Ga0157370_10018593 | |||
| 1299 | Ga0157370_10019457 | |||
| 1300 | Ga0157370_10199558 | |||
| 1301 | Ga0157369_10006138 | |||
| 1302 | Ga0157369_10010683 | |||
| 1303 | Ga0157369_10014330 | |||
| 1304 | Ga0157369_10051322 | |||
| 1305 | Ga0157369_10200696 | |||
| 1306 | Ga0157369_10207531 | |||
| 1307 | Ga0157369_10268349 | |||
| 1308 | Ga0157369_10425079 | |||
| 1309 | Ga0157369_10538257 | |||
| 1310 | Ga0157369_10723962 | |||
| 1311 | Ga0157369_11226764 | |||
| 1312 | Ga0157374_10100418 | |||
| 1313 | Ga0157374_10156334 | |||
| 1314 | Ga0157374_10638624 | |||
| 1315 | Ga0157374_10925550 | |||
| 1316 | Ga0157372_10382916 | |||
| 1317 | Ga0157372_10393051 | |||
| 1318 | Ga0157372_10516537 | |||
| 1319 | Ga0157379_10477127 | |||
| 1320 | Ga0157376_10125435 | |||
| 1321 | Ga0157376_10168148 | |||
| 1322 | Ga0197907_10035628 | |||
| 1323 | Ga0197907_10139501 | |||
| 1324 | Ga0197907_10762157 | |||
| 1325 | Ga0206356_10054100 | |||
| 1326 | Ga0206349_1640098 | |||
| 1327 | Ga0206355_1658166 | |||
| 1328 | Ga0206351_10099922 | |||
| 1329 | Ga0206351_10242669 | |||
| 1330 | Ga0206351_10825820 | |||
| 1331 | Ga0206354_10920257 | |||
| 1332 | Ga0206354_11626196 | |||
| 1333 | Ga0206353_10200660 | |||
| 1334 | Ga0206353_10769160 | |||
| 1335 | Ga0206353_11819336 | |||
| 1336 | Ga0206353_11848666 | |||
| 1337 | Ga0213875_10000485 | |||
| 1338 | Ga0213875_10001030 | |||
| 1339 | Ga0213875_10004119 | |||
| 1340 | Ga0213875_10119531 | |||
| 1341 | Ga0224712_10021488 | |||
| 1342 | Ga0224712_10041525 | |||
| 1343 | Ga0224712_10173690 | |||
| 1344 | Ga0228598_1023408 | |||
| 1345 | Ga0207692_10000513 | |||
| 1346 | Ga0207692_10002081 | |||
| 1347 | Ga0207692_10002757 | |||
| 1348 | Ga0207692_10004411 | |||
| 1349 | Ga0207692_10050271 | |||
| 1350 | Ga0207692_10114231 | |||
| 1351 | Ga0207692_10325867 | |||
| 1352 | Ga0207692_10466260 | |||
| 1353 | Ga0207685_10004862 | |||
| 1354 | Ga0207685_10007066 | |||
| 1355 | Ga0207685_10022322 | |||
| 1356 | Ga0207685_10228053 | |||
| 1357 | Ga0207699_10000398 | |||
| 1358 | Ga0207699_10000640 | |||
| 1359 | Ga0207699_10001707 | |||
| 1360 | Ga0207699_10040823 | |||
| 1361 | Ga0207699_10066630 | |||
| 1362 | Ga0207643_10261272 | |||
| 1363 | Ga0207705_10051953 | |||
| 1364 | Ga0207705_10227591 | |||
| 1365 | Ga0207684_10004970 | |||
| 1366 | Ga0207684_10013951 | |||
| 1367 | Ga0207684_10040034 | |||
| 1368 | Ga0207684_10127047 | |||
| 1369 | Ga0207684_10196275 | |||
| 1370 | Ga0207684_10307063 | |||
| 1371 | Ga0207654_10245255 | |||
| 1372 | Ga0207707_10033436 | |||
| 1373 | Ga0207707_10062431 | |||
| 1374 | Ga0207707_10094415 | |||
| 1375 | Ga0207695_10014617 | |||
| 1376 | Ga0207695_10529116 | |||
| 1377 | Ga0207671_10660064 | |||
| 1378 | Ga0207693_10004303 | |||
| 1379 | Ga0207693_10023999 | |||
| 1380 | Ga0207693_10025688 | |||
| 1381 | Ga0207693_10062289 | |||
| 1382 | Ga0207693_10102425 | |||
| 1383 | Ga0207693_10150033 | |||
| 1384 | Ga0207693_10164570 | |||
| 1385 | Ga0207693_10404670 | |||
| 1386 | Ga0207663_10001861 | |||
| 1387 | Ga0207663_10007756 | |||
| 1388 | Ga0207663_10013410 | |||
| 1389 | Ga0207660_10063046 | |||
| 1390 | Ga0207662_10132289 | |||
| 1391 | Ga0207657_10050386 | |||
| 1392 | Ga0207657_10056915 | |||
| 1393 | Ga0207657_10202813 | |||
| 1394 | Ga0207652_10012809 | |||
| 1395 | Ga0207652_10027724 | |||
| 1396 | Ga0207652_10082744 | |||
| 1397 | Ga0207652_10225832 | |||
| 1398 | Ga0207646_10002286 | |||
| 1399 | Ga0207646_10002860 | |||
| 1400 | Ga0207646_10008897 | |||
| 1401 | Ga0207646_10196833 | |||
| 1402 | Ga0207646_10229098 | |||
| 1403 | Ga0207694_10468723 | |||
| 1404 | Ga0207694_10607923 | |||
| 1405 | Ga0207694_10795546 | |||
| 1406 | Ga0207687_10288232 | |||
| 1407 | Ga0207687_10457877 | |||
| 1408 | Ga0207700_10000812 | |||
| 1409 | Ga0207700_10001889 | |||
| 1410 | Ga0207700_10002281 | |||
| 1411 | Ga0207700_10004320 | |||
| 1412 | Ga0207700_10008564 | |||
| 1413 | Ga0207700_10010553 | |||
| 1414 | Ga0207700_10014302 | |||
| 1415 | Ga0207700_10017449 | |||
| 1416 | Ga0207700_10026367 | |||
| 1417 | Ga0207700_10034078 | |||
| 1418 | Ga0207700_10034433 | |||
| 1419 | Ga0207700_10039333 | |||
| 1420 | Ga0207700_10040856 | |||
| 1421 | Ga0207700_10147551 | |||
| 1422 | Ga0207700_10182351 | |||
| 1423 | Ga0207664_10000765 | |||
| 1424 | Ga0207664_10000771 | |||
| 1425 | Ga0207664_10000939 | |||
| 1426 | Ga0207664_10003924 | |||
| 1427 | Ga0207664_10004915 | |||
| 1428 | Ga0207664_10004934 | |||
| 1429 | Ga0207664_10005706 | |||
| 1430 | Ga0207664_10005902 | |||
| 1431 | Ga0207664_10019119 | |||
| 1432 | Ga0207664_10019315 | |||
| 1433 | Ga0207664_10022154 | |||
| 1434 | Ga0207664_10032513 | |||
| 1435 | Ga0207664_10069344 | |||
| 1436 | Ga0207664_10071539 | |||
| 1437 | Ga0207664_10097492 | |||
| 1438 | Ga0207664_10182691 | |||
| 1439 | Ga0207664_10246841 | |||
| 1440 | Ga0207664_10283067 | |||
| 1441 | Ga0207664_10337089 | |||
| 1442 | Ga0207664_10389100 | |||
| 1443 | Ga0207664_10413691 | |||
| 1444 | Ga0207664_10483762 | |||
| 1445 | Ga0207664_10630831 | |||
| 1446 | Ga0207644_10063331 | |||
| 1447 | Ga0207690_10098230 | |||
| 1448 | Ga0207690_10565882 | |||
| 1449 | Ga0207706_10090119 | |||
| 1450 | Ga0207686_10228765 | |||
| 1451 | Ga0207704_10147233 | |||
| 1452 | Ga0207665_10001933 | |||
| 1453 | Ga0207665_10009998 | |||
| 1454 | Ga0207665_10011289 | |||
| 1455 | Ga0207665_10051131 | |||
| 1456 | Ga0207665_10130971 | |||
| 1457 | Ga0207665_10162515 | |||
| 1458 | Ga0207665_10179907 | |||
| 1459 | Ga0207691_10122839 | |||
| 1460 | Ga0207689_10022270 | |||
| 1461 | Ga0207661_10009603 | |||
| 1462 | Ga0207661_10021010 | |||
| 1463 | Ga0207661_10048711 | |||
| 1464 | Ga0207667_10049669 | |||
| 1465 | Ga0207667_10053071 | |||
| 1466 | Ga0207667_10191588 | |||
| 1467 | Ga0207668_10012489 | |||
| 1468 | Ga0207668_10444794 | |||
| 1469 | Ga0207677_10991396 | |||
| 1470 | Ga0207703_10134988 | |||
| 1471 | Ga0207639_10169491 | |||
| 1472 | Ga0207678_10012201 | |||
| 1473 | Ga0207678_10013981 | |||
| 1474 | Ga0207678_10075322 | |||
| 1475 | Ga0207678_10100422 | |||
| 1476 | Ga0207678_10188634 | |||
| 1477 | Ga0207678_10443145 | |||
| 1478 | Ga0207702_10020304 | |||
| 1479 | Ga0207702_10089279 | |||
| 1480 | Ga0207702_10417796 | |||
| 1481 | Ga0207641_10165904 | |||
| 1482 | Ga0207641_10647820 | |||
| 1483 | Ga0207676_10247945 | |||
| 1484 | Ga0207674_10222785 | |||
| 1485 | Ga0207674_10368365 | |||
| 1486 | Ga0207674_10395085 | |||
| 1487 | Ga0207683_10005302 | |||
| 1488 | Ga0207683_10045233 | |||
| 1489 | Ga0207683_10148853 | |||
| 1490 | Ga0265357_1001605 | |||
| 1491 | Ga0268266_10084515 | |||
| 1492 | Ga0268266_10283742 | |||
| 1493 | Ga0268264_10650597 | |||
| 1494 | Ga0265337_1000318 | |||
| 1495 | Ga0265326_10013500 | |||
| 1496 | Ga0265319_1003114 | |||
| 1497 | Ga0265334_10001069 | |||
| 1498 | Ga0265323_10002263 | |||
| 1499 | Ga0265336_10003038 | |||
| 1500 | Ga0265336_10005397 | |||
| 1501 | Ga0265336_10017292 | |||
| 1502 | Ga0307515_10006481 | |||
| 1503 | Ga0307515_10061573 | |||
| 1504 | Ga0265338_10000127 | |||
| 1505 | Ga0265338_10000887 | |||
| 1506 | Ga0265338_10006971 | |||
| 1507 | Ga0265338_10009496 | |||
| 1508 | Ga0265338_10012718 | |||
| 1509 | Ga0265324_10004303 | |||
| 1510 | Ga0265777_101856 | |||
| 1511 | Ga0265776_103552 | |||
| 1512 | Ga0265760_10014273 | |||
| 1513 | Ga0265760_10039655 | |||
| 1514 | Ga0265760_10132585 | |||
| 1515 | Ga0265332_10000734 | |||
| 1516 | Ga0265320_10005829 | |||
| 1517 | Ga0265325_10008273 | |||
| 1518 | Ga0265340_10004992 | |||
| 1519 | Ga0265339_10014531 | |||
| 1520 | Ga0265316_10028560 | |||
| 1521 | Ga0307408_100033866 | |||
| 1522 | Ga0307408_100051964 | |||
| 1523 | Ga0307408_100052971 | |||
| 1524 | Ga0265313_10013502 | |||
| 1525 | Ga0310105_104307 | |||
| 1526 | Ga0310111_121143 | |||
| 1527 | Ga0310119_108127 | |||
| 1528 | Ga0265314_10028985 | |||
| 1529 | Ga0265342_10019702 | |||
| 1530 | Ga0307405_10144105 | |||
| 1531 | Ga0307405_10188515 | |||
| 1532 | Ga0307405_10330421 | |||
| 1533 | Ga0307518_10000657 | |||
| 1534 | Ga0307410_10010519 | |||
| 1535 | Ga0307410_10024284 | |||
| 1536 | Ga0307410_10025544 | |||
| 1537 | Ga0307410_10079471 | |||
| 1538 | Ga0307406_10545402 | |||
| 1539 | Ga0307407_10035278 | |||
| 1540 | Ga0307407_10048165 | |||
| 1541 | Ga0307412_10551956 | |||
| 1542 | Ga0307412_10722364 | |||
| 1543 | Ga0307409_100056916 | |||
| 1544 | Ga0307409_100178314 | |||
| 1545 | Ga0307409_100254817 | |||
| 1546 | Ga0307409_100682447 | |||
| 1547 | Ga0307409_100711869 | |||
| 1548 | Ga0307416_100018930 | |||
| 1549 | Ga0307416_100052350 | |||
| 1550 | Ga0307416_100059920 | |||
| 1551 | Ga0307416_100129365 | |||
| 1552 | Ga0307416_100180228 | |||
| 1553 | Ga0307416_100327538 | |||
| 1554 | Ga0307414_10018542 | |||
| 1555 | Ga0307414_10153787 | |||
| 1556 | Ga0307414_10689350 | |||
| 1557 | Ga0307411_10235844 | |||
| 1558 | Ga0307415_100014934 | |||
| 1559 | Ga0307415_100022425 | |||
| 1560 | Ga0307415_100047305 | |||
| 1561 | Ga0307415_100118178 | |||
| 1562 | Ga0307415_100178508 | |||
| 1563 | Ga0307507_10049795 | |||
| 1564 | Ga0373958_0007766 | |||
| 1565 | Ga0373926_0001872 | |||
| 1566 | Ga0373926_0038864 | |||
| 1567 | Ga0373926_0052855 | |||
| 1568 | Ga0373934_0000165 | |||
| 1569 | Ga0373934_0012715 | |||
| 1570 | Ga0373934_0022630 | |||
| 1571 | Ga0373934_0032141 | |||
| 1572 | Ga0373934_0032769 | |||
| 1573 | Ga0373934_0044429 | |||
| 1574 | Ga0373934_0049241 | |||
| 1575 | Ga0373944_0000345 | |||
| 1576 | Ga0373949_0011260 | |||
| 1577 | Ga0373952_0015366 | |||
| 1578 | Ga0373923_0009580 | |||
| 1579 | Ga0373923_0013437 | |||
| 1580 | Ga0373923_0055176 | |||
| 1581 | Ga0373923_0113084 | |||
| 1582 | Ga0373936_0000448 | |||
| 1583 | Ga0373936_0001537 | |||
| 1584 | Ga0373936_0018143 | |||
| 1585 | Ga0373936_0039864 | |||
| 1586 | Ga0373945_0000682 | |||
| 1587 | Ga0373953_0000062 | |||
| 1588 | Ga0373953_0013157 | |||
| 1589 | Ga0373953_0047949 | |||
| 1590 | Ga0373954_0007167 | |||
| 1591 | Ga0373954_0021224 | |||
| 1592 | Ga0373954_0036457 | |||
| 1593 | Ga0373954_0039715 | |||
| 1594 | Ga0373954_0061848 | |||
| 1595 | Ga0373956_0000061 | |||
| 1596 | Ga0373956_0029111 | |||
| 1597 | Ga0373956_0030168 | |||
| 1598 | Ga0373956_0030579 | |||
| 1599 | Ga0373956_0066933 | |||
| 1600 | Ga0373956_0081202 | |||
| 1601 | Ga0373956_0170712 | |||
| 1602 | Ga0373957_0000042 | |||
| 1603 | Ga0373957_0013829 | |||
| 1604 | Ga0373957_0037156 | |||
| 1605 | Ga0373957_0068612 | |||
| 1606 | Ga0373957_0105112 | |||
| 1607 | Ga0373960_0161888 | |||
| 1608 | Ga0373943_0000127 | |||
| 1609 | Ga0373943_0018233 | |||
| 1610 | Ga0373943_0051452 | |||
| 1611 | Ga0373946_0000467 | |||
| 1612 | Ga0373946_0047740 | |||
| 1613 | Ga0373946_0094167 | |||
| 1614 | Ga0373955_0000106 | |||
| 1615 | Ga0373955_0008015 | |||
| 1616 | Ga0373955_0013101 | |||
| 1617 | Ga0373955_0072504 | |||
| 1618 | Ga0373955_0210032 | |||
| 1619 | Ga0373955_0255352 | |||
| 1620 | Ga0373955_0352651 | |||
| 1621 | Ga0373962_0012829 | |||
| 1622 | Ga0373924_0001200 | |||
| 1623 | Ga0373924_0003026 | |||
| 1624 | Ga0373924_0006330 | |||
| 1625 | Ga0373924_0007278 | |||
| 1626 | Ga0373931_0195222 | |||
| 1627 | Ga0373935_0000083 | |||
| 1628 | Ga0373935_0007518 | |||
| 1629 | Ga0373935_0021882 | |||
| 1630 | Ga0373935_0035072 | |||
| 1631 | Ga0373935_0115500 | |||
| 1632 | Ga0373935_0122408 | |||
| 1633 | Ga0373935_0293636 | |||
| 1634 | Ga0373935_0371545 | |||
| 1635 | Ga0373935_0423605 | |||
| 1636 | Ga0373935_0553927 | |||
| 1637 | Ga0373935_0690063 | |||
| 1638 | Ga0373927_0008507 | |||
| 1639 | Ga0373927_0040668 | |||
| 1640 | Ga0373927_0125554 | |||
| 1641 | Ga0373933_0000046 | |||
| 1642 | Ga0373933_0000764 | |||
| 1643 | Ga0373933_0005963 | |||
| 1644 | Ga0373933_0010125 | |||
| 1645 | Ga0373933_0010818 | |||
| 1646 | Ga0373933_0015066 | |||
| 1647 | Ga0373933_0020037 | |||
| 1648 | Ga0373933_0038363 | |||
| 1649 | Ga0373933_0410757 | |||
| 1650 | Ga0373947_0000013 | |||
| 1651 | Ga0373947_0007926 | |||
| 1652 | Ga0373947_0031865 | |||
| 1653 | Ga0373947_0036654 | |||
| 1654 | Ga0373947_0045765 | |||
| 1655 | Ga0373947_0063994 | |||
| 1656 | Ga0373947_0209585 | |||
| 1657 | Ga0373947_0243985 | |||
| 1658 | Ga0310104_08455 | |||
| 1659 | Ga0373937_0000115 | |||
| 1660 | Ga0373937_0002923 | |||
| 1661 | Ga0373937_0009930 | |||
| 1662 | Ga0373937_0015807 | |||
| 1663 | Ga0373937_0018604 | |||
| 1664 | Ga0373937_0078781 | |||
| 1665 | Ga0373937_0082411 | |||
| 1666 | Ga0373937_0113042 | |||
| 1667 | Ga0373937_0129547 | |||
| 1668 | Ga0373937_0149465 | |||
| 1669 | Ga0373937_0288264 | |||
| 1670 | Ga0265778_011012 | |||
| 1671 | Ga0265778_014753 | |||
| 1672 | Ga0265778_018811 | |||
| 1673 | Ga0265778_025861 | |||
| 1674 | Ga0372808_010397 | |||
| 1675 | Ga0372808_013298 | |||
| 1676 | Ga0373925_0000006 | |||
| 1677 | Ga0373925_0013192 | |||
| 1678 | Ga0373925_0015172 | |||
| 1679 | Ga0373925_0020550 | |||
| 1680 | Ga0373925_0026483 | |||
| 1681 | Ga0373925_0044387 | |||
| 1682 | Ga0373925_0141086 | |||
| 1683 | Ga0373925_0157988 | |||
| 1684 | Ga0373925_0337715 | |||
| 1685 | Ga0395899_0083803 | |||
| 1686 | Ga0395899_0357733 | |||
| 1687 | Ga0395900_0054575 | |||
| 1688 | Ga0395900_0082987 | |||
| 1689 | Ga0395900_0092673 | |||
| 1690 | Ga0395898_0018007 | |||
| 1691 | Ga0395898_0018475 | |||
| 1692 | Ga0395898_0144371 | |||
| 1693 | Ga0395898_0493466 | |||
| 1694 | Ga0395905_0220082 | |||
| 1695 | Ga0436364_0037108 | |||
| 1696 | Ga0436364_0117635 | |||
| 1697 | Ga0436364_0303129 | |||
| 1698 | Ga0436364_0367672 | |||
| 1699 | Ga0436364_0564335 | |||
| 1700 | Ga0436364_0609944 | |||
| 1701 | Ga0395901_0018489 | |||
| 1702 | Ga0395901_0056756 | |||
| 1703 | Ga0436365_1828923 | |||
| 1704 | Ga0436360_0262833 | |||
| 1705 | Ga0436360_1222117 | |||
| 1706 | Ga0436361_0002952 | |||
| 1707 | Ga0436361_0005383 | |||
| 1708 | Ga0436363_0317296 | |||
| 1709 | Ga0436363_1049305 | |||
| 1710 | Ga0436363_1128805 | |||
| 1711 | Ga0436362_0056396 | |||
| 1712 | Ga0436362_1050687 | |||
| 1713 | Ga0436362_1130435 | |||
| 1714 | Ga0451791_0777094 | |||
| 1715 | Ga0451793_0570611 | |||
| 1716 | Ga0451797_0898786 | |||
| 1717 | Ga0451795_0973011 | |||
| 1718 | Ga0451800_0530642 | |||
| 1719 | Ga0451843_0695364 | |||
| 1720 | Ga0451853_2506132 | |||
| 1721 | Ga0466965_0228532 | |||
| 1722 | Ga0466966_0300108 | |||
| 1723 | Ga0466961_0245966 | |||
| 1724 | Ga0466963_0017558 | |||
| 1725 | Ga0466963_0076171 | |||
| 1726 | Ga0466963_0137736 | |||
| 1727 | Ga0466971_0245579 | |||
| 1728 | Ga0466968_0135462 | |||
| 1729 | Ga0466970_0064859 | |||
| 1730 | Ga0466970_0180247 | |||
| 1731 | Ga0466957_0050098 | |||
| 1732 | Ga0466957_0172828 | |||
| 1733 | Ga0466957_0286495 | |||
| 1734 | Ga0466960_0316841 | |||
| 1735 | Ga0466960_0547183 | |||
| 1736 | Ga0466959_0482100 | |||
| 1737 | Ga0466958_0217978 | |||
| 1738 | Ga0466958_0618926 | |||
| 1739 | Ga0466967_0009950 | |||
| 1740 | Ga0466967_0024778 | |||
| 1741 | Ga0466967_0075539 | |||
| 1742 | Ga0466967_0206356 | |||
| 1743 | Ga0466967_0234827 | |||
| 1744 | Ga0466967_0350413 | |||
| 1745 | Ga0466967_0655418 | |||
| 1746 | Ga0466967_0769870 | |||
| 1747 | Ga0495592_0000166 | |||
| 1748 | Ga0495592_0015558 | |||
| 1749 | Ga0495592_0055960 | |||
| 1750 | Ga0495592_0096440 | |||
| 1751 | Ga0495592_0124689 | |||
| 1752 | Ga0495592_0260506 | |||
| 1753 | Ga0495603_0115365 | |||
| 1754 | Ga0495629_0002265 | |||
| 1755 | Ga0495629_0002959 | |||
| 1756 | Ga0495629_0039481 | |||
| 1757 | Ga0495641_0002211 | |||
| 1758 | Ga0495641_0006393 | |||
| 1759 | Ga0495641_0016080 | |||
| 1760 | Ga0495641_0026755 | |||
| 1761 | Ga0495641_0064513 | |||
| 1762 | Ga0495651_0000067 | |||
| 1763 | Ga0495651_0001741 | |||
| 1764 | Ga0495651_0003120 | |||
| 1765 | Ga0495651_0006413 | |||
| 1766 | Ga0495651_0011288 | |||
| 1767 | Ga0495651_0017640 | |||
| 1768 | Ga0495651_0044041 | |||
| 1769 | Ga0495651_0059181 | |||
| 1770 | Ga0495651_0144457 | |||
| 1771 | Ga0495651_0187785 | |||
| 1772 | Ga0495653_0002855 | |||
| 1773 | Ga0495653_0003019 | |||
| 1774 | Ga0495653_0008818 | |||
| 1775 | Ga0495653_0009962 | |||
| 1776 | Ga0495653_0049954 | |||
| 1777 | Ga0495653_0065592 | |||
| 1778 | Ga0495653_0068170 | |||
| 1779 | Ga0495653_0130307 | |||
| 1780 | Ga0495653_0155901 | |||
| 1781 | Ga0495580_0004032 | |||
| 1782 | Ga0495580_0495234 | |||
| 1783 | Ga0495582_0028806 | |||
| 1784 | Ga0495582_0029531 | |||
| 1785 | Ga0495582_0244517 | |||
| 1786 | Ga0495639_0001164 | |||
| 1787 | Ga0495639_0023650 | |||
| 1788 | Ga0495639_0033106 | |||
| 1789 | Ga0495639_0099476 | |||
| 1790 | Ga0495662_0001369 | |||
| 1791 | Ga0495662_0022367 | |||
| 1792 | Ga0495662_0033107 | |||
| 1793 | Ga0495662_0033556 | |||
| 1794 | Ga0495662_0035004 | |||
| 1795 | Ga0495662_0058791 | |||
| 1796 | Ga0495662_0218166 | |||
| 1797 | Ga0495664_0001129 | |||
| 1798 | Ga0495664_0008813 | |||
| 1799 | Ga0495664_0018782 | |||
| 1800 | Ga0495664_0025488 | |||
| 1801 | Ga0495664_0055824 | |||
| 1802 | Ga0495664_0100952 | |||
| 1803 | Ga0495664_0181696 | |||
| 1804 | Ga0495664_0441646 | |||
| 1805 | Ga0495594_0015879 | |||
| 1806 | Ga0495594_0212143 | |||
| 1807 | Ga0495607_0027343 | |||
| 1808 | Ga0495608_0000095 | |||
| 1809 | Ga0495608_0001055 | |||
| 1810 | Ga0495608_0056758 | |||
| 1811 | Ga0495608_0068711 | |||
| 1812 | Ga0495608_0084913 | |||
| 1813 | Ga0495608_0105356 | |||
| 1814 | Ga0495608_0140033 | |||
| 1815 | Ga0495618_0005027 | |||
| 1816 | Ga0495618_0030791 | |||
| 1817 | Ga0495618_0041188 | |||
| 1818 | Ga0495618_0078116 | |||
| 1819 | Ga0495618_0189755 | |||
| 1820 | Ga0495618_0205363 | |||
| 1821 | Ga0495618_0211030 | |||
| 1822 | Ga0495618_0263348 | |||
| 1823 | Ga0495628_0000916 | |||
| 1824 | Ga0495628_0008790 | |||
| 1825 | Ga0495628_0025055 | |||
| 1826 | Ga0495628_0059190 | |||
| 1827 | Ga0495628_0069739 | |||
| 1828 | Ga0495628_0101958 | |||
| 1829 | Ga0495628_0224043 | |||
| 1830 | Ga0495628_0248900 | |||
| 1831 | Ga0495628_0277448 | |||
| 1832 | Ga0495630_0016843 | |||
| 1833 | Ga0495630_0052920 | |||
| 1834 | Ga0495630_0149607 | |||
| 1835 | Ga0495630_0165725 | |||
| 1836 | Ga0495630_0233228 | |||
| 1837 | Ga0495630_0266924 | |||
| 1838 | Ga0495630_0277890 | |||
| 1839 | Ga0495630_0301553 | |||
| 1840 | Ga0495630_0709376 | |||
| 1841 | Ga0495666_0009075 | |||
| 1842 | Ga0495666_0114680 | |||
| 1843 | Ga0495666_0228179 | |||
| 1844 | Ga0495652_0000337 | |||
| 1845 | Ga0495652_0005021 | |||
| 1846 | Ga0495652_0007308 | |||
| 1847 | Ga0495652_0028603 | |||
| 1848 | Ga0495652_0077310 | |||
| 1849 | Ga0495652_0124303 | |||
| 1850 | Ga0495652_0143248 | |||
| 1851 | Ga0495652_0145468 | |||
| 1852 | Ga0495652_0215581 | |||
| 1853 | Ga0495652_0235454 | |||
| 1854 | Ga0495665_0003362 | |||
| 1855 | Ga0495665_0004591 | |||
| 1856 | Ga0495640_0003965 | |||
| 1857 | Ga0495640_0004351 | |||
| 1858 | Ga0495640_0006745 | |||
| 1859 | Ga0495640_0020499 | |||
| 1860 | Ga0495640_0036929 | |||
| 1861 | Ga0495640_0258620 | |||
| 1862 | Ga0495586_0012351 | |||
| 1863 | Ga0495587_0000078 | |||
| 1864 | Ga0495587_0004576 | |||
| 1865 | Ga0495587_0015551 | |||
| 1866 | Ga0495587_0025015 | |||
| 1867 | Ga0495587_0052225 | |||
| 1868 | Ga0495587_0109646 | |||
| 1869 | Ga0495587_0173389 | |||
| 1870 | Ga0495645_0003438 | |||
| 1871 | Ga0495645_0036732 | |||
| 1872 | Ga0495645_0054572 | |||
| 1873 | Ga0495645_0102750 | |||
| 1874 | Ga0495645_0131842 | |||
| 1875 | Ga0495645_0148684 | |||
| 1876 | Ga0495645_0175675 | |||
| 1877 | Ga0495645_0199943 | |||
| 1878 | Ga0495645_0202898 | |||
| 1879 | Ga0495645_0276561 | |||
| 1880 | Ga0495667_0000122 | |||
| 1881 | Ga0495667_0000189 | |||
| 1882 | Ga0495667_0004398 | |||
| 1883 | Ga0495667_0007120 | |||
| 1884 | Ga0495667_0007839 | |||
| 1885 | Ga0495667_0089644 | |||
| 1886 | Ga0495667_0127099 | |||
| 1887 | Ga0495667_0162688 | |||
| 1888 | Ga0495667_0228140 | |||
| 1889 | Ga0495634_0011114 | |||
| 1890 | Ga0495634_0013313 | |||
| 1891 | Ga0495634_0033802 | |||
| 1892 | Ga0495634_0073656 | |||
| 1893 | Ga0495634_0080022 | |||
| 1894 | Ga0495634_0095768 | |||
| 1895 | Ga0495634_0137063 | |||
| 1896 | Ga0495634_0169949 | |||
| 1897 | Ga0495634_0254443 | |||
| 1898 | Ga0495635_0006820 | |||
| 1899 | Ga0495635_0017697 | |||
| 1900 | Ga0495635_0027490 | |||
| 1901 | Ga0495635_0028679 | |||
| 1902 | Ga0495635_0116269 | |||
| 1903 | Ga0495635_0124494 | |||
| 1904 | Ga0495635_0126290 | |||
| 1905 | Ga0495635_0265272 | |||
| 1906 | Ga0495635_0475443 | |||
| 1907 | Ga0495661_0050042 | |||
| 1908 | Ga0495657_0000098 | |||
| 1909 | Ga0495657_0002783 | |||
| 1910 | Ga0495657_0008034 | |||
| 1911 | Ga0495657_0026798 | |||
| 1912 | Ga0495657_0034763 | |||
| 1913 | Ga0495657_0039045 | |||
| 1914 | Ga0495657_0056772 | |||
| 1915 | Ga0495657_0087146 | |||
| 1916 | Ga0495657_0219374 | |||
| 1917 | Ga0495657_0227726 | |||
| 1918 | Ga0495599_0000115 | |||
| 1919 | Ga0495599_0000177 | |||
| 1920 | Ga0495599_0001503 | |||
| 1921 | Ga0495599_0009217 | |||
| 1922 | Ga0495599_0045654 | |||
| 1923 | Ga0495599_0117479 | |||
| 1924 | Ga0495599_0130116 | |||
| 1925 | Ga0495599_0241140 | |||
| 1926 | Ga0495623_0000184 | |||
| 1927 | Ga0495623_0013148 | |||
| 1928 | Ga0495623_0026732 | |||
| 1929 | Ga0495623_0055269 | |||
| 1930 | Ga0495623_0067712 | |||
| 1931 | Ga0495623_0102113 | |||
| 1932 | Ga0495623_0108227 | |||
| 1933 | Ga0495646_0004406 | |||
| 1934 | Ga0495646_0007946 | |||
| 1935 | Ga0495646_0030532 | |||
| 1936 | Ga0495646_0031214 | |||
| 1937 | Ga0495646_0039835 | |||
| 1938 | Ga0495646_0127778 | |||
| 1939 | Ga0495646_0136375 | |||
| 1940 | Ga0495646_0174349 | |||
| 1941 | Ga0495646_0183385 | |||
| 1942 | Ga0495646_0206820 | |||
| 1943 | Ga0495646_0254515 | |||
| 1944 | Ga0495647_0017856 | |||
| 1945 | Ga0495658_0012461 | |||
| 1946 | Ga0495658_0040676 | |||
| 1947 | Ga0495658_0116344 | |||
| 1948 | Ga0495613_0004810 | |||
| 1949 | Ga0495613_0015231 | |||
| 1950 | Ga0495613_0241684 | |||
| 1951 | Ga0495624_0018370 | |||
| 1952 | Ga0495624_0029789 | |||
| 1953 | Ga0495624_0047687 | |||
| 1954 | Ga0495600_0002753 | |||
| 1955 | Ga0495600_0028120 | |||
| 1956 | Ga0495600_0050502 | |||
| 1957 | Ga0495600_0060176 | |||
| 1958 | Ga0495600_0075592 | |||
| 1959 | Ga0495600_0133828 | |||
| 1960 | Ga0495600_0214261 | |||
| 1961 | Ga0495600_0235202 | |||
| 1962 | Ga0495581_0009279 | |||
| 1963 | Ga0495581_0098371 | |||
| 1964 | Ga0495581_0385200 | |||
| 1965 | Ga0495604_0000142 | |||
| 1966 | Ga0495604_0002956 | |||
| 1967 | Ga0495604_0010319 | |||
| 1968 | Ga0495604_0050516 | |||
| 1969 | Ga0495604_0051177 | |||
| 1970 | Ga0495604_0271680 | |||
| 1971 | Ga0495604_0307677 | |||
| 1972 | Ga0495604_0323823 | |||
| 1973 | Ga0495674_0003502 | |||
| 1974 | Ga0495674_0010298 | |||
| 1975 | Ga0495674_0057991 | |||
| 1976 | Ga0495674_0061807 | |||
| 1977 | Ga0495674_0094221 | |||
| 1978 | Ga0495674_0122790 | |||
| 1979 | Ga0495674_0184252 | |||
| 1980 | Ga0495674_0399716 | |||
| 1981 | Ga0495676_0008370 | |||
| 1982 | Ga0495676_0023985 | |||
| 1983 | Ga0495676_0059141 | |||
| 1984 | Ga0495676_0135898 | |||
| 1985 | Ga0495680_0000111 | |||
| 1986 | Ga0495680_0004282 | |||
| 1987 | Ga0495680_0005094 | |||
| 1988 | Ga0495680_0005872 | |||
| 1989 | Ga0495680_0010139 | |||
| 1990 | Ga0495680_0014651 | |||
| 1991 | Ga0495680_0020748 | |||
| 1992 | Ga0495680_0035570 | |||
| 1993 | Ga0495680_0042483 | |||
| 1994 | Ga0495680_0058725 | |||
| 1995 | Ga0495680_0066318 | |||
| 1996 | Ga0495680_0204475 | |||
| 1997 | Ga0495675_0001489 | |||
| 1998 | Ga0495675_0040589 | |||
| 1999 | Ga0495675_0093748 | |||
| 2000 | Ga0495684_0002270 | |||
| 2001 | Ga0495684_0003204 | |||
| 2002 | Ga0495684_0008149 | |||
| 2003 | Ga0495684_0014213 | |||
| 2004 | Ga0495684_0016512 | |||
| 2005 | Ga0495684_0025479 | |||
| 2006 | Ga0495684_0101894 | |||
| 2007 | Ga0495684_0133356 | |||
| 2008 | Ga0495593_0002166 | |||
| 2009 | Ga0495593_0091666 | |||
| 2010 | Ga0495593_0229754 | |||
| 2011 | Ga0495602_0000820 | |||
| 2012 | Ga0495602_0004405 | |||
| 2013 | Ga0495602_0008286 | |||
| 2014 | Ga0495602_0026182 | |||
| 2015 | Ga0495602_0055984 | |||
| 2016 | Ga0495602_0074611 | |||
| 2017 | Ga0495602_0445132 | |||
| 2018 | Ga0495614_0001134 | |||
| 2019 | Ga0496101_0089050 | |||
| 2020 | Ga0496102_0033671 | |||
| 2021 | Ga0496102_0047351 | |||
| 2022 | Ga0496102_0151084 | |||
| 2023 | Ga0496102_0400745 | |||
| 2024 | Ga0496102_0750462 | |||
| 2025 | Ga0496103_0045631 | |||
| 2026 | Ga0496104_0004882 | |||
| 2027 | Ga0496104_0005898 | |||
| 2028 | Ga0496104_0966441 | |||
| 2029 | Ga0496105_0002449 | |||
| 2030 | Ga0496105_0005053 | |||
| 2031 | Ga0496105_0009106 | |||
| 2032 | Ga0496105_0095805 | |||
| 2033 | Ga0496105_0656734 | |||
| 2034 | Ga0496106_0120979 | |||
| 2035 | Ga0496106_0181377 | |||
| 2036 | Ga0496106_0295182 | |||
| 2037 | Ga0496106_0693877 | |||
| 2038 | Ga0496107_0071031 | |||
| 2039 | Ga0496107_0099752 | |||
| 2040 | Ga0496108_0010097 | |||
| 2041 | Ga0496108_0023008 | |||
| 2042 | Ga0496108_0044634 | |||
| 2043 | Ga0496108_0048489 | |||
| 2044 | Ga0496108_0077587 | |||
| 2045 | Ga0496108_0084430 | |||
| 2046 | Ga0496108_0270569 | |||
| 2047 | Ga0496108_0372406 | |||
| 2048 | Ga0496109_0021509 | |||
| 2049 | Ga0496109_0051181 | |||
| 2050 | Ga0496109_0136576 | |||
| 2051 | Ga0496109_0178551 | |||
| 2052 | Ga0496109_0247544 | |||
| 2053 | Ga0496110_0001460 | |||
| 2054 | Ga0496110_0058374 | |||
| 2055 | Ga0496110_0074566 | |||
| 2056 | Ga0496110_0076390 | |||
| 2057 | Ga0496110_0180169 | |||
| 2058 | Ga0496110_0184032 | |||
| 2059 | Ga0496110_0189103 | |||
| 2060 | Ga0496110_0317571 | |||
| 2061 | Ga0496110_0446269 | |||
| 2062 | Ga0496110_0454220 | |||
| 2063 | Ga0496110_0911045 | |||
| 2064 | Ga0496111_0001687 | |||
| 2065 | Ga0496111_0029524 | |||
| 2066 | Ga0496111_0034819 | |||
| 2067 | Ga0496111_0212428 | |||
| 2068 | Ga0496111_0361233 | |||
| 2069 | Ga0496111_0374359 | |||
| 2070 | Ga0496112_0000184 | |||
| 2071 | Ga0496112_0092630 | |||
| 2072 | Ga0496112_0109660 | |||
| 2073 | Ga0496112_0120011 | |||
| 2074 | Ga0496112_0323102 | |||
| 2075 | Ga0496113_0003802 | |||
| 2076 | Ga0496113_0009108 | |||
| 2077 | Ga0496113_0542018 | |||
| 2078 | Ga0496114_0087446 | |||
| 2079 | Ga0496114_0309857 | |||
| 2080 | Ga0496114_0498460 | |||
| 2081 | Ga0496115_0006393 | |||
| 2082 | Ga0496115_0016211 | |||
| 2083 | Ga0496115_0045292 | |||
| 2084 | Ga0496119_0070317 | |||
| 2085 | Ga0496120_0122420 | |||
| 2086 | Ga0496126_0061346 | |||
| 2087 | Ga0496126_0160793 | |||
| 2088 | Ga0496126_0161341 | |||
| 2089 | Ga0496126_0352785 | |||
| 2090 | Ga0501038_0332506 | |||
| 2091 | Ga0501040_0191297 | |||
| 2092 | Ga0501081_0263068 | |||
| 2093 | Ga0501044_0138400 | |||
| 2094 | nmdc:mga05p37_48767_c1 | |||
| 2095 | nmdc:mga0n895_126015_c1 | |||
| 2096 | nmdc:mga0n895_281445_c1 | |||
| 2097 | nmdc:mga0n895_6775_c1 | |||
| 2098 | nmdc:mga0n895_78977_c1 | |||
| 2099 | nmdc:mga0rr50_24008_c1 | |||
| 2100 | nmdc:mga0rr50_31795_c1 | |||
| 2101 | nmdc:mga0rr50_768369_c1 | |||
| 2102 | nmdc:mga08x19_14122_c1 | |||
| 2103 | nmdc:mga08x19_20251_c1 | |||
| 2104 | nmdc:mga0a205_130722_c1 | |||
| 2105 | nmdc:mga0a205_45417_c1 | |||
| 2106 | Ga0495601_0002036 | |||
| 2107 | Ga0495601_0053364 | |||
| 2108 | Ga0495601_0088569 | |||
| 2109 | Ga0495601_0108858 | |||
| 2110 | Ga0495601_0131991 | |||
| 2111 | Ga0495601_0132087 | |||
| 2112 | Ga0495601_0150587 | |||
| 2113 | Ga0495601_0181150 | |||
| 2114 | Ga0495612_0003599 | |||
| 2115 | Ga0495612_0003737 | |||
| 2116 | Ga0495595_0000738 | |||
| 2117 | Ga0495595_0004179 | |||
| 2118 | Ga0495595_0052581 | |||
| 2119 | Ga0495619_0003457 | |||
| 2120 | Ga0495619_0014222 | |||
| 2121 | Ga0495619_0018280 | |||
| 2122 | Ga0495619_0019112 | |||
| 2123 | Ga0495619_0108272 | |||
| 2124 | Ga0495619_0128523 | |||
| 2125 | Ga0500559_0015887 | |||
| 2126 | Ga0466962_0370843 | |||
| 2127 | 2623500986 | |||
| 2128 | 2644013345 | |||
| 2129 | 2644175659 | |||
| 2130 | 2863073084 | |||
| 2131 | 2866614834 | |||
| 2132 | 2866616499 | |||
| 2133 | 2917742712 | |||
| 2134 | 8003323747 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zlj-assembly4.cif.gz_H | crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain | 0.9887 | 145 | 208 |
| 4wul-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9717 | 150 | 206 |
| 1zlk-assembly1.cif.gz_B | crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain-dna complex | 0.9714 | 145 | 208 |
| 6ekh-assembly1.cif.gz_Y | crystal structure of activated chey from methanoccocus maripaludis | 0.9703 | 1 | 113 |
| 4wul-assembly1.cif.gz_B | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9674 | 150 | 206 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53213_1064_1134_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9722 | 150 | 214 | 1.10.10.10 |
| 1zlkB00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9714 | 145 | 208 | 1.10.10.10 |
| 6ekhY00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9703 | 1 | 113 | 3.40.50.2300 |
| af_P52106_149_214_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9692 | 150 | 206 | 1.10.10.10 |
| af_P06993_830_894_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9682 | 150 | 207 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-K9TAR8-F1-model_v4 | Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain | 0.9862 | 2 | 122 |
GO:0000160
GO:0003677 GO:0016020 |
| AF-D3DBU1-F1-model_v4 | Response regulator receiver protein | 0.9843 | 2 | 139 |
GO:0000160
GO:0003677 |
| AF-C8XHH1-F1-model_v4 | Response regulator receiver protein | 0.9786 | 1 | 127 |
GO:0000160
GO:0003677 |
| AF-K9T8I0-F1-model_v4 | Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain | 0.9678 | 2 | 127 |
GO:0000160
GO:0003677 GO:0016020 GO:0030313 |
| AF-A0A1Z4K307-F1-model_v4 | deleted | 0.9665 | 1 | 127 |
|