F489389

General Info

Members Datasets Scaffolds Average Seq Length
1066 432 1063 138

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10467584|Ga0065707_104675841
Length 157
Sequence MLTAYCLLLTAYGNKDMLIDRRVGRRLMNQINVVPYIDVMLVLLVIFMVTAPLINPGQIELPSVGKTSEPPLQPMEVSIQSDGALSLRDRARSMDERKVSRNDLLAAIRQKQKQNPDQAVVISADKDVRYEAVLEVMDMLQQNQVRKVGLLAKPRGG

Samples

Sample ID Description Type Environment
1 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
2 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
3 2643221660 Methylibium sp. Root1272 Isolate Unclassified
4 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
201 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
202 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
206 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
207 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
208 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
209 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
210 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
211 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
212 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
215 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
216 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
217 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
218 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
219 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
220 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
221 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
222 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
223 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
233 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
234 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
235 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
239 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
253 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
257 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
260 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
261 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
262 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
263 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
266 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
267 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
268 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
269 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
270 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
273 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
276 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
279 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
280 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
286 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
287 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
290 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
315 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
316 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
320 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
321 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
322 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
323 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
324 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
325 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
326 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
327 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
328 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
329 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
330 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
331 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
332 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
333 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
334 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
335 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
338 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
339 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
340 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
341 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
342 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
355 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
356 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
357 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
358 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
379 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
380 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
381 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
382 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
383 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
386 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
387 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
388 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
389 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
390 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
391 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
392 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
403 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
404 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
405 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
406 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
407 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
408 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
409 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
410 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
411 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
412 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
413 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
414 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
415 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
416 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
417 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
418 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
419 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
420 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
421 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
422 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
423 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
424 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
425 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
426 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
427 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
428 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
429 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
430 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
431 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
432 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.88
Nodule 0
Rhizoplane 2.16
Rhizosphere 85.93
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26128J50194_1003477 3300003347 Bacteria 1042
2 Ga0055543_1022535 3300004625 Bacteria 1142
3 Ga0065165_1000092 3300005262 Bacteria 148435
4 Ga0065715_10669271 3300005293 Bacteria 669
5 Ga0065707_10083123 3300005295 Bacteria 10357
6 Ga0065707_10467584 3300005295 Bacteria 785
7 Ga0070658_10399846 3300005327 Bacteria 1180
8 Ga0070676_10011422 3300005328 Bacteria 4829
9 Ga0070676_10048890 3300005328 Bacteria 2474
10 Ga0070676_10252750 3300005328 Bacteria 1177
11 Ga0070676_10931738 3300005328 Bacteria 649
12 Ga0070676_11182796 3300005328 Bacteria 580
13 Ga0070690_100000300 3300005330 Bacteria 25499
14 Ga0070690_100381469 3300005330 Bacteria 1031
15 Ga0070690_100747498 3300005330 Bacteria 755
16 Ga0070690_100817040 3300005330 Bacteria 724
17 Ga0070670_100072630 3300005331 Bacteria 2955
18 Ga0070670_100083904 3300005331 Bacteria 2737
19 Ga0070677_10003447 3300005333 Bacteria 5103
20 Ga0070677_10198215 3300005333 Bacteria 967
21 Ga0068869_100028350 3300005334 Bacteria 3911
22 Ga0068869_100079862 3300005334 Bacteria 2438
23 Ga0068869_100264125 3300005334 Bacteria 1379
24 Ga0068869_100352433 3300005334 Bacteria 1200
25 Ga0068869_101137894 3300005334 Bacteria 684
26 Ga0070666_10065754 3300005335 Bacteria 2460
27 Ga0070666_10856859 3300005335 Bacteria 671
28 Ga0070680_100249963 3300005336 Bacteria 1499
29 Ga0070680_100398442 3300005336 Bacteria 1173
30 Ga0070680_100699222 3300005336 Bacteria 872
31 Ga0070682_100179723 3300005337 Bacteria 1477
32 Ga0070682_100278675 3300005337 Bacteria 1218
33 Ga0068868_100043659 3300005338 Bacteria 3502
34 Ga0068868_100073159 3300005338 Bacteria 2736
35 Ga0068868_100288850 3300005338 Bacteria 1390
36 Ga0068868_100842698 3300005338 Bacteria 830
37 Ga0068868_100849263 3300005338 Bacteria 827
38 Ga0068868_101252304 3300005338 Bacteria 687
39 Ga0070689_100000861 3300005340 Bacteria 18854
40 Ga0070689_100500818 3300005340 Bacteria 1040
41 Ga0070689_101268652 3300005340 Bacteria 663
42 Ga0070691_10039151 3300005341 Bacteria 2240
43 Ga0070691_10083618 3300005341 Bacteria 1566
44 Ga0070691_10117632 3300005341 Bacteria 1335
45 Ga0070687_100132070 3300005343 Bacteria 1443
46 Ga0070687_100474085 3300005343 Bacteria 837
47 Ga0070687_101000230 3300005343 Bacteria 606
48 Ga0070661_100118999 3300005344 Bacteria 1977
49 Ga0070661_101323769 3300005344 Bacteria 605
50 Ga0070692_10020728 3300005345 Bacteria 3190
51 Ga0070692_10200256 3300005345 Bacteria 1169
52 Ga0070692_10424610 3300005345 Bacteria 845
53 Ga0070668_100080727 3300005347 Bacteria 2549
54 Ga0070668_100122184 3300005347 Bacteria 2083
55 Ga0070668_100413291 3300005347 Bacteria 1154
56 Ga0070668_100706146 3300005347 Bacteria 890
57 Ga0070669_100166422 3300005353 Bacteria 1716
58 Ga0070669_100336919 3300005353 Bacteria 1221
59 Ga0070675_100102474 3300005354 Bacteria 2412
60 Ga0070675_100119417 3300005354 Bacteria 2239
61 Ga0070671_100042736 3300005355 Bacteria 3767
62 Ga0070671_100046476 3300005355 Bacteria 3610
63 Ga0070671_100059799 3300005355 Bacteria 3172
64 Ga0070671_100271210 3300005355 Bacteria 1442
65 Ga0070671_101853676 3300005355 Bacteria 536
66 Ga0070674_100030606 3300005356 Bacteria 3559
67 Ga0070674_100170190 3300005356 Bacteria 1660
68 Ga0070674_100258779 3300005356 Bacteria 1370
69 Ga0070674_100287626 3300005356 Bacteria 1305
70 Ga0070674_100456639 3300005356 Bacteria 1055
71 Ga0070674_101532092 3300005356 Bacteria 600
72 Ga0070673_100001741 3300005364 Bacteria 12960
73 Ga0070673_100044306 3300005364 Bacteria 3444
74 Ga0070673_100055581 3300005364 Bacteria 3119
75 Ga0070673_100156271 3300005364 Bacteria 1936
76 Ga0070673_100326679 3300005364 Bacteria 1356
77 Ga0070688_100598564 3300005365 Bacteria 843
78 Ga0070659_100559422 3300005366 Bacteria 980
79 Ga0070659_101334537 3300005366 Bacteria 636
80 Ga0070667_100003744 3300005367 Bacteria 12915
81 Ga0070667_100041004 3300005367 Bacteria 3883
82 Ga0070667_100136381 3300005367 Bacteria 2146
83 Ga0070667_100217270 3300005367 Bacteria 1700
84 Ga0070667_100401046 3300005367 Bacteria 1248
85 Ga0070667_100601126 3300005367 Bacteria 1013
86 Ga0070667_100613516 3300005367 Bacteria 1003
87 Ga0070667_101013773 3300005367 Bacteria 775
88 Ga0070709_11271333 3300005434 Bacteria 593
89 Ga0070701_10066002 3300005438 Bacteria 1922
90 Ga0070705_100065362 3300005440 Bacteria 2177
91 Ga0070705_100091313 3300005440 Bacteria 1898
92 Ga0070705_100390600 3300005440 Bacteria 1027
93 Ga0070705_100396085 3300005440 Bacteria 1021
94 Ga0070705_100641001 3300005440 Bacteria 827
95 Ga0070705_100668485 3300005440 Bacteria 812
96 Ga0070700_100002065 3300005441 Bacteria 10203
97 Ga0070700_100044562 3300005441 Bacteria 2733
98 Ga0070700_100099417 3300005441 Bacteria 1914
99 Ga0070700_100202877 3300005441 Bacteria 1394
100 Ga0070700_100236442 3300005441 Bacteria 1303
101 Ga0070694_100149815 3300005444 Bacteria 1703
102 Ga0070694_100151394 3300005444 Bacteria 1695
103 Ga0070694_100172149 3300005444 Bacteria 1596
104 Ga0070694_100180682 3300005444 Bacteria 1560
105 Ga0070694_101540761 3300005444 Bacteria 563
106 Ga0070708_100022137 3300005445 Bacteria 5387
107 Ga0070708_101514367 3300005445 Bacteria 625
108 Ga0070663_100138750 3300005455 Bacteria 1854
109 Ga0070663_100257192 3300005455 Bacteria 1384
110 Ga0070678_100025513 3300005456 Bacteria 3978
111 Ga0070678_100034520 3300005456 Bacteria 3524
112 Ga0070678_100063394 3300005456 Bacteria 2735
113 Ga0070678_100110420 3300005456 Bacteria 2150
114 Ga0070678_100257442 3300005456 Bacteria 1466
115 Ga0070678_100501737 3300005456 Bacteria 1071
116 Ga0070662_100672546 3300005457 Bacteria 874
117 Ga0070662_101324465 3300005457 Bacteria 620
118 Ga0070681_10074249 3300005458 Bacteria 3362
119 Ga0068867_100004065 3300005459 Bacteria 10300
120 Ga0068867_100004640 3300005459 Bacteria 9669
121 Ga0068867_100005613 3300005459 Bacteria 8889
122 Ga0068867_100040768 3300005459 Bacteria 3391
123 Ga0068867_100302267 3300005459 Bacteria 1319
124 Ga0070685_10061441 3300005466 Bacteria 2200
125 Ga0070685_10372158 3300005466 Bacteria 982
126 Ga0070685_10423717 3300005466 Bacteria 927
127 Ga0070706_100050486 3300005467 Bacteria 3839
128 Ga0070706_100065903 3300005467 Bacteria 3350
129 Ga0070707_100012911 3300005468 Bacteria 7803
130 Ga0070707_100825928 3300005468 Bacteria 891
131 Ga0070698_100078740 3300005471 Bacteria 3294
132 Ga0070699_100410889 3300005518 Bacteria 1224
133 Ga0070699_101547242 3300005518 Bacteria 608
134 Ga0070679_100296260 3300005530 Bacteria 1569
135 Ga0070684_100483072 3300005535 Bacteria 1147
136 Ga0070697_100072004 3300005536 Bacteria 2836
137 Ga0070697_100098562 3300005536 Bacteria 2425
138 Ga0070697_101478875 3300005536 Bacteria 607
139 Ga0070697_101493637 3300005536 Bacteria 604
140 Ga0068853_100226210 3300005539 Bacteria 1710
141 Ga0068853_100336266 3300005539 Bacteria 1402
142 Ga0068853_100532240 3300005539 Bacteria 1112
143 Ga0068853_101212206 3300005539 Bacteria 729
144 Ga0068853_101457658 3300005539 Bacteria 662
145 Ga0070672_100010574 3300005543 Bacteria 6406
146 Ga0070672_100047876 3300005543 Bacteria 3319
147 Ga0070672_100346695 3300005543 Bacteria 1265
148 Ga0070686_100000276 3300005544 Bacteria 35087
149 Ga0070686_100027336 3300005544 Bacteria 3452
150 Ga0070686_101878428 3300005544 Bacteria 511
151 Ga0070695_100019621 3300005545 Bacteria 4119
152 Ga0070695_100047990 3300005545 Bacteria 2729
153 Ga0070695_100085829 3300005545 Bacteria 2091
154 Ga0070695_100172292 3300005545 Bacteria 1527
155 Ga0070696_100005155 3300005546 Bacteria 8736
156 Ga0070696_100023372 3300005546 Bacteria 4202
157 Ga0070696_100134017 3300005546 Bacteria 1805
158 Ga0070696_100160694 3300005546 Bacteria 1655
159 Ga0070693_100276330 3300005547 Bacteria 1123
160 Ga0070693_100285622 3300005547 Bacteria 1107
161 Ga0070693_100360143 3300005547 Bacteria 998
162 Ga0070665_100041322 3300005548 Bacteria 4634
163 Ga0070665_100070429 3300005548 Bacteria 3504
164 Ga0070665_100210764 3300005548 Bacteria 1944
165 Ga0070665_100806753 3300005548 Bacteria 952
166 Ga0070704_100034277 3300005549 Bacteria 3441
167 Ga0070704_100050541 3300005549 Bacteria 2923
168 Ga0070704_100074667 3300005549 Bacteria 2474
169 Ga0070704_100140290 3300005549 Bacteria 1886
170 Ga0070704_100237601 3300005549 Bacteria 1490
171 Ga0070704_100352489 3300005549 Bacteria 1243
172 Ga0070704_100740196 3300005549 Bacteria 875
173 Ga0068855_100147363 3300005563 Bacteria 2678
174 Ga0068855_100648027 3300005563 Bacteria 1135
175 Ga0070664_100437150 3300005564 Bacteria 1200
176 Ga0070664_100755889 3300005564 Bacteria 907
177 Ga0070664_100828612 3300005564 Bacteria 866
178 Ga0070664_102067616 3300005564 Bacteria 540
179 Ga0068857_100012597 3300005577 Bacteria 7367
180 Ga0068857_100017748 3300005577 Bacteria 6239
181 Ga0068857_100091436 3300005577 Bacteria 2724
182 Ga0068857_100166574 3300005577 Bacteria 2002
183 Ga0068854_100128619 3300005578 Bacteria 1932
184 Ga0068854_100246931 3300005578 Bacteria 1423
185 Ga0068856_100196588 3300005614 Bacteria 2031
186 Ga0068856_100239215 3300005614 Bacteria 1831
187 Ga0068856_100410526 3300005614 Bacteria 1374
188 Ga0068856_101092571 3300005614 Bacteria 815
189 Ga0070702_100004569 3300005615 Bacteria 6334
190 Ga0070702_100009084 3300005615 Bacteria 4850
191 Ga0068852_100009754 3300005616 Bacteria 7138
192 Ga0068852_100194764 3300005616 Bacteria 1915
193 Ga0068859_100029195 3300005617 Bacteria 5534
194 Ga0068859_100031129 3300005617 Bacteria 5355
195 Ga0068859_100227548 3300005617 Bacteria 1953
196 Ga0068859_100417001 3300005617 Bacteria 1439
197 Ga0068859_100630261 3300005617 Bacteria 1165
198 Ga0068859_102172732 3300005617 Bacteria 613
199 Ga0068864_100004217 3300005618 Bacteria 11827
200 Ga0068864_100030630 3300005618 Bacteria 4561
201 Ga0068864_101053974 3300005618 Bacteria 808
202 Ga0068866_10000076 3300005718 Bacteria 39397
203 Ga0068866_10062319 3300005718 Bacteria 1940
204 Ga0068866_10237597 3300005718 Bacteria 1108
205 Ga0068861_100007611 3300005719 Bacteria 7432
206 Ga0068870_10012568 3300005840 Bacteria 3960
207 Ga0068870_10042556 3300005840 Bacteria 2365
208 Ga0068870_10461075 3300005840 Bacteria 839
209 Ga0068863_100002662 3300005841 Bacteria 17665
210 Ga0068863_100631257 3300005841 Bacteria 1062
211 Ga0068858_100000442 3300005842 Bacteria 43385
212 Ga0068858_100028744 3300005842 Bacteria 5163
213 Ga0068858_100062203 3300005842 Bacteria 3451
214 Ga0068858_100849232 3300005842 Bacteria 892
215 Ga0068858_101191011 3300005842 Bacteria 749
216 Ga0068858_101271470 3300005842 Bacteria 724
217 Ga0068858_102173163 3300005842 Bacteria 549
218 Ga0068860_100022077 3300005843 Bacteria 6161
219 Ga0068860_100116350 3300005843 Bacteria 2558
220 Ga0068860_100311452 3300005843 Bacteria 1544
221 Ga0068860_100799250 3300005843 Bacteria 956
222 Ga0068860_100887990 3300005843 Bacteria 907
223 Ga0068862_100000952 3300005844 Bacteria 27845
224 Ga0068862_100122412 3300005844 Bacteria 2294
225 Ga0068862_100133200 3300005844 Bacteria 2200
226 Ga0068862_101916227 3300005844 Bacteria 603
227 Ga0068862_102707869 3300005844 Bacteria 507
228 Ga0075365_10019696 3300006038 Bacteria 4171
229 Ga0075365_11014506 3300006038 Bacteria 585
230 Ga0075368_10009558 3300006042 Bacteria 3487
231 Ga0075368_10019412 3300006042 Bacteria 2566
232 Ga0075363_100041779 3300006048 Bacteria 2419
233 Ga0075363_100383143 3300006048 Bacteria 825
234 Ga0075364_10485397 3300006051 Bacteria 845
235 Ga0070715_10664075 3300006163 Bacteria 618
236 Ga0070716_100027492 3300006173 Bacteria 3057
237 Ga0070716_100107534 3300006173 Bacteria 1722
238 Ga0070716_101356461 3300006173 Bacteria 577
239 Ga0075362_10001957 3300006177 Bacteria 6765
240 Ga0075367_10037112 3300006178 Bacteria 2829
241 Ga0075367_10633990 3300006178 Bacteria 679
242 Ga0075369_10003660 3300006186 Bacteria 5614
243 Ga0075369_10008676 3300006186 Bacteria 3922
244 Ga0075369_10039561 3300006186 Bacteria 2014
245 Ga0075366_10008996 3300006195 Bacteria 5570
246 Ga0075366_10020936 3300006195 Bacteria 3799
247 Ga0075366_10036504 3300006195 Bacteria 2898
248 Ga0075366_10038797 3300006195 Bacteria 2813
249 Ga0075366_10098545 3300006195 Bacteria 1753
250 Ga0075366_10865233 3300006195 Bacteria 563
251 Ga0097621_100002873 3300006237 Bacteria 11818
252 Ga0097621_100045264 3300006237 Bacteria 3553
253 Ga0097621_100055977 3300006237 Bacteria 3221
254 Ga0097621_100415390 3300006237 Bacteria 1207
255 Ga0075370_10000366 3300006353 Bacteria 16529
256 Ga0075370_10010448 3300006353 Bacteria 4855
257 Ga0075370_10010871 3300006353 Bacteria 4771
258 Ga0075370_10027521 3300006353 Bacteria 3155
259 Ga0075370_10471547 3300006353 Bacteria 756
260 Ga0075370_10751327 3300006353 Bacteria 594
261 Ga0068871_100002359 3300006358 Bacteria 12878
262 Ga0068871_100095357 3300006358 Bacteria 2484
263 Ga0068871_100237977 3300006358 Bacteria 1582
264 Ga0075428_100007382 3300006844 Bacteria 12189
265 Ga0075430_100008948 3300006846 Bacteria 8456
266 Ga0075430_100141991 3300006846 Bacteria 2000
267 Ga0075430_100207070 3300006846 Bacteria 1628
268 Ga0075431_100010497 3300006847 Bacteria 9312
269 Ga0075431_100654811 3300006847 Bacteria 1030
270 Ga0075433_10271141 3300006852 Bacteria 1504
271 Ga0075434_100478950 3300006871 Bacteria 1266
272 Ga0075434_101131489 3300006871 Bacteria 796
273 Ga0075429_100010327 3300006880 Bacteria 8077
274 Ga0075429_100065627 3300006880 Bacteria 3160
275 Ga0075429_100339869 3300006880 Bacteria 1314
276 Ga0068865_100004680 3300006881 Bacteria 8266
277 Ga0068865_100070650 3300006881 Bacteria 2474
278 Ga0068865_100252927 3300006881 Bacteria 1391
279 Ga0068865_100371785 3300006881 Bacteria 1163
280 Ga0068865_100740148 3300006881 Bacteria 843
281 Ga0068865_100757180 3300006881 Bacteria 835
282 Ga0068865_101688200 3300006881 Bacteria 571
283 Ga0075436_100249448 3300006914 Bacteria 1264
284 Ga0075436_100469681 3300006914 Bacteria 918
285 Ga0097620_100031130 3300006931 Bacteria 5355
286 Ga0097620_100227543 3300006931 Bacteria 1953
287 Ga0097620_100417000 3300006931 Bacteria 1439
288 Ga0097620_100630212 3300006931 Bacteria 1165
289 Ga0097620_102172728 3300006931 Bacteria 613
290 Ga0075435_100702759 3300007076 Bacteria 879
291 Ga0075435_101238924 3300007076 Bacteria 653
292 Ga0099794_10010187 3300007265 Bacteria 3982
293 Ga0099794_10080488 3300007265 Bacteria 1606
294 Ga0099794_10192212 3300007265 Bacteria 1044
295 Ga0099795_10014274 3300007788 Bacteria 2459
296 Ga0105240_10024979 3300009093 Bacteria 7864
297 Ga0105240_10043802 3300009093 Bacteria 5691
298 Ga0111539_10006144 3300009094 Bacteria 15507
299 Ga0111539_11709330 3300009094 Bacteria 730
300 Ga0105245_10000279 3300009098 Bacteria 48462
301 Ga0105245_10017419 3300009098 Bacteria 6268
302 Ga0105245_10054670 3300009098 Bacteria 3586
303 Ga0105245_10193155 3300009098 Bacteria 1951
304 Ga0105245_10693816 3300009098 Bacteria 1051
305 Ga0105245_11009829 3300009098 Bacteria 876
306 Ga0105245_11464193 3300009098 Bacteria 733
307 Ga0114129_10199706 3300009147 Bacteria 2709
308 Ga0114129_11088168 3300009147 Bacteria 1001
309 Ga0105243_10000328 3300009148 Bacteria 52003
310 Ga0105243_10042317 3300009148 Bacteria 3566
311 Ga0105243_10042712 3300009148 Bacteria 3550
312 Ga0105243_10929159 3300009148 Bacteria 867
313 Ga0105243_11534987 3300009148 Bacteria 691
314 Ga0105241_10119896 3300009174 Bacteria 2117
315 Ga0105241_10285839 3300009174 Bacteria 1410
316 Ga0105241_10804725 3300009174 Bacteria 866
317 Ga0105241_11824647 3300009174 Bacteria 594
318 Ga0105242_10000629 3300009176 Bacteria 27730
319 Ga0105242_10119601 3300009176 Bacteria 2258
320 Ga0105242_10130248 3300009176 Bacteria 2170
321 Ga0105242_10177588 3300009176 Bacteria 1876
322 Ga0105242_11151969 3300009176 Bacteria 792
323 Ga0105248_10099558 3300009177 Bacteria 3276
324 Ga0105248_10108959 3300009177 Bacteria 3123
325 Ga0105248_10154567 3300009177 Bacteria 2589
326 Ga0105248_11015863 3300009177 Bacteria 937
327 Ga0105248_11367456 3300009177 Bacteria 801
328 Ga0105237_10019997 3300009545 Bacteria 6912
329 Ga0105237_10023165 3300009545 Bacteria 6366
330 Ga0105238_10959484 3300009551 Bacteria 875
331 Ga0105238_11034900 3300009551 Bacteria 842
332 Ga0105249_10041028 3300009553 Bacteria 4205
333 Ga0105249_10184647 3300009553 Bacteria 2031
334 Ga0105249_10185727 3300009553 Bacteria 2026
335 Ga0105249_10312075 3300009553 Bacteria 1581
336 Ga0105249_10386522 3300009553 Bacteria 1426
337 Ga0105249_10457856 3300009553 Bacteria 1315
338 Ga0099796_10006792 3300010159 Bacteria 2952
339 Ga0105239_10034134 3300010375 Bacteria 5585
340 Ga0105239_10097074 3300010375 Bacteria 3256
341 Ga0105239_10869713 3300010375 Bacteria 1034
342 Ga0105239_12427338 3300010375 Bacteria 611
343 Ga0105246_10200007 3300011119 Bacteria 1553
344 Ga0105246_10664469 3300011119 Bacteria 909
345 Ga0105246_12078353 3300011119 Bacteria 550
346 Ga0157326_1035325 3300012513 Bacteria 680
347 Ga0157369_11827977 3300013105 Bacteria 617
348 Ga0157374_10000104 3300013296 Bacteria 78523
349 Ga0157374_10054467 3300013296 Bacteria 3731
350 Ga0157374_10109574 3300013296 Bacteria 2655
351 Ga0157374_10730633 3300013296 Bacteria 1004
352 Ga0157374_10948477 3300013296 Bacteria 879
353 Ga0157378_10000815 3300013297 Bacteria 28986
354 Ga0157378_10005354 3300013297 Bacteria 11257
355 Ga0157378_10010321 3300013297 Bacteria 8153
356 Ga0157378_10189673 3300013297 Bacteria 1938
357 Ga0157378_10467196 3300013297 Bacteria 1255
358 Ga0163162_10000821 3300013306 Bacteria 28874
359 Ga0163162_10109032 3300013306 Bacteria 2865
360 Ga0163162_11243326 3300013306 Bacteria 845
361 Ga0163162_12126839 3300013306 Bacteria 644
362 Ga0157375_10029474 3300013308 Bacteria 5162
363 Ga0157375_10089129 3300013308 Bacteria 3141
364 Ga0157375_10090951 3300013308 Bacteria 3112
365 Ga0157375_10203443 3300013308 Bacteria 2136
366 Ga0157375_10295166 3300013308 Bacteria 1784
367 Ga0157375_10723938 3300013308 Bacteria 1148
368 Ga0157375_11244299 3300013308 Bacteria 874
369 Ga0157375_11400237 3300013308 Bacteria 824
370 Ga0163163_10042982 3300014325 Bacteria 4428
371 Ga0163163_10898372 3300014325 Bacteria 949
372 Ga0163163_10939065 3300014325 Bacteria 928
373 Ga0157380_10005446 3300014326 Bacteria 8897
374 Ga0157380_10009860 3300014326 Bacteria 6857
375 Ga0157380_10141913 3300014326 Bacteria 2065
376 Ga0157380_10441454 3300014326 Bacteria 1247
377 Ga0157380_10977140 3300014326 Bacteria 878
378 Ga0157380_11148501 3300014326 Bacteria 818
379 Ga0157380_13145535 3300014326 Bacteria 527
380 Ga0157377_10307343 3300014745 Bacteria 1049
381 Ga0157379_10009379 3300014968 Bacteria 8527
382 Ga0157379_10023336 3300014968 Bacteria 5489
383 Ga0157379_10080210 3300014968 Bacteria 2923
384 Ga0157379_10117188 3300014968 Bacteria 2395
385 Ga0157379_10245831 3300014968 Bacteria 1623
386 Ga0157376_10118610 3300014969 Bacteria 2341
387 Ga0157376_10194291 3300014969 Bacteria 1863
388 Ga0157376_10450126 3300014969 Bacteria 1256
389 Ga0163161_10037448 3300017792 Bacteria 3477
390 Ga0163161_10049557 3300017792 Bacteria 3036
391 Ga0163161_10207972 3300017792 Bacteria 1511
392 Ga0213876_10043325 3300021384 Bacteria 2378
393 Ga0207697_10015096 3300025315 Bacteria 3195
394 Ga0207656_10341985 3300025321 Bacteria 746
395 Ga0207682_10005721 3300025893 Bacteria 5042
396 Ga0207682_10387554 3300025893 Bacteria 660
397 Ga0207642_10009043 3300025899 Bacteria 3448
398 Ga0207642_10020964 3300025899 Bacteria 2563
399 Ga0207642_10153234 3300025899 Bacteria 1229
400 Ga0207642_10199560 3300025899 Bacteria 1104
401 Ga0207688_10209676 3300025901 Bacteria 1170
402 Ga0207688_10248797 3300025901 Bacteria 1076
403 Ga0207645_10015401 3300025907 Bacteria 5080
404 Ga0207645_10024383 3300025907 Bacteria 3923
405 Ga0207645_10170753 3300025907 Bacteria 1425
406 Ga0207645_10453464 3300025907 Bacteria 866
407 Ga0207643_10005204 3300025908 Bacteria 6960
408 Ga0207643_10018546 3300025908 Bacteria 3811
409 Ga0207643_10075362 3300025908 Bacteria 1947
410 Ga0207705_10201441 3300025909 Bacteria 1508
411 Ga0207684_10042382 3300025910 Bacteria 3858
412 Ga0207684_10052018 3300025910 Bacteria 3475
413 Ga0207654_10501493 3300025911 Bacteria 857
414 Ga0207707_10063136 3300025912 Bacteria 3224
415 Ga0207671_10028571 3300025914 Bacteria 4166
416 Ga0207663_11044505 3300025916 Bacteria 656
417 Ga0207660_10131851 3300025917 Bacteria 1903
418 Ga0207660_10135206 3300025917 Bacteria 1880
419 Ga0207662_10197331 3300025918 Bacteria 1301
420 Ga0207662_10819254 3300025918 Bacteria 657
421 Ga0207657_10040208 3300025919 Bacteria 4146
422 Ga0207649_11377079 3300025920 Bacteria 558
423 Ga0207652_10313936 3300025921 Bacteria 1415
424 Ga0207652_10462507 3300025921 Bacteria 1143
425 Ga0207646_10023091 3300025922 Bacteria 5717
426 Ga0207646_10551562 3300025922 Bacteria 1036
427 Ga0207681_10186571 3300025923 Bacteria 1583
428 Ga0207694_10421837 3300025924 Bacteria 1111
429 Ga0207694_11002958 3300025924 Bacteria 707
430 Ga0207694_11498981 3300025924 Bacteria 569
431 Ga0207650_10122628 3300025925 Bacteria 2025
432 Ga0207650_10141435 3300025925 Bacteria 1892
433 Ga0207650_10289082 3300025925 Bacteria 1336
434 Ga0207650_10474584 3300025925 Bacteria 1043
435 Ga0207659_10061637 3300025926 Bacteria 2704
436 Ga0207659_10072532 3300025926 Bacteria 2517
437 Ga0207659_10073001 3300025926 Bacteria 2511
438 Ga0207659_10280908 3300025926 Bacteria 1361
439 Ga0207659_10659490 3300025926 Bacteria 894
440 Ga0207659_10746826 3300025926 Bacteria 839
441 Ga0207687_10001372 3300025927 Bacteria 16638
442 Ga0207687_10137735 3300025927 Bacteria 1848
443 Ga0207687_10240758 3300025927 Bacteria 1434
444 Ga0207687_10892312 3300025927 Bacteria 761
445 Ga0207644_10015701 3300025931 Bacteria 5088
446 Ga0207644_10033584 3300025931 Bacteria 3586
447 Ga0207644_10082985 3300025931 Bacteria 2372
448 Ga0207644_10442976 3300025931 Bacteria 1066
449 Ga0207644_11062764 3300025931 Bacteria 680
450 Ga0207690_10433682 3300025932 Bacteria 1053
451 Ga0207690_10730292 3300025932 Bacteria 815
452 Ga0207706_10018642 3300025933 Bacteria 6245
453 Ga0207706_10120157 3300025933 Bacteria 2310
454 Ga0207686_10004499 3300025934 Bacteria 7469
455 Ga0207686_10097810 3300025934 Bacteria 1953
456 Ga0207686_10143702 3300025934 Bacteria 1652
457 Ga0207686_10146827 3300025934 Bacteria 1637
458 Ga0207686_10614847 3300025934 Bacteria 856
459 Ga0207709_10002051 3300025935 Bacteria 13026
460 Ga0207709_10008041 3300025935 Bacteria 5841
461 Ga0207709_10073394 3300025935 Bacteria 2180
462 Ga0207670_10002690 3300025936 Bacteria 9345
463 Ga0207670_10116335 3300025936 Bacteria 1935
464 Ga0207670_11395292 3300025936 Bacteria 595
465 Ga0207669_10013598 3300025937 Bacteria 4049
466 Ga0207669_10137492 3300025937 Bacteria 1690
467 Ga0207669_10521039 3300025937 Bacteria 954
468 Ga0207669_10764793 3300025937 Bacteria 799
469 Ga0207669_11117897 3300025937 Bacteria 666
470 Ga0207704_10001158 3300025938 Bacteria 11736
471 Ga0207704_10053094 3300025938 Bacteria 2461
472 Ga0207704_10768208 3300025938 Bacteria 803
473 Ga0207704_10781293 3300025938 Bacteria 796
474 Ga0207704_11280964 3300025938 Bacteria 626
475 Ga0207665_10137755 3300025939 Bacteria 1738
476 Ga0207691_10083518 3300025940 Bacteria 2867
477 Ga0207691_10249421 3300025940 Bacteria 1533
478 Ga0207691_10963779 3300025940 Bacteria 713
479 Ga0207711_10128035 3300025941 Bacteria 2273
480 Ga0207711_10179018 3300025941 Bacteria 1927
481 Ga0207711_11259548 3300025941 Bacteria 681
482 Ga0207689_10001264 3300025942 Bacteria 24372
483 Ga0207689_10048148 3300025942 Bacteria 3516
484 Ga0207689_10079396 3300025942 Bacteria 2697
485 Ga0207689_10270416 3300025942 Bacteria 1407
486 Ga0207689_10344092 3300025942 Bacteria 1239
487 Ga0207689_11112890 3300025942 Bacteria 666
488 Ga0207679_10552185 3300025945 Bacteria 1033
489 Ga0207679_10569083 3300025945 Bacteria 1018
490 Ga0207679_10709718 3300025945 Bacteria 913
491 Ga0207667_10295894 3300025949 Bacteria 1654
492 Ga0207667_10434636 3300025949 Bacteria 1335
493 Ga0207651_10078914 3300025960 Bacteria 2363
494 Ga0207651_10182372 3300025960 Bacteria 1666
495 Ga0207651_10462292 3300025960 Bacteria 1090
496 Ga0207712_10114397 3300025961 Bacteria 2029
497 Ga0207712_10152538 3300025961 Bacteria 1786
498 Ga0207712_10315739 3300025961 Bacteria 1287
499 Ga0207712_10951280 3300025961 Bacteria 761
500 Ga0207668_10354122 3300025972 Bacteria 1228
501 Ga0207668_11226300 3300025972 Bacteria 674
502 Ga0207640_10061774 3300025981 Bacteria 2483
503 Ga0207640_10134548 3300025981 Bacteria 1792
504 Ga0207658_10004811 3300025986 Bacteria 9339
505 Ga0207658_10232678 3300025986 Bacteria 1556
506 Ga0207658_10333230 3300025986 Bacteria 1317
507 Ga0207658_10390154 3300025986 Bacteria 1221
508 Ga0207658_10480332 3300025986 Bacteria 1104
509 Ga0207658_10791567 3300025986 Bacteria 860
510 Ga0207677_10008704 3300026023 Bacteria 5682
511 Ga0207677_10037952 3300026023 Bacteria 3153
512 Ga0207677_10082026 3300026023 Bacteria 2316
513 Ga0207677_10200638 3300026023 Bacteria 1585
514 Ga0207677_10311169 3300026023 Bacteria 1305
515 Ga0207677_10376671 3300026023 Bacteria 1197
516 Ga0207677_10862374 3300026023 Bacteria 814
517 Ga0207703_10003431 3300026035 Bacteria 13308
518 Ga0207703_10024821 3300026035 Bacteria 4716
519 Ga0207703_10104125 3300026035 Bacteria 2410
520 Ga0207703_10351563 3300026035 Bacteria 1357
521 Ga0207703_10374934 3300026035 Bacteria 1315
522 Ga0207703_10551746 3300026035 Bacteria 1087
523 Ga0207703_10742300 3300026035 Bacteria 935
524 Ga0207639_10083964 3300026041 Bacteria 2529
525 Ga0207639_10305531 3300026041 Bacteria 1407
526 Ga0207639_10396423 3300026041 Bacteria 1243
527 Ga0207639_11368618 3300026041 Bacteria 664
528 Ga0207678_10157281 3300026067 Bacteria 1941
529 Ga0207678_10888986 3300026067 Bacteria 788
530 Ga0207708_10000058 3300026075 Bacteria 95656
531 Ga0207708_10003747 3300026075 Bacteria 11205
532 Ga0207708_10014104 3300026075 Bacteria 5973
533 Ga0207708_10233950 3300026075 Bacteria 1476
534 Ga0207702_10114151 3300026078 Bacteria 2407
535 Ga0207702_10437946 3300026078 Bacteria 1266
536 Ga0207641_10027510 3300026088 Bacteria 4697
537 Ga0207641_10041940 3300026088 Bacteria 3837
538 Ga0207641_10065794 3300026088 Bacteria 3101
539 Ga0207648_10000121 3300026089 Bacteria 76270
540 Ga0207648_10022267 3300026089 Bacteria 5693
541 Ga0207648_10045378 3300026089 Bacteria 3855
542 Ga0207648_10047353 3300026089 Bacteria 3769
543 Ga0207648_10152615 3300026089 Bacteria 2039
544 Ga0207648_10355051 3300026089 Bacteria 1322
545 Ga0207648_11029073 3300026089 Bacteria 772
546 Ga0207676_10004330 3300026095 Bacteria 10043
547 Ga0207676_10174580 3300026095 Bacteria 1875
548 Ga0207676_10383007 3300026095 Bacteria 1310
549 Ga0207676_10607058 3300026095 Bacteria 1051
550 Ga0207674_10017885 3300026116 Bacteria 7726
551 Ga0207674_10032949 3300026116 Bacteria 5429
552 Ga0207674_10159973 3300026116 Bacteria 2206
553 Ga0207674_10190465 3300026116 Bacteria 2001
554 Ga0207674_10373084 3300026116 Bacteria 1379
555 Ga0207674_11473613 3300026116 Bacteria 650
556 Ga0207675_100000143 3300026118 Bacteria 61743
557 Ga0207675_100056721 3300026118 Bacteria 3653
558 Ga0207683_10005276 3300026121 Bacteria 11091
559 Ga0207683_10017452 3300026121 Bacteria 6117
560 Ga0207683_10077218 3300026121 Bacteria 2949
561 Ga0207683_10154661 3300026121 Bacteria 2071
562 Ga0207683_11697753 3300026121 Bacteria 581
563 Ga0207698_11021245 3300026142 Bacteria 838
564 Ga0209969_1004655 3300027360 Bacteria 1919
565 Ga0209981_1012313 3300027378 Bacteria 1184
566 Ga0210000_1003423 3300027462 Bacteria 2288
567 Ga0209995_1023439 3300027471 Bacteria 1026
568 Ga0209968_1000406 3300027526 Bacteria 7034
569 Ga0209968_1034862 3300027526 Bacteria 849
570 Ga0209999_1023090 3300027543 Bacteria 1146
571 Ga0209983_1014750 3300027665 Bacteria 1611
572 Ga0209588_1249969 3300027671 Bacteria 542
573 Ga0209971_1003770 3300027682 Bacteria 3584
574 Ga0209971_1006480 3300027682 Bacteria 2768
575 Ga0209971_1113183 3300027682 Bacteria 666
576 Ga0209966_1001477 3300027695 Bacteria 4080
577 Ga0209998_10029342 3300027717 Bacteria 1213
578 Ga0209813_10010978 3300027866 Bacteria 2356
579 Ga0209813_10084932 3300027866 Bacteria 1053
580 Ga0207428_10173137 3300027907 Bacteria 1634
581 Ga0207428_10284778 3300027907 Bacteria 1226
582 Ga0207428_10561317 3300027907 Bacteria 825
583 Ga0268266_10021482 3300028379 Bacteria 5498
584 Ga0268266_10054582 3300028379 Bacteria 3433
585 Ga0268266_10346642 3300028379 Bacteria 1395
586 Ga0268265_10025116 3300028380 Bacteria 4224
587 Ga0268265_10036789 3300028380 Bacteria 3588
588 Ga0268264_10011923 3300028381 Bacteria 7160
589 Ga0268264_10046608 3300028381 Bacteria 3601
590 Ga0268264_10094702 3300028381 Bacteria 2582
591 Ga0268264_10665234 3300028381 Bacteria 1032
592 Ga0268264_11013529 3300028381 Bacteria 837
593 Ga0265318_10060093 3300028577 Bacteria 1417
594 Ga0265318_10274901 3300028577 Bacteria 614
595 Ga0265322_10108869 3300028654 Bacteria 788
596 Ga0307517_10000499 3300028786 Bacteria 67326
597 Ga0307517_10053917 3300028786 Bacteria 3992
598 Ga0307515_10017831 3300028794 Bacteria 12902
599 Ga0307515_10061230 3300028794 Bacteria 5345
600 Ga0307515_10303092 3300028794 Bacteria 1281
601 Ga0307515_10344822 3300028794 Bacteria 1139
602 Ga0307515_10409468 3300028794 Bacteria 979
603 Ga0265338_10106841 3300028800 Bacteria 2265
604 Ga0265324_10003482 3300029957 Bacteria 7459
605 Ga0307511_10000471 3300030521 Bacteria 43590
606 Ga0307512_10113943 3300030522 Bacteria 1767
607 Ga0265330_10008863 3300031235 Bacteria 4812
608 Ga0265332_10012224 3300031238 Bacteria 3809
609 Ga0265328_10000016 3300031239 Bacteria 132959
610 Ga0265328_10003721 3300031239 Bacteria 6725
611 Ga0265325_10054431 3300031241 Bacteria 2048
612 Ga0265325_10441900 3300031241 Bacteria 567
613 Ga0265329_10005212 3300031242 Bacteria 5284
614 Ga0265339_10119949 3300031249 Bacteria 1353
615 Ga0265331_10003027 3300031250 Bacteria 11025
616 Ga0265331_10074353 3300031250 Bacteria 1586
617 Ga0265331_10127325 3300031250 Bacteria 1163
618 Ga0265331_10525456 3300031250 Bacteria 533
619 Ga0265327_10000103 3300031251 Bacteria 185405
620 Ga0265327_10031534 3300031251 Bacteria 2976
621 Ga0265327_10107029 3300031251 Bacteria 1341
622 Ga0265327_10108325 3300031251 Bacteria 1331
623 Ga0265316_10036177 3300031344 Bacteria 3993
624 Ga0265316_10115550 3300031344 Bacteria 2029
625 Ga0265316_10533534 3300031344 Bacteria 836
626 Ga0307513_10021752 3300031456 Bacteria 7565
627 Ga0307513_10302643 3300031456 Bacteria 1365
628 Ga0307509_10000032 3300031507 Bacteria 202919
629 Ga0307509_10002631 3300031507 Bacteria 28728
630 Ga0307509_10004339 3300031507 Bacteria 20572
631 Ga0307509_10012369 3300031507 Bacteria 10215
632 Ga0307509_10027391 3300031507 Bacteria 6341
633 Ga0307509_10066960 3300031507 Bacteria 3765
634 Ga0307509_10176895 3300031507 Bacteria 2005
635 Ga0307408_100498340 3300031548 Bacteria 1066
636 Ga0307408_100659709 3300031548 Bacteria 936
637 Ga0307408_101164982 3300031548 Bacteria 718
638 Ga0307508_10017553 3300031616 Bacteria 6505
639 Ga0307508_10107934 3300031616 Bacteria 2383
640 Ga0307508_10165511 3300031616 Bacteria 1814
641 Ga0307508_10207068 3300031616 Bacteria 1562
642 Ga0307514_10016794 3300031649 Bacteria 6026
643 Ga0307514_10018499 3300031649 Bacteria 5712
644 Ga0307514_10432961 3300031649 Bacteria 655
645 Ga0316575_10000232 3300031665 Bacteria 14984
646 Ga0316575_10004541 3300031665 Bacteria 4887
647 Ga0265314_10005881 3300031711 Bacteria 10980
648 Ga0265314_10011856 3300031711 Bacteria 7160
649 Ga0307516_10195244 3300031730 Bacteria 1747
650 Ga0307516_10261674 3300031730 Bacteria 1420
651 Ga0307413_10178539 3300031824 Bacteria 1511
652 Ga0307412_10533678 3300031911 Bacteria 982
653 Ga0307412_10791382 3300031911 Bacteria 822
654 Ga0307412_11069507 3300031911 Bacteria 716
655 Ga0307412_11410542 3300031911 Bacteria 631
656 Ga0307416_100562644 3300032002 Bacteria 1215
657 Ga0307416_103535146 3300032002 Bacteria 523
658 Ga0307411_10368588 3300032005 Bacteria 1177
659 Ga0307411_10481583 3300032005 Bacteria 1045
660 Ga0307411_11356154 3300032005 Bacteria 649
661 Ga0307411_11692783 3300032005 Bacteria 585
662 Ga0307415_100084635 3300032126 Bacteria 2276
663 Ga0307415_100433084 3300032126 Bacteria 1132
664 Ga0307507_10054152 3300033179 Bacteria 3822
665 Ga0307507_10102485 3300033179 Bacteria 2387
666 Ga0307510_10002130 3300033180 Bacteria 22354
667 Ga0307510_10091238 3300033180 Bacteria 2889
668 Ga0307510_10115814 3300033180 Bacteria 2403
669 Ga0307510_10304281 3300033180 Bacteria 1055
670 Ga0373958_0022583 3300034819 Bacteria 1177
671 Ga0373959_0008650 3300034820 Bacteria 1738
672 Ga0373926_0104689 3300035083 Bacteria 1060
673 Ga0373926_0267077 3300035083 Bacteria 665
674 Ga0373928_0124931 3300035084 Bacteria 693
675 Ga0373929_0222344 3300035085 Bacteria 537
676 Ga0373934_0000098 3300035086 Bacteria 30518
677 Ga0373940_0001620 3300035088 Bacteria 4132
678 Ga0373949_0015829 3300035090 Bacteria 1688
679 Ga0373952_0009088 3300035092 Bacteria 1895
680 Ga0373923_0179065 3300035111 Bacteria 973
681 Ga0373923_0684716 3300035111 Bacteria 508
682 Ga0373936_0028084 3300035113 Bacteria 2210
683 Ga0373936_0496120 3300035113 Bacteria 567
684 Ga0373939_0000016 3300035114 Bacteria 62934
685 Ga0373939_0044187 3300035114 Bacteria 1355
686 Ga0373953_0013828 3300035117 Bacteria 2890
687 Ga0373954_0000709 3300035118 Bacteria 12806
688 Ga0373954_0377376 3300035118 Bacteria 700
689 Ga0373956_0005111 3300035119 Bacteria 5250
690 Ga0373956_0332865 3300035119 Bacteria 724
691 Ga0373957_0020547 3300035120 Bacteria 2334
692 Ga0373957_0083602 3300035120 Bacteria 1262
693 Ga0373957_0433884 3300035120 Bacteria 568
694 Ga0373943_0631110 3300035170 Bacteria 632
695 Ga0373955_0020139 3300035172 Bacteria 3349
696 Ga0373955_0210377 3300035172 Bacteria 1159
697 Ga0373955_0454025 3300035172 Bacteria 781
698 Ga0373955_0562875 3300035172 Bacteria 697
699 Ga0373924_0285380 3300035410 Bacteria 732
700 Ga0373924_0351309 3300035410 Bacteria 657
701 Ga0373931_0088685 3300035691 Bacteria 1720
702 Ga0373931_0279802 3300035691 Bacteria 1024
703 Ga0373931_0284222 3300035691 Bacteria 1017
704 Ga0373931_0356269 3300035691 Bacteria 917
705 Ga0373931_0427323 3300035691 Bacteria 843
706 Ga0373931_0628411 3300035691 Bacteria 704
707 Ga0373927_0006664 3300035695 Bacteria 7858
708 Ga0373927_0017581 3300035695 Bacteria 4705
709 Ga0373927_0029470 3300035695 Bacteria 3578
710 Ga0373927_0126277 3300035695 Bacteria 1670
711 Ga0373927_0286590 3300035695 Bacteria 1084
712 Ga0373927_0306202 3300035695 Bacteria 1046
713 Ga0373933_0003854 3300035724 Bacteria 8273
714 Ga0373933_0040367 3300035724 Bacteria 2750
715 Ga0373933_0055759 3300035724 Bacteria 2371
716 Ga0373933_0120830 3300035724 Bacteria 1640
717 Ga0373947_0310063 3300035725 Bacteria 1054
718 Ga0373947_0644544 3300035725 Bacteria 722
719 Ga0373947_0765299 3300035725 Bacteria 659
720 Ga0373937_0001120 3300036401 Bacteria 22587
721 Ga0373937_0026386 3300036401 Bacteria 5251
722 Ga0373937_0174583 3300036401 Bacteria 2017
723 Ga0373937_0253324 3300036401 Bacteria 1659
724 Ga0373937_0509471 3300036401 Bacteria 1143
725 Ga0373937_0701317 3300036401 Bacteria 959
726 Ga0373937_1010088 3300036401 Bacteria 780
727 Ga0373937_1138148 3300036401 Bacteria 729
728 Ga0373937_1587594 3300036401 Bacteria 601
729 Ga0316582_0039871 3300036647 Bacteria 2927
730 Ga0373925_0010477 3300037068 Bacteria 6723
731 Ga0373925_0173865 3300037068 Bacteria 1701
732 Ga0373925_0412140 3300037068 Bacteria 1103
733 Ga0373925_0974648 3300037068 Bacteria 698
734 Ga0373925_1267539 3300037068 Bacteria 605
735 Ga0373925_1313559 3300037068 Bacteria 593
736 Ga0395901_1034950 3300038443 Bacteria 795
737 Ga0400490_23584 3300038726 Bacteria 23428
738 Ga0436365_0539896 3300039437 Bacteria 2533
739 Ga0436365_1535422 3300039437 Bacteria 562
740 Ga0439439_0210289 3300041406 Bacteria 568
741 Ga0451804_0289310 3300041463 Bacteria 583
742 Ga0451841_0212508 3300041498 Bacteria 604
743 Ga0451853_1110049 3300041512 Bacteria 710
744 Ga0439431_0050391 3300041997 Bacteria 1078
745 Ga0439441_077141 3300042001 Bacteria 721
746 Ga0439443_044163 3300042003 Bacteria 767
747 Ga0439462_0158563 3300042015 Bacteria 638
748 Ga0450888_014470 3300042126 Bacteria 955
749 Ga0450898_008229 3300042134 Bacteria 1641
750 Ga0439446_0309148 3300042156 Bacteria 556
751 Ga0439435_0199154 3300042436 Bacteria 660
752 Ga0439460_0288402 3300042461 Bacteria 572
753 Ga0451577_0000013 3300042876 Bacteria 550689
754 Ga0451577_0001260 3300042876 Bacteria 35013
755 Ga0451577_0002627 3300042876 Bacteria 21052
756 Ga0451577_0006351 3300042876 Bacteria 11803
757 Ga0451577_0049289 3300042876 Bacteria 3761
758 Ga0451577_0085704 3300042876 Bacteria 2811
759 Ga0451577_0349496 3300042876 Bacteria 1341
760 Ga0451577_0365696 3300042876 Bacteria 1308
761 Ga0451577_0394603 3300042876 Bacteria 1256
762 Ga0451577_0680984 3300042876 Bacteria 932
763 Ga0453683_0000033 3300044673 Bacteria 241479
764 Ga0453683_0029419 3300044673 Bacteria 3473
765 Ga0453683_0806786 3300044673 Bacteria 618
766 Ga0453684_0000014 3300044712 Bacteria 993311
767 Ga0453684_0000029 3300044712 Bacteria 757969
768 Ga0453684_0000085 3300044712 Bacteria 397817
769 Ga0453684_0000142 3300044712 Bacteria 316405
770 Ga0453684_0007704 3300044712 Bacteria 19673
771 Ga0453684_0021042 3300044712 Bacteria 9780
772 Ga0453684_0079145 3300044712 Bacteria 4109
773 Ga0453684_0095901 3300044712 Bacteria 3645
774 Ga0453684_0302414 3300044712 Bacteria 1818
775 Ga0453684_1281363 3300044712 Bacteria 765
776 Ga0453684_1356964 3300044712 Bacteria 739
777 Ga0451576_0000018 3300045051 Bacteria 550689
778 Ga0451576_0000272 3300045051 Bacteria 126530
779 Ga0451576_0006043 3300045051 Bacteria 14946
780 Ga0451576_0014372 3300045051 Bacteria 8815
781 Ga0451576_0024032 3300045051 Bacteria 6587
782 Ga0451576_0070029 3300045051 Bacteria 3650
783 Ga0451576_0092509 3300045051 Bacteria 3146
784 Ga0451576_0226688 3300045051 Bacteria 1951
785 Ga0451576_1214693 3300045051 Bacteria 787
786 Ga0495592_0000237 3300046454 Bacteria 47510
787 Ga0495603_0343118 3300046455 Bacteria 857
788 Ga0495590_0055228 3300046457 Bacteria 1388
789 Ga0495629_0440426 3300046459 Bacteria 883
790 Ga0495629_0486510 3300046459 Bacteria 833
791 Ga0495641_0042268 3300046461 Bacteria 2113
792 Ga0495641_0069493 3300046461 Bacteria 1583
793 Ga0495651_0000147 3300046462 Bacteria 51361
794 Ga0495653_0666112 3300046463 Bacteria 634
795 Ga0495653_0784174 3300046463 Bacteria 574
796 Ga0495580_0055683 3300046472 Bacteria 2786
797 Ga0495580_0201885 3300046472 Bacteria 1369
798 Ga0495605_0054917 3300046474 Bacteria 1927
799 Ga0495662_0016895 3300046476 Bacteria 3531
800 Ga0495664_0496524 3300046477 Bacteria 729
801 Ga0495594_0217236 3300046499 Bacteria 1090
802 Ga0495606_0212192 3300046507 Bacteria 1096
803 Ga0495608_0035567 3300046511 Bacteria 3358
804 Ga0495610_0226611 3300046512 Bacteria 752
805 Ga0495610_0240316 3300046512 Bacteria 722
806 Ga0495618_0124682 3300046514 Bacteria 1649
807 Ga0495618_0773400 3300046514 Bacteria 560
808 Ga0495628_0031067 3300046516 Bacteria 4320
809 Ga0495630_0035969 3300046517 Bacteria 3702
810 Ga0495630_0050983 3300046517 Bacteria 3096
811 Ga0495631_0130716 3300046518 Bacteria 1079
812 Ga0495632_0005889 3300046519 Bacteria 8002
813 Ga0495648_0193333 3300046524 Bacteria 1025
814 Ga0495648_0267512 3300046524 Bacteria 817
815 Ga0495663_0170056 3300046525 Bacteria 751
816 Ga0495666_0035252 3300046526 Bacteria 2440
817 Ga0495666_0293873 3300046526 Bacteria 735
818 Ga0495652_0093413 3300046529 Bacteria 2456
819 Ga0495654_0233960 3300046530 Bacteria 772
820 Ga0495640_0022395 3300046533 Bacteria 4618
821 Ga0495640_0815346 3300046533 Bacteria 556
822 Ga0495586_0200934 3300046535 Bacteria 1130
823 Ga0495586_0294447 3300046535 Bacteria 929
824 Ga0495587_0028734 3300046536 Bacteria 3379
825 Ga0495587_0644233 3300046536 Bacteria 582
826 Ga0495598_0009508 3300046537 Bacteria 2301
827 Ga0495621_0072434 3300046539 Bacteria 1272
828 Ga0495597_0021547 3300046542 Bacteria 2995
829 Ga0495645_0041638 3300046543 Bacteria 3349
830 Ga0495622_0305429 3300046557 Bacteria 693
831 Ga0495622_0393882 3300046557 Bacteria 597
832 Ga0495667_0048876 3300046559 Bacteria 2793
833 Ga0495656_0439470 3300046615 Bacteria 686
834 Ga0495668_0070343 3300046616 Bacteria 1924
835 Ga0495668_0142214 3300046616 Bacteria 1313
836 Ga0495634_0094564 3300046642 Bacteria 1936
837 Ga0495611_0470180 3300046648 Bacteria 572
838 Ga0495625_0061838 3300046660 Bacteria 2648
839 Ga0495625_0326347 3300046660 Bacteria 976
840 Ga0495635_0282900 3300046663 Bacteria 1114
841 Ga0495659_0199677 3300046664 Bacteria 820
842 Ga0495657_0050053 3300046675 Bacteria 2811
843 Ga0495657_0312372 3300046675 Bacteria 935
844 Ga0495599_0046691 3300046678 Bacteria 2715
845 Ga0495646_0433929 3300046680 Bacteria 680
846 Ga0495647_0096873 3300046681 Bacteria 1217
847 Ga0495658_0020747 3300046683 Bacteria 3454
848 Ga0495658_0145953 3300046683 Bacteria 1450
849 Ga0495658_0223988 3300046683 Bacteria 1178
850 Ga0495658_0687886 3300046683 Bacteria 655
851 Ga0495658_0715353 3300046683 Bacteria 641
852 Ga0495669_0043302 3300046684 Bacteria 2004
853 Ga0495669_0105898 3300046684 Bacteria 1310
854 Ga0495613_0219996 3300046689 Bacteria 1333
855 Ga0495613_0621769 3300046689 Bacteria 717
856 Ga0495624_0097345 3300046690 Bacteria 1813
857 Ga0495624_0109110 3300046690 Bacteria 1702
858 Ga0495649_0013283 3300046694 Bacteria 4755
859 Ga0495649_0376384 3300046694 Bacteria 715
860 Ga0495600_0263413 3300046809 Bacteria 1094
861 Ga0495660_0045027 3300046810 Bacteria 2424
862 Ga0495604_0041161 3300047317 Bacteria 3624
863 Ga0495604_0397293 3300047317 Bacteria 908
864 Ga0495636_0338502 3300047318 Bacteria 709
865 Ga0495674_0058682 3300047319 Bacteria 3363
866 Ga0495676_0508029 3300047321 Bacteria 790
867 Ga0495680_0167626 3300047322 Bacteria 1591
868 Ga0495680_0232929 3300047322 Bacteria 1311
869 Ga0495687_001087 3300047443 Bacteria 26673
870 Ga0495687_024124 3300047443 Bacteria 2895
871 Ga0495675_0208964 3300047444 Bacteria 1186
872 Ga0495679_217375 3300047446 Bacteria 500
873 Ga0495684_0089261 3300047471 Bacteria 2335
874 Ga0495686_0077805 3300047472 Bacteria 2031
875 Ga0495626_0127504 3300048091 Bacteria 1089
876 Ga0495626_0407002 3300048091 Bacteria 525
877 Ga0496100_0348445 3300048903 Bacteria 1118
878 Ga0496102_0279006 3300048905 Bacteria 1575
879 Ga0496102_1437573 3300048905 Bacteria 608
880 Ga0496104_0030414 3300048907 Bacteria 5018
881 Ga0496104_0868068 3300048907 Bacteria 808
882 Ga0496104_0950704 3300048907 Bacteria 764
883 Ga0496105_0416810 3300048908 Bacteria 1064
884 Ga0496106_0298400 3300048909 Bacteria 1292
885 Ga0496106_0366866 3300048909 Bacteria 1157
886 Ga0496107_0431665 3300048910 Bacteria 979
887 Ga0496108_0112206 3300048911 Bacteria 2332
888 Ga0496108_0222856 3300048911 Bacteria 1639
889 Ga0496109_0074233 3300048912 Bacteria 3126
890 Ga0496109_0121010 3300048912 Bacteria 2439
891 Ga0496109_0170274 3300048912 Bacteria 2043
892 Ga0496110_0080300 3300048913 Bacteria 2906
893 Ga0496110_0324001 3300048913 Bacteria 1404
894 Ga0496112_0003758 3300048915 Bacteria 12678
895 Ga0496112_0677138 3300048915 Bacteria 960
896 Ga0496112_1044568 3300048915 Bacteria 736
897 Ga0496113_0008289 3300048916 Bacteria 6763
898 Ga0496114_0283883 3300048917 Bacteria 1460
899 Ga0496121_0349519 3300048924 Bacteria 985
900 Ga0495682_0081502 3300049460 Bacteria 1164
901 Ga0501295_077350 3300049518 Bacteria 752
902 Ga0501297_010513 3300049520 Bacteria 1049
903 Ga0501299_138030 3300049522 Bacteria 604
904 Ga0501032_0001187 3300049569 Bacteria 20871
905 Ga0501032_0125317 3300049569 Bacteria 1697
906 Ga0501034_0000736 3300049571 Bacteria 49477
907 Ga0501034_0011390 3300049571 Bacteria 9223
908 Ga0501036_0011409 3300049572 Bacteria 7355
909 Ga0501036_0110733 3300049572 Bacteria 2320
910 Ga0501036_0127730 3300049572 Bacteria 2147
911 Ga0501036_0329443 3300049572 Bacteria 1276
912 Ga0501036_0826978 3300049572 Bacteria 762
913 Ga0501037_0122253 3300049573 Bacteria 1871
914 Ga0501037_0207585 3300049573 Bacteria 1382
915 Ga0501038_0003601 3300049574 Bacteria 14420
916 Ga0501038_0774885 3300049574 Bacteria 714
917 Ga0501038_0928465 3300049574 Bacteria 641
918 Ga0501039_0013815 3300049575 Bacteria 6177
919 Ga0501039_0041288 3300049575 Bacteria 3562
920 Ga0501039_0318992 3300049575 Bacteria 1222
921 Ga0501039_0925098 3300049575 Bacteria 678
922 Ga0501039_1397368 3300049575 Bacteria 539
923 Ga0501040_0050613 3300049576 Bacteria 2842
924 Ga0501040_0057294 3300049576 Bacteria 2675
925 Ga0501040_0192097 3300049576 Bacteria 1449
926 Ga0501041_0011932 3300049577 Bacteria 5145
927 Ga0501041_0230361 3300049577 Bacteria 1163
928 Ga0501042_0003342 3300049578 Bacteria 10056
929 Ga0501042_1439924 3300049578 Bacteria 503
930 Ga0501043_0184695 3300049579 Bacteria 1624
931 Ga0501043_0199465 3300049579 Bacteria 1554
932 Ga0501043_0313675 3300049579 Bacteria 1196
933 Ga0501046_0014667 3300049580 Bacteria 6600
934 Ga0501046_0102177 3300049580 Bacteria 2198
935 Ga0501046_0179953 3300049580 Bacteria 1582
936 Ga0501046_1134039 3300049580 Bacteria 539
937 Ga0501048_0032648 3300049582 Bacteria 3762
938 Ga0501048_0361246 3300049582 Bacteria 1036
939 Ga0501068_0001429 3300049584 Bacteria 12668
940 Ga0501068_0038276 3300049584 Bacteria 2873
941 Ga0501071_0015573 3300049587 Bacteria 5221
942 Ga0501071_0042333 3300049587 Bacteria 3263
943 Ga0501072_0000910 3300049588 Bacteria 21707
944 Ga0501072_0003685 3300049588 Bacteria 11559
945 Ga0501072_0321149 3300049588 Bacteria 1230
946 Ga0501072_0518449 3300049588 Bacteria 942
947 Ga0501073_0004078 3300049589 Bacteria 10954
948 Ga0501073_0463719 3300049589 Bacteria 876
949 Ga0501073_0568955 3300049589 Bacteria 783
950 Ga0501074_0019104 3300049590 Bacteria 4976
951 Ga0501074_0039408 3300049590 Bacteria 3423
952 Ga0501074_0134629 3300049590 Bacteria 1767
953 Ga0501075_0044513 3300049591 Bacteria 3330
954 Ga0501075_0376283 3300049591 Bacteria 1082
955 Ga0501075_0741824 3300049591 Bacteria 748
956 Ga0501075_1463352 3300049591 Bacteria 517
957 Ga0501076_0003023 3300049592 Bacteria 11684
958 Ga0501076_0019677 3300049592 Bacteria 5162
959 Ga0501076_0028780 3300049592 Bacteria 4317
960 Ga0501077_0034211 3300049593 Bacteria 3234
961 Ga0501077_0550627 3300049593 Bacteria 740
962 Ga0501079_0006062 3300049741 Bacteria 9061
963 Ga0501079_0096217 3300049741 Bacteria 2295
964 Ga0501079_0702920 3300049741 Bacteria 796
965 Ga0501080_0001631 3300049742 Bacteria 19095
966 Ga0501080_0006509 3300049742 Bacteria 10490
967 Ga0501080_0018841 3300049742 Bacteria 6391
968 Ga0501080_0152381 3300049742 Bacteria 2136
969 Ga0501080_0924342 3300049742 Bacteria 759
970 Ga0501081_0002314 3300049743 Bacteria 11993
971 Ga0501081_0005048 3300049743 Bacteria 8497
972 Ga0501081_0105029 3300049743 Bacteria 2001
973 Ga0501083_0002703 3300049744 Bacteria 12234
974 Ga0501083_0013468 3300049744 Bacteria 5716
975 Ga0501083_0057518 3300049744 Bacteria 2603
976 Ga0501269_017794 3300049766 Unclassified 880
977 Ga0501035_0274233 3300049822 Bacteria 1427
978 Ga0501045_0000766 3300049824 Bacteria 20598
979 nmdc:mga03683_172376_c1 3300050489 Bacteria 984
980 nmdc:mga03n38_21294_c1 3300050490 Bacteria 2607
981 nmdc:mga03n38_44569_c1 3300050490 Bacteria 1949
982 nmdc:mga00v17_237278_c1 3300050491 Bacteria 1182
983 nmdc:mga00v17_91783_c1 3300050491 Bacteria 903
984 nmdc:mga0yw44_166232_c1 3300050492 Bacteria 1446
985 nmdc:mga0k408_115144_c1 3300050493 Bacteria 1591
986 nmdc:mga0k408_21109_c1 3300050493 Bacteria 3655
987 nmdc:mga0k408_30350_c1 3300050493 Bacteria 3082
988 nmdc:mga0k408_36491_c1 3300050493 Bacteria 2822
989 nmdc:mga0k408_4161_c1 3300050493 Bacteria 7678
990 nmdc:mga0k408_7389_c1 3300050493 Bacteria 5867
991 nmdc:mga06z11_15228_c1 3300050494 Bacteria 3428
992 nmdc:mga06z11_3894_c1 3300050494 Bacteria 5820
993 nmdc:mga04h51_25330_c1 3300050495 Bacteria 1825
994 nmdc:mga04h51_7728_c1 3300050495 Bacteria 2849
995 nmdc:mga04h51_98167_c1 3300050495 Bacteria 1064
996 nmdc:mga07m45_137308_c1 3300050496 Bacteria 1416
997 nmdc:mga07m45_160_c1 3300050496 Bacteria 27032
998 nmdc:mga07m45_1622_c1 3300050496 Bacteria 10350
999 nmdc:mga07m45_42054_c1 3300050496 Bacteria 2561
1000 nmdc:mga07m45_469_c1 3300050496 Bacteria 16990
1001 nmdc:mga07m45_563763_c1 3300050496 Bacteria 658
1002 nmdc:mga07m45_6702_c1 3300050496 Bacteria 5844
1003 nmdc:mga07m45_767994_c1 3300050496 Bacteria 553
1004 nmdc:mga05p37_1235803_c1 3300050507 Bacteria 768
1005 nmdc:mga09592_175962_c1 3300050508 Bacteria 1851
1006 nmdc:mga09592_83767_c1 3300050508 Bacteria 2718
1007 nmdc:mga0qj67_1162468_c1 3300050509 Bacteria 601
1008 nmdc:mga0qj67_517559_c1 3300050509 Bacteria 958
1009 nmdc:mga06r32_20528_c1 3300050510 Bacteria 6083
1010 nmdc:mga08y16_2162484_c1 3300050511 Bacteria 503
1011 nmdc:mga08y16_533089_c1 3300050511 Bacteria 1190
1012 nmdc:mga08y16_8908_c1 3300050511 Bacteria 10536
1013 nmdc:mga0n895_689277_c1 3300050512 Bacteria 1018
1014 nmdc:mga0rr50_1477348_c1 3300050513 Bacteria 575
1015 nmdc:mga08x19_141793_c1 3300050514 Bacteria 1623
1016 nmdc:mga08x19_224583_c1 3300050514 Bacteria 1291
1017 nmdc:mga08x19_37590_c1 3300050514 Bacteria 3073
1018 nmdc:mga0a205_1108433_c1 3300050515 Bacteria 639
1019 nmdc:mga0a205_451421_c1 3300050515 Bacteria 1145
1020 nmdc:mga0a205_529402_c1 3300050515 Bacteria 1034
1021 nmdc:mga0sz30_2878_c1 3300050516 Bacteria 6154
1022 nmdc:mga0sz30_51890_c1 3300050516 Bacteria 1741
1023 Ga0495655_0198662 3300053083 Bacteria 655
1024 Ga0495595_0468057 3300053084 Bacteria 641
1025 Ga0495619_0326172 3300053085 Bacteria 1063
1026 Ga0500578_0026552 3300053086 Bacteria 3714
1027 Ga0500643_070441 3300053087 Bacteria 971
1028 Ga0500644_0003036 3300053088 Bacteria 4162
1029 Ga0500647_0171717 3300053091 Bacteria 1000
1030 Ga0500583_0015822 3300053092 Bacteria 2996
1031 Ga0500583_0092466 3300053092 Bacteria 1473
1032 Ga0500651_0060890 3300053093 Bacteria 2359
1033 Ga0500641_0012327 3300053096 Bacteria 3121
1034 Ga0500650_0057618 3300053098 Bacteria 1812
1035 Ga0500650_0328909 3300053098 Bacteria 672
1036 Ga0500594_0000648 3300053118 Bacteria 7419
1037 Ga0500607_242573 3300053121 Bacteria 726
1038 Ga0500621_265672 3300053126 Bacteria 568
1039 Ga0500652_015634 3300053131 Bacteria 2744
1040 Ga0500655_008683 3300053133 Bacteria 1828
1041 Ga0500658_0010471 3300053134 Bacteria 3422
1042 Ga0500559_0000602 3300053136 Bacteria 24517
1043 Ga0500559_0299026 3300053136 Bacteria 756
1044 Ga0500568_0047353 3300053139 Bacteria 1703
1045 Ga0500573_0527334 3300053140 Bacteria 528
1046 Ga0500604_0004670 3300053151 Bacteria 3629
1047 Ga0500620_105003 3300053155 Bacteria 988
1048 Ga0500622_0197165 3300053156 Bacteria 918
1049 Ga0500636_0274429 3300053177 Bacteria 845
1050 Ga0500636_0331247 3300053177 Bacteria 735
1051 Ga0500645_002532 3300053730 Bacteria 8063
1052 Ga0500645_163903 3300053730 Bacteria 609
1053 Ga0500587_000910 3300053739 Bacteria 3945
1054 Ga0501084_0082467 3300054114 Bacteria 2698
1055 Ga0501084_0111519 3300054114 Bacteria 2299
1056 Ga0501084_0186580 3300054114 Bacteria 1750
1057 Ga0590075_076040 3300059424 Bacteria 868
1058 Ga0501082_0011839 3300060353 Bacteria 7498
1059 Ga0501082_0045137 3300060353 Bacteria 3800
1060 Ga0501082_0230371 3300060353 Bacteria 1612
1061 Ga0501082_0387912 3300060353 Bacteria 1219
1062 Ga0530510_0000945 3300061734 Bacteria 19157
1063 Ga0530510_0366553 3300061734 Bacteria 1083

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10000103 Ga0265327_1000010347 103
2 3300035724 Ga0373933_0120830 Ga0373933_0120830_883_1278 104
3 3300036401 Ga0373937_0701317 Ga0373937_0701317_512_907 104
4 3300050490 nmdc:mga03n38_44569_c1 nmdc:mga03n38_44569_c1_1610_1936 108
5 3300007788 Ga0099795_10014274 Ga0099795_100142742 109
6 3300046533 Ga0495640_0815346 Ga0495640_0815346_123_515 113
7 3300036401 Ga0373937_1587594 Ga0373937_1587594_143_535 114
8 3300046463 Ga0495653_0784174 Ga0495653_0784174_62_454 114
9 3300046559 Ga0495667_0048876 Ga0495667_0048876_516_908 114
10 3300053085 Ga0495619_0326172 Ga0495619_0326172_213_605 114
11 3300005445 Ga0070708_100022137 Ga0070708_1000221373 115
12 3300005467 Ga0070706_100065903 Ga0070706_1000659032 115
13 3300005468 Ga0070707_100012911 Ga0070707_1000129114 115
14 3300005471 Ga0070698_100078740 Ga0070698_1000787402 115
15 3300005518 Ga0070699_100410889 Ga0070699_1004108892 115
16 3300005536 Ga0070697_100098562 Ga0070697_1000985623 115
17 3300025910 Ga0207684_10042382 Ga0207684_100423824 115
18 3300025922 Ga0207646_10023091 Ga0207646_100230915 115
19 3300053092 Ga0500583_0092466 Ga0500583_0092466_1095_1460 115
20 3300049518 Ga0501295_077350 Ga0501295_077350_329_694 116
21 3300049766 Ga0501269_017794 Ga0501269_017794_295_660 116
22 3300035113 Ga0373936_0496120 Ga0373936_0496120_165_557 117
23 3300035117 Ga0373953_0013828 Ga0373953_0013828_38_448 117
24 3300037068 Ga0373925_0173865 Ga0373925_0173865_11_403 117
25 3300046536 Ga0495587_0644233 Ga0495587_0644233_197_562 117
26 3300046690 Ga0495624_0097345 Ga0495624_0097345_1158_1568 117
27 3300047317 Ga0495604_0397293 Ga0495604_0397293_473_883 117
28 3300050496 nmdc:mga07m45_767994_c1 nmdc:mga07m45_767994_c1_38_406 117
29 3300046529 Ga0495652_0093413 Ga0495652_0093413_58_468 118
30 3300046543 Ga0495645_0041638 Ga0495645_0041638_1659_2069 118
31 3300046678 Ga0495599_0046691 Ga0495599_0046691_2161_2571 118
32 3300005440 Ga0070705_100641001 Ga0070705_1006410011 119
33 3300005546 Ga0070696_100160694 Ga0070696_1001606942 119
34 3300005549 Ga0070704_100074667 Ga0070704_1000746672 119
35 3300035118 Ga0373954_0377376 Ga0373954_0377376_246_656 119
36 3300035120 Ga0373957_0083602 Ga0373957_0083602_406_816 119
37 3300035170 Ga0373943_0631110 Ga0373943_0631110_149_559 119
38 3300035172 Ga0373955_0562875 Ga0373955_0562875_199_609 119
39 3300035410 Ga0373924_0285380 Ga0373924_0285380_44_454 119
40 3300035724 Ga0373933_0055759 Ga0373933_0055759_302_712 119
41 3300036401 Ga0373937_0253324 Ga0373937_0253324_19_429 119
42 3300046455 Ga0495603_0343118 Ga0495603_0343118_195_605 119
43 3300046463 Ga0495653_0666112 Ga0495653_0666112_19_429 119
44 3300046476 Ga0495662_0016895 Ga0495662_0016895_61_471 119
45 3300046499 Ga0495594_0217236 Ga0495594_0217236_44_454 119
46 3300046511 Ga0495608_0035567 Ga0495608_0035567_2843_3253 119
47 3300046514 Ga0495618_0124682 Ga0495618_0124682_296_706 119
48 3300046516 Ga0495628_0031067 Ga0495628_0031067_856_1266 119
49 3300046536 Ga0495587_0028734 Ga0495587_0028734_364_774 119
50 3300046557 Ga0495622_0393882 Ga0495622_0393882_151_561 119
51 3300046642 Ga0495634_0094564 Ga0495634_0094564_691_1101 119
52 3300046663 Ga0495635_0282900 Ga0495635_0282900_465_875 119
53 3300046680 Ga0495646_0433929 Ga0495646_0433929_216_626 119
54 3300047319 Ga0495674_0058682 Ga0495674_0058682_70_480 119
55 3300005434 Ga0070709_11271333 Ga0070709_112713331 120
56 3300025931 Ga0207644_11062764 Ga0207644_110627642 122
57 3300035083 Ga0373926_0104689 Ga0373926_0104689_590_1000 122
58 3300035111 Ga0373923_0179065 Ga0373923_0179065_277_687 122
59 3300035172 Ga0373955_0210377 Ga0373955_0210377_422_832 122
60 3300035695 Ga0373927_0029470 Ga0373927_0029470_60_470 122
61 3300036401 Ga0373937_1010088 Ga0373937_1010088_67_477 122
62 3300046461 Ga0495641_0042268 Ga0495641_0042268_807_1217 122
63 3300046472 Ga0495580_0201885 Ga0495580_0201885_786_1196 122
64 3300046477 Ga0495664_0496524 Ga0495664_0496524_309_719 122
65 3300046514 Ga0495618_0773400 Ga0495618_0773400_111_521 122
66 3300046517 Ga0495630_0050983 Ga0495630_0050983_2497_2907 122
67 3300046526 Ga0495666_0293873 Ga0495666_0293873_58_468 122
68 3300046533 Ga0495640_0022395 Ga0495640_0022395_1648_2058 122
69 3300046535 Ga0495586_0200934 Ga0495586_0200934_586_969 122
70 3300046535 Ga0495586_0294447 Ga0495586_0294447_216_626 122
71 3300046675 Ga0495657_0312372 Ga0495657_0312372_117_527 122
72 3300046683 Ga0495658_0715353 Ga0495658_0715353_215_625 122
73 3300046689 Ga0495613_0219996 Ga0495613_0219996_629_1039 122
74 3300046809 Ga0495600_0263413 Ga0495600_0263413_296_706 122
75 3300047317 Ga0495604_0041161 Ga0495604_0041161_3170_3580 122
76 3300047322 Ga0495680_0167626 Ga0495680_0167626_280_690 122
77 3300047471 Ga0495684_0089261 Ga0495684_0089261_1084_1494 122
78 3300006173 Ga0070716_100027492 Ga0070716_1000274924 123
79 3300035691 Ga0373931_0284222 Ga0373931_0284222_586_981 123
80 3300046512 Ga0495610_0240316 Ga0495610_0240316_336_707 123
81 3300050496 nmdc:mga07m45_137308_c1 nmdc:mga07m45_137308_c1_15_386 123
82 3300050496 nmdc:mga07m45_563763_c1 nmdc:mga07m45_563763_c1_251_622 123
83 3300031239 Ga0265328_10000016 Ga0265328_1000001629 124
84 3300031344 Ga0265316_10533534 Ga0265316_105335342 124
85 3300031911 Ga0307412_10533678 Ga0307412_105336782 124
86 3300031911 Ga0307412_11410542 Ga0307412_114105421 124
87 3300032005 Ga0307411_11356154 Ga0307411_113561542 124
88 3300033179 Ga0307507_10054152 Ga0307507_100541523 124
89 3300038726 Ga0400490_23584 Ga0400490_23584_3961_4353 124
90 3300049572 Ga0501036_0826978 Ga0501036_0826978_363_749 124
91 3300006195 Ga0075366_10865233 Ga0075366_108652331 125
92 3300025942 Ga0207689_11112890 Ga0207689_111128902 125
93 3300044712 Ga0453684_0302414 Ga0453684_0302414_1007_1405 125
94 3300053126 Ga0500621_265672 Ga0500621_265672_14_391 125
95 3300004625 Ga0055543_1022535 Ga0055543_10225351 126
96 3300005262 Ga0065165_1000092 Ga0065165_1000092107 126
97 3300005330 Ga0070690_100000300 Ga0070690_10000030027 126
98 3300005334 Ga0068869_100028350 Ga0068869_1000283504 126
99 3300005337 Ga0070682_100278675 Ga0070682_1002786752 126
100 3300005338 Ga0068868_100288850 Ga0068868_1002888502 126
101 3300005340 Ga0070689_100000861 Ga0070689_10000086122 126
102 3300005341 Ga0070691_10039151 Ga0070691_100391512 126
103 3300005345 Ga0070692_10020728 Ga0070692_100207282 126
104 3300005354 Ga0070675_100102474 Ga0070675_1001024742 126
105 3300005356 Ga0070674_100170190 Ga0070674_1001701902 126
106 3300005438 Ga0070701_10066002 Ga0070701_100660022 126
107 3300005440 Ga0070705_100065362 Ga0070705_1000653622 126
108 3300005441 Ga0070700_100044562 Ga0070700_1000445622 126
109 3300005456 Ga0070678_100034520 Ga0070678_1000345202 126
110 3300005459 Ga0068867_100004065 Ga0068867_1000040653 126
111 3300005466 Ga0070685_10061441 Ga0070685_100614412 126
112 3300005544 Ga0070686_100000276 Ga0070686_10000027636 126
113 3300005545 Ga0070695_100172292 Ga0070695_1001722922 126
114 3300005546 Ga0070696_100005155 Ga0070696_1000051555 126
115 3300005549 Ga0070704_100352489 Ga0070704_1003524892 126
116 3300005615 Ga0070702_100004569 Ga0070702_1000045693 126
117 3300005617 Ga0068859_100031129 Ga0068859_1000311292 126
118 3300005719 Ga0068861_100007611 Ga0068861_1000076118 126
119 3300005843 Ga0068860_100022077 Ga0068860_1000220772 126
120 3300005843 Ga0068860_100887990 Ga0068860_1008879902 126
121 3300006237 Ga0097621_100002873 Ga0097621_10000287312 126
122 3300006353 Ga0075370_10471547 Ga0075370_104715472 126
123 3300006358 Ga0068871_100002359 Ga0068871_1000023593 126
124 3300006844 Ga0075428_100007382 Ga0075428_10000738211 126
125 3300006846 Ga0075430_100141991 Ga0075430_1001419913 126
126 3300006880 Ga0075429_100010327 Ga0075429_1000103278 126
127 3300006931 Ga0097620_100031130 Ga0097620_1000311302 126
128 3300007265 Ga0099794_10080488 Ga0099794_100804882 126
129 3300009098 Ga0105245_10693816 Ga0105245_106938162 126
130 3300009176 Ga0105242_10119601 Ga0105242_101196014 126
131 3300010375 Ga0105239_10869713 Ga0105239_108697132 126
132 3300011119 Ga0105246_12078353 Ga0105246_120783531 126
133 3300013296 Ga0157374_10948477 Ga0157374_109484772 126
134 3300025899 Ga0207642_10009043 Ga0207642_100090432 126
135 3300025907 Ga0207645_10170753 Ga0207645_101707532 126
136 3300025917 Ga0207660_10131851 Ga0207660_101318512 126
137 3300025927 Ga0207687_10001372 Ga0207687_100013722 126
138 3300025933 Ga0207706_10120157 Ga0207706_101201572 126
139 3300025934 Ga0207686_10004499 Ga0207686_100044992 126
140 3300025935 Ga0207709_10002051 Ga0207709_1000205115 126
141 3300025938 Ga0207704_10001158 Ga0207704_100011588 126
142 3300026035 Ga0207703_10003431 Ga0207703_100034319 126
143 3300027526 Ga0209968_1034862 Ga0209968_10348622 126
144 3300027907 Ga0207428_10173137 Ga0207428_101731371 126
145 3300027907 Ga0207428_10561317 Ga0207428_105613172 126
146 3300028380 Ga0268265_10025116 Ga0268265_100251162 126
147 3300028381 Ga0268264_10011923 Ga0268264_100119232 126
148 3300028794 Ga0307515_10409468 Ga0307515_104094682 126
149 3300031548 Ga0307408_101164982 Ga0307408_1011649822 126
150 3300032005 Ga0307411_10481583 Ga0307411_104815831 126
151 3300032126 Ga0307415_100084635 Ga0307415_1000846353 126
152 3300032126 Ga0307415_100433084 Ga0307415_1004330841 126
153 3300035086 Ga0373934_0000098 Ga0373934_0000098_246_638 126
154 3300035118 Ga0373954_0000709 Ga0373954_0000709_11501_11893 126
155 3300035119 Ga0373956_0005111 Ga0373956_0005111_907_1299 126
156 3300035120 Ga0373957_0020547 Ga0373957_0020547_1286_1678 126
157 3300035172 Ga0373955_0020139 Ga0373955_0020139_2514_2906 126
158 3300035691 Ga0373931_0356269 Ga0373931_0356269_485_880 126
159 3300035691 Ga0373931_0628411 Ga0373931_0628411_73_477 126
160 3300035724 Ga0373933_0003854 Ga0373933_0003854_459_851 126
161 3300036401 Ga0373937_0001120 Ga0373937_0001120_892_1284 126
162 3300042001 Ga0439441_077141 Ga0439441_077141_316_708 126
163 3300042436 Ga0439435_0199154 Ga0439435_0199154_17_409 126
164 3300046462 Ga0495651_0000147 Ga0495651_0000147_747_1139 126
165 3300046615 Ga0495656_0439470 Ga0495656_0439470_269_661 126
166 3300046675 Ga0495657_0050053 Ga0495657_0050053_753_1145 126
167 3300047444 Ga0495675_0208964 Ga0495675_0208964_674_1066 126
168 3300048905 Ga0496102_1437573 Ga0496102_1437573_78_470 126
169 3300048909 Ga0496106_0298400 Ga0496106_0298400_759_1151 126
170 3300048910 Ga0496107_0431665 Ga0496107_0431665_26_418 126
171 3300048912 Ga0496109_0170274 Ga0496109_0170274_1575_1967 126
172 3300048915 Ga0496112_0677138 Ga0496112_0677138_411_803 126
173 3300050508 nmdc:mga09592_83767_c1 nmdc:mga09592_83767_c1_1982_2377 126
174 3300050510 nmdc:mga06r32_20528_c1 nmdc:mga06r32_20528_c1_4545_4940 126
175 3300053084 Ga0495595_0468057 Ga0495595_0468057_164_556 126
176 3300053140 Ga0500573_0527334 Ga0500573_0527334_85_489 126
177 3300005295 Ga0065707_10083123 Ga0065707_100831236 127
178 3300005334 Ga0068869_100352433 Ga0068869_1003524332 127
179 3300005347 Ga0070668_100413291 Ga0070668_1004132912 127
180 3300005356 Ga0070674_100258779 Ga0070674_1002587792 127
181 3300005367 Ga0070667_100613516 Ga0070667_1006135162 127
182 3300005539 Ga0068853_100226210 Ga0068853_1002262102 127
183 3300006914 Ga0075436_100249448 Ga0075436_1002494481 127
184 3300009174 Ga0105241_10804725 Ga0105241_108047252 127
185 3300009176 Ga0105242_11151969 Ga0105242_111519692 127
186 3300009553 Ga0105249_10184647 Ga0105249_101846472 127
187 3300010159 Ga0099796_10006792 Ga0099796_100067922 127
188 3300013297 Ga0157378_10000815 Ga0157378_1000081532 127
189 3300013306 Ga0163162_10000821 Ga0163162_1000082123 127
190 3300013308 Ga0157375_10090951 Ga0157375_100909513 127
191 3300014326 Ga0157380_10009860 Ga0157380_100098604 127
192 3300014968 Ga0157379_10080210 Ga0157379_100802104 127
193 3300031251 Ga0265327_10031534 Ga0265327_100315342 127
194 3300031665 Ga0316575_10004541 Ga0316575_100045414 127
195 3300032005 Ga0307411_10368588 Ga0307411_103685882 127
196 3300035172 Ga0373955_0454025 Ga0373955_0454025_221_619 127
197 3300035725 Ga0373947_0310063 Ga0373947_0310063_617_1018 127
198 3300036401 Ga0373937_1138148 Ga0373937_1138148_310_708 127
199 3300042876 Ga0451577_0049289 Ga0451577_0049289_1903_2298 127
200 3300050514 nmdc:mga08x19_224583_c1 nmdc:mga08x19_224583_c1_839_1234 127
201 iso_pu_bacteria 2574179768 2574429454 127
202 3300005445 Ga0070708_101514367 Ga0070708_1015143671 128
203 3300037068 Ga0373925_1267539 Ga0373925_1267539_94_498 128
204 3300046472 Ga0495580_0055683 Ga0495580_0055683_128_532 128
205 3300005345 Ga0070692_10424610 Ga0070692_104246102 130
206 3300005440 Ga0070705_100091313 Ga0070705_1000913134 130
207 3300005545 Ga0070695_100019621 Ga0070695_1000196216 130
208 3300005549 Ga0070704_100050541 Ga0070704_1000505413 130
209 3300005844 Ga0068862_101916227 Ga0068862_1019162271 130
210 3300006358 Ga0068871_100237977 Ga0068871_1002379772 130
211 3300009147 Ga0114129_11088168 Ga0114129_110881682 130
212 3300014969 Ga0157376_10450126 Ga0157376_104501262 130
213 3300025942 Ga0207689_10344092 Ga0207689_103440922 130
214 3300026089 Ga0207648_11029073 Ga0207648_110290732 130
215 3300028577 Ga0265318_10274901 Ga0265318_102749012 130
216 3300028654 Ga0265322_10108869 Ga0265322_101088692 130
217 3300035083 Ga0373926_0267077 Ga0373926_0267077_159_572 130
218 3300035111 Ga0373923_0684716 Ga0373923_0684716_55_468 130
219 3300035113 Ga0373936_0028084 Ga0373936_0028084_517_930 130
220 3300035410 Ga0373924_0351309 Ga0373924_0351309_103_516 130
221 3300035695 Ga0373927_0017581 Ga0373927_0017581_4252_4665 130
222 3300036401 Ga0373937_0174583 Ga0373937_0174583_151_564 130
223 3300036401 Ga0373937_0509471 Ga0373937_0509471_255_668 130
224 3300037068 Ga0373925_0010477 Ga0373925_0010477_6191_6604 130
225 3300037068 Ga0373925_0412140 Ga0373925_0412140_507_917 130
226 3300042876 Ga0451577_0365696 Ga0451577_0365696_823_1230 130
227 3300044712 Ga0453684_0000014 Ga0453684_0000014_410273_410680 130
228 3300044712 Ga0453684_0000142 Ga0453684_0000142_21372_21779 130
229 3300044712 Ga0453684_0021042 Ga0453684_0021042_2181_2588 130
230 3300045051 Ga0451576_0000272 Ga0451576_0000272_43331_43738 130
231 3300048907 Ga0496104_0950704 Ga0496104_0950704_187_600 130
232 3300049589 Ga0501073_0568955 Ga0501073_0568955_175_588 130
233 3300050515 nmdc:mga0a205_1108433_c1 nmdc:mga0a205_1108433_c1_55_468 130
234 3300005328 Ga0070676_10252750 Ga0070676_102527502 131
235 3300005440 Ga0070705_100668485 Ga0070705_1006684852 131
236 3300005468 Ga0070707_100825928 Ga0070707_1008259282 131
237 3300005536 Ga0070697_101478875 Ga0070697_1014788752 131
238 3300005547 Ga0070693_100360143 Ga0070693_1003601432 131
239 3300005617 Ga0068859_100417001 Ga0068859_1004170013 131
240 3300006931 Ga0097620_100417000 Ga0097620_1004170003 131
241 3300009174 Ga0105241_11824647 Ga0105241_118246471 131
242 3300021384 Ga0213876_10043325 Ga0213876_100433252 131
243 3300025916 Ga0207663_11044505 Ga0207663_110445051 131
244 3300025918 Ga0207662_10197331 Ga0207662_101973312 131
245 3300025921 Ga0207652_10313936 Ga0207652_103139362 131
246 3300025922 Ga0207646_10551562 Ga0207646_105515622 131
247 3300026116 Ga0207674_11473613 Ga0207674_114736131 131
248 3300031250 Ga0265331_10074353 Ga0265331_100743532 131
249 3300031251 Ga0265327_10107029 Ga0265327_101070292 131
250 3300031507 Ga0307509_10000032 Ga0307509_10000032128 131
251 3300035092 Ga0373952_0009088 Ga0373952_0009088_747_1157 131
252 3300035119 Ga0373956_0332865 Ga0373956_0332865_184_597 131
253 3300035695 Ga0373927_0006664 Ga0373927_0006664_670_1083 131
254 3300035695 Ga0373927_0306202 Ga0373927_0306202_459_869 131
255 3300037068 Ga0373925_1313559 Ga0373925_1313559_154_564 131
256 3300039437 Ga0436365_0539896 Ga0436365_0539896_672_1082 131
257 3300044673 Ga0453683_0029419 Ga0453683_0029419_1243_1653 131
258 3300044712 Ga0453684_0079145 Ga0453684_0079145_329_739 131
259 3300045051 Ga0451576_0070029 Ga0451576_0070029_530_940 131
260 3300005336 Ga0070680_100398442 Ga0070680_1003984422 132
261 3300005441 Ga0070700_100002065 Ga0070700_1000020658 132
262 3300005444 Ga0070694_100180682 Ga0070694_1001806822 132
263 3300005459 Ga0068867_100040768 Ga0068867_1000407681 132
264 3300005466 Ga0070685_10372158 Ga0070685_103721582 132
265 3300005518 Ga0070699_101547242 Ga0070699_1015472421 132
266 3300005539 Ga0068853_100336266 Ga0068853_1003362662 132
267 3300005545 Ga0070695_100047990 Ga0070695_1000479904 132
268 3300005546 Ga0070696_100023372 Ga0070696_1000233723 132
269 3300005546 Ga0070696_100134017 Ga0070696_1001340173 132
270 3300005547 Ga0070693_100276330 Ga0070693_1002763302 132
271 3300005563 Ga0068855_100648027 Ga0068855_1006480272 132
272 3300005842 Ga0068858_100028744 Ga0068858_1000287443 132
273 3300005842 Ga0068858_102173163 Ga0068858_1021731632 132
274 3300005844 Ga0068862_100122412 Ga0068862_1001224123 132
275 3300005844 Ga0068862_102707869 Ga0068862_1027078691 132
276 3300006038 Ga0075365_11014506 Ga0075365_110145061 132
277 3300006173 Ga0070716_100107534 Ga0070716_1001075342 132
278 3300006173 Ga0070716_101356461 Ga0070716_1013564611 132
279 3300006186 Ga0075369_10003660 Ga0075369_100036609 132
280 3300006195 Ga0075366_10036504 Ga0075366_100365043 132
281 3300006852 Ga0075433_10271141 Ga0075433_102711412 132
282 3300006881 Ga0068865_101688200 Ga0068865_1016882001 132
283 3300006914 Ga0075436_100469681 Ga0075436_1004696812 132
284 3300007076 Ga0075435_101238924 Ga0075435_1012389242 132
285 3300007265 Ga0099794_10010187 Ga0099794_100101874 132
286 3300007265 Ga0099794_10192212 Ga0099794_101922122 132
287 3300009148 Ga0105243_10042712 Ga0105243_100427122 132
288 3300009176 Ga0105242_10130248 Ga0105242_101302483 132
289 3300009551 Ga0105238_10959484 Ga0105238_109594842 132
290 3300009553 Ga0105249_10457856 Ga0105249_104578562 132
291 3300013105 Ga0157369_11827977 Ga0157369_118279771 132
292 3300013296 Ga0157374_10000104 Ga0157374_100001042 132
293 3300013306 Ga0163162_12126839 Ga0163162_121268392 132
294 3300013308 Ga0157375_10295166 Ga0157375_102951663 132
295 3300014325 Ga0163163_10042982 Ga0163163_100429825 132
296 3300014326 Ga0157380_10141913 Ga0157380_101419132 132
297 3300014968 Ga0157379_10117188 Ga0157379_101171882 132
298 3300025919 Ga0207657_10040208 Ga0207657_100402083 132
299 3300025924 Ga0207694_10421837 Ga0207694_104218372 132
300 3300025934 Ga0207686_10143702 Ga0207686_101437022 132
301 3300025934 Ga0207686_10146827 Ga0207686_101468273 132
302 3300025934 Ga0207686_10614847 Ga0207686_106148471 132
303 3300025935 Ga0207709_10073394 Ga0207709_100733942 132
304 3300025937 Ga0207669_11117897 Ga0207669_111178971 132
305 3300025938 Ga0207704_10768208 Ga0207704_107682082 132
306 3300025939 Ga0207665_10137755 Ga0207665_101377552 132
307 3300025949 Ga0207667_10434636 Ga0207667_104346362 132
308 3300026035 Ga0207703_10024821 Ga0207703_100248215 132
309 3300026041 Ga0207639_10305531 Ga0207639_103055312 132
310 3300026075 Ga0207708_10003747 Ga0207708_100037476 132
311 3300026089 Ga0207648_10355051 Ga0207648_103550512 132
312 3300027665 Ga0209983_1014750 Ga0209983_10147503 132
313 3300027671 Ga0209588_1249969 Ga0209588_12499691 132
314 3300027682 Ga0209971_1003770 Ga0209971_10037703 132
315 3300027717 Ga0209998_10029342 Ga0209998_100293422 132
316 3300028800 Ga0265338_10106841 Ga0265338_101068412 132
317 3300029957 Ga0265324_10003482 Ga0265324_100034823 132
318 3300030521 Ga0307511_10000471 Ga0307511_1000047136 132
319 3300031241 Ga0265325_10054431 Ga0265325_100544312 132
320 3300031344 Ga0265316_10115550 Ga0265316_101155502 132
321 3300031711 Ga0265314_10005881 Ga0265314_100058814 132
322 3300031824 Ga0307413_10178539 Ga0307413_101785392 132
323 3300042876 Ga0451577_0000013 Ga0451577_0000013_170930_171346 132
324 3300042876 Ga0451577_0002627 Ga0451577_0002627_7354_7767 132
325 3300042876 Ga0451577_0085704 Ga0451577_0085704_714_1127 132
326 3300042876 Ga0451577_0349496 Ga0451577_0349496_323_742 132
327 3300044673 Ga0453683_0000033 Ga0453683_0000033_49773_50189 132
328 3300044712 Ga0453684_0000029 Ga0453684_0000029_32197_32610 132
329 3300044712 Ga0453684_0000085 Ga0453684_0000085_226472_226888 132
330 3300044712 Ga0453684_0007704 Ga0453684_0007704_11717_12130 132
331 3300044712 Ga0453684_1356964 Ga0453684_1356964_196_609 132
332 3300045051 Ga0451576_0000018 Ga0451576_0000018_379344_379760 132
333 3300045051 Ga0451576_0014372 Ga0451576_0014372_4947_5360 132
334 3300045051 Ga0451576_0024032 Ga0451576_0024032_5001_5414 132
335 3300045051 Ga0451576_0226688 Ga0451576_0226688_1172_1588 132
336 3300046664 Ga0495659_0199677 Ga0495659_0199677_164_577 132
337 3300049569 Ga0501032_0001187 Ga0501032_0001187_18501_18914 132
338 3300049569 Ga0501032_0125317 Ga0501032_0125317_829_1242 132
339 3300049574 Ga0501038_0003601 Ga0501038_0003601_300_713 132
340 3300049575 Ga0501039_0318992 Ga0501039_0318992_169_582 132
341 3300049822 Ga0501035_0274233 Ga0501035_0274233_839_1252 132
342 3300050491 nmdc:mga00v17_237278_c1 nmdc:mga00v17_237278_c1_139_555 132
343 3300050493 nmdc:mga0k408_115144_c1 nmdc:mga0k408_115144_c1_77_493 132
344 3300050493 nmdc:mga0k408_30350_c1 nmdc:mga0k408_30350_c1_154_576 132
345 3300050513 nmdc:mga0rr50_1477348_c1 nmdc:mga0rr50_1477348_c1_145_558 132
346 3300050514 nmdc:mga08x19_141793_c1 nmdc:mga08x19_141793_c1_678_1091 132
347 3300050514 nmdc:mga08x19_37590_c1 nmdc:mga08x19_37590_c1_2523_2936 132
348 3300050515 nmdc:mga0a205_529402_c1 nmdc:mga0a205_529402_c1_128_541 132
349 3300050516 nmdc:mga0sz30_51890_c1 nmdc:mga0sz30_51890_c1_213_629 132
350 3300053087 Ga0500643_070441 Ga0500643_070441_379_822 132
351 3300053092 Ga0500583_0015822 Ga0500583_0015822_2449_2892 132
352 3300053096 Ga0500641_0012327 Ga0500641_0012327_1991_2407 132
353 3300053098 Ga0500650_0057618 Ga0500650_0057618_1355_1798 132
354 3300053133 Ga0500655_008683 Ga0500655_008683_1063_1506 132
355 3300053151 Ga0500604_0004670 Ga0500604_0004670_135_578 132
356 3300053730 Ga0500645_163903 Ga0500645_163903_21_464 132
357 3300005330 Ga0070690_100747498 Ga0070690_1007474982 133
358 3300005340 Ga0070689_101268652 Ga0070689_1012686521 133
359 3300006871 Ga0075434_101131489 Ga0075434_1011314892 133
360 3300006881 Ga0068865_100070650 Ga0068865_1000706501 133
361 3300007076 Ga0075435_100702759 Ga0075435_1007027592 133
362 3300025936 Ga0207670_11395292 Ga0207670_113952921 133
363 3300027360 Ga0209969_1004655 Ga0209969_10046554 133
364 3300027378 Ga0209981_1012313 Ga0209981_10123132 133
365 3300027462 Ga0210000_1003423 Ga0210000_10034232 133
366 3300027543 Ga0209999_1023090 Ga0209999_10230903 133
367 3300027682 Ga0209971_1006480 Ga0209971_10064802 133
368 3300027682 Ga0209971_1113183 Ga0209971_11131832 133
369 3300031665 Ga0316575_10000232 Ga0316575_100002329 133
370 3300032002 Ga0307416_100562644 Ga0307416_1005626442 133
371 3300035120 Ga0373957_0433884 Ga0373957_0433884_104_520 133
372 3300035691 Ga0373931_0279802 Ga0373931_0279802_165_587 133
373 3300036401 Ga0373937_0026386 Ga0373937_0026386_2005_2421 133
374 3300036647 Ga0316582_0039871 Ga0316582_0039871_1315_1737 133
375 3300042015 Ga0439462_0158563 Ga0439462_0158563_188_610 133
376 3300042461 Ga0439460_0288402 Ga0439460_0288402_123_542 133
377 3300044712 Ga0453684_1281363 Ga0453684_1281363_211_627 133
378 3300047321 Ga0495676_0508029 Ga0495676_0508029_279_695 133
379 3300049520 Ga0501297_010513 Ga0501297_010513_119_541 133
380 3300049522 Ga0501299_138030 Ga0501299_138030_147_569 133
381 3300049571 Ga0501034_0011390 Ga0501034_0011390_785_1204 133
382 3300049572 Ga0501036_0011409 Ga0501036_0011409_1883_2308 133
383 3300049572 Ga0501036_0127730 Ga0501036_0127730_256_681 133
384 3300049574 Ga0501038_0928465 Ga0501038_0928465_101_526 133
385 3300049575 Ga0501039_0013815 Ga0501039_0013815_117_542 133
386 3300049576 Ga0501040_0192097 Ga0501040_0192097_314_739 133
387 3300049577 Ga0501041_0011932 Ga0501041_0011932_624_1049 133
388 3300049577 Ga0501041_0230361 Ga0501041_0230361_292_717 133
389 3300049578 Ga0501042_0003342 Ga0501042_0003342_5593_6018 133
390 3300049579 Ga0501043_0199465 Ga0501043_0199465_443_868 133
391 3300049580 Ga0501046_0179953 Ga0501046_0179953_664_1089 133
392 3300049580 Ga0501046_1134039 Ga0501046_1134039_59_484 133
393 3300049582 Ga0501048_0032648 Ga0501048_0032648_1785_2210 133
394 3300049587 Ga0501071_0015573 Ga0501071_0015573_628_1053 133
395 3300049588 Ga0501072_0003685 Ga0501072_0003685_2273_2698 133
396 3300049588 Ga0501072_0518449 Ga0501072_0518449_121_546 133
397 3300049589 Ga0501073_0463719 Ga0501073_0463719_150_575 133
398 3300049590 Ga0501074_0019104 Ga0501074_0019104_2311_2736 133
399 3300049591 Ga0501075_0044513 Ga0501075_0044513_2068_2493 133
400 3300049591 Ga0501075_0376283 Ga0501075_0376283_311_736 133
401 3300049592 Ga0501076_0003023 Ga0501076_0003023_5004_5429 133
402 3300049592 Ga0501076_0019677 Ga0501076_0019677_418_843 133
403 3300049593 Ga0501077_0550627 Ga0501077_0550627_166_591 133
404 3300049741 Ga0501079_0006062 Ga0501079_0006062_2770_3195 133
405 3300049742 Ga0501080_0006509 Ga0501080_0006509_6805_7230 133
406 3300049742 Ga0501080_0152381 Ga0501080_0152381_1527_1952 133
407 3300049743 Ga0501081_0002314 Ga0501081_0002314_5945_6370 133
408 3300049744 Ga0501083_0057518 Ga0501083_0057518_332_757 133
409 3300049824 Ga0501045_0000766 Ga0501045_0000766_285_710 133
410 3300050512 nmdc:mga0n895_689277_c1 nmdc:mga0n895_689277_c1_70_492 133
411 3300054114 Ga0501084_0082467 Ga0501084_0082467_129_554 133
412 3300060353 Ga0501082_0011839 Ga0501082_0011839_459_884 133
413 3300060353 Ga0501082_0230371 Ga0501082_0230371_856_1281 133
414 3300061734 Ga0530510_0000945 Ga0530510_0000945_15989_16414 133
415 3300061734 Ga0530510_0366553 Ga0530510_0366553_199_624 133
416 3300005293 Ga0065715_10669271 Ga0065715_106692711 134
417 3300005295 Ga0065707_10467584 Ga0065707_104675841 134
418 3300005327 Ga0070658_10399846 Ga0070658_103998462 134
419 3300005328 Ga0070676_10048890 Ga0070676_100488903 134
420 3300005328 Ga0070676_10931738 Ga0070676_109317382 134
421 3300005331 Ga0070670_100083904 Ga0070670_1000839043 134
422 3300005333 Ga0070677_10003447 Ga0070677_100034474 134
423 3300005333 Ga0070677_10198215 Ga0070677_101982152 134
424 3300005335 Ga0070666_10065754 Ga0070666_100657543 134
425 3300005336 Ga0070680_100699222 Ga0070680_1006992222 134
426 3300005337 Ga0070682_100179723 Ga0070682_1001797232 134
427 3300005338 Ga0068868_100073159 Ga0068868_1000731593 134
428 3300005338 Ga0068868_101252304 Ga0068868_1012523041 134
429 3300005340 Ga0070689_100500818 Ga0070689_1005008181 134
430 3300005341 Ga0070691_10083618 Ga0070691_100836181 134
431 3300005341 Ga0070691_10117632 Ga0070691_101176323 134
432 3300005343 Ga0070687_100132070 Ga0070687_1001320702 134
433 3300005343 Ga0070687_100474085 Ga0070687_1004740852 134
434 3300005344 Ga0070661_100118999 Ga0070661_1001189993 134
435 3300005344 Ga0070661_101323769 Ga0070661_1013237691 134
436 3300005347 Ga0070668_100122184 Ga0070668_1001221841 134
437 3300005347 Ga0070668_100706146 Ga0070668_1007061462 134
438 3300005353 Ga0070669_100166422 Ga0070669_1001664222 134
439 3300005353 Ga0070669_100336919 Ga0070669_1003369192 134
440 3300005354 Ga0070675_100119417 Ga0070675_1001194174 134
441 3300005355 Ga0070671_100042736 Ga0070671_1000427364 134
442 3300005355 Ga0070671_100271210 Ga0070671_1002712102 134
443 3300005355 Ga0070671_101853676 Ga0070671_1018536761 134
444 3300005356 Ga0070674_100030606 Ga0070674_1000306064 134
445 3300005356 Ga0070674_100456639 Ga0070674_1004566392 134
446 3300005364 Ga0070673_100044306 Ga0070673_1000443063 134
447 3300005364 Ga0070673_100055581 Ga0070673_1000555814 134
448 3300005365 Ga0070688_100598564 Ga0070688_1005985642 134
449 3300005366 Ga0070659_101334537 Ga0070659_1013345372 134
450 3300005367 Ga0070667_100041004 Ga0070667_1000410045 134
451 3300005367 Ga0070667_100217270 Ga0070667_1002172702 134
452 3300005367 Ga0070667_100601126 Ga0070667_1006011261 134
453 3300005440 Ga0070705_100390600 Ga0070705_1003906002 134
454 3300005441 Ga0070700_100099417 Ga0070700_1000994173 134
455 3300005444 Ga0070694_100149815 Ga0070694_1001498153 134
456 3300005444 Ga0070694_100151394 Ga0070694_1001513942 134
457 3300005444 Ga0070694_100172149 Ga0070694_1001721492 134
458 3300005444 Ga0070694_101540761 Ga0070694_1015407611 134
459 3300005456 Ga0070678_100025513 Ga0070678_1000255135 134
460 3300005456 Ga0070678_100110420 Ga0070678_1001104202 134
461 3300005456 Ga0070678_100501737 Ga0070678_1005017372 134
462 3300005457 Ga0070662_100672546 Ga0070662_1006725462 134
463 3300005459 Ga0068867_100302267 Ga0068867_1003022671 134
464 3300005466 Ga0070685_10423717 Ga0070685_104237172 134
465 3300005467 Ga0070706_100050486 Ga0070706_1000504862 134
466 3300005536 Ga0070697_100072004 Ga0070697_1000720043 134
467 3300005536 Ga0070697_101493637 Ga0070697_1014936371 134
468 3300005539 Ga0068853_101212206 Ga0068853_1012122062 134
469 3300005539 Ga0068853_101457658 Ga0068853_1014576582 134
470 3300005543 Ga0070672_100010574 Ga0070672_1000105747 134
471 3300005543 Ga0070672_100047876 Ga0070672_1000478764 134
472 3300005543 Ga0070672_100346695 Ga0070672_1003466952 134
473 3300005544 Ga0070686_100027336 Ga0070686_1000273362 134
474 3300005545 Ga0070695_100085829 Ga0070695_1000858291 134
475 3300005547 Ga0070693_100285622 Ga0070693_1002856221 134
476 3300005548 Ga0070665_100210764 Ga0070665_1002107643 134
477 3300005549 Ga0070704_100034277 Ga0070704_1000342772 134
478 3300005549 Ga0070704_100140290 Ga0070704_1001402902 134
479 3300005549 Ga0070704_100740196 Ga0070704_1007401961 134
480 3300005564 Ga0070664_100755889 Ga0070664_1007558892 134
481 3300005564 Ga0070664_102067616 Ga0070664_1020676162 134
482 3300005578 Ga0068854_100246931 Ga0068854_1002469312 134
483 3300005614 Ga0068856_100410526 Ga0068856_1004105262 134
484 3300005614 Ga0068856_101092571 Ga0068856_1010925712 134
485 3300005615 Ga0070702_100009084 Ga0070702_1000090848 134
486 3300005616 Ga0068852_100194764 Ga0068852_1001947642 134
487 3300005617 Ga0068859_100227548 Ga0068859_1002275483 134
488 3300005618 Ga0068864_100030630 Ga0068864_1000306306 134
489 3300005718 Ga0068866_10000076 Ga0068866_1000007642 134
490 3300005718 Ga0068866_10237597 Ga0068866_102375972 134
491 3300005840 Ga0068870_10042556 Ga0068870_100425561 134
492 3300005840 Ga0068870_10461075 Ga0068870_104610752 134
493 3300005841 Ga0068863_100631257 Ga0068863_1006312572 134
494 3300005842 Ga0068858_100000442 Ga0068858_10000044215 134
495 3300005842 Ga0068858_100062203 Ga0068858_1000622032 134
496 3300005842 Ga0068858_100849232 Ga0068858_1008492322 134
497 3300005843 Ga0068860_100799250 Ga0068860_1007992502 134
498 3300005844 Ga0068862_100000952 Ga0068862_10000095227 134
499 3300005844 Ga0068862_100133200 Ga0068862_1001332003 134
500 3300006163 Ga0070715_10664075 Ga0070715_106640751 134
501 3300006237 Ga0097621_100045264 Ga0097621_1000452643 134
502 3300006237 Ga0097621_100055977 Ga0097621_1000559772 134
503 3300006358 Ga0068871_100095357 Ga0068871_1000953574 134
504 3300006846 Ga0075430_100207070 Ga0075430_1002070702 134
505 3300006847 Ga0075431_100010497 Ga0075431_1000104978 134
506 3300006847 Ga0075431_100654811 Ga0075431_1006548112 134
507 3300006880 Ga0075429_100065627 Ga0075429_1000656274 134
508 3300006880 Ga0075429_100339869 Ga0075429_1003398692 134
509 3300006881 Ga0068865_100004680 Ga0068865_1000046807 134
510 3300006881 Ga0068865_100371785 Ga0068865_1003717852 134
511 3300006881 Ga0068865_100740148 Ga0068865_1007401482 134
512 3300006931 Ga0097620_100227543 Ga0097620_1002275433 134
513 3300009094 Ga0111539_10006144 Ga0111539_100061445 134
514 3300009094 Ga0111539_11709330 Ga0111539_117093302 134
515 3300009098 Ga0105245_10000279 Ga0105245_100002797 134
516 3300009098 Ga0105245_10193155 Ga0105245_101931554 134
517 3300009098 Ga0105245_11009829 Ga0105245_110098292 134
518 3300009147 Ga0114129_10199706 Ga0114129_101997062 134
519 3300009148 Ga0105243_10000328 Ga0105243_100003287 134
520 3300009148 Ga0105243_10042317 Ga0105243_100423175 134
521 3300009148 Ga0105243_11534987 Ga0105243_115349871 134
522 3300009176 Ga0105242_10000629 Ga0105242_1000062931 134
523 3300009176 Ga0105242_10177588 Ga0105242_101775882 134
524 3300009177 Ga0105248_10099558 Ga0105248_100995585 134
525 3300009177 Ga0105248_10154567 Ga0105248_101545674 134
526 3300009177 Ga0105248_11015863 Ga0105248_110158632 134
527 3300009177 Ga0105248_11367456 Ga0105248_113674562 134
528 3300009553 Ga0105249_10041028 Ga0105249_100410285 134
529 3300009553 Ga0105249_10185727 Ga0105249_101857273 134
530 3300011119 Ga0105246_10664469 Ga0105246_106644692 134
531 3300013296 Ga0157374_10054467 Ga0157374_100544672 134
532 3300013296 Ga0157374_10109574 Ga0157374_101095741 134
533 3300013297 Ga0157378_10005354 Ga0157378_1000535411 134
534 3300013297 Ga0157378_10010321 Ga0157378_100103214 134
535 3300013297 Ga0157378_10189673 Ga0157378_101896734 134
536 3300013308 Ga0157375_10029474 Ga0157375_100294743 134
537 3300013308 Ga0157375_10203443 Ga0157375_102034434 134
538 3300013308 Ga0157375_10723938 Ga0157375_107239381 134
539 3300013308 Ga0157375_11400237 Ga0157375_114002371 134
540 3300014325 Ga0163163_10898372 Ga0163163_108983722 134
541 3300014326 Ga0157380_10005446 Ga0157380_100054463 134
542 3300014326 Ga0157380_10977140 Ga0157380_109771402 134
543 3300014326 Ga0157380_13145535 Ga0157380_131455351 134
544 3300014745 Ga0157377_10307343 Ga0157377_103073432 134
545 3300014968 Ga0157379_10009379 Ga0157379_1000937910 134
546 3300014968 Ga0157379_10023336 Ga0157379_100233367 134
547 3300014969 Ga0157376_10118610 Ga0157376_101186102 134
548 3300014969 Ga0157376_10194291 Ga0157376_101942913 134
549 3300017792 Ga0163161_10037448 Ga0163161_100374482 134
550 3300017792 Ga0163161_10049557 Ga0163161_100495573 134
551 3300025315 Ga0207697_10015096 Ga0207697_100150964 134
552 3300025321 Ga0207656_10341985 Ga0207656_103419852 134
553 3300025893 Ga0207682_10005721 Ga0207682_100057214 134
554 3300025893 Ga0207682_10387554 Ga0207682_103875542 134
555 3300025899 Ga0207642_10020964 Ga0207642_100209642 134
556 3300025899 Ga0207642_10199560 Ga0207642_101995601 134
557 3300025901 Ga0207688_10209676 Ga0207688_102096762 134
558 3300025907 Ga0207645_10024383 Ga0207645_100243833 134
559 3300025908 Ga0207643_10005204 Ga0207643_100052046 134
560 3300025908 Ga0207643_10075362 Ga0207643_100753622 134
561 3300025909 Ga0207705_10201441 Ga0207705_102014412 134
562 3300025910 Ga0207684_10052018 Ga0207684_100520183 134
563 3300025912 Ga0207707_10063136 Ga0207707_100631364 134
564 3300025917 Ga0207660_10135206 Ga0207660_101352062 134
565 3300025918 Ga0207662_10819254 Ga0207662_108192542 134
566 3300025920 Ga0207649_11377079 Ga0207649_113770791 134
567 3300025923 Ga0207681_10186571 Ga0207681_101865713 134
568 3300025925 Ga0207650_10122628 Ga0207650_101226282 134
569 3300025925 Ga0207650_10141435 Ga0207650_101414353 134
570 3300025925 Ga0207650_10289082 Ga0207650_102890823 134
571 3300025925 Ga0207650_10474584 Ga0207650_104745842 134
572 3300025926 Ga0207659_10061637 Ga0207659_100616374 134
573 3300025926 Ga0207659_10072532 Ga0207659_100725323 134
574 3300025926 Ga0207659_10073001 Ga0207659_100730012 134
575 3300025926 Ga0207659_10659490 Ga0207659_106594902 134
576 3300025926 Ga0207659_10746826 Ga0207659_107468262 134
577 3300025931 Ga0207644_10033584 Ga0207644_100335842 134
578 3300025931 Ga0207644_10082985 Ga0207644_100829853 134
579 3300025933 Ga0207706_10018642 Ga0207706_100186425 134
580 3300025934 Ga0207686_10097810 Ga0207686_100978102 134
581 3300025935 Ga0207709_10008041 Ga0207709_100080414 134
582 3300025936 Ga0207670_10002690 Ga0207670_100026907 134
583 3300025936 Ga0207670_10116335 Ga0207670_101163352 134
584 3300025937 Ga0207669_10013598 Ga0207669_100135982 134
585 3300025937 Ga0207669_10137492 Ga0207669_101374922 134
586 3300025937 Ga0207669_10521039 Ga0207669_105210392 134
587 3300025938 Ga0207704_10781293 Ga0207704_107812932 134
588 3300025940 Ga0207691_10083518 Ga0207691_100835184 134
589 3300025940 Ga0207691_10249421 Ga0207691_102494211 134
590 3300025940 Ga0207691_10963779 Ga0207691_109637792 134
591 3300025941 Ga0207711_10179018 Ga0207711_101790182 134
592 3300025942 Ga0207689_10001264 Ga0207689_1000126423 134
593 3300025942 Ga0207689_10048148 Ga0207689_100481482 134
594 3300025945 Ga0207679_10552185 Ga0207679_105521852 134
595 3300025945 Ga0207679_10569083 Ga0207679_105690831 134
596 3300025960 Ga0207651_10078914 Ga0207651_100789143 134
597 3300025960 Ga0207651_10182372 Ga0207651_101823723 134
598 3300025960 Ga0207651_10462292 Ga0207651_104622922 134
599 3300025961 Ga0207712_10152538 Ga0207712_101525382 134
600 3300025961 Ga0207712_10951280 Ga0207712_109512802 134
601 3300025972 Ga0207668_10354122 Ga0207668_103541222 134
602 3300025972 Ga0207668_11226300 Ga0207668_112263002 134
603 3300025981 Ga0207640_10134548 Ga0207640_101345483 134
604 3300025986 Ga0207658_10232678 Ga0207658_102326782 134
605 3300025986 Ga0207658_10791567 Ga0207658_107915671 134
606 3300026023 Ga0207677_10082026 Ga0207677_100820262 134
607 3300026023 Ga0207677_10376671 Ga0207677_103766712 134
608 3300026023 Ga0207677_10862374 Ga0207677_108623742 134
609 3300026035 Ga0207703_10104125 Ga0207703_101041251 134
610 3300026041 Ga0207639_11368618 Ga0207639_113686182 134
611 3300026067 Ga0207678_10888986 Ga0207678_108889862 134
612 3300026075 Ga0207708_10000058 Ga0207708_1000005890 134
613 3300026075 Ga0207708_10014104 Ga0207708_100141042 134
614 3300026078 Ga0207702_10437946 Ga0207702_104379462 134
615 3300026088 Ga0207641_10041940 Ga0207641_100419402 134
616 3300026088 Ga0207641_10065794 Ga0207641_100657942 134
617 3300026089 Ga0207648_10000121 Ga0207648_1000012183 134
618 3300026089 Ga0207648_10022267 Ga0207648_100222674 134
619 3300026089 Ga0207648_10047353 Ga0207648_100473535 134
620 3300026095 Ga0207676_10174580 Ga0207676_101745804 134
621 3300026095 Ga0207676_10607058 Ga0207676_106070582 134
622 3300026116 Ga0207674_10373084 Ga0207674_103730842 134
623 3300026118 Ga0207675_100000143 Ga0207675_10000014349 134
624 3300026118 Ga0207675_100056721 Ga0207675_1000567213 134
625 3300026121 Ga0207683_10005276 Ga0207683_100052763 134
626 3300026121 Ga0207683_10017452 Ga0207683_100174525 134
627 3300026121 Ga0207683_10077218 Ga0207683_100772183 134
628 3300026121 Ga0207683_11697753 Ga0207683_116977531 134
629 3300027907 Ga0207428_10284778 Ga0207428_102847782 134
630 3300028379 Ga0268266_10346642 Ga0268266_103466422 134
631 3300028380 Ga0268265_10036789 Ga0268265_100367893 134
632 3300028381 Ga0268264_10046608 Ga0268264_100466085 134
633 3300028381 Ga0268264_11013529 Ga0268264_110135292 134
634 3300028577 Ga0265318_10060093 Ga0265318_100600932 134
635 3300031235 Ga0265330_10008863 Ga0265330_100088634 134
636 3300031238 Ga0265332_10012224 Ga0265332_100122243 134
637 3300031239 Ga0265328_10003721 Ga0265328_100037214 134
638 3300031241 Ga0265325_10441900 Ga0265325_104419001 134
639 3300031242 Ga0265329_10005212 Ga0265329_100052125 134
640 3300031249 Ga0265339_10119949 Ga0265339_101199492 134
641 3300031250 Ga0265331_10003027 Ga0265331_100030274 134
642 3300031251 Ga0265327_10108325 Ga0265327_101083252 134
643 3300031344 Ga0265316_10036177 Ga0265316_100361772 134
644 3300031548 Ga0307408_100498340 Ga0307408_1004983402 134
645 3300031711 Ga0265314_10011856 Ga0265314_100118568 134
646 3300032002 Ga0307416_103535146 Ga0307416_1035351461 134
647 3300034819 Ga0373958_0022583 Ga0373958_0022583_431_859 134
648 3300039437 Ga0436365_1535422 Ga0436365_1535422_82_501 134
649 3300041463 Ga0451804_0289310 Ga0451804_0289310_113_544 134
650 3300041512 Ga0451853_1110049 Ga0451853_1110049_168_593 134
651 3300042876 Ga0451577_0394603 Ga0451577_0394603_796_1221 134
652 3300042876 Ga0451577_0680984 Ga0451577_0680984_352_777 134
653 3300045051 Ga0451576_0092509 Ga0451576_0092509_113_538 134
654 3300046525 Ga0495663_0170056 Ga0495663_0170056_218_643 134
655 3300046537 Ga0495598_0009508 Ga0495598_0009508_824_1249 134
656 3300046539 Ga0495621_0072434 Ga0495621_0072434_480_908 134
657 3300046683 Ga0495658_0020747 Ga0495658_0020747_2889_3314 134
658 3300046684 Ga0495669_0043302 Ga0495669_0043302_238_663 134
659 3300048907 Ga0496104_0868068 Ga0496104_0868068_29_454 134
660 3300048908 Ga0496105_0416810 Ga0496105_0416810_132_557 134
661 3300048909 Ga0496106_0366866 Ga0496106_0366866_546_971 134
662 3300048911 Ga0496108_0222856 Ga0496108_0222856_1078_1503 134
663 3300048912 Ga0496109_0121010 Ga0496109_0121010_284_709 134
664 3300048913 Ga0496110_0080300 Ga0496110_0080300_529_954 134
665 3300048917 Ga0496114_0283883 Ga0496114_0283883_882_1307 134
666 3300049571 Ga0501034_0000736 Ga0501034_0000736_43895_44314 134
667 3300049572 Ga0501036_0110733 Ga0501036_0110733_1241_1666 134
668 3300049572 Ga0501036_0329443 Ga0501036_0329443_188_613 134
669 3300049573 Ga0501037_0122253 Ga0501037_0122253_1087_1506 134
670 3300049573 Ga0501037_0207585 Ga0501037_0207585_436_861 134
671 3300049574 Ga0501038_0774885 Ga0501038_0774885_262_681 134
672 3300049575 Ga0501039_0041288 Ga0501039_0041288_1446_1871 134
673 3300049575 Ga0501039_0925098 Ga0501039_0925098_180_605 134
674 3300049575 Ga0501039_1397368 Ga0501039_1397368_74_493 134
675 3300049576 Ga0501040_0057294 Ga0501040_0057294_1251_1676 134
676 3300049578 Ga0501042_1439924 Ga0501042_1439924_20_445 134
677 3300049579 Ga0501043_0184695 Ga0501043_0184695_317_736 134
678 3300049579 Ga0501043_0313675 Ga0501043_0313675_252_677 134
679 3300049580 Ga0501046_0014667 Ga0501046_0014667_1133_1558 134
680 3300049582 Ga0501048_0361246 Ga0501048_0361246_222_647 134
681 3300049584 Ga0501068_0001429 Ga0501068_0001429_5061_5480 134
682 3300049584 Ga0501068_0038276 Ga0501068_0038276_509_934 134
683 3300049587 Ga0501071_0042333 Ga0501071_0042333_2194_2619 134
684 3300049588 Ga0501072_0000910 Ga0501072_0000910_4030_4449 134
685 3300049588 Ga0501072_0321149 Ga0501072_0321149_367_792 134
686 3300049589 Ga0501073_0004078 Ga0501073_0004078_7426_7845 134
687 3300049590 Ga0501074_0039408 Ga0501074_0039408_2655_3074 134
688 3300049590 Ga0501074_0134629 Ga0501074_0134629_660_1085 134
689 3300049591 Ga0501075_0741824 Ga0501075_0741824_10_435 134
690 3300049591 Ga0501075_1463352 Ga0501075_1463352_72_497 134
691 3300049592 Ga0501076_0028780 Ga0501076_0028780_2335_2760 134
692 3300049593 Ga0501077_0034211 Ga0501077_0034211_1408_1833 134
693 3300049741 Ga0501079_0096217 Ga0501079_0096217_1792_2217 134
694 3300049742 Ga0501080_0001631 Ga0501080_0001631_14059_14478 134
695 3300049742 Ga0501080_0018841 Ga0501080_0018841_4373_4798 134
696 3300049742 Ga0501080_0924342 Ga0501080_0924342_95_514 134
697 3300049743 Ga0501081_0005048 Ga0501081_0005048_1746_2171 134
698 3300049743 Ga0501081_0105029 Ga0501081_0105029_522_947 134
699 3300049744 Ga0501083_0002703 Ga0501083_0002703_6836_7261 134
700 3300049744 Ga0501083_0013468 Ga0501083_0013468_4722_5141 134
701 3300050507 nmdc:mga05p37_1235803_c1 nmdc:mga05p37_1235803_c1_37_462 134
702 3300050508 nmdc:mga09592_175962_c1 nmdc:mga09592_175962_c1_1354_1779 134
703 3300050509 nmdc:mga0qj67_1162468_c1 nmdc:mga0qj67_1162468_c1_88_516 134
704 3300050509 nmdc:mga0qj67_517559_c1 nmdc:mga0qj67_517559_c1_460_885 134
705 3300050511 nmdc:mga08y16_533089_c1 nmdc:mga08y16_533089_c1_583_1008 134
706 3300050511 nmdc:mga08y16_8908_c1 nmdc:mga08y16_8908_c1_3031_3456 134
707 3300050515 nmdc:mga0a205_451421_c1 nmdc:mga0a205_451421_c1_634_1059 134
708 3300054114 Ga0501084_0111519 Ga0501084_0111519_849_1268 134
709 3300054114 Ga0501084_0186580 Ga0501084_0186580_603_1028 134
710 3300060353 Ga0501082_0045137 Ga0501082_0045137_1782_2207 134
711 3300060353 Ga0501082_0387912 Ga0501082_0387912_168_587 134
712 3300005356 Ga0070674_101532092 Ga0070674_1015320921 135
713 3300006846 Ga0075430_100008948 Ga0075430_10000894810 135
714 3300025937 Ga0207669_10764793 Ga0207669_107647932 135
715 3300031250 Ga0265331_10127325 Ga0265331_101273252 135
716 3300042003 Ga0439443_044163 Ga0439443_044163_329_757 135
717 3300042876 Ga0451577_0001260 Ga0451577_0001260_5626_6057 135
718 3300042876 Ga0451577_0006351 Ga0451577_0006351_3672_4103 135
719 3300044712 Ga0453684_0095901 Ga0453684_0095901_1961_2392 135
720 3300045051 Ga0451576_0006043 Ga0451576_0006043_375_806 135
721 3300049576 Ga0501040_0050613 Ga0501040_0050613_2365_2799 135
722 3300005334 Ga0068869_101137894 Ga0068869_1011378941 136
723 3300005336 Ga0070680_100249963 Ga0070680_1002499632 136
724 3300005440 Ga0070705_100396085 Ga0070705_1003960852 136
725 3300005441 Ga0070700_100236442 Ga0070700_1002364422 136
726 3300005455 Ga0070663_100138750 Ga0070663_1001387502 136
727 3300005458 Ga0070681_10074249 Ga0070681_100742491 136
728 3300005535 Ga0070684_100483072 Ga0070684_1004830722 136
729 3300005549 Ga0070704_100237601 Ga0070704_1002376012 136
730 3300005563 Ga0068855_100147363 Ga0068855_1001473633 136
731 3300005577 Ga0068857_100017748 Ga0068857_1000177487 136
732 3300005614 Ga0068856_100196588 Ga0068856_1001965881 136
733 3300009174 Ga0105241_10119896 Ga0105241_101198964 136
734 3300009545 Ga0105237_10019997 Ga0105237_100199977 136
735 3300010375 Ga0105239_10097074 Ga0105239_100970742 136
736 3300025911 Ga0207654_10501493 Ga0207654_105014932 136
737 3300025949 Ga0207667_10295894 Ga0207667_102958942 136
738 3300026035 Ga0207703_10374934 Ga0207703_103749342 136
739 3300026116 Ga0207674_10032949 Ga0207674_100329495 136
740 3300035724 Ga0373933_0040367 Ga0373933_0040367_657_1082 136
741 3300047322 Ga0495680_0232929 Ga0495680_0232929_127_552 136
742 3300005330 Ga0070690_100817040 Ga0070690_1008170401 137
743 3300005338 Ga0068868_100842698 Ga0068868_1008426981 137
744 3300005343 Ga0070687_101000230 Ga0070687_1010002301 137
745 3300005345 Ga0070692_10200256 Ga0070692_102002562 137
746 3300005347 Ga0070668_100080727 Ga0070668_1000807272 137
747 3300005364 Ga0070673_100326679 Ga0070673_1003266792 137
748 3300005441 Ga0070700_100202877 Ga0070700_1002028772 137
749 3300005456 Ga0070678_100257442 Ga0070678_1002574422 137
750 3300005457 Ga0070662_101324465 Ga0070662_1013244651 137
751 3300005544 Ga0070686_101878428 Ga0070686_1018784281 137
752 3300005548 Ga0070665_100070429 Ga0070665_1000704292 137
753 3300005564 Ga0070664_100828612 Ga0070664_1008286121 137
754 3300005577 Ga0068857_100091436 Ga0068857_1000914362 137
755 3300005614 Ga0068856_100239215 Ga0068856_1002392152 137
756 3300005618 Ga0068864_101053974 Ga0068864_1010539742 137
757 3300005718 Ga0068866_10062319 Ga0068866_100623193 137
758 3300005842 Ga0068858_101271470 Ga0068858_1012714702 137
759 3300006871 Ga0075434_100478950 Ga0075434_1004789502 137
760 3300009098 Ga0105245_10054670 Ga0105245_100546704 137
761 3300010375 Ga0105239_12427338 Ga0105239_124273381 137
762 3300013296 Ga0157374_10730633 Ga0157374_107306332 137
763 3300013297 Ga0157378_10467196 Ga0157378_104671961 137
764 3300014326 Ga0157380_10441454 Ga0157380_104414542 137
765 3300025899 Ga0207642_10153234 Ga0207642_101532342 137
766 3300025924 Ga0207694_11002958 Ga0207694_110029582 137
767 3300025932 Ga0207690_10730292 Ga0207690_107302922 137
768 3300025938 Ga0207704_10053094 Ga0207704_100530942 137
769 3300025941 Ga0207711_11259548 Ga0207711_112595482 137
770 3300025942 Ga0207689_10270416 Ga0207689_102704162 137
771 3300025945 Ga0207679_10709718 Ga0207679_107097181 137
772 3300026023 Ga0207677_10037952 Ga0207677_100379522 137
773 3300026023 Ga0207677_10200638 Ga0207677_102006382 137
774 3300026035 Ga0207703_10351563 Ga0207703_103515633 137
775 3300026041 Ga0207639_10396423 Ga0207639_103964232 137
776 3300026075 Ga0207708_10233950 Ga0207708_102339502 137
777 3300026078 Ga0207702_10114151 Ga0207702_101141513 137
778 3300026095 Ga0207676_10383007 Ga0207676_103830072 137
779 3300026121 Ga0207683_10154661 Ga0207683_101546613 137
780 3300028379 Ga0268266_10021482 Ga0268266_100214826 137
781 3300028381 Ga0268264_10665234 Ga0268264_106652342 137
782 3300041406 Ga0439439_0210289 Ga0439439_0210289_12_428 137
783 3300048915 Ga0496112_1044568 Ga0496112_1044568_140_574 137
784 3300050511 nmdc:mga08y16_2162484_c1 nmdc:mga08y16_2162484_c1_22_456 137
785 3300014326 Ga0157380_11148501 Ga0157380_111485012 138
786 3300031911 Ga0307412_10791382 Ga0307412_107913822 138
787 3300031911 Ga0307412_11069507 Ga0307412_110695071 138
788 3300044673 Ga0453683_0806786 Ga0453683_0806786_14_442 138
789 3300045051 Ga0451576_1214693 Ga0451576_1214693_79_504 138
790 iso_pu_bacteria 2643221654 2644302697 138
791 iso_pu_bacteria 2643221660 2644338909 138
792 3300005530 Ga0070679_100296260 Ga0070679_1002962602 139
793 3300009093 Ga0105240_10024979 Ga0105240_100249793 139
794 3300012513 Ga0157326_1035325 Ga0157326_10353251 139
795 3300025921 Ga0207652_10462507 Ga0207652_104625072 139
796 3300031250 Ga0265331_10525456 Ga0265331_105254561 139
797 3300038443 Ga0395901_1034950 Ga0395901_1034950_270_701 139
798 3300025901 Ga0207688_10248797 Ga0207688_102487971 140
799 3300025926 Ga0207659_10280908 Ga0207659_102809082 140
800 3300046454 Ga0495592_0000237 Ga0495592_0000237_22684_23106 140
801 3300049580 Ga0501046_0102177 Ga0501046_0102177_1588_2025 140
802 3300005330 Ga0070690_100381469 Ga0070690_1003814692 141
803 3300005335 Ga0070666_10856859 Ga0070666_108568591 141
804 3300005364 Ga0070673_100156271 Ga0070673_1001562714 141
805 3300005455 Ga0070663_100257192 Ga0070663_1002571922 141
806 3300005459 Ga0068867_100005613 Ga0068867_1000056136 141
807 3300005539 Ga0068853_100532240 Ga0068853_1005322402 141
808 3300005577 Ga0068857_100012597 Ga0068857_1000125976 141
809 3300005578 Ga0068854_100128619 Ga0068854_1001286192 141
810 3300005616 Ga0068852_100009754 Ga0068852_1000097544 141
811 3300005617 Ga0068859_100029195 Ga0068859_1000291955 141
812 3300006038 Ga0075365_10019696 Ga0075365_100196962 141
813 3300006042 Ga0075368_10009558 Ga0075368_100095582 141
814 3300006048 Ga0075363_100041779 Ga0075363_1000417794 141
815 3300006051 Ga0075364_10485397 Ga0075364_104853972 141
816 3300006177 Ga0075362_10001957 Ga0075362_100019579 141
817 3300006178 Ga0075367_10037112 Ga0075367_100371123 141
818 3300006178 Ga0075367_10633990 Ga0075367_106339901 141
819 3300006186 Ga0075369_10008676 Ga0075369_100086763 141
820 3300006195 Ga0075366_10098545 Ga0075366_100985453 141
821 3300006353 Ga0075370_10010871 Ga0075370_100108716 141
822 3300006353 Ga0075370_10027521 Ga0075370_100275214 141
823 3300009093 Ga0105240_10043802 Ga0105240_100438025 141
824 3300009148 Ga0105243_10929159 Ga0105243_109291591 141
825 3300009174 Ga0105241_10285839 Ga0105241_102858391 141
826 3300009545 Ga0105237_10023165 Ga0105237_100231652 141
827 3300010375 Ga0105239_10034134 Ga0105239_100341347 141
828 3300025907 Ga0207645_10453464 Ga0207645_104534642 141
829 3300025908 Ga0207643_10018546 Ga0207643_100185465 141
830 3300025914 Ga0207671_10028571 Ga0207671_100285716 141
831 3300025927 Ga0207687_10892312 Ga0207687_108923121 141
832 3300025938 Ga0207704_11280964 Ga0207704_112809641 141
833 3300025981 Ga0207640_10061774 Ga0207640_100617742 141
834 3300026023 Ga0207677_10311169 Ga0207677_103111691 141
835 3300026035 Ga0207703_10742300 Ga0207703_107423002 141
836 3300026041 Ga0207639_10083964 Ga0207639_100839645 141
837 3300026067 Ga0207678_10157281 Ga0207678_101572813 141
838 3300026089 Ga0207648_10045378 Ga0207648_100453782 141
839 3300026116 Ga0207674_10159973 Ga0207674_101599731 141
840 3300026142 Ga0207698_11021245 Ga0207698_110212452 141
841 3300027866 Ga0209813_10010978 Ga0209813_100109783 141
842 3300031548 Ga0307408_100659709 Ga0307408_1006597092 141
843 3300032005 Ga0307411_11692783 Ga0307411_116927831 141
844 3300035695 Ga0373927_0126277 Ga0373927_0126277_1017_1442 141
845 3300035725 Ga0373947_0644544 Ga0373947_0644544_254_679 141
846 3300041997 Ga0439431_0050391 Ga0439431_0050391_136_561 141
847 3300042126 Ga0450888_014470 Ga0450888_014470_359_784 141
848 3300042134 Ga0450898_008229 Ga0450898_008229_44_469 141
849 3300042156 Ga0439446_0309148 Ga0439446_0309148_117_542 141
850 3300046681 Ga0495647_0096873 Ga0495647_0096873_435_860 141
851 3300046683 Ga0495658_0145953 Ga0495658_0145953_748_1173 141
852 3300047443 Ga0495687_001087 Ga0495687_001087_25145_25570 141
853 3300048091 Ga0495626_0127504 Ga0495626_0127504_620_1045 141
854 3300049741 Ga0501079_0702920 Ga0501079_0702920_250_675 141
855 3300050489 nmdc:mga03683_172376_c1 nmdc:mga03683_172376_c1_549_974 141
856 3300050490 nmdc:mga03n38_21294_c1 nmdc:mga03n38_21294_c1_194_622 141
857 3300050491 nmdc:mga00v17_91783_c1 nmdc:mga00v17_91783_c1_164_589 141
858 3300050492 nmdc:mga0yw44_166232_c1 nmdc:mga0yw44_166232_c1_27_455 141
859 3300050493 nmdc:mga0k408_21109_c1 nmdc:mga0k408_21109_c1_1680_2105 141
860 3300050493 nmdc:mga0k408_36491_c1 nmdc:mga0k408_36491_c1_1236_1661 141
861 3300050494 nmdc:mga06z11_15228_c1 nmdc:mga06z11_15228_c1_1506_1931 141
862 3300050494 nmdc:mga06z11_3894_c1 nmdc:mga06z11_3894_c1_5371_5799 141
863 3300050495 nmdc:mga04h51_25330_c1 nmdc:mga04h51_25330_c1_451_876 141
864 3300050495 nmdc:mga04h51_7728_c1 nmdc:mga04h51_7728_c1_1522_1950 141
865 3300050496 nmdc:mga07m45_1622_c1 nmdc:mga07m45_1622_c1_8114_8542 141
866 3300050496 nmdc:mga07m45_6702_c1 nmdc:mga07m45_6702_c1_4651_5076 141
867 3300050516 nmdc:mga0sz30_2878_c1 nmdc:mga0sz30_2878_c1_3788_4216 141
868 3300003347 JGI26128J50194_1003477 JGI26128J50194_10034772 142
869 3300005328 Ga0070676_10011422 Ga0070676_100114226 142
870 3300005328 Ga0070676_11182796 Ga0070676_111827961 142
871 3300005331 Ga0070670_100072630 Ga0070670_1000726304 142
872 3300005334 Ga0068869_100079862 Ga0068869_1000798623 142
873 3300005334 Ga0068869_100264125 Ga0068869_1002641252 142
874 3300005338 Ga0068868_100043659 Ga0068868_1000436592 142
875 3300005338 Ga0068868_100849263 Ga0068868_1008492632 142
876 3300005355 Ga0070671_100046476 Ga0070671_1000464763 142
877 3300005355 Ga0070671_100059799 Ga0070671_1000597993 142
878 3300005356 Ga0070674_100287626 Ga0070674_1002876261 142
879 3300005364 Ga0070673_100001741 Ga0070673_1000017413 142
880 3300005366 Ga0070659_100559422 Ga0070659_1005594221 142
881 3300005367 Ga0070667_100003744 Ga0070667_1000037448 142
882 3300005367 Ga0070667_100136381 Ga0070667_1001363812 142
883 3300005367 Ga0070667_100401046 Ga0070667_1004010462 142
884 3300005367 Ga0070667_101013773 Ga0070667_1010137732 142
885 3300005456 Ga0070678_100063394 Ga0070678_1000633944 142
886 3300005459 Ga0068867_100004640 Ga0068867_1000046401 142
887 3300005548 Ga0070665_100041322 Ga0070665_1000413226 142
888 3300005548 Ga0070665_100806753 Ga0070665_1008067531 142
889 3300005564 Ga0070664_100437150 Ga0070664_1004371501 142
890 3300005577 Ga0068857_100166574 Ga0068857_1001665744 142
891 3300005617 Ga0068859_100630261 Ga0068859_1006302612 142
892 3300005617 Ga0068859_102172732 Ga0068859_1021727321 142
893 3300005618 Ga0068864_100004217 Ga0068864_1000042178 142
894 3300005840 Ga0068870_10012568 Ga0068870_100125682 142
895 3300005841 Ga0068863_100002662 Ga0068863_10000266210 142
896 3300005842 Ga0068858_101191011 Ga0068858_1011910111 142
897 3300005843 Ga0068860_100116350 Ga0068860_1001163503 142
898 3300005843 Ga0068860_100311452 Ga0068860_1003114522 142
899 3300006042 Ga0075368_10019412 Ga0075368_100194125 142
900 3300006048 Ga0075363_100383143 Ga0075363_1003831432 142
901 3300006186 Ga0075369_10039561 Ga0075369_100395611 142
902 3300006195 Ga0075366_10008996 Ga0075366_100089963 142
903 3300006195 Ga0075366_10020936 Ga0075366_100209365 142
904 3300006195 Ga0075366_10038797 Ga0075366_100387972 142
905 3300006237 Ga0097621_100415390 Ga0097621_1004153901 142
906 3300006353 Ga0075370_10000366 Ga0075370_1000036610 142
907 3300006353 Ga0075370_10010448 Ga0075370_100104486 142
908 3300006353 Ga0075370_10751327 Ga0075370_107513271 142
909 3300006881 Ga0068865_100252927 Ga0068865_1002529272 142
910 3300006881 Ga0068865_100757180 Ga0068865_1007571802 142
911 3300006931 Ga0097620_100630212 Ga0097620_1006302122 142
912 3300006931 Ga0097620_102172728 Ga0097620_1021727282 142
913 3300009098 Ga0105245_10017419 Ga0105245_100174195 142
914 3300009098 Ga0105245_11464193 Ga0105245_114641932 142
915 3300009177 Ga0105248_10108959 Ga0105248_101089592 142
916 3300009551 Ga0105238_11034900 Ga0105238_110349002 142
917 3300009553 Ga0105249_10312075 Ga0105249_103120752 142
918 3300009553 Ga0105249_10386522 Ga0105249_103865222 142
919 3300011119 Ga0105246_10200007 Ga0105246_102000072 142
920 3300013306 Ga0163162_10109032 Ga0163162_101090322 142
921 3300013306 Ga0163162_11243326 Ga0163162_112433261 142
922 3300013308 Ga0157375_10089129 Ga0157375_100891292 142
923 3300013308 Ga0157375_11244299 Ga0157375_112442992 142
924 3300014325 Ga0163163_10939065 Ga0163163_109390652 142
925 3300014968 Ga0157379_10245831 Ga0157379_102458312 142
926 3300017792 Ga0163161_10207972 Ga0163161_102079723 142
927 3300025907 Ga0207645_10015401 Ga0207645_100154011 142
928 3300025924 Ga0207694_11498981 Ga0207694_114989811 142
929 3300025927 Ga0207687_10137735 Ga0207687_101377352 142
930 3300025927 Ga0207687_10240758 Ga0207687_102407583 142
931 3300025931 Ga0207644_10015701 Ga0207644_100157015 142
932 3300025931 Ga0207644_10442976 Ga0207644_104429762 142
933 3300025932 Ga0207690_10433682 Ga0207690_104336821 142
934 3300025941 Ga0207711_10128035 Ga0207711_101280353 142
935 3300025942 Ga0207689_10079396 Ga0207689_100793963 142
936 3300025961 Ga0207712_10114397 Ga0207712_101143972 142
937 3300025961 Ga0207712_10315739 Ga0207712_103157391 142
938 3300025986 Ga0207658_10004811 Ga0207658_100048113 142
939 3300025986 Ga0207658_10333230 Ga0207658_103332301 142
940 3300025986 Ga0207658_10390154 Ga0207658_103901542 142
941 3300025986 Ga0207658_10480332 Ga0207658_104803322 142
942 3300026023 Ga0207677_10008704 Ga0207677_100087045 142
943 3300026035 Ga0207703_10551746 Ga0207703_105517462 142
944 3300026088 Ga0207641_10027510 Ga0207641_100275102 142
945 3300026089 Ga0207648_10152615 Ga0207648_101526151 142
946 3300026095 Ga0207676_10004330 Ga0207676_100043303 142
947 3300026116 Ga0207674_10017885 Ga0207674_100178856 142
948 3300026116 Ga0207674_10190465 Ga0207674_101904651 142
949 3300027471 Ga0209995_1023439 Ga0209995_10234392 142
950 3300027526 Ga0209968_1000406 Ga0209968_10004067 142
951 3300027695 Ga0209966_1001477 Ga0209966_10014775 142
952 3300027866 Ga0209813_10084932 Ga0209813_100849322 142
953 3300028379 Ga0268266_10054582 Ga0268266_100545826 142
954 3300028381 Ga0268264_10094702 Ga0268264_100947023 142
955 3300028786 Ga0307517_10000499 Ga0307517_1000049935 142
956 3300028786 Ga0307517_10053917 Ga0307517_100539175 142
957 3300028794 Ga0307515_10017831 Ga0307515_1001783112 142
958 3300028794 Ga0307515_10061230 Ga0307515_100612306 142
959 3300028794 Ga0307515_10303092 Ga0307515_103030922 142
960 3300028794 Ga0307515_10344822 Ga0307515_103448221 142
961 3300030522 Ga0307512_10113943 Ga0307512_101139433 142
962 3300031456 Ga0307513_10021752 Ga0307513_100217527 142
963 3300031456 Ga0307513_10302643 Ga0307513_103026432 142
964 3300031507 Ga0307509_10002631 Ga0307509_100026319 142
965 3300031507 Ga0307509_10004339 Ga0307509_1000433921 142
966 3300031507 Ga0307509_10012369 Ga0307509_100123697 142
967 3300031507 Ga0307509_10027391 Ga0307509_100273915 142
968 3300031507 Ga0307509_10066960 Ga0307509_100669606 142
969 3300031507 Ga0307509_10176895 Ga0307509_101768953 142
970 3300031616 Ga0307508_10017553 Ga0307508_100175535 142
971 3300031616 Ga0307508_10107934 Ga0307508_101079342 142
972 3300031616 Ga0307508_10165511 Ga0307508_101655113 142
973 3300031616 Ga0307508_10207068 Ga0307508_102070682 142
974 3300031649 Ga0307514_10016794 Ga0307514_100167946 142
975 3300031649 Ga0307514_10018499 Ga0307514_100184996 142
976 3300031649 Ga0307514_10432961 Ga0307514_104329612 142
977 3300031730 Ga0307516_10195244 Ga0307516_101952442 142
978 3300031730 Ga0307516_10261674 Ga0307516_102616741 142
979 3300033179 Ga0307507_10102485 Ga0307507_101024852 142
980 3300033180 Ga0307510_10002130 Ga0307510_1000213014 142
981 3300033180 Ga0307510_10091238 Ga0307510_100912382 142
982 3300033180 Ga0307510_10115814 Ga0307510_101158144 142
983 3300033180 Ga0307510_10304281 Ga0307510_103042812 142
984 3300034820 Ga0373959_0008650 Ga0373959_0008650_368_805 142
985 3300035084 Ga0373928_0124931 Ga0373928_0124931_166_597 142
986 3300035085 Ga0373929_0222344 Ga0373929_0222344_33_461 142
987 3300035088 Ga0373940_0001620 Ga0373940_0001620_1236_1673 142
988 3300035090 Ga0373949_0015829 Ga0373949_0015829_1156_1587 142
989 3300035114 Ga0373939_0000016 Ga0373939_0000016_5316_5753 142
990 3300035114 Ga0373939_0044187 Ga0373939_0044187_628_1059 142
991 3300035691 Ga0373931_0088685 Ga0373931_0088685_292_729 142
992 3300035691 Ga0373931_0427323 Ga0373931_0427323_304_735 142
993 3300035695 Ga0373927_0286590 Ga0373927_0286590_270_701 142
994 3300035725 Ga0373947_0765299 Ga0373947_0765299_49_480 142
995 3300037068 Ga0373925_0974648 Ga0373925_0974648_48_479 142
996 3300041498 Ga0451841_0212508 Ga0451841_0212508_125_553 142
997 3300046457 Ga0495590_0055228 Ga0495590_0055228_229_657 142
998 3300046459 Ga0495629_0440426 Ga0495629_0440426_386_817 142
999 3300046459 Ga0495629_0486510 Ga0495629_0486510_128_559 142
1000 3300046461 Ga0495641_0069493 Ga0495641_0069493_748_1179 142
1001 3300046474 Ga0495605_0054917 Ga0495605_0054917_1196_1624 142
1002 3300046507 Ga0495606_0212192 Ga0495606_0212192_159_590 142
1003 3300046512 Ga0495610_0226611 Ga0495610_0226611_242_670 142
1004 3300046517 Ga0495630_0035969 Ga0495630_0035969_218_649 142
1005 3300046518 Ga0495631_0130716 Ga0495631_0130716_310_738 142
1006 3300046519 Ga0495632_0005889 Ga0495632_0005889_5890_6318 142
1007 3300046524 Ga0495648_0193333 Ga0495648_0193333_432_860 142
1008 3300046524 Ga0495648_0267512 Ga0495648_0267512_209_640 142
1009 3300046526 Ga0495666_0035252 Ga0495666_0035252_1454_1885 142
1010 3300046530 Ga0495654_0233960 Ga0495654_0233960_146_577 142
1011 3300046542 Ga0495597_0021547 Ga0495597_0021547_1022_1450 142
1012 3300046557 Ga0495622_0305429 Ga0495622_0305429_194_625 142
1013 3300046616 Ga0495668_0070343 Ga0495668_0070343_1122_1553 142
1014 3300046616 Ga0495668_0142214 Ga0495668_0142214_305_733 142
1015 3300046648 Ga0495611_0470180 Ga0495611_0470180_24_452 142
1016 3300046660 Ga0495625_0061838 Ga0495625_0061838_132_560 142
1017 3300046660 Ga0495625_0326347 Ga0495625_0326347_487_918 142
1018 3300046683 Ga0495658_0223988 Ga0495658_0223988_519_950 142
1019 3300046683 Ga0495658_0687886 Ga0495658_0687886_164_595 142
1020 3300046684 Ga0495669_0105898 Ga0495669_0105898_14_442 142
1021 3300046689 Ga0495613_0621769 Ga0495613_0621769_131_562 142
1022 3300046690 Ga0495624_0109110 Ga0495624_0109110_31_462 142
1023 3300046694 Ga0495649_0013283 Ga0495649_0013283_1730_2158 142
1024 3300046694 Ga0495649_0376384 Ga0495649_0376384_28_456 142
1025 3300046810 Ga0495660_0045027 Ga0495660_0045027_81_509 142
1026 3300047318 Ga0495636_0338502 Ga0495636_0338502_86_514 142
1027 3300047443 Ga0495687_024124 Ga0495687_024124_1037_1465 142
1028 3300047446 Ga0495679_217375 Ga0495679_217375_22_450 142
1029 3300047472 Ga0495686_0077805 Ga0495686_0077805_1415_1846 142
1030 3300048091 Ga0495626_0407002 Ga0495626_0407002_15_443 142
1031 3300048903 Ga0496100_0348445 Ga0496100_0348445_172_603 142
1032 3300048905 Ga0496102_0279006 Ga0496102_0279006_320_748 142
1033 3300048907 Ga0496104_0030414 Ga0496104_0030414_2035_2463 142
1034 3300048911 Ga0496108_0112206 Ga0496108_0112206_271_699 142
1035 3300048912 Ga0496109_0074233 Ga0496109_0074233_2643_3071 142
1036 3300048913 Ga0496110_0324001 Ga0496110_0324001_810_1238 142
1037 3300048915 Ga0496112_0003758 Ga0496112_0003758_10783_11211 142
1038 3300048916 Ga0496113_0008289 Ga0496113_0008289_4927_5355 142
1039 3300048924 Ga0496121_0349519 Ga0496121_0349519_484_915 142
1040 3300049460 Ga0495682_0081502 Ga0495682_0081502_632_1060 142
1041 3300050493 nmdc:mga0k408_4161_c1 nmdc:mga0k408_4161_c1_6414_6845 142
1042 3300050493 nmdc:mga0k408_7389_c1 nmdc:mga0k408_7389_c1_428_856 142
1043 3300050495 nmdc:mga04h51_98167_c1 nmdc:mga04h51_98167_c1_191_622 142
1044 3300050496 nmdc:mga07m45_160_c1 nmdc:mga07m45_160_c1_24164_24595 142
1045 3300050496 nmdc:mga07m45_42054_c1 nmdc:mga07m45_42054_c1_220_648 142
1046 3300050496 nmdc:mga07m45_469_c1 nmdc:mga07m45_469_c1_1116_1553 142
1047 3300053083 Ga0495655_0198662 Ga0495655_0198662_55_483 142
1048 3300053086 Ga0500578_0026552 Ga0500578_0026552_1511_1942 142
1049 3300053088 Ga0500644_0003036 Ga0500644_0003036_1717_2145 142
1050 3300053091 Ga0500647_0171717 Ga0500647_0171717_483_911 142
1051 3300053093 Ga0500651_0060890 Ga0500651_0060890_1726_2154 142
1052 3300053098 Ga0500650_0328909 Ga0500650_0328909_204_632 142
1053 3300053118 Ga0500594_0000648 Ga0500594_0000648_1965_2393 142
1054 3300053121 Ga0500607_242573 Ga0500607_242573_212_640 142
1055 3300053131 Ga0500652_015634 Ga0500652_015634_1582_2010 142
1056 3300053134 Ga0500658_0010471 Ga0500658_0010471_2041_2469 142
1057 3300053136 Ga0500559_0000602 Ga0500559_0000602_21972_22400 142
1058 3300053136 Ga0500559_0299026 Ga0500559_0299026_118_546 142
1059 3300053139 Ga0500568_0047353 Ga0500568_0047353_1091_1519 142
1060 3300053155 Ga0500620_105003 Ga0500620_105003_477_908 142
1061 3300053156 Ga0500622_0197165 Ga0500622_0197165_313_741 142
1062 3300053177 Ga0500636_0274429 Ga0500636_0274429_206_634 142
1063 3300053177 Ga0500636_0331247 Ga0500636_0331247_83_514 142
1064 3300053730 Ga0500645_002532 Ga0500645_002532_1356_1787 142
1065 3300053739 Ga0500587_000910 Ga0500587_000910_3359_3787 142
1066 3300059424 Ga0590075_076040 Ga0590075_076040_348_776 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

24

155

0.95

Feature Viewer

pLDDT pTM Quality
71.85 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map