F489389
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1066 | 432 | 1063 | 138 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10467584|Ga0065707_104675841 |
| Length | 157 |
| Sequence | MLTAYCLLLTAYGNKDMLIDRRVGRRLMNQINVVPYIDVMLVLLVIFMVTAPLINPGQIELPSVGKTSEPPLQPMEVSIQSDGALSLRDRARSMDERKVSRNDLLAAIRQKQKQNPDQAVVISADKDVRYEAVLEVMDMLQQNQVRKVGLLAKPRGG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 2 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 3 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 4 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 5 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 6 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 76 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 77 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 78 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 100 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 207 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 208 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 212 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 214 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 217 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 218 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 219 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 220 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 221 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 222 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 223 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 231 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 232 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 235 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 236 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 237 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 239 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 241 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 244 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 247 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 253 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 257 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 260 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 261 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 262 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 266 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 267 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 268 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 269 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 270 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 271 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 272 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 273 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 274 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 275 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 276 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 277 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 278 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 342 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 350 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 351 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 352 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 353 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 354 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 356 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 357 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 358 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 383 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 386 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 387 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 388 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 389 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 390 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 392 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 393 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 403 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 407 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 408 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 410 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 411 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 412 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 413 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 414 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 415 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 416 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 417 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 418 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 419 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 420 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 421 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 422 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 423 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 424 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 425 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 426 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 428 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 429 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 431 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.72 |
| Metatranscriptomes | 0 |
| Isolates | 0.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.88 |
| Nodule | 0 |
| Rhizoplane | 2.16 |
| Rhizosphere | 85.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI26128J50194_1003477 | 3300003347 | Bacteria | 1042 |
| 2 | Ga0055543_1022535 | 3300004625 | Bacteria | 1142 |
| 3 | Ga0065165_1000092 | 3300005262 | Bacteria | 148435 |
| 4 | Ga0065715_10669271 | 3300005293 | Bacteria | 669 |
| 5 | Ga0065707_10083123 | 3300005295 | Bacteria | 10357 |
| 6 | Ga0065707_10467584 | 3300005295 | Bacteria | 785 |
| 7 | Ga0070658_10399846 | 3300005327 | Bacteria | 1180 |
| 8 | Ga0070676_10011422 | 3300005328 | Bacteria | 4829 |
| 9 | Ga0070676_10048890 | 3300005328 | Bacteria | 2474 |
| 10 | Ga0070676_10252750 | 3300005328 | Bacteria | 1177 |
| 11 | Ga0070676_10931738 | 3300005328 | Bacteria | 649 |
| 12 | Ga0070676_11182796 | 3300005328 | Bacteria | 580 |
| 13 | Ga0070690_100000300 | 3300005330 | Bacteria | 25499 |
| 14 | Ga0070690_100381469 | 3300005330 | Bacteria | 1031 |
| 15 | Ga0070690_100747498 | 3300005330 | Bacteria | 755 |
| 16 | Ga0070690_100817040 | 3300005330 | Bacteria | 724 |
| 17 | Ga0070670_100072630 | 3300005331 | Bacteria | 2955 |
| 18 | Ga0070670_100083904 | 3300005331 | Bacteria | 2737 |
| 19 | Ga0070677_10003447 | 3300005333 | Bacteria | 5103 |
| 20 | Ga0070677_10198215 | 3300005333 | Bacteria | 967 |
| 21 | Ga0068869_100028350 | 3300005334 | Bacteria | 3911 |
| 22 | Ga0068869_100079862 | 3300005334 | Bacteria | 2438 |
| 23 | Ga0068869_100264125 | 3300005334 | Bacteria | 1379 |
| 24 | Ga0068869_100352433 | 3300005334 | Bacteria | 1200 |
| 25 | Ga0068869_101137894 | 3300005334 | Bacteria | 684 |
| 26 | Ga0070666_10065754 | 3300005335 | Bacteria | 2460 |
| 27 | Ga0070666_10856859 | 3300005335 | Bacteria | 671 |
| 28 | Ga0070680_100249963 | 3300005336 | Bacteria | 1499 |
| 29 | Ga0070680_100398442 | 3300005336 | Bacteria | 1173 |
| 30 | Ga0070680_100699222 | 3300005336 | Bacteria | 872 |
| 31 | Ga0070682_100179723 | 3300005337 | Bacteria | 1477 |
| 32 | Ga0070682_100278675 | 3300005337 | Bacteria | 1218 |
| 33 | Ga0068868_100043659 | 3300005338 | Bacteria | 3502 |
| 34 | Ga0068868_100073159 | 3300005338 | Bacteria | 2736 |
| 35 | Ga0068868_100288850 | 3300005338 | Bacteria | 1390 |
| 36 | Ga0068868_100842698 | 3300005338 | Bacteria | 830 |
| 37 | Ga0068868_100849263 | 3300005338 | Bacteria | 827 |
| 38 | Ga0068868_101252304 | 3300005338 | Bacteria | 687 |
| 39 | Ga0070689_100000861 | 3300005340 | Bacteria | 18854 |
| 40 | Ga0070689_100500818 | 3300005340 | Bacteria | 1040 |
| 41 | Ga0070689_101268652 | 3300005340 | Bacteria | 663 |
| 42 | Ga0070691_10039151 | 3300005341 | Bacteria | 2240 |
| 43 | Ga0070691_10083618 | 3300005341 | Bacteria | 1566 |
| 44 | Ga0070691_10117632 | 3300005341 | Bacteria | 1335 |
| 45 | Ga0070687_100132070 | 3300005343 | Bacteria | 1443 |
| 46 | Ga0070687_100474085 | 3300005343 | Bacteria | 837 |
| 47 | Ga0070687_101000230 | 3300005343 | Bacteria | 606 |
| 48 | Ga0070661_100118999 | 3300005344 | Bacteria | 1977 |
| 49 | Ga0070661_101323769 | 3300005344 | Bacteria | 605 |
| 50 | Ga0070692_10020728 | 3300005345 | Bacteria | 3190 |
| 51 | Ga0070692_10200256 | 3300005345 | Bacteria | 1169 |
| 52 | Ga0070692_10424610 | 3300005345 | Bacteria | 845 |
| 53 | Ga0070668_100080727 | 3300005347 | Bacteria | 2549 |
| 54 | Ga0070668_100122184 | 3300005347 | Bacteria | 2083 |
| 55 | Ga0070668_100413291 | 3300005347 | Bacteria | 1154 |
| 56 | Ga0070668_100706146 | 3300005347 | Bacteria | 890 |
| 57 | Ga0070669_100166422 | 3300005353 | Bacteria | 1716 |
| 58 | Ga0070669_100336919 | 3300005353 | Bacteria | 1221 |
| 59 | Ga0070675_100102474 | 3300005354 | Bacteria | 2412 |
| 60 | Ga0070675_100119417 | 3300005354 | Bacteria | 2239 |
| 61 | Ga0070671_100042736 | 3300005355 | Bacteria | 3767 |
| 62 | Ga0070671_100046476 | 3300005355 | Bacteria | 3610 |
| 63 | Ga0070671_100059799 | 3300005355 | Bacteria | 3172 |
| 64 | Ga0070671_100271210 | 3300005355 | Bacteria | 1442 |
| 65 | Ga0070671_101853676 | 3300005355 | Bacteria | 536 |
| 66 | Ga0070674_100030606 | 3300005356 | Bacteria | 3559 |
| 67 | Ga0070674_100170190 | 3300005356 | Bacteria | 1660 |
| 68 | Ga0070674_100258779 | 3300005356 | Bacteria | 1370 |
| 69 | Ga0070674_100287626 | 3300005356 | Bacteria | 1305 |
| 70 | Ga0070674_100456639 | 3300005356 | Bacteria | 1055 |
| 71 | Ga0070674_101532092 | 3300005356 | Bacteria | 600 |
| 72 | Ga0070673_100001741 | 3300005364 | Bacteria | 12960 |
| 73 | Ga0070673_100044306 | 3300005364 | Bacteria | 3444 |
| 74 | Ga0070673_100055581 | 3300005364 | Bacteria | 3119 |
| 75 | Ga0070673_100156271 | 3300005364 | Bacteria | 1936 |
| 76 | Ga0070673_100326679 | 3300005364 | Bacteria | 1356 |
| 77 | Ga0070688_100598564 | 3300005365 | Bacteria | 843 |
| 78 | Ga0070659_100559422 | 3300005366 | Bacteria | 980 |
| 79 | Ga0070659_101334537 | 3300005366 | Bacteria | 636 |
| 80 | Ga0070667_100003744 | 3300005367 | Bacteria | 12915 |
| 81 | Ga0070667_100041004 | 3300005367 | Bacteria | 3883 |
| 82 | Ga0070667_100136381 | 3300005367 | Bacteria | 2146 |
| 83 | Ga0070667_100217270 | 3300005367 | Bacteria | 1700 |
| 84 | Ga0070667_100401046 | 3300005367 | Bacteria | 1248 |
| 85 | Ga0070667_100601126 | 3300005367 | Bacteria | 1013 |
| 86 | Ga0070667_100613516 | 3300005367 | Bacteria | 1003 |
| 87 | Ga0070667_101013773 | 3300005367 | Bacteria | 775 |
| 88 | Ga0070709_11271333 | 3300005434 | Bacteria | 593 |
| 89 | Ga0070701_10066002 | 3300005438 | Bacteria | 1922 |
| 90 | Ga0070705_100065362 | 3300005440 | Bacteria | 2177 |
| 91 | Ga0070705_100091313 | 3300005440 | Bacteria | 1898 |
| 92 | Ga0070705_100390600 | 3300005440 | Bacteria | 1027 |
| 93 | Ga0070705_100396085 | 3300005440 | Bacteria | 1021 |
| 94 | Ga0070705_100641001 | 3300005440 | Bacteria | 827 |
| 95 | Ga0070705_100668485 | 3300005440 | Bacteria | 812 |
| 96 | Ga0070700_100002065 | 3300005441 | Bacteria | 10203 |
| 97 | Ga0070700_100044562 | 3300005441 | Bacteria | 2733 |
| 98 | Ga0070700_100099417 | 3300005441 | Bacteria | 1914 |
| 99 | Ga0070700_100202877 | 3300005441 | Bacteria | 1394 |
| 100 | Ga0070700_100236442 | 3300005441 | Bacteria | 1303 |
| 101 | Ga0070694_100149815 | 3300005444 | Bacteria | 1703 |
| 102 | Ga0070694_100151394 | 3300005444 | Bacteria | 1695 |
| 103 | Ga0070694_100172149 | 3300005444 | Bacteria | 1596 |
| 104 | Ga0070694_100180682 | 3300005444 | Bacteria | 1560 |
| 105 | Ga0070694_101540761 | 3300005444 | Bacteria | 563 |
| 106 | Ga0070708_100022137 | 3300005445 | Bacteria | 5387 |
| 107 | Ga0070708_101514367 | 3300005445 | Bacteria | 625 |
| 108 | Ga0070663_100138750 | 3300005455 | Bacteria | 1854 |
| 109 | Ga0070663_100257192 | 3300005455 | Bacteria | 1384 |
| 110 | Ga0070678_100025513 | 3300005456 | Bacteria | 3978 |
| 111 | Ga0070678_100034520 | 3300005456 | Bacteria | 3524 |
| 112 | Ga0070678_100063394 | 3300005456 | Bacteria | 2735 |
| 113 | Ga0070678_100110420 | 3300005456 | Bacteria | 2150 |
| 114 | Ga0070678_100257442 | 3300005456 | Bacteria | 1466 |
| 115 | Ga0070678_100501737 | 3300005456 | Bacteria | 1071 |
| 116 | Ga0070662_100672546 | 3300005457 | Bacteria | 874 |
| 117 | Ga0070662_101324465 | 3300005457 | Bacteria | 620 |
| 118 | Ga0070681_10074249 | 3300005458 | Bacteria | 3362 |
| 119 | Ga0068867_100004065 | 3300005459 | Bacteria | 10300 |
| 120 | Ga0068867_100004640 | 3300005459 | Bacteria | 9669 |
| 121 | Ga0068867_100005613 | 3300005459 | Bacteria | 8889 |
| 122 | Ga0068867_100040768 | 3300005459 | Bacteria | 3391 |
| 123 | Ga0068867_100302267 | 3300005459 | Bacteria | 1319 |
| 124 | Ga0070685_10061441 | 3300005466 | Bacteria | 2200 |
| 125 | Ga0070685_10372158 | 3300005466 | Bacteria | 982 |
| 126 | Ga0070685_10423717 | 3300005466 | Bacteria | 927 |
| 127 | Ga0070706_100050486 | 3300005467 | Bacteria | 3839 |
| 128 | Ga0070706_100065903 | 3300005467 | Bacteria | 3350 |
| 129 | Ga0070707_100012911 | 3300005468 | Bacteria | 7803 |
| 130 | Ga0070707_100825928 | 3300005468 | Bacteria | 891 |
| 131 | Ga0070698_100078740 | 3300005471 | Bacteria | 3294 |
| 132 | Ga0070699_100410889 | 3300005518 | Bacteria | 1224 |
| 133 | Ga0070699_101547242 | 3300005518 | Bacteria | 608 |
| 134 | Ga0070679_100296260 | 3300005530 | Bacteria | 1569 |
| 135 | Ga0070684_100483072 | 3300005535 | Bacteria | 1147 |
| 136 | Ga0070697_100072004 | 3300005536 | Bacteria | 2836 |
| 137 | Ga0070697_100098562 | 3300005536 | Bacteria | 2425 |
| 138 | Ga0070697_101478875 | 3300005536 | Bacteria | 607 |
| 139 | Ga0070697_101493637 | 3300005536 | Bacteria | 604 |
| 140 | Ga0068853_100226210 | 3300005539 | Bacteria | 1710 |
| 141 | Ga0068853_100336266 | 3300005539 | Bacteria | 1402 |
| 142 | Ga0068853_100532240 | 3300005539 | Bacteria | 1112 |
| 143 | Ga0068853_101212206 | 3300005539 | Bacteria | 729 |
| 144 | Ga0068853_101457658 | 3300005539 | Bacteria | 662 |
| 145 | Ga0070672_100010574 | 3300005543 | Bacteria | 6406 |
| 146 | Ga0070672_100047876 | 3300005543 | Bacteria | 3319 |
| 147 | Ga0070672_100346695 | 3300005543 | Bacteria | 1265 |
| 148 | Ga0070686_100000276 | 3300005544 | Bacteria | 35087 |
| 149 | Ga0070686_100027336 | 3300005544 | Bacteria | 3452 |
| 150 | Ga0070686_101878428 | 3300005544 | Bacteria | 511 |
| 151 | Ga0070695_100019621 | 3300005545 | Bacteria | 4119 |
| 152 | Ga0070695_100047990 | 3300005545 | Bacteria | 2729 |
| 153 | Ga0070695_100085829 | 3300005545 | Bacteria | 2091 |
| 154 | Ga0070695_100172292 | 3300005545 | Bacteria | 1527 |
| 155 | Ga0070696_100005155 | 3300005546 | Bacteria | 8736 |
| 156 | Ga0070696_100023372 | 3300005546 | Bacteria | 4202 |
| 157 | Ga0070696_100134017 | 3300005546 | Bacteria | 1805 |
| 158 | Ga0070696_100160694 | 3300005546 | Bacteria | 1655 |
| 159 | Ga0070693_100276330 | 3300005547 | Bacteria | 1123 |
| 160 | Ga0070693_100285622 | 3300005547 | Bacteria | 1107 |
| 161 | Ga0070693_100360143 | 3300005547 | Bacteria | 998 |
| 162 | Ga0070665_100041322 | 3300005548 | Bacteria | 4634 |
| 163 | Ga0070665_100070429 | 3300005548 | Bacteria | 3504 |
| 164 | Ga0070665_100210764 | 3300005548 | Bacteria | 1944 |
| 165 | Ga0070665_100806753 | 3300005548 | Bacteria | 952 |
| 166 | Ga0070704_100034277 | 3300005549 | Bacteria | 3441 |
| 167 | Ga0070704_100050541 | 3300005549 | Bacteria | 2923 |
| 168 | Ga0070704_100074667 | 3300005549 | Bacteria | 2474 |
| 169 | Ga0070704_100140290 | 3300005549 | Bacteria | 1886 |
| 170 | Ga0070704_100237601 | 3300005549 | Bacteria | 1490 |
| 171 | Ga0070704_100352489 | 3300005549 | Bacteria | 1243 |
| 172 | Ga0070704_100740196 | 3300005549 | Bacteria | 875 |
| 173 | Ga0068855_100147363 | 3300005563 | Bacteria | 2678 |
| 174 | Ga0068855_100648027 | 3300005563 | Bacteria | 1135 |
| 175 | Ga0070664_100437150 | 3300005564 | Bacteria | 1200 |
| 176 | Ga0070664_100755889 | 3300005564 | Bacteria | 907 |
| 177 | Ga0070664_100828612 | 3300005564 | Bacteria | 866 |
| 178 | Ga0070664_102067616 | 3300005564 | Bacteria | 540 |
| 179 | Ga0068857_100012597 | 3300005577 | Bacteria | 7367 |
| 180 | Ga0068857_100017748 | 3300005577 | Bacteria | 6239 |
| 181 | Ga0068857_100091436 | 3300005577 | Bacteria | 2724 |
| 182 | Ga0068857_100166574 | 3300005577 | Bacteria | 2002 |
| 183 | Ga0068854_100128619 | 3300005578 | Bacteria | 1932 |
| 184 | Ga0068854_100246931 | 3300005578 | Bacteria | 1423 |
| 185 | Ga0068856_100196588 | 3300005614 | Bacteria | 2031 |
| 186 | Ga0068856_100239215 | 3300005614 | Bacteria | 1831 |
| 187 | Ga0068856_100410526 | 3300005614 | Bacteria | 1374 |
| 188 | Ga0068856_101092571 | 3300005614 | Bacteria | 815 |
| 189 | Ga0070702_100004569 | 3300005615 | Bacteria | 6334 |
| 190 | Ga0070702_100009084 | 3300005615 | Bacteria | 4850 |
| 191 | Ga0068852_100009754 | 3300005616 | Bacteria | 7138 |
| 192 | Ga0068852_100194764 | 3300005616 | Bacteria | 1915 |
| 193 | Ga0068859_100029195 | 3300005617 | Bacteria | 5534 |
| 194 | Ga0068859_100031129 | 3300005617 | Bacteria | 5355 |
| 195 | Ga0068859_100227548 | 3300005617 | Bacteria | 1953 |
| 196 | Ga0068859_100417001 | 3300005617 | Bacteria | 1439 |
| 197 | Ga0068859_100630261 | 3300005617 | Bacteria | 1165 |
| 198 | Ga0068859_102172732 | 3300005617 | Bacteria | 613 |
| 199 | Ga0068864_100004217 | 3300005618 | Bacteria | 11827 |
| 200 | Ga0068864_100030630 | 3300005618 | Bacteria | 4561 |
| 201 | Ga0068864_101053974 | 3300005618 | Bacteria | 808 |
| 202 | Ga0068866_10000076 | 3300005718 | Bacteria | 39397 |
| 203 | Ga0068866_10062319 | 3300005718 | Bacteria | 1940 |
| 204 | Ga0068866_10237597 | 3300005718 | Bacteria | 1108 |
| 205 | Ga0068861_100007611 | 3300005719 | Bacteria | 7432 |
| 206 | Ga0068870_10012568 | 3300005840 | Bacteria | 3960 |
| 207 | Ga0068870_10042556 | 3300005840 | Bacteria | 2365 |
| 208 | Ga0068870_10461075 | 3300005840 | Bacteria | 839 |
| 209 | Ga0068863_100002662 | 3300005841 | Bacteria | 17665 |
| 210 | Ga0068863_100631257 | 3300005841 | Bacteria | 1062 |
| 211 | Ga0068858_100000442 | 3300005842 | Bacteria | 43385 |
| 212 | Ga0068858_100028744 | 3300005842 | Bacteria | 5163 |
| 213 | Ga0068858_100062203 | 3300005842 | Bacteria | 3451 |
| 214 | Ga0068858_100849232 | 3300005842 | Bacteria | 892 |
| 215 | Ga0068858_101191011 | 3300005842 | Bacteria | 749 |
| 216 | Ga0068858_101271470 | 3300005842 | Bacteria | 724 |
| 217 | Ga0068858_102173163 | 3300005842 | Bacteria | 549 |
| 218 | Ga0068860_100022077 | 3300005843 | Bacteria | 6161 |
| 219 | Ga0068860_100116350 | 3300005843 | Bacteria | 2558 |
| 220 | Ga0068860_100311452 | 3300005843 | Bacteria | 1544 |
| 221 | Ga0068860_100799250 | 3300005843 | Bacteria | 956 |
| 222 | Ga0068860_100887990 | 3300005843 | Bacteria | 907 |
| 223 | Ga0068862_100000952 | 3300005844 | Bacteria | 27845 |
| 224 | Ga0068862_100122412 | 3300005844 | Bacteria | 2294 |
| 225 | Ga0068862_100133200 | 3300005844 | Bacteria | 2200 |
| 226 | Ga0068862_101916227 | 3300005844 | Bacteria | 603 |
| 227 | Ga0068862_102707869 | 3300005844 | Bacteria | 507 |
| 228 | Ga0075365_10019696 | 3300006038 | Bacteria | 4171 |
| 229 | Ga0075365_11014506 | 3300006038 | Bacteria | 585 |
| 230 | Ga0075368_10009558 | 3300006042 | Bacteria | 3487 |
| 231 | Ga0075368_10019412 | 3300006042 | Bacteria | 2566 |
| 232 | Ga0075363_100041779 | 3300006048 | Bacteria | 2419 |
| 233 | Ga0075363_100383143 | 3300006048 | Bacteria | 825 |
| 234 | Ga0075364_10485397 | 3300006051 | Bacteria | 845 |
| 235 | Ga0070715_10664075 | 3300006163 | Bacteria | 618 |
| 236 | Ga0070716_100027492 | 3300006173 | Bacteria | 3057 |
| 237 | Ga0070716_100107534 | 3300006173 | Bacteria | 1722 |
| 238 | Ga0070716_101356461 | 3300006173 | Bacteria | 577 |
| 239 | Ga0075362_10001957 | 3300006177 | Bacteria | 6765 |
| 240 | Ga0075367_10037112 | 3300006178 | Bacteria | 2829 |
| 241 | Ga0075367_10633990 | 3300006178 | Bacteria | 679 |
| 242 | Ga0075369_10003660 | 3300006186 | Bacteria | 5614 |
| 243 | Ga0075369_10008676 | 3300006186 | Bacteria | 3922 |
| 244 | Ga0075369_10039561 | 3300006186 | Bacteria | 2014 |
| 245 | Ga0075366_10008996 | 3300006195 | Bacteria | 5570 |
| 246 | Ga0075366_10020936 | 3300006195 | Bacteria | 3799 |
| 247 | Ga0075366_10036504 | 3300006195 | Bacteria | 2898 |
| 248 | Ga0075366_10038797 | 3300006195 | Bacteria | 2813 |
| 249 | Ga0075366_10098545 | 3300006195 | Bacteria | 1753 |
| 250 | Ga0075366_10865233 | 3300006195 | Bacteria | 563 |
| 251 | Ga0097621_100002873 | 3300006237 | Bacteria | 11818 |
| 252 | Ga0097621_100045264 | 3300006237 | Bacteria | 3553 |
| 253 | Ga0097621_100055977 | 3300006237 | Bacteria | 3221 |
| 254 | Ga0097621_100415390 | 3300006237 | Bacteria | 1207 |
| 255 | Ga0075370_10000366 | 3300006353 | Bacteria | 16529 |
| 256 | Ga0075370_10010448 | 3300006353 | Bacteria | 4855 |
| 257 | Ga0075370_10010871 | 3300006353 | Bacteria | 4771 |
| 258 | Ga0075370_10027521 | 3300006353 | Bacteria | 3155 |
| 259 | Ga0075370_10471547 | 3300006353 | Bacteria | 756 |
| 260 | Ga0075370_10751327 | 3300006353 | Bacteria | 594 |
| 261 | Ga0068871_100002359 | 3300006358 | Bacteria | 12878 |
| 262 | Ga0068871_100095357 | 3300006358 | Bacteria | 2484 |
| 263 | Ga0068871_100237977 | 3300006358 | Bacteria | 1582 |
| 264 | Ga0075428_100007382 | 3300006844 | Bacteria | 12189 |
| 265 | Ga0075430_100008948 | 3300006846 | Bacteria | 8456 |
| 266 | Ga0075430_100141991 | 3300006846 | Bacteria | 2000 |
| 267 | Ga0075430_100207070 | 3300006846 | Bacteria | 1628 |
| 268 | Ga0075431_100010497 | 3300006847 | Bacteria | 9312 |
| 269 | Ga0075431_100654811 | 3300006847 | Bacteria | 1030 |
| 270 | Ga0075433_10271141 | 3300006852 | Bacteria | 1504 |
| 271 | Ga0075434_100478950 | 3300006871 | Bacteria | 1266 |
| 272 | Ga0075434_101131489 | 3300006871 | Bacteria | 796 |
| 273 | Ga0075429_100010327 | 3300006880 | Bacteria | 8077 |
| 274 | Ga0075429_100065627 | 3300006880 | Bacteria | 3160 |
| 275 | Ga0075429_100339869 | 3300006880 | Bacteria | 1314 |
| 276 | Ga0068865_100004680 | 3300006881 | Bacteria | 8266 |
| 277 | Ga0068865_100070650 | 3300006881 | Bacteria | 2474 |
| 278 | Ga0068865_100252927 | 3300006881 | Bacteria | 1391 |
| 279 | Ga0068865_100371785 | 3300006881 | Bacteria | 1163 |
| 280 | Ga0068865_100740148 | 3300006881 | Bacteria | 843 |
| 281 | Ga0068865_100757180 | 3300006881 | Bacteria | 835 |
| 282 | Ga0068865_101688200 | 3300006881 | Bacteria | 571 |
| 283 | Ga0075436_100249448 | 3300006914 | Bacteria | 1264 |
| 284 | Ga0075436_100469681 | 3300006914 | Bacteria | 918 |
| 285 | Ga0097620_100031130 | 3300006931 | Bacteria | 5355 |
| 286 | Ga0097620_100227543 | 3300006931 | Bacteria | 1953 |
| 287 | Ga0097620_100417000 | 3300006931 | Bacteria | 1439 |
| 288 | Ga0097620_100630212 | 3300006931 | Bacteria | 1165 |
| 289 | Ga0097620_102172728 | 3300006931 | Bacteria | 613 |
| 290 | Ga0075435_100702759 | 3300007076 | Bacteria | 879 |
| 291 | Ga0075435_101238924 | 3300007076 | Bacteria | 653 |
| 292 | Ga0099794_10010187 | 3300007265 | Bacteria | 3982 |
| 293 | Ga0099794_10080488 | 3300007265 | Bacteria | 1606 |
| 294 | Ga0099794_10192212 | 3300007265 | Bacteria | 1044 |
| 295 | Ga0099795_10014274 | 3300007788 | Bacteria | 2459 |
| 296 | Ga0105240_10024979 | 3300009093 | Bacteria | 7864 |
| 297 | Ga0105240_10043802 | 3300009093 | Bacteria | 5691 |
| 298 | Ga0111539_10006144 | 3300009094 | Bacteria | 15507 |
| 299 | Ga0111539_11709330 | 3300009094 | Bacteria | 730 |
| 300 | Ga0105245_10000279 | 3300009098 | Bacteria | 48462 |
| 301 | Ga0105245_10017419 | 3300009098 | Bacteria | 6268 |
| 302 | Ga0105245_10054670 | 3300009098 | Bacteria | 3586 |
| 303 | Ga0105245_10193155 | 3300009098 | Bacteria | 1951 |
| 304 | Ga0105245_10693816 | 3300009098 | Bacteria | 1051 |
| 305 | Ga0105245_11009829 | 3300009098 | Bacteria | 876 |
| 306 | Ga0105245_11464193 | 3300009098 | Bacteria | 733 |
| 307 | Ga0114129_10199706 | 3300009147 | Bacteria | 2709 |
| 308 | Ga0114129_11088168 | 3300009147 | Bacteria | 1001 |
| 309 | Ga0105243_10000328 | 3300009148 | Bacteria | 52003 |
| 310 | Ga0105243_10042317 | 3300009148 | Bacteria | 3566 |
| 311 | Ga0105243_10042712 | 3300009148 | Bacteria | 3550 |
| 312 | Ga0105243_10929159 | 3300009148 | Bacteria | 867 |
| 313 | Ga0105243_11534987 | 3300009148 | Bacteria | 691 |
| 314 | Ga0105241_10119896 | 3300009174 | Bacteria | 2117 |
| 315 | Ga0105241_10285839 | 3300009174 | Bacteria | 1410 |
| 316 | Ga0105241_10804725 | 3300009174 | Bacteria | 866 |
| 317 | Ga0105241_11824647 | 3300009174 | Bacteria | 594 |
| 318 | Ga0105242_10000629 | 3300009176 | Bacteria | 27730 |
| 319 | Ga0105242_10119601 | 3300009176 | Bacteria | 2258 |
| 320 | Ga0105242_10130248 | 3300009176 | Bacteria | 2170 |
| 321 | Ga0105242_10177588 | 3300009176 | Bacteria | 1876 |
| 322 | Ga0105242_11151969 | 3300009176 | Bacteria | 792 |
| 323 | Ga0105248_10099558 | 3300009177 | Bacteria | 3276 |
| 324 | Ga0105248_10108959 | 3300009177 | Bacteria | 3123 |
| 325 | Ga0105248_10154567 | 3300009177 | Bacteria | 2589 |
| 326 | Ga0105248_11015863 | 3300009177 | Bacteria | 937 |
| 327 | Ga0105248_11367456 | 3300009177 | Bacteria | 801 |
| 328 | Ga0105237_10019997 | 3300009545 | Bacteria | 6912 |
| 329 | Ga0105237_10023165 | 3300009545 | Bacteria | 6366 |
| 330 | Ga0105238_10959484 | 3300009551 | Bacteria | 875 |
| 331 | Ga0105238_11034900 | 3300009551 | Bacteria | 842 |
| 332 | Ga0105249_10041028 | 3300009553 | Bacteria | 4205 |
| 333 | Ga0105249_10184647 | 3300009553 | Bacteria | 2031 |
| 334 | Ga0105249_10185727 | 3300009553 | Bacteria | 2026 |
| 335 | Ga0105249_10312075 | 3300009553 | Bacteria | 1581 |
| 336 | Ga0105249_10386522 | 3300009553 | Bacteria | 1426 |
| 337 | Ga0105249_10457856 | 3300009553 | Bacteria | 1315 |
| 338 | Ga0099796_10006792 | 3300010159 | Bacteria | 2952 |
| 339 | Ga0105239_10034134 | 3300010375 | Bacteria | 5585 |
| 340 | Ga0105239_10097074 | 3300010375 | Bacteria | 3256 |
| 341 | Ga0105239_10869713 | 3300010375 | Bacteria | 1034 |
| 342 | Ga0105239_12427338 | 3300010375 | Bacteria | 611 |
| 343 | Ga0105246_10200007 | 3300011119 | Bacteria | 1553 |
| 344 | Ga0105246_10664469 | 3300011119 | Bacteria | 909 |
| 345 | Ga0105246_12078353 | 3300011119 | Bacteria | 550 |
| 346 | Ga0157326_1035325 | 3300012513 | Bacteria | 680 |
| 347 | Ga0157369_11827977 | 3300013105 | Bacteria | 617 |
| 348 | Ga0157374_10000104 | 3300013296 | Bacteria | 78523 |
| 349 | Ga0157374_10054467 | 3300013296 | Bacteria | 3731 |
| 350 | Ga0157374_10109574 | 3300013296 | Bacteria | 2655 |
| 351 | Ga0157374_10730633 | 3300013296 | Bacteria | 1004 |
| 352 | Ga0157374_10948477 | 3300013296 | Bacteria | 879 |
| 353 | Ga0157378_10000815 | 3300013297 | Bacteria | 28986 |
| 354 | Ga0157378_10005354 | 3300013297 | Bacteria | 11257 |
| 355 | Ga0157378_10010321 | 3300013297 | Bacteria | 8153 |
| 356 | Ga0157378_10189673 | 3300013297 | Bacteria | 1938 |
| 357 | Ga0157378_10467196 | 3300013297 | Bacteria | 1255 |
| 358 | Ga0163162_10000821 | 3300013306 | Bacteria | 28874 |
| 359 | Ga0163162_10109032 | 3300013306 | Bacteria | 2865 |
| 360 | Ga0163162_11243326 | 3300013306 | Bacteria | 845 |
| 361 | Ga0163162_12126839 | 3300013306 | Bacteria | 644 |
| 362 | Ga0157375_10029474 | 3300013308 | Bacteria | 5162 |
| 363 | Ga0157375_10089129 | 3300013308 | Bacteria | 3141 |
| 364 | Ga0157375_10090951 | 3300013308 | Bacteria | 3112 |
| 365 | Ga0157375_10203443 | 3300013308 | Bacteria | 2136 |
| 366 | Ga0157375_10295166 | 3300013308 | Bacteria | 1784 |
| 367 | Ga0157375_10723938 | 3300013308 | Bacteria | 1148 |
| 368 | Ga0157375_11244299 | 3300013308 | Bacteria | 874 |
| 369 | Ga0157375_11400237 | 3300013308 | Bacteria | 824 |
| 370 | Ga0163163_10042982 | 3300014325 | Bacteria | 4428 |
| 371 | Ga0163163_10898372 | 3300014325 | Bacteria | 949 |
| 372 | Ga0163163_10939065 | 3300014325 | Bacteria | 928 |
| 373 | Ga0157380_10005446 | 3300014326 | Bacteria | 8897 |
| 374 | Ga0157380_10009860 | 3300014326 | Bacteria | 6857 |
| 375 | Ga0157380_10141913 | 3300014326 | Bacteria | 2065 |
| 376 | Ga0157380_10441454 | 3300014326 | Bacteria | 1247 |
| 377 | Ga0157380_10977140 | 3300014326 | Bacteria | 878 |
| 378 | Ga0157380_11148501 | 3300014326 | Bacteria | 818 |
| 379 | Ga0157380_13145535 | 3300014326 | Bacteria | 527 |
| 380 | Ga0157377_10307343 | 3300014745 | Bacteria | 1049 |
| 381 | Ga0157379_10009379 | 3300014968 | Bacteria | 8527 |
| 382 | Ga0157379_10023336 | 3300014968 | Bacteria | 5489 |
| 383 | Ga0157379_10080210 | 3300014968 | Bacteria | 2923 |
| 384 | Ga0157379_10117188 | 3300014968 | Bacteria | 2395 |
| 385 | Ga0157379_10245831 | 3300014968 | Bacteria | 1623 |
| 386 | Ga0157376_10118610 | 3300014969 | Bacteria | 2341 |
| 387 | Ga0157376_10194291 | 3300014969 | Bacteria | 1863 |
| 388 | Ga0157376_10450126 | 3300014969 | Bacteria | 1256 |
| 389 | Ga0163161_10037448 | 3300017792 | Bacteria | 3477 |
| 390 | Ga0163161_10049557 | 3300017792 | Bacteria | 3036 |
| 391 | Ga0163161_10207972 | 3300017792 | Bacteria | 1511 |
| 392 | Ga0213876_10043325 | 3300021384 | Bacteria | 2378 |
| 393 | Ga0207697_10015096 | 3300025315 | Bacteria | 3195 |
| 394 | Ga0207656_10341985 | 3300025321 | Bacteria | 746 |
| 395 | Ga0207682_10005721 | 3300025893 | Bacteria | 5042 |
| 396 | Ga0207682_10387554 | 3300025893 | Bacteria | 660 |
| 397 | Ga0207642_10009043 | 3300025899 | Bacteria | 3448 |
| 398 | Ga0207642_10020964 | 3300025899 | Bacteria | 2563 |
| 399 | Ga0207642_10153234 | 3300025899 | Bacteria | 1229 |
| 400 | Ga0207642_10199560 | 3300025899 | Bacteria | 1104 |
| 401 | Ga0207688_10209676 | 3300025901 | Bacteria | 1170 |
| 402 | Ga0207688_10248797 | 3300025901 | Bacteria | 1076 |
| 403 | Ga0207645_10015401 | 3300025907 | Bacteria | 5080 |
| 404 | Ga0207645_10024383 | 3300025907 | Bacteria | 3923 |
| 405 | Ga0207645_10170753 | 3300025907 | Bacteria | 1425 |
| 406 | Ga0207645_10453464 | 3300025907 | Bacteria | 866 |
| 407 | Ga0207643_10005204 | 3300025908 | Bacteria | 6960 |
| 408 | Ga0207643_10018546 | 3300025908 | Bacteria | 3811 |
| 409 | Ga0207643_10075362 | 3300025908 | Bacteria | 1947 |
| 410 | Ga0207705_10201441 | 3300025909 | Bacteria | 1508 |
| 411 | Ga0207684_10042382 | 3300025910 | Bacteria | 3858 |
| 412 | Ga0207684_10052018 | 3300025910 | Bacteria | 3475 |
| 413 | Ga0207654_10501493 | 3300025911 | Bacteria | 857 |
| 414 | Ga0207707_10063136 | 3300025912 | Bacteria | 3224 |
| 415 | Ga0207671_10028571 | 3300025914 | Bacteria | 4166 |
| 416 | Ga0207663_11044505 | 3300025916 | Bacteria | 656 |
| 417 | Ga0207660_10131851 | 3300025917 | Bacteria | 1903 |
| 418 | Ga0207660_10135206 | 3300025917 | Bacteria | 1880 |
| 419 | Ga0207662_10197331 | 3300025918 | Bacteria | 1301 |
| 420 | Ga0207662_10819254 | 3300025918 | Bacteria | 657 |
| 421 | Ga0207657_10040208 | 3300025919 | Bacteria | 4146 |
| 422 | Ga0207649_11377079 | 3300025920 | Bacteria | 558 |
| 423 | Ga0207652_10313936 | 3300025921 | Bacteria | 1415 |
| 424 | Ga0207652_10462507 | 3300025921 | Bacteria | 1143 |
| 425 | Ga0207646_10023091 | 3300025922 | Bacteria | 5717 |
| 426 | Ga0207646_10551562 | 3300025922 | Bacteria | 1036 |
| 427 | Ga0207681_10186571 | 3300025923 | Bacteria | 1583 |
| 428 | Ga0207694_10421837 | 3300025924 | Bacteria | 1111 |
| 429 | Ga0207694_11002958 | 3300025924 | Bacteria | 707 |
| 430 | Ga0207694_11498981 | 3300025924 | Bacteria | 569 |
| 431 | Ga0207650_10122628 | 3300025925 | Bacteria | 2025 |
| 432 | Ga0207650_10141435 | 3300025925 | Bacteria | 1892 |
| 433 | Ga0207650_10289082 | 3300025925 | Bacteria | 1336 |
| 434 | Ga0207650_10474584 | 3300025925 | Bacteria | 1043 |
| 435 | Ga0207659_10061637 | 3300025926 | Bacteria | 2704 |
| 436 | Ga0207659_10072532 | 3300025926 | Bacteria | 2517 |
| 437 | Ga0207659_10073001 | 3300025926 | Bacteria | 2511 |
| 438 | Ga0207659_10280908 | 3300025926 | Bacteria | 1361 |
| 439 | Ga0207659_10659490 | 3300025926 | Bacteria | 894 |
| 440 | Ga0207659_10746826 | 3300025926 | Bacteria | 839 |
| 441 | Ga0207687_10001372 | 3300025927 | Bacteria | 16638 |
| 442 | Ga0207687_10137735 | 3300025927 | Bacteria | 1848 |
| 443 | Ga0207687_10240758 | 3300025927 | Bacteria | 1434 |
| 444 | Ga0207687_10892312 | 3300025927 | Bacteria | 761 |
| 445 | Ga0207644_10015701 | 3300025931 | Bacteria | 5088 |
| 446 | Ga0207644_10033584 | 3300025931 | Bacteria | 3586 |
| 447 | Ga0207644_10082985 | 3300025931 | Bacteria | 2372 |
| 448 | Ga0207644_10442976 | 3300025931 | Bacteria | 1066 |
| 449 | Ga0207644_11062764 | 3300025931 | Bacteria | 680 |
| 450 | Ga0207690_10433682 | 3300025932 | Bacteria | 1053 |
| 451 | Ga0207690_10730292 | 3300025932 | Bacteria | 815 |
| 452 | Ga0207706_10018642 | 3300025933 | Bacteria | 6245 |
| 453 | Ga0207706_10120157 | 3300025933 | Bacteria | 2310 |
| 454 | Ga0207686_10004499 | 3300025934 | Bacteria | 7469 |
| 455 | Ga0207686_10097810 | 3300025934 | Bacteria | 1953 |
| 456 | Ga0207686_10143702 | 3300025934 | Bacteria | 1652 |
| 457 | Ga0207686_10146827 | 3300025934 | Bacteria | 1637 |
| 458 | Ga0207686_10614847 | 3300025934 | Bacteria | 856 |
| 459 | Ga0207709_10002051 | 3300025935 | Bacteria | 13026 |
| 460 | Ga0207709_10008041 | 3300025935 | Bacteria | 5841 |
| 461 | Ga0207709_10073394 | 3300025935 | Bacteria | 2180 |
| 462 | Ga0207670_10002690 | 3300025936 | Bacteria | 9345 |
| 463 | Ga0207670_10116335 | 3300025936 | Bacteria | 1935 |
| 464 | Ga0207670_11395292 | 3300025936 | Bacteria | 595 |
| 465 | Ga0207669_10013598 | 3300025937 | Bacteria | 4049 |
| 466 | Ga0207669_10137492 | 3300025937 | Bacteria | 1690 |
| 467 | Ga0207669_10521039 | 3300025937 | Bacteria | 954 |
| 468 | Ga0207669_10764793 | 3300025937 | Bacteria | 799 |
| 469 | Ga0207669_11117897 | 3300025937 | Bacteria | 666 |
| 470 | Ga0207704_10001158 | 3300025938 | Bacteria | 11736 |
| 471 | Ga0207704_10053094 | 3300025938 | Bacteria | 2461 |
| 472 | Ga0207704_10768208 | 3300025938 | Bacteria | 803 |
| 473 | Ga0207704_10781293 | 3300025938 | Bacteria | 796 |
| 474 | Ga0207704_11280964 | 3300025938 | Bacteria | 626 |
| 475 | Ga0207665_10137755 | 3300025939 | Bacteria | 1738 |
| 476 | Ga0207691_10083518 | 3300025940 | Bacteria | 2867 |
| 477 | Ga0207691_10249421 | 3300025940 | Bacteria | 1533 |
| 478 | Ga0207691_10963779 | 3300025940 | Bacteria | 713 |
| 479 | Ga0207711_10128035 | 3300025941 | Bacteria | 2273 |
| 480 | Ga0207711_10179018 | 3300025941 | Bacteria | 1927 |
| 481 | Ga0207711_11259548 | 3300025941 | Bacteria | 681 |
| 482 | Ga0207689_10001264 | 3300025942 | Bacteria | 24372 |
| 483 | Ga0207689_10048148 | 3300025942 | Bacteria | 3516 |
| 484 | Ga0207689_10079396 | 3300025942 | Bacteria | 2697 |
| 485 | Ga0207689_10270416 | 3300025942 | Bacteria | 1407 |
| 486 | Ga0207689_10344092 | 3300025942 | Bacteria | 1239 |
| 487 | Ga0207689_11112890 | 3300025942 | Bacteria | 666 |
| 488 | Ga0207679_10552185 | 3300025945 | Bacteria | 1033 |
| 489 | Ga0207679_10569083 | 3300025945 | Bacteria | 1018 |
| 490 | Ga0207679_10709718 | 3300025945 | Bacteria | 913 |
| 491 | Ga0207667_10295894 | 3300025949 | Bacteria | 1654 |
| 492 | Ga0207667_10434636 | 3300025949 | Bacteria | 1335 |
| 493 | Ga0207651_10078914 | 3300025960 | Bacteria | 2363 |
| 494 | Ga0207651_10182372 | 3300025960 | Bacteria | 1666 |
| 495 | Ga0207651_10462292 | 3300025960 | Bacteria | 1090 |
| 496 | Ga0207712_10114397 | 3300025961 | Bacteria | 2029 |
| 497 | Ga0207712_10152538 | 3300025961 | Bacteria | 1786 |
| 498 | Ga0207712_10315739 | 3300025961 | Bacteria | 1287 |
| 499 | Ga0207712_10951280 | 3300025961 | Bacteria | 761 |
| 500 | Ga0207668_10354122 | 3300025972 | Bacteria | 1228 |
| 501 | Ga0207668_11226300 | 3300025972 | Bacteria | 674 |
| 502 | Ga0207640_10061774 | 3300025981 | Bacteria | 2483 |
| 503 | Ga0207640_10134548 | 3300025981 | Bacteria | 1792 |
| 504 | Ga0207658_10004811 | 3300025986 | Bacteria | 9339 |
| 505 | Ga0207658_10232678 | 3300025986 | Bacteria | 1556 |
| 506 | Ga0207658_10333230 | 3300025986 | Bacteria | 1317 |
| 507 | Ga0207658_10390154 | 3300025986 | Bacteria | 1221 |
| 508 | Ga0207658_10480332 | 3300025986 | Bacteria | 1104 |
| 509 | Ga0207658_10791567 | 3300025986 | Bacteria | 860 |
| 510 | Ga0207677_10008704 | 3300026023 | Bacteria | 5682 |
| 511 | Ga0207677_10037952 | 3300026023 | Bacteria | 3153 |
| 512 | Ga0207677_10082026 | 3300026023 | Bacteria | 2316 |
| 513 | Ga0207677_10200638 | 3300026023 | Bacteria | 1585 |
| 514 | Ga0207677_10311169 | 3300026023 | Bacteria | 1305 |
| 515 | Ga0207677_10376671 | 3300026023 | Bacteria | 1197 |
| 516 | Ga0207677_10862374 | 3300026023 | Bacteria | 814 |
| 517 | Ga0207703_10003431 | 3300026035 | Bacteria | 13308 |
| 518 | Ga0207703_10024821 | 3300026035 | Bacteria | 4716 |
| 519 | Ga0207703_10104125 | 3300026035 | Bacteria | 2410 |
| 520 | Ga0207703_10351563 | 3300026035 | Bacteria | 1357 |
| 521 | Ga0207703_10374934 | 3300026035 | Bacteria | 1315 |
| 522 | Ga0207703_10551746 | 3300026035 | Bacteria | 1087 |
| 523 | Ga0207703_10742300 | 3300026035 | Bacteria | 935 |
| 524 | Ga0207639_10083964 | 3300026041 | Bacteria | 2529 |
| 525 | Ga0207639_10305531 | 3300026041 | Bacteria | 1407 |
| 526 | Ga0207639_10396423 | 3300026041 | Bacteria | 1243 |
| 527 | Ga0207639_11368618 | 3300026041 | Bacteria | 664 |
| 528 | Ga0207678_10157281 | 3300026067 | Bacteria | 1941 |
| 529 | Ga0207678_10888986 | 3300026067 | Bacteria | 788 |
| 530 | Ga0207708_10000058 | 3300026075 | Bacteria | 95656 |
| 531 | Ga0207708_10003747 | 3300026075 | Bacteria | 11205 |
| 532 | Ga0207708_10014104 | 3300026075 | Bacteria | 5973 |
| 533 | Ga0207708_10233950 | 3300026075 | Bacteria | 1476 |
| 534 | Ga0207702_10114151 | 3300026078 | Bacteria | 2407 |
| 535 | Ga0207702_10437946 | 3300026078 | Bacteria | 1266 |
| 536 | Ga0207641_10027510 | 3300026088 | Bacteria | 4697 |
| 537 | Ga0207641_10041940 | 3300026088 | Bacteria | 3837 |
| 538 | Ga0207641_10065794 | 3300026088 | Bacteria | 3101 |
| 539 | Ga0207648_10000121 | 3300026089 | Bacteria | 76270 |
| 540 | Ga0207648_10022267 | 3300026089 | Bacteria | 5693 |
| 541 | Ga0207648_10045378 | 3300026089 | Bacteria | 3855 |
| 542 | Ga0207648_10047353 | 3300026089 | Bacteria | 3769 |
| 543 | Ga0207648_10152615 | 3300026089 | Bacteria | 2039 |
| 544 | Ga0207648_10355051 | 3300026089 | Bacteria | 1322 |
| 545 | Ga0207648_11029073 | 3300026089 | Bacteria | 772 |
| 546 | Ga0207676_10004330 | 3300026095 | Bacteria | 10043 |
| 547 | Ga0207676_10174580 | 3300026095 | Bacteria | 1875 |
| 548 | Ga0207676_10383007 | 3300026095 | Bacteria | 1310 |
| 549 | Ga0207676_10607058 | 3300026095 | Bacteria | 1051 |
| 550 | Ga0207674_10017885 | 3300026116 | Bacteria | 7726 |
| 551 | Ga0207674_10032949 | 3300026116 | Bacteria | 5429 |
| 552 | Ga0207674_10159973 | 3300026116 | Bacteria | 2206 |
| 553 | Ga0207674_10190465 | 3300026116 | Bacteria | 2001 |
| 554 | Ga0207674_10373084 | 3300026116 | Bacteria | 1379 |
| 555 | Ga0207674_11473613 | 3300026116 | Bacteria | 650 |
| 556 | Ga0207675_100000143 | 3300026118 | Bacteria | 61743 |
| 557 | Ga0207675_100056721 | 3300026118 | Bacteria | 3653 |
| 558 | Ga0207683_10005276 | 3300026121 | Bacteria | 11091 |
| 559 | Ga0207683_10017452 | 3300026121 | Bacteria | 6117 |
| 560 | Ga0207683_10077218 | 3300026121 | Bacteria | 2949 |
| 561 | Ga0207683_10154661 | 3300026121 | Bacteria | 2071 |
| 562 | Ga0207683_11697753 | 3300026121 | Bacteria | 581 |
| 563 | Ga0207698_11021245 | 3300026142 | Bacteria | 838 |
| 564 | Ga0209969_1004655 | 3300027360 | Bacteria | 1919 |
| 565 | Ga0209981_1012313 | 3300027378 | Bacteria | 1184 |
| 566 | Ga0210000_1003423 | 3300027462 | Bacteria | 2288 |
| 567 | Ga0209995_1023439 | 3300027471 | Bacteria | 1026 |
| 568 | Ga0209968_1000406 | 3300027526 | Bacteria | 7034 |
| 569 | Ga0209968_1034862 | 3300027526 | Bacteria | 849 |
| 570 | Ga0209999_1023090 | 3300027543 | Bacteria | 1146 |
| 571 | Ga0209983_1014750 | 3300027665 | Bacteria | 1611 |
| 572 | Ga0209588_1249969 | 3300027671 | Bacteria | 542 |
| 573 | Ga0209971_1003770 | 3300027682 | Bacteria | 3584 |
| 574 | Ga0209971_1006480 | 3300027682 | Bacteria | 2768 |
| 575 | Ga0209971_1113183 | 3300027682 | Bacteria | 666 |
| 576 | Ga0209966_1001477 | 3300027695 | Bacteria | 4080 |
| 577 | Ga0209998_10029342 | 3300027717 | Bacteria | 1213 |
| 578 | Ga0209813_10010978 | 3300027866 | Bacteria | 2356 |
| 579 | Ga0209813_10084932 | 3300027866 | Bacteria | 1053 |
| 580 | Ga0207428_10173137 | 3300027907 | Bacteria | 1634 |
| 581 | Ga0207428_10284778 | 3300027907 | Bacteria | 1226 |
| 582 | Ga0207428_10561317 | 3300027907 | Bacteria | 825 |
| 583 | Ga0268266_10021482 | 3300028379 | Bacteria | 5498 |
| 584 | Ga0268266_10054582 | 3300028379 | Bacteria | 3433 |
| 585 | Ga0268266_10346642 | 3300028379 | Bacteria | 1395 |
| 586 | Ga0268265_10025116 | 3300028380 | Bacteria | 4224 |
| 587 | Ga0268265_10036789 | 3300028380 | Bacteria | 3588 |
| 588 | Ga0268264_10011923 | 3300028381 | Bacteria | 7160 |
| 589 | Ga0268264_10046608 | 3300028381 | Bacteria | 3601 |
| 590 | Ga0268264_10094702 | 3300028381 | Bacteria | 2582 |
| 591 | Ga0268264_10665234 | 3300028381 | Bacteria | 1032 |
| 592 | Ga0268264_11013529 | 3300028381 | Bacteria | 837 |
| 593 | Ga0265318_10060093 | 3300028577 | Bacteria | 1417 |
| 594 | Ga0265318_10274901 | 3300028577 | Bacteria | 614 |
| 595 | Ga0265322_10108869 | 3300028654 | Bacteria | 788 |
| 596 | Ga0307517_10000499 | 3300028786 | Bacteria | 67326 |
| 597 | Ga0307517_10053917 | 3300028786 | Bacteria | 3992 |
| 598 | Ga0307515_10017831 | 3300028794 | Bacteria | 12902 |
| 599 | Ga0307515_10061230 | 3300028794 | Bacteria | 5345 |
| 600 | Ga0307515_10303092 | 3300028794 | Bacteria | 1281 |
| 601 | Ga0307515_10344822 | 3300028794 | Bacteria | 1139 |
| 602 | Ga0307515_10409468 | 3300028794 | Bacteria | 979 |
| 603 | Ga0265338_10106841 | 3300028800 | Bacteria | 2265 |
| 604 | Ga0265324_10003482 | 3300029957 | Bacteria | 7459 |
| 605 | Ga0307511_10000471 | 3300030521 | Bacteria | 43590 |
| 606 | Ga0307512_10113943 | 3300030522 | Bacteria | 1767 |
| 607 | Ga0265330_10008863 | 3300031235 | Bacteria | 4812 |
| 608 | Ga0265332_10012224 | 3300031238 | Bacteria | 3809 |
| 609 | Ga0265328_10000016 | 3300031239 | Bacteria | 132959 |
| 610 | Ga0265328_10003721 | 3300031239 | Bacteria | 6725 |
| 611 | Ga0265325_10054431 | 3300031241 | Bacteria | 2048 |
| 612 | Ga0265325_10441900 | 3300031241 | Bacteria | 567 |
| 613 | Ga0265329_10005212 | 3300031242 | Bacteria | 5284 |
| 614 | Ga0265339_10119949 | 3300031249 | Bacteria | 1353 |
| 615 | Ga0265331_10003027 | 3300031250 | Bacteria | 11025 |
| 616 | Ga0265331_10074353 | 3300031250 | Bacteria | 1586 |
| 617 | Ga0265331_10127325 | 3300031250 | Bacteria | 1163 |
| 618 | Ga0265331_10525456 | 3300031250 | Bacteria | 533 |
| 619 | Ga0265327_10000103 | 3300031251 | Bacteria | 185405 |
| 620 | Ga0265327_10031534 | 3300031251 | Bacteria | 2976 |
| 621 | Ga0265327_10107029 | 3300031251 | Bacteria | 1341 |
| 622 | Ga0265327_10108325 | 3300031251 | Bacteria | 1331 |
| 623 | Ga0265316_10036177 | 3300031344 | Bacteria | 3993 |
| 624 | Ga0265316_10115550 | 3300031344 | Bacteria | 2029 |
| 625 | Ga0265316_10533534 | 3300031344 | Bacteria | 836 |
| 626 | Ga0307513_10021752 | 3300031456 | Bacteria | 7565 |
| 627 | Ga0307513_10302643 | 3300031456 | Bacteria | 1365 |
| 628 | Ga0307509_10000032 | 3300031507 | Bacteria | 202919 |
| 629 | Ga0307509_10002631 | 3300031507 | Bacteria | 28728 |
| 630 | Ga0307509_10004339 | 3300031507 | Bacteria | 20572 |
| 631 | Ga0307509_10012369 | 3300031507 | Bacteria | 10215 |
| 632 | Ga0307509_10027391 | 3300031507 | Bacteria | 6341 |
| 633 | Ga0307509_10066960 | 3300031507 | Bacteria | 3765 |
| 634 | Ga0307509_10176895 | 3300031507 | Bacteria | 2005 |
| 635 | Ga0307408_100498340 | 3300031548 | Bacteria | 1066 |
| 636 | Ga0307408_100659709 | 3300031548 | Bacteria | 936 |
| 637 | Ga0307408_101164982 | 3300031548 | Bacteria | 718 |
| 638 | Ga0307508_10017553 | 3300031616 | Bacteria | 6505 |
| 639 | Ga0307508_10107934 | 3300031616 | Bacteria | 2383 |
| 640 | Ga0307508_10165511 | 3300031616 | Bacteria | 1814 |
| 641 | Ga0307508_10207068 | 3300031616 | Bacteria | 1562 |
| 642 | Ga0307514_10016794 | 3300031649 | Bacteria | 6026 |
| 643 | Ga0307514_10018499 | 3300031649 | Bacteria | 5712 |
| 644 | Ga0307514_10432961 | 3300031649 | Bacteria | 655 |
| 645 | Ga0316575_10000232 | 3300031665 | Bacteria | 14984 |
| 646 | Ga0316575_10004541 | 3300031665 | Bacteria | 4887 |
| 647 | Ga0265314_10005881 | 3300031711 | Bacteria | 10980 |
| 648 | Ga0265314_10011856 | 3300031711 | Bacteria | 7160 |
| 649 | Ga0307516_10195244 | 3300031730 | Bacteria | 1747 |
| 650 | Ga0307516_10261674 | 3300031730 | Bacteria | 1420 |
| 651 | Ga0307413_10178539 | 3300031824 | Bacteria | 1511 |
| 652 | Ga0307412_10533678 | 3300031911 | Bacteria | 982 |
| 653 | Ga0307412_10791382 | 3300031911 | Bacteria | 822 |
| 654 | Ga0307412_11069507 | 3300031911 | Bacteria | 716 |
| 655 | Ga0307412_11410542 | 3300031911 | Bacteria | 631 |
| 656 | Ga0307416_100562644 | 3300032002 | Bacteria | 1215 |
| 657 | Ga0307416_103535146 | 3300032002 | Bacteria | 523 |
| 658 | Ga0307411_10368588 | 3300032005 | Bacteria | 1177 |
| 659 | Ga0307411_10481583 | 3300032005 | Bacteria | 1045 |
| 660 | Ga0307411_11356154 | 3300032005 | Bacteria | 649 |
| 661 | Ga0307411_11692783 | 3300032005 | Bacteria | 585 |
| 662 | Ga0307415_100084635 | 3300032126 | Bacteria | 2276 |
| 663 | Ga0307415_100433084 | 3300032126 | Bacteria | 1132 |
| 664 | Ga0307507_10054152 | 3300033179 | Bacteria | 3822 |
| 665 | Ga0307507_10102485 | 3300033179 | Bacteria | 2387 |
| 666 | Ga0307510_10002130 | 3300033180 | Bacteria | 22354 |
| 667 | Ga0307510_10091238 | 3300033180 | Bacteria | 2889 |
| 668 | Ga0307510_10115814 | 3300033180 | Bacteria | 2403 |
| 669 | Ga0307510_10304281 | 3300033180 | Bacteria | 1055 |
| 670 | Ga0373958_0022583 | 3300034819 | Bacteria | 1177 |
| 671 | Ga0373959_0008650 | 3300034820 | Bacteria | 1738 |
| 672 | Ga0373926_0104689 | 3300035083 | Bacteria | 1060 |
| 673 | Ga0373926_0267077 | 3300035083 | Bacteria | 665 |
| 674 | Ga0373928_0124931 | 3300035084 | Bacteria | 693 |
| 675 | Ga0373929_0222344 | 3300035085 | Bacteria | 537 |
| 676 | Ga0373934_0000098 | 3300035086 | Bacteria | 30518 |
| 677 | Ga0373940_0001620 | 3300035088 | Bacteria | 4132 |
| 678 | Ga0373949_0015829 | 3300035090 | Bacteria | 1688 |
| 679 | Ga0373952_0009088 | 3300035092 | Bacteria | 1895 |
| 680 | Ga0373923_0179065 | 3300035111 | Bacteria | 973 |
| 681 | Ga0373923_0684716 | 3300035111 | Bacteria | 508 |
| 682 | Ga0373936_0028084 | 3300035113 | Bacteria | 2210 |
| 683 | Ga0373936_0496120 | 3300035113 | Bacteria | 567 |
| 684 | Ga0373939_0000016 | 3300035114 | Bacteria | 62934 |
| 685 | Ga0373939_0044187 | 3300035114 | Bacteria | 1355 |
| 686 | Ga0373953_0013828 | 3300035117 | Bacteria | 2890 |
| 687 | Ga0373954_0000709 | 3300035118 | Bacteria | 12806 |
| 688 | Ga0373954_0377376 | 3300035118 | Bacteria | 700 |
| 689 | Ga0373956_0005111 | 3300035119 | Bacteria | 5250 |
| 690 | Ga0373956_0332865 | 3300035119 | Bacteria | 724 |
| 691 | Ga0373957_0020547 | 3300035120 | Bacteria | 2334 |
| 692 | Ga0373957_0083602 | 3300035120 | Bacteria | 1262 |
| 693 | Ga0373957_0433884 | 3300035120 | Bacteria | 568 |
| 694 | Ga0373943_0631110 | 3300035170 | Bacteria | 632 |
| 695 | Ga0373955_0020139 | 3300035172 | Bacteria | 3349 |
| 696 | Ga0373955_0210377 | 3300035172 | Bacteria | 1159 |
| 697 | Ga0373955_0454025 | 3300035172 | Bacteria | 781 |
| 698 | Ga0373955_0562875 | 3300035172 | Bacteria | 697 |
| 699 | Ga0373924_0285380 | 3300035410 | Bacteria | 732 |
| 700 | Ga0373924_0351309 | 3300035410 | Bacteria | 657 |
| 701 | Ga0373931_0088685 | 3300035691 | Bacteria | 1720 |
| 702 | Ga0373931_0279802 | 3300035691 | Bacteria | 1024 |
| 703 | Ga0373931_0284222 | 3300035691 | Bacteria | 1017 |
| 704 | Ga0373931_0356269 | 3300035691 | Bacteria | 917 |
| 705 | Ga0373931_0427323 | 3300035691 | Bacteria | 843 |
| 706 | Ga0373931_0628411 | 3300035691 | Bacteria | 704 |
| 707 | Ga0373927_0006664 | 3300035695 | Bacteria | 7858 |
| 708 | Ga0373927_0017581 | 3300035695 | Bacteria | 4705 |
| 709 | Ga0373927_0029470 | 3300035695 | Bacteria | 3578 |
| 710 | Ga0373927_0126277 | 3300035695 | Bacteria | 1670 |
| 711 | Ga0373927_0286590 | 3300035695 | Bacteria | 1084 |
| 712 | Ga0373927_0306202 | 3300035695 | Bacteria | 1046 |
| 713 | Ga0373933_0003854 | 3300035724 | Bacteria | 8273 |
| 714 | Ga0373933_0040367 | 3300035724 | Bacteria | 2750 |
| 715 | Ga0373933_0055759 | 3300035724 | Bacteria | 2371 |
| 716 | Ga0373933_0120830 | 3300035724 | Bacteria | 1640 |
| 717 | Ga0373947_0310063 | 3300035725 | Bacteria | 1054 |
| 718 | Ga0373947_0644544 | 3300035725 | Bacteria | 722 |
| 719 | Ga0373947_0765299 | 3300035725 | Bacteria | 659 |
| 720 | Ga0373937_0001120 | 3300036401 | Bacteria | 22587 |
| 721 | Ga0373937_0026386 | 3300036401 | Bacteria | 5251 |
| 722 | Ga0373937_0174583 | 3300036401 | Bacteria | 2017 |
| 723 | Ga0373937_0253324 | 3300036401 | Bacteria | 1659 |
| 724 | Ga0373937_0509471 | 3300036401 | Bacteria | 1143 |
| 725 | Ga0373937_0701317 | 3300036401 | Bacteria | 959 |
| 726 | Ga0373937_1010088 | 3300036401 | Bacteria | 780 |
| 727 | Ga0373937_1138148 | 3300036401 | Bacteria | 729 |
| 728 | Ga0373937_1587594 | 3300036401 | Bacteria | 601 |
| 729 | Ga0316582_0039871 | 3300036647 | Bacteria | 2927 |
| 730 | Ga0373925_0010477 | 3300037068 | Bacteria | 6723 |
| 731 | Ga0373925_0173865 | 3300037068 | Bacteria | 1701 |
| 732 | Ga0373925_0412140 | 3300037068 | Bacteria | 1103 |
| 733 | Ga0373925_0974648 | 3300037068 | Bacteria | 698 |
| 734 | Ga0373925_1267539 | 3300037068 | Bacteria | 605 |
| 735 | Ga0373925_1313559 | 3300037068 | Bacteria | 593 |
| 736 | Ga0395901_1034950 | 3300038443 | Bacteria | 795 |
| 737 | Ga0400490_23584 | 3300038726 | Bacteria | 23428 |
| 738 | Ga0436365_0539896 | 3300039437 | Bacteria | 2533 |
| 739 | Ga0436365_1535422 | 3300039437 | Bacteria | 562 |
| 740 | Ga0439439_0210289 | 3300041406 | Bacteria | 568 |
| 741 | Ga0451804_0289310 | 3300041463 | Bacteria | 583 |
| 742 | Ga0451841_0212508 | 3300041498 | Bacteria | 604 |
| 743 | Ga0451853_1110049 | 3300041512 | Bacteria | 710 |
| 744 | Ga0439431_0050391 | 3300041997 | Bacteria | 1078 |
| 745 | Ga0439441_077141 | 3300042001 | Bacteria | 721 |
| 746 | Ga0439443_044163 | 3300042003 | Bacteria | 767 |
| 747 | Ga0439462_0158563 | 3300042015 | Bacteria | 638 |
| 748 | Ga0450888_014470 | 3300042126 | Bacteria | 955 |
| 749 | Ga0450898_008229 | 3300042134 | Bacteria | 1641 |
| 750 | Ga0439446_0309148 | 3300042156 | Bacteria | 556 |
| 751 | Ga0439435_0199154 | 3300042436 | Bacteria | 660 |
| 752 | Ga0439460_0288402 | 3300042461 | Bacteria | 572 |
| 753 | Ga0451577_0000013 | 3300042876 | Bacteria | 550689 |
| 754 | Ga0451577_0001260 | 3300042876 | Bacteria | 35013 |
| 755 | Ga0451577_0002627 | 3300042876 | Bacteria | 21052 |
| 756 | Ga0451577_0006351 | 3300042876 | Bacteria | 11803 |
| 757 | Ga0451577_0049289 | 3300042876 | Bacteria | 3761 |
| 758 | Ga0451577_0085704 | 3300042876 | Bacteria | 2811 |
| 759 | Ga0451577_0349496 | 3300042876 | Bacteria | 1341 |
| 760 | Ga0451577_0365696 | 3300042876 | Bacteria | 1308 |
| 761 | Ga0451577_0394603 | 3300042876 | Bacteria | 1256 |
| 762 | Ga0451577_0680984 | 3300042876 | Bacteria | 932 |
| 763 | Ga0453683_0000033 | 3300044673 | Bacteria | 241479 |
| 764 | Ga0453683_0029419 | 3300044673 | Bacteria | 3473 |
| 765 | Ga0453683_0806786 | 3300044673 | Bacteria | 618 |
| 766 | Ga0453684_0000014 | 3300044712 | Bacteria | 993311 |
| 767 | Ga0453684_0000029 | 3300044712 | Bacteria | 757969 |
| 768 | Ga0453684_0000085 | 3300044712 | Bacteria | 397817 |
| 769 | Ga0453684_0000142 | 3300044712 | Bacteria | 316405 |
| 770 | Ga0453684_0007704 | 3300044712 | Bacteria | 19673 |
| 771 | Ga0453684_0021042 | 3300044712 | Bacteria | 9780 |
| 772 | Ga0453684_0079145 | 3300044712 | Bacteria | 4109 |
| 773 | Ga0453684_0095901 | 3300044712 | Bacteria | 3645 |
| 774 | Ga0453684_0302414 | 3300044712 | Bacteria | 1818 |
| 775 | Ga0453684_1281363 | 3300044712 | Bacteria | 765 |
| 776 | Ga0453684_1356964 | 3300044712 | Bacteria | 739 |
| 777 | Ga0451576_0000018 | 3300045051 | Bacteria | 550689 |
| 778 | Ga0451576_0000272 | 3300045051 | Bacteria | 126530 |
| 779 | Ga0451576_0006043 | 3300045051 | Bacteria | 14946 |
| 780 | Ga0451576_0014372 | 3300045051 | Bacteria | 8815 |
| 781 | Ga0451576_0024032 | 3300045051 | Bacteria | 6587 |
| 782 | Ga0451576_0070029 | 3300045051 | Bacteria | 3650 |
| 783 | Ga0451576_0092509 | 3300045051 | Bacteria | 3146 |
| 784 | Ga0451576_0226688 | 3300045051 | Bacteria | 1951 |
| 785 | Ga0451576_1214693 | 3300045051 | Bacteria | 787 |
| 786 | Ga0495592_0000237 | 3300046454 | Bacteria | 47510 |
| 787 | Ga0495603_0343118 | 3300046455 | Bacteria | 857 |
| 788 | Ga0495590_0055228 | 3300046457 | Bacteria | 1388 |
| 789 | Ga0495629_0440426 | 3300046459 | Bacteria | 883 |
| 790 | Ga0495629_0486510 | 3300046459 | Bacteria | 833 |
| 791 | Ga0495641_0042268 | 3300046461 | Bacteria | 2113 |
| 792 | Ga0495641_0069493 | 3300046461 | Bacteria | 1583 |
| 793 | Ga0495651_0000147 | 3300046462 | Bacteria | 51361 |
| 794 | Ga0495653_0666112 | 3300046463 | Bacteria | 634 |
| 795 | Ga0495653_0784174 | 3300046463 | Bacteria | 574 |
| 796 | Ga0495580_0055683 | 3300046472 | Bacteria | 2786 |
| 797 | Ga0495580_0201885 | 3300046472 | Bacteria | 1369 |
| 798 | Ga0495605_0054917 | 3300046474 | Bacteria | 1927 |
| 799 | Ga0495662_0016895 | 3300046476 | Bacteria | 3531 |
| 800 | Ga0495664_0496524 | 3300046477 | Bacteria | 729 |
| 801 | Ga0495594_0217236 | 3300046499 | Bacteria | 1090 |
| 802 | Ga0495606_0212192 | 3300046507 | Bacteria | 1096 |
| 803 | Ga0495608_0035567 | 3300046511 | Bacteria | 3358 |
| 804 | Ga0495610_0226611 | 3300046512 | Bacteria | 752 |
| 805 | Ga0495610_0240316 | 3300046512 | Bacteria | 722 |
| 806 | Ga0495618_0124682 | 3300046514 | Bacteria | 1649 |
| 807 | Ga0495618_0773400 | 3300046514 | Bacteria | 560 |
| 808 | Ga0495628_0031067 | 3300046516 | Bacteria | 4320 |
| 809 | Ga0495630_0035969 | 3300046517 | Bacteria | 3702 |
| 810 | Ga0495630_0050983 | 3300046517 | Bacteria | 3096 |
| 811 | Ga0495631_0130716 | 3300046518 | Bacteria | 1079 |
| 812 | Ga0495632_0005889 | 3300046519 | Bacteria | 8002 |
| 813 | Ga0495648_0193333 | 3300046524 | Bacteria | 1025 |
| 814 | Ga0495648_0267512 | 3300046524 | Bacteria | 817 |
| 815 | Ga0495663_0170056 | 3300046525 | Bacteria | 751 |
| 816 | Ga0495666_0035252 | 3300046526 | Bacteria | 2440 |
| 817 | Ga0495666_0293873 | 3300046526 | Bacteria | 735 |
| 818 | Ga0495652_0093413 | 3300046529 | Bacteria | 2456 |
| 819 | Ga0495654_0233960 | 3300046530 | Bacteria | 772 |
| 820 | Ga0495640_0022395 | 3300046533 | Bacteria | 4618 |
| 821 | Ga0495640_0815346 | 3300046533 | Bacteria | 556 |
| 822 | Ga0495586_0200934 | 3300046535 | Bacteria | 1130 |
| 823 | Ga0495586_0294447 | 3300046535 | Bacteria | 929 |
| 824 | Ga0495587_0028734 | 3300046536 | Bacteria | 3379 |
| 825 | Ga0495587_0644233 | 3300046536 | Bacteria | 582 |
| 826 | Ga0495598_0009508 | 3300046537 | Bacteria | 2301 |
| 827 | Ga0495621_0072434 | 3300046539 | Bacteria | 1272 |
| 828 | Ga0495597_0021547 | 3300046542 | Bacteria | 2995 |
| 829 | Ga0495645_0041638 | 3300046543 | Bacteria | 3349 |
| 830 | Ga0495622_0305429 | 3300046557 | Bacteria | 693 |
| 831 | Ga0495622_0393882 | 3300046557 | Bacteria | 597 |
| 832 | Ga0495667_0048876 | 3300046559 | Bacteria | 2793 |
| 833 | Ga0495656_0439470 | 3300046615 | Bacteria | 686 |
| 834 | Ga0495668_0070343 | 3300046616 | Bacteria | 1924 |
| 835 | Ga0495668_0142214 | 3300046616 | Bacteria | 1313 |
| 836 | Ga0495634_0094564 | 3300046642 | Bacteria | 1936 |
| 837 | Ga0495611_0470180 | 3300046648 | Bacteria | 572 |
| 838 | Ga0495625_0061838 | 3300046660 | Bacteria | 2648 |
| 839 | Ga0495625_0326347 | 3300046660 | Bacteria | 976 |
| 840 | Ga0495635_0282900 | 3300046663 | Bacteria | 1114 |
| 841 | Ga0495659_0199677 | 3300046664 | Bacteria | 820 |
| 842 | Ga0495657_0050053 | 3300046675 | Bacteria | 2811 |
| 843 | Ga0495657_0312372 | 3300046675 | Bacteria | 935 |
| 844 | Ga0495599_0046691 | 3300046678 | Bacteria | 2715 |
| 845 | Ga0495646_0433929 | 3300046680 | Bacteria | 680 |
| 846 | Ga0495647_0096873 | 3300046681 | Bacteria | 1217 |
| 847 | Ga0495658_0020747 | 3300046683 | Bacteria | 3454 |
| 848 | Ga0495658_0145953 | 3300046683 | Bacteria | 1450 |
| 849 | Ga0495658_0223988 | 3300046683 | Bacteria | 1178 |
| 850 | Ga0495658_0687886 | 3300046683 | Bacteria | 655 |
| 851 | Ga0495658_0715353 | 3300046683 | Bacteria | 641 |
| 852 | Ga0495669_0043302 | 3300046684 | Bacteria | 2004 |
| 853 | Ga0495669_0105898 | 3300046684 | Bacteria | 1310 |
| 854 | Ga0495613_0219996 | 3300046689 | Bacteria | 1333 |
| 855 | Ga0495613_0621769 | 3300046689 | Bacteria | 717 |
| 856 | Ga0495624_0097345 | 3300046690 | Bacteria | 1813 |
| 857 | Ga0495624_0109110 | 3300046690 | Bacteria | 1702 |
| 858 | Ga0495649_0013283 | 3300046694 | Bacteria | 4755 |
| 859 | Ga0495649_0376384 | 3300046694 | Bacteria | 715 |
| 860 | Ga0495600_0263413 | 3300046809 | Bacteria | 1094 |
| 861 | Ga0495660_0045027 | 3300046810 | Bacteria | 2424 |
| 862 | Ga0495604_0041161 | 3300047317 | Bacteria | 3624 |
| 863 | Ga0495604_0397293 | 3300047317 | Bacteria | 908 |
| 864 | Ga0495636_0338502 | 3300047318 | Bacteria | 709 |
| 865 | Ga0495674_0058682 | 3300047319 | Bacteria | 3363 |
| 866 | Ga0495676_0508029 | 3300047321 | Bacteria | 790 |
| 867 | Ga0495680_0167626 | 3300047322 | Bacteria | 1591 |
| 868 | Ga0495680_0232929 | 3300047322 | Bacteria | 1311 |
| 869 | Ga0495687_001087 | 3300047443 | Bacteria | 26673 |
| 870 | Ga0495687_024124 | 3300047443 | Bacteria | 2895 |
| 871 | Ga0495675_0208964 | 3300047444 | Bacteria | 1186 |
| 872 | Ga0495679_217375 | 3300047446 | Bacteria | 500 |
| 873 | Ga0495684_0089261 | 3300047471 | Bacteria | 2335 |
| 874 | Ga0495686_0077805 | 3300047472 | Bacteria | 2031 |
| 875 | Ga0495626_0127504 | 3300048091 | Bacteria | 1089 |
| 876 | Ga0495626_0407002 | 3300048091 | Bacteria | 525 |
| 877 | Ga0496100_0348445 | 3300048903 | Bacteria | 1118 |
| 878 | Ga0496102_0279006 | 3300048905 | Bacteria | 1575 |
| 879 | Ga0496102_1437573 | 3300048905 | Bacteria | 608 |
| 880 | Ga0496104_0030414 | 3300048907 | Bacteria | 5018 |
| 881 | Ga0496104_0868068 | 3300048907 | Bacteria | 808 |
| 882 | Ga0496104_0950704 | 3300048907 | Bacteria | 764 |
| 883 | Ga0496105_0416810 | 3300048908 | Bacteria | 1064 |
| 884 | Ga0496106_0298400 | 3300048909 | Bacteria | 1292 |
| 885 | Ga0496106_0366866 | 3300048909 | Bacteria | 1157 |
| 886 | Ga0496107_0431665 | 3300048910 | Bacteria | 979 |
| 887 | Ga0496108_0112206 | 3300048911 | Bacteria | 2332 |
| 888 | Ga0496108_0222856 | 3300048911 | Bacteria | 1639 |
| 889 | Ga0496109_0074233 | 3300048912 | Bacteria | 3126 |
| 890 | Ga0496109_0121010 | 3300048912 | Bacteria | 2439 |
| 891 | Ga0496109_0170274 | 3300048912 | Bacteria | 2043 |
| 892 | Ga0496110_0080300 | 3300048913 | Bacteria | 2906 |
| 893 | Ga0496110_0324001 | 3300048913 | Bacteria | 1404 |
| 894 | Ga0496112_0003758 | 3300048915 | Bacteria | 12678 |
| 895 | Ga0496112_0677138 | 3300048915 | Bacteria | 960 |
| 896 | Ga0496112_1044568 | 3300048915 | Bacteria | 736 |
| 897 | Ga0496113_0008289 | 3300048916 | Bacteria | 6763 |
| 898 | Ga0496114_0283883 | 3300048917 | Bacteria | 1460 |
| 899 | Ga0496121_0349519 | 3300048924 | Bacteria | 985 |
| 900 | Ga0495682_0081502 | 3300049460 | Bacteria | 1164 |
| 901 | Ga0501295_077350 | 3300049518 | Bacteria | 752 |
| 902 | Ga0501297_010513 | 3300049520 | Bacteria | 1049 |
| 903 | Ga0501299_138030 | 3300049522 | Bacteria | 604 |
| 904 | Ga0501032_0001187 | 3300049569 | Bacteria | 20871 |
| 905 | Ga0501032_0125317 | 3300049569 | Bacteria | 1697 |
| 906 | Ga0501034_0000736 | 3300049571 | Bacteria | 49477 |
| 907 | Ga0501034_0011390 | 3300049571 | Bacteria | 9223 |
| 908 | Ga0501036_0011409 | 3300049572 | Bacteria | 7355 |
| 909 | Ga0501036_0110733 | 3300049572 | Bacteria | 2320 |
| 910 | Ga0501036_0127730 | 3300049572 | Bacteria | 2147 |
| 911 | Ga0501036_0329443 | 3300049572 | Bacteria | 1276 |
| 912 | Ga0501036_0826978 | 3300049572 | Bacteria | 762 |
| 913 | Ga0501037_0122253 | 3300049573 | Bacteria | 1871 |
| 914 | Ga0501037_0207585 | 3300049573 | Bacteria | 1382 |
| 915 | Ga0501038_0003601 | 3300049574 | Bacteria | 14420 |
| 916 | Ga0501038_0774885 | 3300049574 | Bacteria | 714 |
| 917 | Ga0501038_0928465 | 3300049574 | Bacteria | 641 |
| 918 | Ga0501039_0013815 | 3300049575 | Bacteria | 6177 |
| 919 | Ga0501039_0041288 | 3300049575 | Bacteria | 3562 |
| 920 | Ga0501039_0318992 | 3300049575 | Bacteria | 1222 |
| 921 | Ga0501039_0925098 | 3300049575 | Bacteria | 678 |
| 922 | Ga0501039_1397368 | 3300049575 | Bacteria | 539 |
| 923 | Ga0501040_0050613 | 3300049576 | Bacteria | 2842 |
| 924 | Ga0501040_0057294 | 3300049576 | Bacteria | 2675 |
| 925 | Ga0501040_0192097 | 3300049576 | Bacteria | 1449 |
| 926 | Ga0501041_0011932 | 3300049577 | Bacteria | 5145 |
| 927 | Ga0501041_0230361 | 3300049577 | Bacteria | 1163 |
| 928 | Ga0501042_0003342 | 3300049578 | Bacteria | 10056 |
| 929 | Ga0501042_1439924 | 3300049578 | Bacteria | 503 |
| 930 | Ga0501043_0184695 | 3300049579 | Bacteria | 1624 |
| 931 | Ga0501043_0199465 | 3300049579 | Bacteria | 1554 |
| 932 | Ga0501043_0313675 | 3300049579 | Bacteria | 1196 |
| 933 | Ga0501046_0014667 | 3300049580 | Bacteria | 6600 |
| 934 | Ga0501046_0102177 | 3300049580 | Bacteria | 2198 |
| 935 | Ga0501046_0179953 | 3300049580 | Bacteria | 1582 |
| 936 | Ga0501046_1134039 | 3300049580 | Bacteria | 539 |
| 937 | Ga0501048_0032648 | 3300049582 | Bacteria | 3762 |
| 938 | Ga0501048_0361246 | 3300049582 | Bacteria | 1036 |
| 939 | Ga0501068_0001429 | 3300049584 | Bacteria | 12668 |
| 940 | Ga0501068_0038276 | 3300049584 | Bacteria | 2873 |
| 941 | Ga0501071_0015573 | 3300049587 | Bacteria | 5221 |
| 942 | Ga0501071_0042333 | 3300049587 | Bacteria | 3263 |
| 943 | Ga0501072_0000910 | 3300049588 | Bacteria | 21707 |
| 944 | Ga0501072_0003685 | 3300049588 | Bacteria | 11559 |
| 945 | Ga0501072_0321149 | 3300049588 | Bacteria | 1230 |
| 946 | Ga0501072_0518449 | 3300049588 | Bacteria | 942 |
| 947 | Ga0501073_0004078 | 3300049589 | Bacteria | 10954 |
| 948 | Ga0501073_0463719 | 3300049589 | Bacteria | 876 |
| 949 | Ga0501073_0568955 | 3300049589 | Bacteria | 783 |
| 950 | Ga0501074_0019104 | 3300049590 | Bacteria | 4976 |
| 951 | Ga0501074_0039408 | 3300049590 | Bacteria | 3423 |
| 952 | Ga0501074_0134629 | 3300049590 | Bacteria | 1767 |
| 953 | Ga0501075_0044513 | 3300049591 | Bacteria | 3330 |
| 954 | Ga0501075_0376283 | 3300049591 | Bacteria | 1082 |
| 955 | Ga0501075_0741824 | 3300049591 | Bacteria | 748 |
| 956 | Ga0501075_1463352 | 3300049591 | Bacteria | 517 |
| 957 | Ga0501076_0003023 | 3300049592 | Bacteria | 11684 |
| 958 | Ga0501076_0019677 | 3300049592 | Bacteria | 5162 |
| 959 | Ga0501076_0028780 | 3300049592 | Bacteria | 4317 |
| 960 | Ga0501077_0034211 | 3300049593 | Bacteria | 3234 |
| 961 | Ga0501077_0550627 | 3300049593 | Bacteria | 740 |
| 962 | Ga0501079_0006062 | 3300049741 | Bacteria | 9061 |
| 963 | Ga0501079_0096217 | 3300049741 | Bacteria | 2295 |
| 964 | Ga0501079_0702920 | 3300049741 | Bacteria | 796 |
| 965 | Ga0501080_0001631 | 3300049742 | Bacteria | 19095 |
| 966 | Ga0501080_0006509 | 3300049742 | Bacteria | 10490 |
| 967 | Ga0501080_0018841 | 3300049742 | Bacteria | 6391 |
| 968 | Ga0501080_0152381 | 3300049742 | Bacteria | 2136 |
| 969 | Ga0501080_0924342 | 3300049742 | Bacteria | 759 |
| 970 | Ga0501081_0002314 | 3300049743 | Bacteria | 11993 |
| 971 | Ga0501081_0005048 | 3300049743 | Bacteria | 8497 |
| 972 | Ga0501081_0105029 | 3300049743 | Bacteria | 2001 |
| 973 | Ga0501083_0002703 | 3300049744 | Bacteria | 12234 |
| 974 | Ga0501083_0013468 | 3300049744 | Bacteria | 5716 |
| 975 | Ga0501083_0057518 | 3300049744 | Bacteria | 2603 |
| 976 | Ga0501269_017794 | 3300049766 | Unclassified | 880 |
| 977 | Ga0501035_0274233 | 3300049822 | Bacteria | 1427 |
| 978 | Ga0501045_0000766 | 3300049824 | Bacteria | 20598 |
| 979 | nmdc:mga03683_172376_c1 | 3300050489 | Bacteria | 984 |
| 980 | nmdc:mga03n38_21294_c1 | 3300050490 | Bacteria | 2607 |
| 981 | nmdc:mga03n38_44569_c1 | 3300050490 | Bacteria | 1949 |
| 982 | nmdc:mga00v17_237278_c1 | 3300050491 | Bacteria | 1182 |
| 983 | nmdc:mga00v17_91783_c1 | 3300050491 | Bacteria | 903 |
| 984 | nmdc:mga0yw44_166232_c1 | 3300050492 | Bacteria | 1446 |
| 985 | nmdc:mga0k408_115144_c1 | 3300050493 | Bacteria | 1591 |
| 986 | nmdc:mga0k408_21109_c1 | 3300050493 | Bacteria | 3655 |
| 987 | nmdc:mga0k408_30350_c1 | 3300050493 | Bacteria | 3082 |
| 988 | nmdc:mga0k408_36491_c1 | 3300050493 | Bacteria | 2822 |
| 989 | nmdc:mga0k408_4161_c1 | 3300050493 | Bacteria | 7678 |
| 990 | nmdc:mga0k408_7389_c1 | 3300050493 | Bacteria | 5867 |
| 991 | nmdc:mga06z11_15228_c1 | 3300050494 | Bacteria | 3428 |
| 992 | nmdc:mga06z11_3894_c1 | 3300050494 | Bacteria | 5820 |
| 993 | nmdc:mga04h51_25330_c1 | 3300050495 | Bacteria | 1825 |
| 994 | nmdc:mga04h51_7728_c1 | 3300050495 | Bacteria | 2849 |
| 995 | nmdc:mga04h51_98167_c1 | 3300050495 | Bacteria | 1064 |
| 996 | nmdc:mga07m45_137308_c1 | 3300050496 | Bacteria | 1416 |
| 997 | nmdc:mga07m45_160_c1 | 3300050496 | Bacteria | 27032 |
| 998 | nmdc:mga07m45_1622_c1 | 3300050496 | Bacteria | 10350 |
| 999 | nmdc:mga07m45_42054_c1 | 3300050496 | Bacteria | 2561 |
| 1000 | nmdc:mga07m45_469_c1 | 3300050496 | Bacteria | 16990 |
| 1001 | nmdc:mga07m45_563763_c1 | 3300050496 | Bacteria | 658 |
| 1002 | nmdc:mga07m45_6702_c1 | 3300050496 | Bacteria | 5844 |
| 1003 | nmdc:mga07m45_767994_c1 | 3300050496 | Bacteria | 553 |
| 1004 | nmdc:mga05p37_1235803_c1 | 3300050507 | Bacteria | 768 |
| 1005 | nmdc:mga09592_175962_c1 | 3300050508 | Bacteria | 1851 |
| 1006 | nmdc:mga09592_83767_c1 | 3300050508 | Bacteria | 2718 |
| 1007 | nmdc:mga0qj67_1162468_c1 | 3300050509 | Bacteria | 601 |
| 1008 | nmdc:mga0qj67_517559_c1 | 3300050509 | Bacteria | 958 |
| 1009 | nmdc:mga06r32_20528_c1 | 3300050510 | Bacteria | 6083 |
| 1010 | nmdc:mga08y16_2162484_c1 | 3300050511 | Bacteria | 503 |
| 1011 | nmdc:mga08y16_533089_c1 | 3300050511 | Bacteria | 1190 |
| 1012 | nmdc:mga08y16_8908_c1 | 3300050511 | Bacteria | 10536 |
| 1013 | nmdc:mga0n895_689277_c1 | 3300050512 | Bacteria | 1018 |
| 1014 | nmdc:mga0rr50_1477348_c1 | 3300050513 | Bacteria | 575 |
| 1015 | nmdc:mga08x19_141793_c1 | 3300050514 | Bacteria | 1623 |
| 1016 | nmdc:mga08x19_224583_c1 | 3300050514 | Bacteria | 1291 |
| 1017 | nmdc:mga08x19_37590_c1 | 3300050514 | Bacteria | 3073 |
| 1018 | nmdc:mga0a205_1108433_c1 | 3300050515 | Bacteria | 639 |
| 1019 | nmdc:mga0a205_451421_c1 | 3300050515 | Bacteria | 1145 |
| 1020 | nmdc:mga0a205_529402_c1 | 3300050515 | Bacteria | 1034 |
| 1021 | nmdc:mga0sz30_2878_c1 | 3300050516 | Bacteria | 6154 |
| 1022 | nmdc:mga0sz30_51890_c1 | 3300050516 | Bacteria | 1741 |
| 1023 | Ga0495655_0198662 | 3300053083 | Bacteria | 655 |
| 1024 | Ga0495595_0468057 | 3300053084 | Bacteria | 641 |
| 1025 | Ga0495619_0326172 | 3300053085 | Bacteria | 1063 |
| 1026 | Ga0500578_0026552 | 3300053086 | Bacteria | 3714 |
| 1027 | Ga0500643_070441 | 3300053087 | Bacteria | 971 |
| 1028 | Ga0500644_0003036 | 3300053088 | Bacteria | 4162 |
| 1029 | Ga0500647_0171717 | 3300053091 | Bacteria | 1000 |
| 1030 | Ga0500583_0015822 | 3300053092 | Bacteria | 2996 |
| 1031 | Ga0500583_0092466 | 3300053092 | Bacteria | 1473 |
| 1032 | Ga0500651_0060890 | 3300053093 | Bacteria | 2359 |
| 1033 | Ga0500641_0012327 | 3300053096 | Bacteria | 3121 |
| 1034 | Ga0500650_0057618 | 3300053098 | Bacteria | 1812 |
| 1035 | Ga0500650_0328909 | 3300053098 | Bacteria | 672 |
| 1036 | Ga0500594_0000648 | 3300053118 | Bacteria | 7419 |
| 1037 | Ga0500607_242573 | 3300053121 | Bacteria | 726 |
| 1038 | Ga0500621_265672 | 3300053126 | Bacteria | 568 |
| 1039 | Ga0500652_015634 | 3300053131 | Bacteria | 2744 |
| 1040 | Ga0500655_008683 | 3300053133 | Bacteria | 1828 |
| 1041 | Ga0500658_0010471 | 3300053134 | Bacteria | 3422 |
| 1042 | Ga0500559_0000602 | 3300053136 | Bacteria | 24517 |
| 1043 | Ga0500559_0299026 | 3300053136 | Bacteria | 756 |
| 1044 | Ga0500568_0047353 | 3300053139 | Bacteria | 1703 |
| 1045 | Ga0500573_0527334 | 3300053140 | Bacteria | 528 |
| 1046 | Ga0500604_0004670 | 3300053151 | Bacteria | 3629 |
| 1047 | Ga0500620_105003 | 3300053155 | Bacteria | 988 |
| 1048 | Ga0500622_0197165 | 3300053156 | Bacteria | 918 |
| 1049 | Ga0500636_0274429 | 3300053177 | Bacteria | 845 |
| 1050 | Ga0500636_0331247 | 3300053177 | Bacteria | 735 |
| 1051 | Ga0500645_002532 | 3300053730 | Bacteria | 8063 |
| 1052 | Ga0500645_163903 | 3300053730 | Bacteria | 609 |
| 1053 | Ga0500587_000910 | 3300053739 | Bacteria | 3945 |
| 1054 | Ga0501084_0082467 | 3300054114 | Bacteria | 2698 |
| 1055 | Ga0501084_0111519 | 3300054114 | Bacteria | 2299 |
| 1056 | Ga0501084_0186580 | 3300054114 | Bacteria | 1750 |
| 1057 | Ga0590075_076040 | 3300059424 | Bacteria | 868 |
| 1058 | Ga0501082_0011839 | 3300060353 | Bacteria | 7498 |
| 1059 | Ga0501082_0045137 | 3300060353 | Bacteria | 3800 |
| 1060 | Ga0501082_0230371 | 3300060353 | Bacteria | 1612 |
| 1061 | Ga0501082_0387912 | 3300060353 | Bacteria | 1219 |
| 1062 | Ga0530510_0000945 | 3300061734 | Bacteria | 19157 |
| 1063 | Ga0530510_0366553 | 3300061734 | Bacteria | 1083 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031251 | Ga0265327_10000103 | Ga0265327_1000010347 | 103 |
| 2 | 3300035724 | Ga0373933_0120830 | Ga0373933_0120830_883_1278 | 104 |
| 3 | 3300036401 | Ga0373937_0701317 | Ga0373937_0701317_512_907 | 104 |
| 4 | 3300050490 | nmdc:mga03n38_44569_c1 | nmdc:mga03n38_44569_c1_1610_1936 | 108 |
| 5 | 3300007788 | Ga0099795_10014274 | Ga0099795_100142742 | 109 |
| 6 | 3300046533 | Ga0495640_0815346 | Ga0495640_0815346_123_515 | 113 |
| 7 | 3300036401 | Ga0373937_1587594 | Ga0373937_1587594_143_535 | 114 |
| 8 | 3300046463 | Ga0495653_0784174 | Ga0495653_0784174_62_454 | 114 |
| 9 | 3300046559 | Ga0495667_0048876 | Ga0495667_0048876_516_908 | 114 |
| 10 | 3300053085 | Ga0495619_0326172 | Ga0495619_0326172_213_605 | 114 |
| 11 | 3300005445 | Ga0070708_100022137 | Ga0070708_1000221373 | 115 |
| 12 | 3300005467 | Ga0070706_100065903 | Ga0070706_1000659032 | 115 |
| 13 | 3300005468 | Ga0070707_100012911 | Ga0070707_1000129114 | 115 |
| 14 | 3300005471 | Ga0070698_100078740 | Ga0070698_1000787402 | 115 |
| 15 | 3300005518 | Ga0070699_100410889 | Ga0070699_1004108892 | 115 |
| 16 | 3300005536 | Ga0070697_100098562 | Ga0070697_1000985623 | 115 |
| 17 | 3300025910 | Ga0207684_10042382 | Ga0207684_100423824 | 115 |
| 18 | 3300025922 | Ga0207646_10023091 | Ga0207646_100230915 | 115 |
| 19 | 3300053092 | Ga0500583_0092466 | Ga0500583_0092466_1095_1460 | 115 |
| 20 | 3300049518 | Ga0501295_077350 | Ga0501295_077350_329_694 | 116 |
| 21 | 3300049766 | Ga0501269_017794 | Ga0501269_017794_295_660 | 116 |
| 22 | 3300035113 | Ga0373936_0496120 | Ga0373936_0496120_165_557 | 117 |
| 23 | 3300035117 | Ga0373953_0013828 | Ga0373953_0013828_38_448 | 117 |
| 24 | 3300037068 | Ga0373925_0173865 | Ga0373925_0173865_11_403 | 117 |
| 25 | 3300046536 | Ga0495587_0644233 | Ga0495587_0644233_197_562 | 117 |
| 26 | 3300046690 | Ga0495624_0097345 | Ga0495624_0097345_1158_1568 | 117 |
| 27 | 3300047317 | Ga0495604_0397293 | Ga0495604_0397293_473_883 | 117 |
| 28 | 3300050496 | nmdc:mga07m45_767994_c1 | nmdc:mga07m45_767994_c1_38_406 | 117 |
| 29 | 3300046529 | Ga0495652_0093413 | Ga0495652_0093413_58_468 | 118 |
| 30 | 3300046543 | Ga0495645_0041638 | Ga0495645_0041638_1659_2069 | 118 |
| 31 | 3300046678 | Ga0495599_0046691 | Ga0495599_0046691_2161_2571 | 118 |
| 32 | 3300005440 | Ga0070705_100641001 | Ga0070705_1006410011 | 119 |
| 33 | 3300005546 | Ga0070696_100160694 | Ga0070696_1001606942 | 119 |
| 34 | 3300005549 | Ga0070704_100074667 | Ga0070704_1000746672 | 119 |
| 35 | 3300035118 | Ga0373954_0377376 | Ga0373954_0377376_246_656 | 119 |
| 36 | 3300035120 | Ga0373957_0083602 | Ga0373957_0083602_406_816 | 119 |
| 37 | 3300035170 | Ga0373943_0631110 | Ga0373943_0631110_149_559 | 119 |
| 38 | 3300035172 | Ga0373955_0562875 | Ga0373955_0562875_199_609 | 119 |
| 39 | 3300035410 | Ga0373924_0285380 | Ga0373924_0285380_44_454 | 119 |
| 40 | 3300035724 | Ga0373933_0055759 | Ga0373933_0055759_302_712 | 119 |
| 41 | 3300036401 | Ga0373937_0253324 | Ga0373937_0253324_19_429 | 119 |
| 42 | 3300046455 | Ga0495603_0343118 | Ga0495603_0343118_195_605 | 119 |
| 43 | 3300046463 | Ga0495653_0666112 | Ga0495653_0666112_19_429 | 119 |
| 44 | 3300046476 | Ga0495662_0016895 | Ga0495662_0016895_61_471 | 119 |
| 45 | 3300046499 | Ga0495594_0217236 | Ga0495594_0217236_44_454 | 119 |
| 46 | 3300046511 | Ga0495608_0035567 | Ga0495608_0035567_2843_3253 | 119 |
| 47 | 3300046514 | Ga0495618_0124682 | Ga0495618_0124682_296_706 | 119 |
| 48 | 3300046516 | Ga0495628_0031067 | Ga0495628_0031067_856_1266 | 119 |
| 49 | 3300046536 | Ga0495587_0028734 | Ga0495587_0028734_364_774 | 119 |
| 50 | 3300046557 | Ga0495622_0393882 | Ga0495622_0393882_151_561 | 119 |
| 51 | 3300046642 | Ga0495634_0094564 | Ga0495634_0094564_691_1101 | 119 |
| 52 | 3300046663 | Ga0495635_0282900 | Ga0495635_0282900_465_875 | 119 |
| 53 | 3300046680 | Ga0495646_0433929 | Ga0495646_0433929_216_626 | 119 |
| 54 | 3300047319 | Ga0495674_0058682 | Ga0495674_0058682_70_480 | 119 |
| 55 | 3300005434 | Ga0070709_11271333 | Ga0070709_112713331 | 120 |
| 56 | 3300025931 | Ga0207644_11062764 | Ga0207644_110627642 | 122 |
| 57 | 3300035083 | Ga0373926_0104689 | Ga0373926_0104689_590_1000 | 122 |
| 58 | 3300035111 | Ga0373923_0179065 | Ga0373923_0179065_277_687 | 122 |
| 59 | 3300035172 | Ga0373955_0210377 | Ga0373955_0210377_422_832 | 122 |
| 60 | 3300035695 | Ga0373927_0029470 | Ga0373927_0029470_60_470 | 122 |
| 61 | 3300036401 | Ga0373937_1010088 | Ga0373937_1010088_67_477 | 122 |
| 62 | 3300046461 | Ga0495641_0042268 | Ga0495641_0042268_807_1217 | 122 |
| 63 | 3300046472 | Ga0495580_0201885 | Ga0495580_0201885_786_1196 | 122 |
| 64 | 3300046477 | Ga0495664_0496524 | Ga0495664_0496524_309_719 | 122 |
| 65 | 3300046514 | Ga0495618_0773400 | Ga0495618_0773400_111_521 | 122 |
| 66 | 3300046517 | Ga0495630_0050983 | Ga0495630_0050983_2497_2907 | 122 |
| 67 | 3300046526 | Ga0495666_0293873 | Ga0495666_0293873_58_468 | 122 |
| 68 | 3300046533 | Ga0495640_0022395 | Ga0495640_0022395_1648_2058 | 122 |
| 69 | 3300046535 | Ga0495586_0200934 | Ga0495586_0200934_586_969 | 122 |
| 70 | 3300046535 | Ga0495586_0294447 | Ga0495586_0294447_216_626 | 122 |
| 71 | 3300046675 | Ga0495657_0312372 | Ga0495657_0312372_117_527 | 122 |
| 72 | 3300046683 | Ga0495658_0715353 | Ga0495658_0715353_215_625 | 122 |
| 73 | 3300046689 | Ga0495613_0219996 | Ga0495613_0219996_629_1039 | 122 |
| 74 | 3300046809 | Ga0495600_0263413 | Ga0495600_0263413_296_706 | 122 |
| 75 | 3300047317 | Ga0495604_0041161 | Ga0495604_0041161_3170_3580 | 122 |
| 76 | 3300047322 | Ga0495680_0167626 | Ga0495680_0167626_280_690 | 122 |
| 77 | 3300047471 | Ga0495684_0089261 | Ga0495684_0089261_1084_1494 | 122 |
| 78 | 3300006173 | Ga0070716_100027492 | Ga0070716_1000274924 | 123 |
| 79 | 3300035691 | Ga0373931_0284222 | Ga0373931_0284222_586_981 | 123 |
| 80 | 3300046512 | Ga0495610_0240316 | Ga0495610_0240316_336_707 | 123 |
| 81 | 3300050496 | nmdc:mga07m45_137308_c1 | nmdc:mga07m45_137308_c1_15_386 | 123 |
| 82 | 3300050496 | nmdc:mga07m45_563763_c1 | nmdc:mga07m45_563763_c1_251_622 | 123 |
| 83 | 3300031239 | Ga0265328_10000016 | Ga0265328_1000001629 | 124 |
| 84 | 3300031344 | Ga0265316_10533534 | Ga0265316_105335342 | 124 |
| 85 | 3300031911 | Ga0307412_10533678 | Ga0307412_105336782 | 124 |
| 86 | 3300031911 | Ga0307412_11410542 | Ga0307412_114105421 | 124 |
| 87 | 3300032005 | Ga0307411_11356154 | Ga0307411_113561542 | 124 |
| 88 | 3300033179 | Ga0307507_10054152 | Ga0307507_100541523 | 124 |
| 89 | 3300038726 | Ga0400490_23584 | Ga0400490_23584_3961_4353 | 124 |
| 90 | 3300049572 | Ga0501036_0826978 | Ga0501036_0826978_363_749 | 124 |
| 91 | 3300006195 | Ga0075366_10865233 | Ga0075366_108652331 | 125 |
| 92 | 3300025942 | Ga0207689_11112890 | Ga0207689_111128902 | 125 |
| 93 | 3300044712 | Ga0453684_0302414 | Ga0453684_0302414_1007_1405 | 125 |
| 94 | 3300053126 | Ga0500621_265672 | Ga0500621_265672_14_391 | 125 |
| 95 | 3300004625 | Ga0055543_1022535 | Ga0055543_10225351 | 126 |
| 96 | 3300005262 | Ga0065165_1000092 | Ga0065165_1000092107 | 126 |
| 97 | 3300005330 | Ga0070690_100000300 | Ga0070690_10000030027 | 126 |
| 98 | 3300005334 | Ga0068869_100028350 | Ga0068869_1000283504 | 126 |
| 99 | 3300005337 | Ga0070682_100278675 | Ga0070682_1002786752 | 126 |
| 100 | 3300005338 | Ga0068868_100288850 | Ga0068868_1002888502 | 126 |
| 101 | 3300005340 | Ga0070689_100000861 | Ga0070689_10000086122 | 126 |
| 102 | 3300005341 | Ga0070691_10039151 | Ga0070691_100391512 | 126 |
| 103 | 3300005345 | Ga0070692_10020728 | Ga0070692_100207282 | 126 |
| 104 | 3300005354 | Ga0070675_100102474 | Ga0070675_1001024742 | 126 |
| 105 | 3300005356 | Ga0070674_100170190 | Ga0070674_1001701902 | 126 |
| 106 | 3300005438 | Ga0070701_10066002 | Ga0070701_100660022 | 126 |
| 107 | 3300005440 | Ga0070705_100065362 | Ga0070705_1000653622 | 126 |
| 108 | 3300005441 | Ga0070700_100044562 | Ga0070700_1000445622 | 126 |
| 109 | 3300005456 | Ga0070678_100034520 | Ga0070678_1000345202 | 126 |
| 110 | 3300005459 | Ga0068867_100004065 | Ga0068867_1000040653 | 126 |
| 111 | 3300005466 | Ga0070685_10061441 | Ga0070685_100614412 | 126 |
| 112 | 3300005544 | Ga0070686_100000276 | Ga0070686_10000027636 | 126 |
| 113 | 3300005545 | Ga0070695_100172292 | Ga0070695_1001722922 | 126 |
| 114 | 3300005546 | Ga0070696_100005155 | Ga0070696_1000051555 | 126 |
| 115 | 3300005549 | Ga0070704_100352489 | Ga0070704_1003524892 | 126 |
| 116 | 3300005615 | Ga0070702_100004569 | Ga0070702_1000045693 | 126 |
| 117 | 3300005617 | Ga0068859_100031129 | Ga0068859_1000311292 | 126 |
| 118 | 3300005719 | Ga0068861_100007611 | Ga0068861_1000076118 | 126 |
| 119 | 3300005843 | Ga0068860_100022077 | Ga0068860_1000220772 | 126 |
| 120 | 3300005843 | Ga0068860_100887990 | Ga0068860_1008879902 | 126 |
| 121 | 3300006237 | Ga0097621_100002873 | Ga0097621_10000287312 | 126 |
| 122 | 3300006353 | Ga0075370_10471547 | Ga0075370_104715472 | 126 |
| 123 | 3300006358 | Ga0068871_100002359 | Ga0068871_1000023593 | 126 |
| 124 | 3300006844 | Ga0075428_100007382 | Ga0075428_10000738211 | 126 |
| 125 | 3300006846 | Ga0075430_100141991 | Ga0075430_1001419913 | 126 |
| 126 | 3300006880 | Ga0075429_100010327 | Ga0075429_1000103278 | 126 |
| 127 | 3300006931 | Ga0097620_100031130 | Ga0097620_1000311302 | 126 |
| 128 | 3300007265 | Ga0099794_10080488 | Ga0099794_100804882 | 126 |
| 129 | 3300009098 | Ga0105245_10693816 | Ga0105245_106938162 | 126 |
| 130 | 3300009176 | Ga0105242_10119601 | Ga0105242_101196014 | 126 |
| 131 | 3300010375 | Ga0105239_10869713 | Ga0105239_108697132 | 126 |
| 132 | 3300011119 | Ga0105246_12078353 | Ga0105246_120783531 | 126 |
| 133 | 3300013296 | Ga0157374_10948477 | Ga0157374_109484772 | 126 |
| 134 | 3300025899 | Ga0207642_10009043 | Ga0207642_100090432 | 126 |
| 135 | 3300025907 | Ga0207645_10170753 | Ga0207645_101707532 | 126 |
| 136 | 3300025917 | Ga0207660_10131851 | Ga0207660_101318512 | 126 |
| 137 | 3300025927 | Ga0207687_10001372 | Ga0207687_100013722 | 126 |
| 138 | 3300025933 | Ga0207706_10120157 | Ga0207706_101201572 | 126 |
| 139 | 3300025934 | Ga0207686_10004499 | Ga0207686_100044992 | 126 |
| 140 | 3300025935 | Ga0207709_10002051 | Ga0207709_1000205115 | 126 |
| 141 | 3300025938 | Ga0207704_10001158 | Ga0207704_100011588 | 126 |
| 142 | 3300026035 | Ga0207703_10003431 | Ga0207703_100034319 | 126 |
| 143 | 3300027526 | Ga0209968_1034862 | Ga0209968_10348622 | 126 |
| 144 | 3300027907 | Ga0207428_10173137 | Ga0207428_101731371 | 126 |
| 145 | 3300027907 | Ga0207428_10561317 | Ga0207428_105613172 | 126 |
| 146 | 3300028380 | Ga0268265_10025116 | Ga0268265_100251162 | 126 |
| 147 | 3300028381 | Ga0268264_10011923 | Ga0268264_100119232 | 126 |
| 148 | 3300028794 | Ga0307515_10409468 | Ga0307515_104094682 | 126 |
| 149 | 3300031548 | Ga0307408_101164982 | Ga0307408_1011649822 | 126 |
| 150 | 3300032005 | Ga0307411_10481583 | Ga0307411_104815831 | 126 |
| 151 | 3300032126 | Ga0307415_100084635 | Ga0307415_1000846353 | 126 |
| 152 | 3300032126 | Ga0307415_100433084 | Ga0307415_1004330841 | 126 |
| 153 | 3300035086 | Ga0373934_0000098 | Ga0373934_0000098_246_638 | 126 |
| 154 | 3300035118 | Ga0373954_0000709 | Ga0373954_0000709_11501_11893 | 126 |
| 155 | 3300035119 | Ga0373956_0005111 | Ga0373956_0005111_907_1299 | 126 |
| 156 | 3300035120 | Ga0373957_0020547 | Ga0373957_0020547_1286_1678 | 126 |
| 157 | 3300035172 | Ga0373955_0020139 | Ga0373955_0020139_2514_2906 | 126 |
| 158 | 3300035691 | Ga0373931_0356269 | Ga0373931_0356269_485_880 | 126 |
| 159 | 3300035691 | Ga0373931_0628411 | Ga0373931_0628411_73_477 | 126 |
| 160 | 3300035724 | Ga0373933_0003854 | Ga0373933_0003854_459_851 | 126 |
| 161 | 3300036401 | Ga0373937_0001120 | Ga0373937_0001120_892_1284 | 126 |
| 162 | 3300042001 | Ga0439441_077141 | Ga0439441_077141_316_708 | 126 |
| 163 | 3300042436 | Ga0439435_0199154 | Ga0439435_0199154_17_409 | 126 |
| 164 | 3300046462 | Ga0495651_0000147 | Ga0495651_0000147_747_1139 | 126 |
| 165 | 3300046615 | Ga0495656_0439470 | Ga0495656_0439470_269_661 | 126 |
| 166 | 3300046675 | Ga0495657_0050053 | Ga0495657_0050053_753_1145 | 126 |
| 167 | 3300047444 | Ga0495675_0208964 | Ga0495675_0208964_674_1066 | 126 |
| 168 | 3300048905 | Ga0496102_1437573 | Ga0496102_1437573_78_470 | 126 |
| 169 | 3300048909 | Ga0496106_0298400 | Ga0496106_0298400_759_1151 | 126 |
| 170 | 3300048910 | Ga0496107_0431665 | Ga0496107_0431665_26_418 | 126 |
| 171 | 3300048912 | Ga0496109_0170274 | Ga0496109_0170274_1575_1967 | 126 |
| 172 | 3300048915 | Ga0496112_0677138 | Ga0496112_0677138_411_803 | 126 |
| 173 | 3300050508 | nmdc:mga09592_83767_c1 | nmdc:mga09592_83767_c1_1982_2377 | 126 |
| 174 | 3300050510 | nmdc:mga06r32_20528_c1 | nmdc:mga06r32_20528_c1_4545_4940 | 126 |
| 175 | 3300053084 | Ga0495595_0468057 | Ga0495595_0468057_164_556 | 126 |
| 176 | 3300053140 | Ga0500573_0527334 | Ga0500573_0527334_85_489 | 126 |
| 177 | 3300005295 | Ga0065707_10083123 | Ga0065707_100831236 | 127 |
| 178 | 3300005334 | Ga0068869_100352433 | Ga0068869_1003524332 | 127 |
| 179 | 3300005347 | Ga0070668_100413291 | Ga0070668_1004132912 | 127 |
| 180 | 3300005356 | Ga0070674_100258779 | Ga0070674_1002587792 | 127 |
| 181 | 3300005367 | Ga0070667_100613516 | Ga0070667_1006135162 | 127 |
| 182 | 3300005539 | Ga0068853_100226210 | Ga0068853_1002262102 | 127 |
| 183 | 3300006914 | Ga0075436_100249448 | Ga0075436_1002494481 | 127 |
| 184 | 3300009174 | Ga0105241_10804725 | Ga0105241_108047252 | 127 |
| 185 | 3300009176 | Ga0105242_11151969 | Ga0105242_111519692 | 127 |
| 186 | 3300009553 | Ga0105249_10184647 | Ga0105249_101846472 | 127 |
| 187 | 3300010159 | Ga0099796_10006792 | Ga0099796_100067922 | 127 |
| 188 | 3300013297 | Ga0157378_10000815 | Ga0157378_1000081532 | 127 |
| 189 | 3300013306 | Ga0163162_10000821 | Ga0163162_1000082123 | 127 |
| 190 | 3300013308 | Ga0157375_10090951 | Ga0157375_100909513 | 127 |
| 191 | 3300014326 | Ga0157380_10009860 | Ga0157380_100098604 | 127 |
| 192 | 3300014968 | Ga0157379_10080210 | Ga0157379_100802104 | 127 |
| 193 | 3300031251 | Ga0265327_10031534 | Ga0265327_100315342 | 127 |
| 194 | 3300031665 | Ga0316575_10004541 | Ga0316575_100045414 | 127 |
| 195 | 3300032005 | Ga0307411_10368588 | Ga0307411_103685882 | 127 |
| 196 | 3300035172 | Ga0373955_0454025 | Ga0373955_0454025_221_619 | 127 |
| 197 | 3300035725 | Ga0373947_0310063 | Ga0373947_0310063_617_1018 | 127 |
| 198 | 3300036401 | Ga0373937_1138148 | Ga0373937_1138148_310_708 | 127 |
| 199 | 3300042876 | Ga0451577_0049289 | Ga0451577_0049289_1903_2298 | 127 |
| 200 | 3300050514 | nmdc:mga08x19_224583_c1 | nmdc:mga08x19_224583_c1_839_1234 | 127 |
| 201 | iso_pu_bacteria | 2574179768 | 2574429454 | 127 |
| 202 | 3300005445 | Ga0070708_101514367 | Ga0070708_1015143671 | 128 |
| 203 | 3300037068 | Ga0373925_1267539 | Ga0373925_1267539_94_498 | 128 |
| 204 | 3300046472 | Ga0495580_0055683 | Ga0495580_0055683_128_532 | 128 |
| 205 | 3300005345 | Ga0070692_10424610 | Ga0070692_104246102 | 130 |
| 206 | 3300005440 | Ga0070705_100091313 | Ga0070705_1000913134 | 130 |
| 207 | 3300005545 | Ga0070695_100019621 | Ga0070695_1000196216 | 130 |
| 208 | 3300005549 | Ga0070704_100050541 | Ga0070704_1000505413 | 130 |
| 209 | 3300005844 | Ga0068862_101916227 | Ga0068862_1019162271 | 130 |
| 210 | 3300006358 | Ga0068871_100237977 | Ga0068871_1002379772 | 130 |
| 211 | 3300009147 | Ga0114129_11088168 | Ga0114129_110881682 | 130 |
| 212 | 3300014969 | Ga0157376_10450126 | Ga0157376_104501262 | 130 |
| 213 | 3300025942 | Ga0207689_10344092 | Ga0207689_103440922 | 130 |
| 214 | 3300026089 | Ga0207648_11029073 | Ga0207648_110290732 | 130 |
| 215 | 3300028577 | Ga0265318_10274901 | Ga0265318_102749012 | 130 |
| 216 | 3300028654 | Ga0265322_10108869 | Ga0265322_101088692 | 130 |
| 217 | 3300035083 | Ga0373926_0267077 | Ga0373926_0267077_159_572 | 130 |
| 218 | 3300035111 | Ga0373923_0684716 | Ga0373923_0684716_55_468 | 130 |
| 219 | 3300035113 | Ga0373936_0028084 | Ga0373936_0028084_517_930 | 130 |
| 220 | 3300035410 | Ga0373924_0351309 | Ga0373924_0351309_103_516 | 130 |
| 221 | 3300035695 | Ga0373927_0017581 | Ga0373927_0017581_4252_4665 | 130 |
| 222 | 3300036401 | Ga0373937_0174583 | Ga0373937_0174583_151_564 | 130 |
| 223 | 3300036401 | Ga0373937_0509471 | Ga0373937_0509471_255_668 | 130 |
| 224 | 3300037068 | Ga0373925_0010477 | Ga0373925_0010477_6191_6604 | 130 |
| 225 | 3300037068 | Ga0373925_0412140 | Ga0373925_0412140_507_917 | 130 |
| 226 | 3300042876 | Ga0451577_0365696 | Ga0451577_0365696_823_1230 | 130 |
| 227 | 3300044712 | Ga0453684_0000014 | Ga0453684_0000014_410273_410680 | 130 |
| 228 | 3300044712 | Ga0453684_0000142 | Ga0453684_0000142_21372_21779 | 130 |
| 229 | 3300044712 | Ga0453684_0021042 | Ga0453684_0021042_2181_2588 | 130 |
| 230 | 3300045051 | Ga0451576_0000272 | Ga0451576_0000272_43331_43738 | 130 |
| 231 | 3300048907 | Ga0496104_0950704 | Ga0496104_0950704_187_600 | 130 |
| 232 | 3300049589 | Ga0501073_0568955 | Ga0501073_0568955_175_588 | 130 |
| 233 | 3300050515 | nmdc:mga0a205_1108433_c1 | nmdc:mga0a205_1108433_c1_55_468 | 130 |
| 234 | 3300005328 | Ga0070676_10252750 | Ga0070676_102527502 | 131 |
| 235 | 3300005440 | Ga0070705_100668485 | Ga0070705_1006684852 | 131 |
| 236 | 3300005468 | Ga0070707_100825928 | Ga0070707_1008259282 | 131 |
| 237 | 3300005536 | Ga0070697_101478875 | Ga0070697_1014788752 | 131 |
| 238 | 3300005547 | Ga0070693_100360143 | Ga0070693_1003601432 | 131 |
| 239 | 3300005617 | Ga0068859_100417001 | Ga0068859_1004170013 | 131 |
| 240 | 3300006931 | Ga0097620_100417000 | Ga0097620_1004170003 | 131 |
| 241 | 3300009174 | Ga0105241_11824647 | Ga0105241_118246471 | 131 |
| 242 | 3300021384 | Ga0213876_10043325 | Ga0213876_100433252 | 131 |
| 243 | 3300025916 | Ga0207663_11044505 | Ga0207663_110445051 | 131 |
| 244 | 3300025918 | Ga0207662_10197331 | Ga0207662_101973312 | 131 |
| 245 | 3300025921 | Ga0207652_10313936 | Ga0207652_103139362 | 131 |
| 246 | 3300025922 | Ga0207646_10551562 | Ga0207646_105515622 | 131 |
| 247 | 3300026116 | Ga0207674_11473613 | Ga0207674_114736131 | 131 |
| 248 | 3300031250 | Ga0265331_10074353 | Ga0265331_100743532 | 131 |
| 249 | 3300031251 | Ga0265327_10107029 | Ga0265327_101070292 | 131 |
| 250 | 3300031507 | Ga0307509_10000032 | Ga0307509_10000032128 | 131 |
| 251 | 3300035092 | Ga0373952_0009088 | Ga0373952_0009088_747_1157 | 131 |
| 252 | 3300035119 | Ga0373956_0332865 | Ga0373956_0332865_184_597 | 131 |
| 253 | 3300035695 | Ga0373927_0006664 | Ga0373927_0006664_670_1083 | 131 |
| 254 | 3300035695 | Ga0373927_0306202 | Ga0373927_0306202_459_869 | 131 |
| 255 | 3300037068 | Ga0373925_1313559 | Ga0373925_1313559_154_564 | 131 |
| 256 | 3300039437 | Ga0436365_0539896 | Ga0436365_0539896_672_1082 | 131 |
| 257 | 3300044673 | Ga0453683_0029419 | Ga0453683_0029419_1243_1653 | 131 |
| 258 | 3300044712 | Ga0453684_0079145 | Ga0453684_0079145_329_739 | 131 |
| 259 | 3300045051 | Ga0451576_0070029 | Ga0451576_0070029_530_940 | 131 |
| 260 | 3300005336 | Ga0070680_100398442 | Ga0070680_1003984422 | 132 |
| 261 | 3300005441 | Ga0070700_100002065 | Ga0070700_1000020658 | 132 |
| 262 | 3300005444 | Ga0070694_100180682 | Ga0070694_1001806822 | 132 |
| 263 | 3300005459 | Ga0068867_100040768 | Ga0068867_1000407681 | 132 |
| 264 | 3300005466 | Ga0070685_10372158 | Ga0070685_103721582 | 132 |
| 265 | 3300005518 | Ga0070699_101547242 | Ga0070699_1015472421 | 132 |
| 266 | 3300005539 | Ga0068853_100336266 | Ga0068853_1003362662 | 132 |
| 267 | 3300005545 | Ga0070695_100047990 | Ga0070695_1000479904 | 132 |
| 268 | 3300005546 | Ga0070696_100023372 | Ga0070696_1000233723 | 132 |
| 269 | 3300005546 | Ga0070696_100134017 | Ga0070696_1001340173 | 132 |
| 270 | 3300005547 | Ga0070693_100276330 | Ga0070693_1002763302 | 132 |
| 271 | 3300005563 | Ga0068855_100648027 | Ga0068855_1006480272 | 132 |
| 272 | 3300005842 | Ga0068858_100028744 | Ga0068858_1000287443 | 132 |
| 273 | 3300005842 | Ga0068858_102173163 | Ga0068858_1021731632 | 132 |
| 274 | 3300005844 | Ga0068862_100122412 | Ga0068862_1001224123 | 132 |
| 275 | 3300005844 | Ga0068862_102707869 | Ga0068862_1027078691 | 132 |
| 276 | 3300006038 | Ga0075365_11014506 | Ga0075365_110145061 | 132 |
| 277 | 3300006173 | Ga0070716_100107534 | Ga0070716_1001075342 | 132 |
| 278 | 3300006173 | Ga0070716_101356461 | Ga0070716_1013564611 | 132 |
| 279 | 3300006186 | Ga0075369_10003660 | Ga0075369_100036609 | 132 |
| 280 | 3300006195 | Ga0075366_10036504 | Ga0075366_100365043 | 132 |
| 281 | 3300006852 | Ga0075433_10271141 | Ga0075433_102711412 | 132 |
| 282 | 3300006881 | Ga0068865_101688200 | Ga0068865_1016882001 | 132 |
| 283 | 3300006914 | Ga0075436_100469681 | Ga0075436_1004696812 | 132 |
| 284 | 3300007076 | Ga0075435_101238924 | Ga0075435_1012389242 | 132 |
| 285 | 3300007265 | Ga0099794_10010187 | Ga0099794_100101874 | 132 |
| 286 | 3300007265 | Ga0099794_10192212 | Ga0099794_101922122 | 132 |
| 287 | 3300009148 | Ga0105243_10042712 | Ga0105243_100427122 | 132 |
| 288 | 3300009176 | Ga0105242_10130248 | Ga0105242_101302483 | 132 |
| 289 | 3300009551 | Ga0105238_10959484 | Ga0105238_109594842 | 132 |
| 290 | 3300009553 | Ga0105249_10457856 | Ga0105249_104578562 | 132 |
| 291 | 3300013105 | Ga0157369_11827977 | Ga0157369_118279771 | 132 |
| 292 | 3300013296 | Ga0157374_10000104 | Ga0157374_100001042 | 132 |
| 293 | 3300013306 | Ga0163162_12126839 | Ga0163162_121268392 | 132 |
| 294 | 3300013308 | Ga0157375_10295166 | Ga0157375_102951663 | 132 |
| 295 | 3300014325 | Ga0163163_10042982 | Ga0163163_100429825 | 132 |
| 296 | 3300014326 | Ga0157380_10141913 | Ga0157380_101419132 | 132 |
| 297 | 3300014968 | Ga0157379_10117188 | Ga0157379_101171882 | 132 |
| 298 | 3300025919 | Ga0207657_10040208 | Ga0207657_100402083 | 132 |
| 299 | 3300025924 | Ga0207694_10421837 | Ga0207694_104218372 | 132 |
| 300 | 3300025934 | Ga0207686_10143702 | Ga0207686_101437022 | 132 |
| 301 | 3300025934 | Ga0207686_10146827 | Ga0207686_101468273 | 132 |
| 302 | 3300025934 | Ga0207686_10614847 | Ga0207686_106148471 | 132 |
| 303 | 3300025935 | Ga0207709_10073394 | Ga0207709_100733942 | 132 |
| 304 | 3300025937 | Ga0207669_11117897 | Ga0207669_111178971 | 132 |
| 305 | 3300025938 | Ga0207704_10768208 | Ga0207704_107682082 | 132 |
| 306 | 3300025939 | Ga0207665_10137755 | Ga0207665_101377552 | 132 |
| 307 | 3300025949 | Ga0207667_10434636 | Ga0207667_104346362 | 132 |
| 308 | 3300026035 | Ga0207703_10024821 | Ga0207703_100248215 | 132 |
| 309 | 3300026041 | Ga0207639_10305531 | Ga0207639_103055312 | 132 |
| 310 | 3300026075 | Ga0207708_10003747 | Ga0207708_100037476 | 132 |
| 311 | 3300026089 | Ga0207648_10355051 | Ga0207648_103550512 | 132 |
| 312 | 3300027665 | Ga0209983_1014750 | Ga0209983_10147503 | 132 |
| 313 | 3300027671 | Ga0209588_1249969 | Ga0209588_12499691 | 132 |
| 314 | 3300027682 | Ga0209971_1003770 | Ga0209971_10037703 | 132 |
| 315 | 3300027717 | Ga0209998_10029342 | Ga0209998_100293422 | 132 |
| 316 | 3300028800 | Ga0265338_10106841 | Ga0265338_101068412 | 132 |
| 317 | 3300029957 | Ga0265324_10003482 | Ga0265324_100034823 | 132 |
| 318 | 3300030521 | Ga0307511_10000471 | Ga0307511_1000047136 | 132 |
| 319 | 3300031241 | Ga0265325_10054431 | Ga0265325_100544312 | 132 |
| 320 | 3300031344 | Ga0265316_10115550 | Ga0265316_101155502 | 132 |
| 321 | 3300031711 | Ga0265314_10005881 | Ga0265314_100058814 | 132 |
| 322 | 3300031824 | Ga0307413_10178539 | Ga0307413_101785392 | 132 |
| 323 | 3300042876 | Ga0451577_0000013 | Ga0451577_0000013_170930_171346 | 132 |
| 324 | 3300042876 | Ga0451577_0002627 | Ga0451577_0002627_7354_7767 | 132 |
| 325 | 3300042876 | Ga0451577_0085704 | Ga0451577_0085704_714_1127 | 132 |
| 326 | 3300042876 | Ga0451577_0349496 | Ga0451577_0349496_323_742 | 132 |
| 327 | 3300044673 | Ga0453683_0000033 | Ga0453683_0000033_49773_50189 | 132 |
| 328 | 3300044712 | Ga0453684_0000029 | Ga0453684_0000029_32197_32610 | 132 |
| 329 | 3300044712 | Ga0453684_0000085 | Ga0453684_0000085_226472_226888 | 132 |
| 330 | 3300044712 | Ga0453684_0007704 | Ga0453684_0007704_11717_12130 | 132 |
| 331 | 3300044712 | Ga0453684_1356964 | Ga0453684_1356964_196_609 | 132 |
| 332 | 3300045051 | Ga0451576_0000018 | Ga0451576_0000018_379344_379760 | 132 |
| 333 | 3300045051 | Ga0451576_0014372 | Ga0451576_0014372_4947_5360 | 132 |
| 334 | 3300045051 | Ga0451576_0024032 | Ga0451576_0024032_5001_5414 | 132 |
| 335 | 3300045051 | Ga0451576_0226688 | Ga0451576_0226688_1172_1588 | 132 |
| 336 | 3300046664 | Ga0495659_0199677 | Ga0495659_0199677_164_577 | 132 |
| 337 | 3300049569 | Ga0501032_0001187 | Ga0501032_0001187_18501_18914 | 132 |
| 338 | 3300049569 | Ga0501032_0125317 | Ga0501032_0125317_829_1242 | 132 |
| 339 | 3300049574 | Ga0501038_0003601 | Ga0501038_0003601_300_713 | 132 |
| 340 | 3300049575 | Ga0501039_0318992 | Ga0501039_0318992_169_582 | 132 |
| 341 | 3300049822 | Ga0501035_0274233 | Ga0501035_0274233_839_1252 | 132 |
| 342 | 3300050491 | nmdc:mga00v17_237278_c1 | nmdc:mga00v17_237278_c1_139_555 | 132 |
| 343 | 3300050493 | nmdc:mga0k408_115144_c1 | nmdc:mga0k408_115144_c1_77_493 | 132 |
| 344 | 3300050493 | nmdc:mga0k408_30350_c1 | nmdc:mga0k408_30350_c1_154_576 | 132 |
| 345 | 3300050513 | nmdc:mga0rr50_1477348_c1 | nmdc:mga0rr50_1477348_c1_145_558 | 132 |
| 346 | 3300050514 | nmdc:mga08x19_141793_c1 | nmdc:mga08x19_141793_c1_678_1091 | 132 |
| 347 | 3300050514 | nmdc:mga08x19_37590_c1 | nmdc:mga08x19_37590_c1_2523_2936 | 132 |
| 348 | 3300050515 | nmdc:mga0a205_529402_c1 | nmdc:mga0a205_529402_c1_128_541 | 132 |
| 349 | 3300050516 | nmdc:mga0sz30_51890_c1 | nmdc:mga0sz30_51890_c1_213_629 | 132 |
| 350 | 3300053087 | Ga0500643_070441 | Ga0500643_070441_379_822 | 132 |
| 351 | 3300053092 | Ga0500583_0015822 | Ga0500583_0015822_2449_2892 | 132 |
| 352 | 3300053096 | Ga0500641_0012327 | Ga0500641_0012327_1991_2407 | 132 |
| 353 | 3300053098 | Ga0500650_0057618 | Ga0500650_0057618_1355_1798 | 132 |
| 354 | 3300053133 | Ga0500655_008683 | Ga0500655_008683_1063_1506 | 132 |
| 355 | 3300053151 | Ga0500604_0004670 | Ga0500604_0004670_135_578 | 132 |
| 356 | 3300053730 | Ga0500645_163903 | Ga0500645_163903_21_464 | 132 |
| 357 | 3300005330 | Ga0070690_100747498 | Ga0070690_1007474982 | 133 |
| 358 | 3300005340 | Ga0070689_101268652 | Ga0070689_1012686521 | 133 |
| 359 | 3300006871 | Ga0075434_101131489 | Ga0075434_1011314892 | 133 |
| 360 | 3300006881 | Ga0068865_100070650 | Ga0068865_1000706501 | 133 |
| 361 | 3300007076 | Ga0075435_100702759 | Ga0075435_1007027592 | 133 |
| 362 | 3300025936 | Ga0207670_11395292 | Ga0207670_113952921 | 133 |
| 363 | 3300027360 | Ga0209969_1004655 | Ga0209969_10046554 | 133 |
| 364 | 3300027378 | Ga0209981_1012313 | Ga0209981_10123132 | 133 |
| 365 | 3300027462 | Ga0210000_1003423 | Ga0210000_10034232 | 133 |
| 366 | 3300027543 | Ga0209999_1023090 | Ga0209999_10230903 | 133 |
| 367 | 3300027682 | Ga0209971_1006480 | Ga0209971_10064802 | 133 |
| 368 | 3300027682 | Ga0209971_1113183 | Ga0209971_11131832 | 133 |
| 369 | 3300031665 | Ga0316575_10000232 | Ga0316575_100002329 | 133 |
| 370 | 3300032002 | Ga0307416_100562644 | Ga0307416_1005626442 | 133 |
| 371 | 3300035120 | Ga0373957_0433884 | Ga0373957_0433884_104_520 | 133 |
| 372 | 3300035691 | Ga0373931_0279802 | Ga0373931_0279802_165_587 | 133 |
| 373 | 3300036401 | Ga0373937_0026386 | Ga0373937_0026386_2005_2421 | 133 |
| 374 | 3300036647 | Ga0316582_0039871 | Ga0316582_0039871_1315_1737 | 133 |
| 375 | 3300042015 | Ga0439462_0158563 | Ga0439462_0158563_188_610 | 133 |
| 376 | 3300042461 | Ga0439460_0288402 | Ga0439460_0288402_123_542 | 133 |
| 377 | 3300044712 | Ga0453684_1281363 | Ga0453684_1281363_211_627 | 133 |
| 378 | 3300047321 | Ga0495676_0508029 | Ga0495676_0508029_279_695 | 133 |
| 379 | 3300049520 | Ga0501297_010513 | Ga0501297_010513_119_541 | 133 |
| 380 | 3300049522 | Ga0501299_138030 | Ga0501299_138030_147_569 | 133 |
| 381 | 3300049571 | Ga0501034_0011390 | Ga0501034_0011390_785_1204 | 133 |
| 382 | 3300049572 | Ga0501036_0011409 | Ga0501036_0011409_1883_2308 | 133 |
| 383 | 3300049572 | Ga0501036_0127730 | Ga0501036_0127730_256_681 | 133 |
| 384 | 3300049574 | Ga0501038_0928465 | Ga0501038_0928465_101_526 | 133 |
| 385 | 3300049575 | Ga0501039_0013815 | Ga0501039_0013815_117_542 | 133 |
| 386 | 3300049576 | Ga0501040_0192097 | Ga0501040_0192097_314_739 | 133 |
| 387 | 3300049577 | Ga0501041_0011932 | Ga0501041_0011932_624_1049 | 133 |
| 388 | 3300049577 | Ga0501041_0230361 | Ga0501041_0230361_292_717 | 133 |
| 389 | 3300049578 | Ga0501042_0003342 | Ga0501042_0003342_5593_6018 | 133 |
| 390 | 3300049579 | Ga0501043_0199465 | Ga0501043_0199465_443_868 | 133 |
| 391 | 3300049580 | Ga0501046_0179953 | Ga0501046_0179953_664_1089 | 133 |
| 392 | 3300049580 | Ga0501046_1134039 | Ga0501046_1134039_59_484 | 133 |
| 393 | 3300049582 | Ga0501048_0032648 | Ga0501048_0032648_1785_2210 | 133 |
| 394 | 3300049587 | Ga0501071_0015573 | Ga0501071_0015573_628_1053 | 133 |
| 395 | 3300049588 | Ga0501072_0003685 | Ga0501072_0003685_2273_2698 | 133 |
| 396 | 3300049588 | Ga0501072_0518449 | Ga0501072_0518449_121_546 | 133 |
| 397 | 3300049589 | Ga0501073_0463719 | Ga0501073_0463719_150_575 | 133 |
| 398 | 3300049590 | Ga0501074_0019104 | Ga0501074_0019104_2311_2736 | 133 |
| 399 | 3300049591 | Ga0501075_0044513 | Ga0501075_0044513_2068_2493 | 133 |
| 400 | 3300049591 | Ga0501075_0376283 | Ga0501075_0376283_311_736 | 133 |
| 401 | 3300049592 | Ga0501076_0003023 | Ga0501076_0003023_5004_5429 | 133 |
| 402 | 3300049592 | Ga0501076_0019677 | Ga0501076_0019677_418_843 | 133 |
| 403 | 3300049593 | Ga0501077_0550627 | Ga0501077_0550627_166_591 | 133 |
| 404 | 3300049741 | Ga0501079_0006062 | Ga0501079_0006062_2770_3195 | 133 |
| 405 | 3300049742 | Ga0501080_0006509 | Ga0501080_0006509_6805_7230 | 133 |
| 406 | 3300049742 | Ga0501080_0152381 | Ga0501080_0152381_1527_1952 | 133 |
| 407 | 3300049743 | Ga0501081_0002314 | Ga0501081_0002314_5945_6370 | 133 |
| 408 | 3300049744 | Ga0501083_0057518 | Ga0501083_0057518_332_757 | 133 |
| 409 | 3300049824 | Ga0501045_0000766 | Ga0501045_0000766_285_710 | 133 |
| 410 | 3300050512 | nmdc:mga0n895_689277_c1 | nmdc:mga0n895_689277_c1_70_492 | 133 |
| 411 | 3300054114 | Ga0501084_0082467 | Ga0501084_0082467_129_554 | 133 |
| 412 | 3300060353 | Ga0501082_0011839 | Ga0501082_0011839_459_884 | 133 |
| 413 | 3300060353 | Ga0501082_0230371 | Ga0501082_0230371_856_1281 | 133 |
| 414 | 3300061734 | Ga0530510_0000945 | Ga0530510_0000945_15989_16414 | 133 |
| 415 | 3300061734 | Ga0530510_0366553 | Ga0530510_0366553_199_624 | 133 |
| 416 | 3300005293 | Ga0065715_10669271 | Ga0065715_106692711 | 134 |
| 417 | 3300005295 | Ga0065707_10467584 | Ga0065707_104675841 | 134 |
| 418 | 3300005327 | Ga0070658_10399846 | Ga0070658_103998462 | 134 |
| 419 | 3300005328 | Ga0070676_10048890 | Ga0070676_100488903 | 134 |
| 420 | 3300005328 | Ga0070676_10931738 | Ga0070676_109317382 | 134 |
| 421 | 3300005331 | Ga0070670_100083904 | Ga0070670_1000839043 | 134 |
| 422 | 3300005333 | Ga0070677_10003447 | Ga0070677_100034474 | 134 |
| 423 | 3300005333 | Ga0070677_10198215 | Ga0070677_101982152 | 134 |
| 424 | 3300005335 | Ga0070666_10065754 | Ga0070666_100657543 | 134 |
| 425 | 3300005336 | Ga0070680_100699222 | Ga0070680_1006992222 | 134 |
| 426 | 3300005337 | Ga0070682_100179723 | Ga0070682_1001797232 | 134 |
| 427 | 3300005338 | Ga0068868_100073159 | Ga0068868_1000731593 | 134 |
| 428 | 3300005338 | Ga0068868_101252304 | Ga0068868_1012523041 | 134 |
| 429 | 3300005340 | Ga0070689_100500818 | Ga0070689_1005008181 | 134 |
| 430 | 3300005341 | Ga0070691_10083618 | Ga0070691_100836181 | 134 |
| 431 | 3300005341 | Ga0070691_10117632 | Ga0070691_101176323 | 134 |
| 432 | 3300005343 | Ga0070687_100132070 | Ga0070687_1001320702 | 134 |
| 433 | 3300005343 | Ga0070687_100474085 | Ga0070687_1004740852 | 134 |
| 434 | 3300005344 | Ga0070661_100118999 | Ga0070661_1001189993 | 134 |
| 435 | 3300005344 | Ga0070661_101323769 | Ga0070661_1013237691 | 134 |
| 436 | 3300005347 | Ga0070668_100122184 | Ga0070668_1001221841 | 134 |
| 437 | 3300005347 | Ga0070668_100706146 | Ga0070668_1007061462 | 134 |
| 438 | 3300005353 | Ga0070669_100166422 | Ga0070669_1001664222 | 134 |
| 439 | 3300005353 | Ga0070669_100336919 | Ga0070669_1003369192 | 134 |
| 440 | 3300005354 | Ga0070675_100119417 | Ga0070675_1001194174 | 134 |
| 441 | 3300005355 | Ga0070671_100042736 | Ga0070671_1000427364 | 134 |
| 442 | 3300005355 | Ga0070671_100271210 | Ga0070671_1002712102 | 134 |
| 443 | 3300005355 | Ga0070671_101853676 | Ga0070671_1018536761 | 134 |
| 444 | 3300005356 | Ga0070674_100030606 | Ga0070674_1000306064 | 134 |
| 445 | 3300005356 | Ga0070674_100456639 | Ga0070674_1004566392 | 134 |
| 446 | 3300005364 | Ga0070673_100044306 | Ga0070673_1000443063 | 134 |
| 447 | 3300005364 | Ga0070673_100055581 | Ga0070673_1000555814 | 134 |
| 448 | 3300005365 | Ga0070688_100598564 | Ga0070688_1005985642 | 134 |
| 449 | 3300005366 | Ga0070659_101334537 | Ga0070659_1013345372 | 134 |
| 450 | 3300005367 | Ga0070667_100041004 | Ga0070667_1000410045 | 134 |
| 451 | 3300005367 | Ga0070667_100217270 | Ga0070667_1002172702 | 134 |
| 452 | 3300005367 | Ga0070667_100601126 | Ga0070667_1006011261 | 134 |
| 453 | 3300005440 | Ga0070705_100390600 | Ga0070705_1003906002 | 134 |
| 454 | 3300005441 | Ga0070700_100099417 | Ga0070700_1000994173 | 134 |
| 455 | 3300005444 | Ga0070694_100149815 | Ga0070694_1001498153 | 134 |
| 456 | 3300005444 | Ga0070694_100151394 | Ga0070694_1001513942 | 134 |
| 457 | 3300005444 | Ga0070694_100172149 | Ga0070694_1001721492 | 134 |
| 458 | 3300005444 | Ga0070694_101540761 | Ga0070694_1015407611 | 134 |
| 459 | 3300005456 | Ga0070678_100025513 | Ga0070678_1000255135 | 134 |
| 460 | 3300005456 | Ga0070678_100110420 | Ga0070678_1001104202 | 134 |
| 461 | 3300005456 | Ga0070678_100501737 | Ga0070678_1005017372 | 134 |
| 462 | 3300005457 | Ga0070662_100672546 | Ga0070662_1006725462 | 134 |
| 463 | 3300005459 | Ga0068867_100302267 | Ga0068867_1003022671 | 134 |
| 464 | 3300005466 | Ga0070685_10423717 | Ga0070685_104237172 | 134 |
| 465 | 3300005467 | Ga0070706_100050486 | Ga0070706_1000504862 | 134 |
| 466 | 3300005536 | Ga0070697_100072004 | Ga0070697_1000720043 | 134 |
| 467 | 3300005536 | Ga0070697_101493637 | Ga0070697_1014936371 | 134 |
| 468 | 3300005539 | Ga0068853_101212206 | Ga0068853_1012122062 | 134 |
| 469 | 3300005539 | Ga0068853_101457658 | Ga0068853_1014576582 | 134 |
| 470 | 3300005543 | Ga0070672_100010574 | Ga0070672_1000105747 | 134 |
| 471 | 3300005543 | Ga0070672_100047876 | Ga0070672_1000478764 | 134 |
| 472 | 3300005543 | Ga0070672_100346695 | Ga0070672_1003466952 | 134 |
| 473 | 3300005544 | Ga0070686_100027336 | Ga0070686_1000273362 | 134 |
| 474 | 3300005545 | Ga0070695_100085829 | Ga0070695_1000858291 | 134 |
| 475 | 3300005547 | Ga0070693_100285622 | Ga0070693_1002856221 | 134 |
| 476 | 3300005548 | Ga0070665_100210764 | Ga0070665_1002107643 | 134 |
| 477 | 3300005549 | Ga0070704_100034277 | Ga0070704_1000342772 | 134 |
| 478 | 3300005549 | Ga0070704_100140290 | Ga0070704_1001402902 | 134 |
| 479 | 3300005549 | Ga0070704_100740196 | Ga0070704_1007401961 | 134 |
| 480 | 3300005564 | Ga0070664_100755889 | Ga0070664_1007558892 | 134 |
| 481 | 3300005564 | Ga0070664_102067616 | Ga0070664_1020676162 | 134 |
| 482 | 3300005578 | Ga0068854_100246931 | Ga0068854_1002469312 | 134 |
| 483 | 3300005614 | Ga0068856_100410526 | Ga0068856_1004105262 | 134 |
| 484 | 3300005614 | Ga0068856_101092571 | Ga0068856_1010925712 | 134 |
| 485 | 3300005615 | Ga0070702_100009084 | Ga0070702_1000090848 | 134 |
| 486 | 3300005616 | Ga0068852_100194764 | Ga0068852_1001947642 | 134 |
| 487 | 3300005617 | Ga0068859_100227548 | Ga0068859_1002275483 | 134 |
| 488 | 3300005618 | Ga0068864_100030630 | Ga0068864_1000306306 | 134 |
| 489 | 3300005718 | Ga0068866_10000076 | Ga0068866_1000007642 | 134 |
| 490 | 3300005718 | Ga0068866_10237597 | Ga0068866_102375972 | 134 |
| 491 | 3300005840 | Ga0068870_10042556 | Ga0068870_100425561 | 134 |
| 492 | 3300005840 | Ga0068870_10461075 | Ga0068870_104610752 | 134 |
| 493 | 3300005841 | Ga0068863_100631257 | Ga0068863_1006312572 | 134 |
| 494 | 3300005842 | Ga0068858_100000442 | Ga0068858_10000044215 | 134 |
| 495 | 3300005842 | Ga0068858_100062203 | Ga0068858_1000622032 | 134 |
| 496 | 3300005842 | Ga0068858_100849232 | Ga0068858_1008492322 | 134 |
| 497 | 3300005843 | Ga0068860_100799250 | Ga0068860_1007992502 | 134 |
| 498 | 3300005844 | Ga0068862_100000952 | Ga0068862_10000095227 | 134 |
| 499 | 3300005844 | Ga0068862_100133200 | Ga0068862_1001332003 | 134 |
| 500 | 3300006163 | Ga0070715_10664075 | Ga0070715_106640751 | 134 |
| 501 | 3300006237 | Ga0097621_100045264 | Ga0097621_1000452643 | 134 |
| 502 | 3300006237 | Ga0097621_100055977 | Ga0097621_1000559772 | 134 |
| 503 | 3300006358 | Ga0068871_100095357 | Ga0068871_1000953574 | 134 |
| 504 | 3300006846 | Ga0075430_100207070 | Ga0075430_1002070702 | 134 |
| 505 | 3300006847 | Ga0075431_100010497 | Ga0075431_1000104978 | 134 |
| 506 | 3300006847 | Ga0075431_100654811 | Ga0075431_1006548112 | 134 |
| 507 | 3300006880 | Ga0075429_100065627 | Ga0075429_1000656274 | 134 |
| 508 | 3300006880 | Ga0075429_100339869 | Ga0075429_1003398692 | 134 |
| 509 | 3300006881 | Ga0068865_100004680 | Ga0068865_1000046807 | 134 |
| 510 | 3300006881 | Ga0068865_100371785 | Ga0068865_1003717852 | 134 |
| 511 | 3300006881 | Ga0068865_100740148 | Ga0068865_1007401482 | 134 |
| 512 | 3300006931 | Ga0097620_100227543 | Ga0097620_1002275433 | 134 |
| 513 | 3300009094 | Ga0111539_10006144 | Ga0111539_100061445 | 134 |
| 514 | 3300009094 | Ga0111539_11709330 | Ga0111539_117093302 | 134 |
| 515 | 3300009098 | Ga0105245_10000279 | Ga0105245_100002797 | 134 |
| 516 | 3300009098 | Ga0105245_10193155 | Ga0105245_101931554 | 134 |
| 517 | 3300009098 | Ga0105245_11009829 | Ga0105245_110098292 | 134 |
| 518 | 3300009147 | Ga0114129_10199706 | Ga0114129_101997062 | 134 |
| 519 | 3300009148 | Ga0105243_10000328 | Ga0105243_100003287 | 134 |
| 520 | 3300009148 | Ga0105243_10042317 | Ga0105243_100423175 | 134 |
| 521 | 3300009148 | Ga0105243_11534987 | Ga0105243_115349871 | 134 |
| 522 | 3300009176 | Ga0105242_10000629 | Ga0105242_1000062931 | 134 |
| 523 | 3300009176 | Ga0105242_10177588 | Ga0105242_101775882 | 134 |
| 524 | 3300009177 | Ga0105248_10099558 | Ga0105248_100995585 | 134 |
| 525 | 3300009177 | Ga0105248_10154567 | Ga0105248_101545674 | 134 |
| 526 | 3300009177 | Ga0105248_11015863 | Ga0105248_110158632 | 134 |
| 527 | 3300009177 | Ga0105248_11367456 | Ga0105248_113674562 | 134 |
| 528 | 3300009553 | Ga0105249_10041028 | Ga0105249_100410285 | 134 |
| 529 | 3300009553 | Ga0105249_10185727 | Ga0105249_101857273 | 134 |
| 530 | 3300011119 | Ga0105246_10664469 | Ga0105246_106644692 | 134 |
| 531 | 3300013296 | Ga0157374_10054467 | Ga0157374_100544672 | 134 |
| 532 | 3300013296 | Ga0157374_10109574 | Ga0157374_101095741 | 134 |
| 533 | 3300013297 | Ga0157378_10005354 | Ga0157378_1000535411 | 134 |
| 534 | 3300013297 | Ga0157378_10010321 | Ga0157378_100103214 | 134 |
| 535 | 3300013297 | Ga0157378_10189673 | Ga0157378_101896734 | 134 |
| 536 | 3300013308 | Ga0157375_10029474 | Ga0157375_100294743 | 134 |
| 537 | 3300013308 | Ga0157375_10203443 | Ga0157375_102034434 | 134 |
| 538 | 3300013308 | Ga0157375_10723938 | Ga0157375_107239381 | 134 |
| 539 | 3300013308 | Ga0157375_11400237 | Ga0157375_114002371 | 134 |
| 540 | 3300014325 | Ga0163163_10898372 | Ga0163163_108983722 | 134 |
| 541 | 3300014326 | Ga0157380_10005446 | Ga0157380_100054463 | 134 |
| 542 | 3300014326 | Ga0157380_10977140 | Ga0157380_109771402 | 134 |
| 543 | 3300014326 | Ga0157380_13145535 | Ga0157380_131455351 | 134 |
| 544 | 3300014745 | Ga0157377_10307343 | Ga0157377_103073432 | 134 |
| 545 | 3300014968 | Ga0157379_10009379 | Ga0157379_1000937910 | 134 |
| 546 | 3300014968 | Ga0157379_10023336 | Ga0157379_100233367 | 134 |
| 547 | 3300014969 | Ga0157376_10118610 | Ga0157376_101186102 | 134 |
| 548 | 3300014969 | Ga0157376_10194291 | Ga0157376_101942913 | 134 |
| 549 | 3300017792 | Ga0163161_10037448 | Ga0163161_100374482 | 134 |
| 550 | 3300017792 | Ga0163161_10049557 | Ga0163161_100495573 | 134 |
| 551 | 3300025315 | Ga0207697_10015096 | Ga0207697_100150964 | 134 |
| 552 | 3300025321 | Ga0207656_10341985 | Ga0207656_103419852 | 134 |
| 553 | 3300025893 | Ga0207682_10005721 | Ga0207682_100057214 | 134 |
| 554 | 3300025893 | Ga0207682_10387554 | Ga0207682_103875542 | 134 |
| 555 | 3300025899 | Ga0207642_10020964 | Ga0207642_100209642 | 134 |
| 556 | 3300025899 | Ga0207642_10199560 | Ga0207642_101995601 | 134 |
| 557 | 3300025901 | Ga0207688_10209676 | Ga0207688_102096762 | 134 |
| 558 | 3300025907 | Ga0207645_10024383 | Ga0207645_100243833 | 134 |
| 559 | 3300025908 | Ga0207643_10005204 | Ga0207643_100052046 | 134 |
| 560 | 3300025908 | Ga0207643_10075362 | Ga0207643_100753622 | 134 |
| 561 | 3300025909 | Ga0207705_10201441 | Ga0207705_102014412 | 134 |
| 562 | 3300025910 | Ga0207684_10052018 | Ga0207684_100520183 | 134 |
| 563 | 3300025912 | Ga0207707_10063136 | Ga0207707_100631364 | 134 |
| 564 | 3300025917 | Ga0207660_10135206 | Ga0207660_101352062 | 134 |
| 565 | 3300025918 | Ga0207662_10819254 | Ga0207662_108192542 | 134 |
| 566 | 3300025920 | Ga0207649_11377079 | Ga0207649_113770791 | 134 |
| 567 | 3300025923 | Ga0207681_10186571 | Ga0207681_101865713 | 134 |
| 568 | 3300025925 | Ga0207650_10122628 | Ga0207650_101226282 | 134 |
| 569 | 3300025925 | Ga0207650_10141435 | Ga0207650_101414353 | 134 |
| 570 | 3300025925 | Ga0207650_10289082 | Ga0207650_102890823 | 134 |
| 571 | 3300025925 | Ga0207650_10474584 | Ga0207650_104745842 | 134 |
| 572 | 3300025926 | Ga0207659_10061637 | Ga0207659_100616374 | 134 |
| 573 | 3300025926 | Ga0207659_10072532 | Ga0207659_100725323 | 134 |
| 574 | 3300025926 | Ga0207659_10073001 | Ga0207659_100730012 | 134 |
| 575 | 3300025926 | Ga0207659_10659490 | Ga0207659_106594902 | 134 |
| 576 | 3300025926 | Ga0207659_10746826 | Ga0207659_107468262 | 134 |
| 577 | 3300025931 | Ga0207644_10033584 | Ga0207644_100335842 | 134 |
| 578 | 3300025931 | Ga0207644_10082985 | Ga0207644_100829853 | 134 |
| 579 | 3300025933 | Ga0207706_10018642 | Ga0207706_100186425 | 134 |
| 580 | 3300025934 | Ga0207686_10097810 | Ga0207686_100978102 | 134 |
| 581 | 3300025935 | Ga0207709_10008041 | Ga0207709_100080414 | 134 |
| 582 | 3300025936 | Ga0207670_10002690 | Ga0207670_100026907 | 134 |
| 583 | 3300025936 | Ga0207670_10116335 | Ga0207670_101163352 | 134 |
| 584 | 3300025937 | Ga0207669_10013598 | Ga0207669_100135982 | 134 |
| 585 | 3300025937 | Ga0207669_10137492 | Ga0207669_101374922 | 134 |
| 586 | 3300025937 | Ga0207669_10521039 | Ga0207669_105210392 | 134 |
| 587 | 3300025938 | Ga0207704_10781293 | Ga0207704_107812932 | 134 |
| 588 | 3300025940 | Ga0207691_10083518 | Ga0207691_100835184 | 134 |
| 589 | 3300025940 | Ga0207691_10249421 | Ga0207691_102494211 | 134 |
| 590 | 3300025940 | Ga0207691_10963779 | Ga0207691_109637792 | 134 |
| 591 | 3300025941 | Ga0207711_10179018 | Ga0207711_101790182 | 134 |
| 592 | 3300025942 | Ga0207689_10001264 | Ga0207689_1000126423 | 134 |
| 593 | 3300025942 | Ga0207689_10048148 | Ga0207689_100481482 | 134 |
| 594 | 3300025945 | Ga0207679_10552185 | Ga0207679_105521852 | 134 |
| 595 | 3300025945 | Ga0207679_10569083 | Ga0207679_105690831 | 134 |
| 596 | 3300025960 | Ga0207651_10078914 | Ga0207651_100789143 | 134 |
| 597 | 3300025960 | Ga0207651_10182372 | Ga0207651_101823723 | 134 |
| 598 | 3300025960 | Ga0207651_10462292 | Ga0207651_104622922 | 134 |
| 599 | 3300025961 | Ga0207712_10152538 | Ga0207712_101525382 | 134 |
| 600 | 3300025961 | Ga0207712_10951280 | Ga0207712_109512802 | 134 |
| 601 | 3300025972 | Ga0207668_10354122 | Ga0207668_103541222 | 134 |
| 602 | 3300025972 | Ga0207668_11226300 | Ga0207668_112263002 | 134 |
| 603 | 3300025981 | Ga0207640_10134548 | Ga0207640_101345483 | 134 |
| 604 | 3300025986 | Ga0207658_10232678 | Ga0207658_102326782 | 134 |
| 605 | 3300025986 | Ga0207658_10791567 | Ga0207658_107915671 | 134 |
| 606 | 3300026023 | Ga0207677_10082026 | Ga0207677_100820262 | 134 |
| 607 | 3300026023 | Ga0207677_10376671 | Ga0207677_103766712 | 134 |
| 608 | 3300026023 | Ga0207677_10862374 | Ga0207677_108623742 | 134 |
| 609 | 3300026035 | Ga0207703_10104125 | Ga0207703_101041251 | 134 |
| 610 | 3300026041 | Ga0207639_11368618 | Ga0207639_113686182 | 134 |
| 611 | 3300026067 | Ga0207678_10888986 | Ga0207678_108889862 | 134 |
| 612 | 3300026075 | Ga0207708_10000058 | Ga0207708_1000005890 | 134 |
| 613 | 3300026075 | Ga0207708_10014104 | Ga0207708_100141042 | 134 |
| 614 | 3300026078 | Ga0207702_10437946 | Ga0207702_104379462 | 134 |
| 615 | 3300026088 | Ga0207641_10041940 | Ga0207641_100419402 | 134 |
| 616 | 3300026088 | Ga0207641_10065794 | Ga0207641_100657942 | 134 |
| 617 | 3300026089 | Ga0207648_10000121 | Ga0207648_1000012183 | 134 |
| 618 | 3300026089 | Ga0207648_10022267 | Ga0207648_100222674 | 134 |
| 619 | 3300026089 | Ga0207648_10047353 | Ga0207648_100473535 | 134 |
| 620 | 3300026095 | Ga0207676_10174580 | Ga0207676_101745804 | 134 |
| 621 | 3300026095 | Ga0207676_10607058 | Ga0207676_106070582 | 134 |
| 622 | 3300026116 | Ga0207674_10373084 | Ga0207674_103730842 | 134 |
| 623 | 3300026118 | Ga0207675_100000143 | Ga0207675_10000014349 | 134 |
| 624 | 3300026118 | Ga0207675_100056721 | Ga0207675_1000567213 | 134 |
| 625 | 3300026121 | Ga0207683_10005276 | Ga0207683_100052763 | 134 |
| 626 | 3300026121 | Ga0207683_10017452 | Ga0207683_100174525 | 134 |
| 627 | 3300026121 | Ga0207683_10077218 | Ga0207683_100772183 | 134 |
| 628 | 3300026121 | Ga0207683_11697753 | Ga0207683_116977531 | 134 |
| 629 | 3300027907 | Ga0207428_10284778 | Ga0207428_102847782 | 134 |
| 630 | 3300028379 | Ga0268266_10346642 | Ga0268266_103466422 | 134 |
| 631 | 3300028380 | Ga0268265_10036789 | Ga0268265_100367893 | 134 |
| 632 | 3300028381 | Ga0268264_10046608 | Ga0268264_100466085 | 134 |
| 633 | 3300028381 | Ga0268264_11013529 | Ga0268264_110135292 | 134 |
| 634 | 3300028577 | Ga0265318_10060093 | Ga0265318_100600932 | 134 |
| 635 | 3300031235 | Ga0265330_10008863 | Ga0265330_100088634 | 134 |
| 636 | 3300031238 | Ga0265332_10012224 | Ga0265332_100122243 | 134 |
| 637 | 3300031239 | Ga0265328_10003721 | Ga0265328_100037214 | 134 |
| 638 | 3300031241 | Ga0265325_10441900 | Ga0265325_104419001 | 134 |
| 639 | 3300031242 | Ga0265329_10005212 | Ga0265329_100052125 | 134 |
| 640 | 3300031249 | Ga0265339_10119949 | Ga0265339_101199492 | 134 |
| 641 | 3300031250 | Ga0265331_10003027 | Ga0265331_100030274 | 134 |
| 642 | 3300031251 | Ga0265327_10108325 | Ga0265327_101083252 | 134 |
| 643 | 3300031344 | Ga0265316_10036177 | Ga0265316_100361772 | 134 |
| 644 | 3300031548 | Ga0307408_100498340 | Ga0307408_1004983402 | 134 |
| 645 | 3300031711 | Ga0265314_10011856 | Ga0265314_100118568 | 134 |
| 646 | 3300032002 | Ga0307416_103535146 | Ga0307416_1035351461 | 134 |
| 647 | 3300034819 | Ga0373958_0022583 | Ga0373958_0022583_431_859 | 134 |
| 648 | 3300039437 | Ga0436365_1535422 | Ga0436365_1535422_82_501 | 134 |
| 649 | 3300041463 | Ga0451804_0289310 | Ga0451804_0289310_113_544 | 134 |
| 650 | 3300041512 | Ga0451853_1110049 | Ga0451853_1110049_168_593 | 134 |
| 651 | 3300042876 | Ga0451577_0394603 | Ga0451577_0394603_796_1221 | 134 |
| 652 | 3300042876 | Ga0451577_0680984 | Ga0451577_0680984_352_777 | 134 |
| 653 | 3300045051 | Ga0451576_0092509 | Ga0451576_0092509_113_538 | 134 |
| 654 | 3300046525 | Ga0495663_0170056 | Ga0495663_0170056_218_643 | 134 |
| 655 | 3300046537 | Ga0495598_0009508 | Ga0495598_0009508_824_1249 | 134 |
| 656 | 3300046539 | Ga0495621_0072434 | Ga0495621_0072434_480_908 | 134 |
| 657 | 3300046683 | Ga0495658_0020747 | Ga0495658_0020747_2889_3314 | 134 |
| 658 | 3300046684 | Ga0495669_0043302 | Ga0495669_0043302_238_663 | 134 |
| 659 | 3300048907 | Ga0496104_0868068 | Ga0496104_0868068_29_454 | 134 |
| 660 | 3300048908 | Ga0496105_0416810 | Ga0496105_0416810_132_557 | 134 |
| 661 | 3300048909 | Ga0496106_0366866 | Ga0496106_0366866_546_971 | 134 |
| 662 | 3300048911 | Ga0496108_0222856 | Ga0496108_0222856_1078_1503 | 134 |
| 663 | 3300048912 | Ga0496109_0121010 | Ga0496109_0121010_284_709 | 134 |
| 664 | 3300048913 | Ga0496110_0080300 | Ga0496110_0080300_529_954 | 134 |
| 665 | 3300048917 | Ga0496114_0283883 | Ga0496114_0283883_882_1307 | 134 |
| 666 | 3300049571 | Ga0501034_0000736 | Ga0501034_0000736_43895_44314 | 134 |
| 667 | 3300049572 | Ga0501036_0110733 | Ga0501036_0110733_1241_1666 | 134 |
| 668 | 3300049572 | Ga0501036_0329443 | Ga0501036_0329443_188_613 | 134 |
| 669 | 3300049573 | Ga0501037_0122253 | Ga0501037_0122253_1087_1506 | 134 |
| 670 | 3300049573 | Ga0501037_0207585 | Ga0501037_0207585_436_861 | 134 |
| 671 | 3300049574 | Ga0501038_0774885 | Ga0501038_0774885_262_681 | 134 |
| 672 | 3300049575 | Ga0501039_0041288 | Ga0501039_0041288_1446_1871 | 134 |
| 673 | 3300049575 | Ga0501039_0925098 | Ga0501039_0925098_180_605 | 134 |
| 674 | 3300049575 | Ga0501039_1397368 | Ga0501039_1397368_74_493 | 134 |
| 675 | 3300049576 | Ga0501040_0057294 | Ga0501040_0057294_1251_1676 | 134 |
| 676 | 3300049578 | Ga0501042_1439924 | Ga0501042_1439924_20_445 | 134 |
| 677 | 3300049579 | Ga0501043_0184695 | Ga0501043_0184695_317_736 | 134 |
| 678 | 3300049579 | Ga0501043_0313675 | Ga0501043_0313675_252_677 | 134 |
| 679 | 3300049580 | Ga0501046_0014667 | Ga0501046_0014667_1133_1558 | 134 |
| 680 | 3300049582 | Ga0501048_0361246 | Ga0501048_0361246_222_647 | 134 |
| 681 | 3300049584 | Ga0501068_0001429 | Ga0501068_0001429_5061_5480 | 134 |
| 682 | 3300049584 | Ga0501068_0038276 | Ga0501068_0038276_509_934 | 134 |
| 683 | 3300049587 | Ga0501071_0042333 | Ga0501071_0042333_2194_2619 | 134 |
| 684 | 3300049588 | Ga0501072_0000910 | Ga0501072_0000910_4030_4449 | 134 |
| 685 | 3300049588 | Ga0501072_0321149 | Ga0501072_0321149_367_792 | 134 |
| 686 | 3300049589 | Ga0501073_0004078 | Ga0501073_0004078_7426_7845 | 134 |
| 687 | 3300049590 | Ga0501074_0039408 | Ga0501074_0039408_2655_3074 | 134 |
| 688 | 3300049590 | Ga0501074_0134629 | Ga0501074_0134629_660_1085 | 134 |
| 689 | 3300049591 | Ga0501075_0741824 | Ga0501075_0741824_10_435 | 134 |
| 690 | 3300049591 | Ga0501075_1463352 | Ga0501075_1463352_72_497 | 134 |
| 691 | 3300049592 | Ga0501076_0028780 | Ga0501076_0028780_2335_2760 | 134 |
| 692 | 3300049593 | Ga0501077_0034211 | Ga0501077_0034211_1408_1833 | 134 |
| 693 | 3300049741 | Ga0501079_0096217 | Ga0501079_0096217_1792_2217 | 134 |
| 694 | 3300049742 | Ga0501080_0001631 | Ga0501080_0001631_14059_14478 | 134 |
| 695 | 3300049742 | Ga0501080_0018841 | Ga0501080_0018841_4373_4798 | 134 |
| 696 | 3300049742 | Ga0501080_0924342 | Ga0501080_0924342_95_514 | 134 |
| 697 | 3300049743 | Ga0501081_0005048 | Ga0501081_0005048_1746_2171 | 134 |
| 698 | 3300049743 | Ga0501081_0105029 | Ga0501081_0105029_522_947 | 134 |
| 699 | 3300049744 | Ga0501083_0002703 | Ga0501083_0002703_6836_7261 | 134 |
| 700 | 3300049744 | Ga0501083_0013468 | Ga0501083_0013468_4722_5141 | 134 |
| 701 | 3300050507 | nmdc:mga05p37_1235803_c1 | nmdc:mga05p37_1235803_c1_37_462 | 134 |
| 702 | 3300050508 | nmdc:mga09592_175962_c1 | nmdc:mga09592_175962_c1_1354_1779 | 134 |
| 703 | 3300050509 | nmdc:mga0qj67_1162468_c1 | nmdc:mga0qj67_1162468_c1_88_516 | 134 |
| 704 | 3300050509 | nmdc:mga0qj67_517559_c1 | nmdc:mga0qj67_517559_c1_460_885 | 134 |
| 705 | 3300050511 | nmdc:mga08y16_533089_c1 | nmdc:mga08y16_533089_c1_583_1008 | 134 |
| 706 | 3300050511 | nmdc:mga08y16_8908_c1 | nmdc:mga08y16_8908_c1_3031_3456 | 134 |
| 707 | 3300050515 | nmdc:mga0a205_451421_c1 | nmdc:mga0a205_451421_c1_634_1059 | 134 |
| 708 | 3300054114 | Ga0501084_0111519 | Ga0501084_0111519_849_1268 | 134 |
| 709 | 3300054114 | Ga0501084_0186580 | Ga0501084_0186580_603_1028 | 134 |
| 710 | 3300060353 | Ga0501082_0045137 | Ga0501082_0045137_1782_2207 | 134 |
| 711 | 3300060353 | Ga0501082_0387912 | Ga0501082_0387912_168_587 | 134 |
| 712 | 3300005356 | Ga0070674_101532092 | Ga0070674_1015320921 | 135 |
| 713 | 3300006846 | Ga0075430_100008948 | Ga0075430_10000894810 | 135 |
| 714 | 3300025937 | Ga0207669_10764793 | Ga0207669_107647932 | 135 |
| 715 | 3300031250 | Ga0265331_10127325 | Ga0265331_101273252 | 135 |
| 716 | 3300042003 | Ga0439443_044163 | Ga0439443_044163_329_757 | 135 |
| 717 | 3300042876 | Ga0451577_0001260 | Ga0451577_0001260_5626_6057 | 135 |
| 718 | 3300042876 | Ga0451577_0006351 | Ga0451577_0006351_3672_4103 | 135 |
| 719 | 3300044712 | Ga0453684_0095901 | Ga0453684_0095901_1961_2392 | 135 |
| 720 | 3300045051 | Ga0451576_0006043 | Ga0451576_0006043_375_806 | 135 |
| 721 | 3300049576 | Ga0501040_0050613 | Ga0501040_0050613_2365_2799 | 135 |
| 722 | 3300005334 | Ga0068869_101137894 | Ga0068869_1011378941 | 136 |
| 723 | 3300005336 | Ga0070680_100249963 | Ga0070680_1002499632 | 136 |
| 724 | 3300005440 | Ga0070705_100396085 | Ga0070705_1003960852 | 136 |
| 725 | 3300005441 | Ga0070700_100236442 | Ga0070700_1002364422 | 136 |
| 726 | 3300005455 | Ga0070663_100138750 | Ga0070663_1001387502 | 136 |
| 727 | 3300005458 | Ga0070681_10074249 | Ga0070681_100742491 | 136 |
| 728 | 3300005535 | Ga0070684_100483072 | Ga0070684_1004830722 | 136 |
| 729 | 3300005549 | Ga0070704_100237601 | Ga0070704_1002376012 | 136 |
| 730 | 3300005563 | Ga0068855_100147363 | Ga0068855_1001473633 | 136 |
| 731 | 3300005577 | Ga0068857_100017748 | Ga0068857_1000177487 | 136 |
| 732 | 3300005614 | Ga0068856_100196588 | Ga0068856_1001965881 | 136 |
| 733 | 3300009174 | Ga0105241_10119896 | Ga0105241_101198964 | 136 |
| 734 | 3300009545 | Ga0105237_10019997 | Ga0105237_100199977 | 136 |
| 735 | 3300010375 | Ga0105239_10097074 | Ga0105239_100970742 | 136 |
| 736 | 3300025911 | Ga0207654_10501493 | Ga0207654_105014932 | 136 |
| 737 | 3300025949 | Ga0207667_10295894 | Ga0207667_102958942 | 136 |
| 738 | 3300026035 | Ga0207703_10374934 | Ga0207703_103749342 | 136 |
| 739 | 3300026116 | Ga0207674_10032949 | Ga0207674_100329495 | 136 |
| 740 | 3300035724 | Ga0373933_0040367 | Ga0373933_0040367_657_1082 | 136 |
| 741 | 3300047322 | Ga0495680_0232929 | Ga0495680_0232929_127_552 | 136 |
| 742 | 3300005330 | Ga0070690_100817040 | Ga0070690_1008170401 | 137 |
| 743 | 3300005338 | Ga0068868_100842698 | Ga0068868_1008426981 | 137 |
| 744 | 3300005343 | Ga0070687_101000230 | Ga0070687_1010002301 | 137 |
| 745 | 3300005345 | Ga0070692_10200256 | Ga0070692_102002562 | 137 |
| 746 | 3300005347 | Ga0070668_100080727 | Ga0070668_1000807272 | 137 |
| 747 | 3300005364 | Ga0070673_100326679 | Ga0070673_1003266792 | 137 |
| 748 | 3300005441 | Ga0070700_100202877 | Ga0070700_1002028772 | 137 |
| 749 | 3300005456 | Ga0070678_100257442 | Ga0070678_1002574422 | 137 |
| 750 | 3300005457 | Ga0070662_101324465 | Ga0070662_1013244651 | 137 |
| 751 | 3300005544 | Ga0070686_101878428 | Ga0070686_1018784281 | 137 |
| 752 | 3300005548 | Ga0070665_100070429 | Ga0070665_1000704292 | 137 |
| 753 | 3300005564 | Ga0070664_100828612 | Ga0070664_1008286121 | 137 |
| 754 | 3300005577 | Ga0068857_100091436 | Ga0068857_1000914362 | 137 |
| 755 | 3300005614 | Ga0068856_100239215 | Ga0068856_1002392152 | 137 |
| 756 | 3300005618 | Ga0068864_101053974 | Ga0068864_1010539742 | 137 |
| 757 | 3300005718 | Ga0068866_10062319 | Ga0068866_100623193 | 137 |
| 758 | 3300005842 | Ga0068858_101271470 | Ga0068858_1012714702 | 137 |
| 759 | 3300006871 | Ga0075434_100478950 | Ga0075434_1004789502 | 137 |
| 760 | 3300009098 | Ga0105245_10054670 | Ga0105245_100546704 | 137 |
| 761 | 3300010375 | Ga0105239_12427338 | Ga0105239_124273381 | 137 |
| 762 | 3300013296 | Ga0157374_10730633 | Ga0157374_107306332 | 137 |
| 763 | 3300013297 | Ga0157378_10467196 | Ga0157378_104671961 | 137 |
| 764 | 3300014326 | Ga0157380_10441454 | Ga0157380_104414542 | 137 |
| 765 | 3300025899 | Ga0207642_10153234 | Ga0207642_101532342 | 137 |
| 766 | 3300025924 | Ga0207694_11002958 | Ga0207694_110029582 | 137 |
| 767 | 3300025932 | Ga0207690_10730292 | Ga0207690_107302922 | 137 |
| 768 | 3300025938 | Ga0207704_10053094 | Ga0207704_100530942 | 137 |
| 769 | 3300025941 | Ga0207711_11259548 | Ga0207711_112595482 | 137 |
| 770 | 3300025942 | Ga0207689_10270416 | Ga0207689_102704162 | 137 |
| 771 | 3300025945 | Ga0207679_10709718 | Ga0207679_107097181 | 137 |
| 772 | 3300026023 | Ga0207677_10037952 | Ga0207677_100379522 | 137 |
| 773 | 3300026023 | Ga0207677_10200638 | Ga0207677_102006382 | 137 |
| 774 | 3300026035 | Ga0207703_10351563 | Ga0207703_103515633 | 137 |
| 775 | 3300026041 | Ga0207639_10396423 | Ga0207639_103964232 | 137 |
| 776 | 3300026075 | Ga0207708_10233950 | Ga0207708_102339502 | 137 |
| 777 | 3300026078 | Ga0207702_10114151 | Ga0207702_101141513 | 137 |
| 778 | 3300026095 | Ga0207676_10383007 | Ga0207676_103830072 | 137 |
| 779 | 3300026121 | Ga0207683_10154661 | Ga0207683_101546613 | 137 |
| 780 | 3300028379 | Ga0268266_10021482 | Ga0268266_100214826 | 137 |
| 781 | 3300028381 | Ga0268264_10665234 | Ga0268264_106652342 | 137 |
| 782 | 3300041406 | Ga0439439_0210289 | Ga0439439_0210289_12_428 | 137 |
| 783 | 3300048915 | Ga0496112_1044568 | Ga0496112_1044568_140_574 | 137 |
| 784 | 3300050511 | nmdc:mga08y16_2162484_c1 | nmdc:mga08y16_2162484_c1_22_456 | 137 |
| 785 | 3300014326 | Ga0157380_11148501 | Ga0157380_111485012 | 138 |
| 786 | 3300031911 | Ga0307412_10791382 | Ga0307412_107913822 | 138 |
| 787 | 3300031911 | Ga0307412_11069507 | Ga0307412_110695071 | 138 |
| 788 | 3300044673 | Ga0453683_0806786 | Ga0453683_0806786_14_442 | 138 |
| 789 | 3300045051 | Ga0451576_1214693 | Ga0451576_1214693_79_504 | 138 |
| 790 | iso_pu_bacteria | 2643221654 | 2644302697 | 138 |
| 791 | iso_pu_bacteria | 2643221660 | 2644338909 | 138 |
| 792 | 3300005530 | Ga0070679_100296260 | Ga0070679_1002962602 | 139 |
| 793 | 3300009093 | Ga0105240_10024979 | Ga0105240_100249793 | 139 |
| 794 | 3300012513 | Ga0157326_1035325 | Ga0157326_10353251 | 139 |
| 795 | 3300025921 | Ga0207652_10462507 | Ga0207652_104625072 | 139 |
| 796 | 3300031250 | Ga0265331_10525456 | Ga0265331_105254561 | 139 |
| 797 | 3300038443 | Ga0395901_1034950 | Ga0395901_1034950_270_701 | 139 |
| 798 | 3300025901 | Ga0207688_10248797 | Ga0207688_102487971 | 140 |
| 799 | 3300025926 | Ga0207659_10280908 | Ga0207659_102809082 | 140 |
| 800 | 3300046454 | Ga0495592_0000237 | Ga0495592_0000237_22684_23106 | 140 |
| 801 | 3300049580 | Ga0501046_0102177 | Ga0501046_0102177_1588_2025 | 140 |
| 802 | 3300005330 | Ga0070690_100381469 | Ga0070690_1003814692 | 141 |
| 803 | 3300005335 | Ga0070666_10856859 | Ga0070666_108568591 | 141 |
| 804 | 3300005364 | Ga0070673_100156271 | Ga0070673_1001562714 | 141 |
| 805 | 3300005455 | Ga0070663_100257192 | Ga0070663_1002571922 | 141 |
| 806 | 3300005459 | Ga0068867_100005613 | Ga0068867_1000056136 | 141 |
| 807 | 3300005539 | Ga0068853_100532240 | Ga0068853_1005322402 | 141 |
| 808 | 3300005577 | Ga0068857_100012597 | Ga0068857_1000125976 | 141 |
| 809 | 3300005578 | Ga0068854_100128619 | Ga0068854_1001286192 | 141 |
| 810 | 3300005616 | Ga0068852_100009754 | Ga0068852_1000097544 | 141 |
| 811 | 3300005617 | Ga0068859_100029195 | Ga0068859_1000291955 | 141 |
| 812 | 3300006038 | Ga0075365_10019696 | Ga0075365_100196962 | 141 |
| 813 | 3300006042 | Ga0075368_10009558 | Ga0075368_100095582 | 141 |
| 814 | 3300006048 | Ga0075363_100041779 | Ga0075363_1000417794 | 141 |
| 815 | 3300006051 | Ga0075364_10485397 | Ga0075364_104853972 | 141 |
| 816 | 3300006177 | Ga0075362_10001957 | Ga0075362_100019579 | 141 |
| 817 | 3300006178 | Ga0075367_10037112 | Ga0075367_100371123 | 141 |
| 818 | 3300006178 | Ga0075367_10633990 | Ga0075367_106339901 | 141 |
| 819 | 3300006186 | Ga0075369_10008676 | Ga0075369_100086763 | 141 |
| 820 | 3300006195 | Ga0075366_10098545 | Ga0075366_100985453 | 141 |
| 821 | 3300006353 | Ga0075370_10010871 | Ga0075370_100108716 | 141 |
| 822 | 3300006353 | Ga0075370_10027521 | Ga0075370_100275214 | 141 |
| 823 | 3300009093 | Ga0105240_10043802 | Ga0105240_100438025 | 141 |
| 824 | 3300009148 | Ga0105243_10929159 | Ga0105243_109291591 | 141 |
| 825 | 3300009174 | Ga0105241_10285839 | Ga0105241_102858391 | 141 |
| 826 | 3300009545 | Ga0105237_10023165 | Ga0105237_100231652 | 141 |
| 827 | 3300010375 | Ga0105239_10034134 | Ga0105239_100341347 | 141 |
| 828 | 3300025907 | Ga0207645_10453464 | Ga0207645_104534642 | 141 |
| 829 | 3300025908 | Ga0207643_10018546 | Ga0207643_100185465 | 141 |
| 830 | 3300025914 | Ga0207671_10028571 | Ga0207671_100285716 | 141 |
| 831 | 3300025927 | Ga0207687_10892312 | Ga0207687_108923121 | 141 |
| 832 | 3300025938 | Ga0207704_11280964 | Ga0207704_112809641 | 141 |
| 833 | 3300025981 | Ga0207640_10061774 | Ga0207640_100617742 | 141 |
| 834 | 3300026023 | Ga0207677_10311169 | Ga0207677_103111691 | 141 |
| 835 | 3300026035 | Ga0207703_10742300 | Ga0207703_107423002 | 141 |
| 836 | 3300026041 | Ga0207639_10083964 | Ga0207639_100839645 | 141 |
| 837 | 3300026067 | Ga0207678_10157281 | Ga0207678_101572813 | 141 |
| 838 | 3300026089 | Ga0207648_10045378 | Ga0207648_100453782 | 141 |
| 839 | 3300026116 | Ga0207674_10159973 | Ga0207674_101599731 | 141 |
| 840 | 3300026142 | Ga0207698_11021245 | Ga0207698_110212452 | 141 |
| 841 | 3300027866 | Ga0209813_10010978 | Ga0209813_100109783 | 141 |
| 842 | 3300031548 | Ga0307408_100659709 | Ga0307408_1006597092 | 141 |
| 843 | 3300032005 | Ga0307411_11692783 | Ga0307411_116927831 | 141 |
| 844 | 3300035695 | Ga0373927_0126277 | Ga0373927_0126277_1017_1442 | 141 |
| 845 | 3300035725 | Ga0373947_0644544 | Ga0373947_0644544_254_679 | 141 |
| 846 | 3300041997 | Ga0439431_0050391 | Ga0439431_0050391_136_561 | 141 |
| 847 | 3300042126 | Ga0450888_014470 | Ga0450888_014470_359_784 | 141 |
| 848 | 3300042134 | Ga0450898_008229 | Ga0450898_008229_44_469 | 141 |
| 849 | 3300042156 | Ga0439446_0309148 | Ga0439446_0309148_117_542 | 141 |
| 850 | 3300046681 | Ga0495647_0096873 | Ga0495647_0096873_435_860 | 141 |
| 851 | 3300046683 | Ga0495658_0145953 | Ga0495658_0145953_748_1173 | 141 |
| 852 | 3300047443 | Ga0495687_001087 | Ga0495687_001087_25145_25570 | 141 |
| 853 | 3300048091 | Ga0495626_0127504 | Ga0495626_0127504_620_1045 | 141 |
| 854 | 3300049741 | Ga0501079_0702920 | Ga0501079_0702920_250_675 | 141 |
| 855 | 3300050489 | nmdc:mga03683_172376_c1 | nmdc:mga03683_172376_c1_549_974 | 141 |
| 856 | 3300050490 | nmdc:mga03n38_21294_c1 | nmdc:mga03n38_21294_c1_194_622 | 141 |
| 857 | 3300050491 | nmdc:mga00v17_91783_c1 | nmdc:mga00v17_91783_c1_164_589 | 141 |
| 858 | 3300050492 | nmdc:mga0yw44_166232_c1 | nmdc:mga0yw44_166232_c1_27_455 | 141 |
| 859 | 3300050493 | nmdc:mga0k408_21109_c1 | nmdc:mga0k408_21109_c1_1680_2105 | 141 |
| 860 | 3300050493 | nmdc:mga0k408_36491_c1 | nmdc:mga0k408_36491_c1_1236_1661 | 141 |
| 861 | 3300050494 | nmdc:mga06z11_15228_c1 | nmdc:mga06z11_15228_c1_1506_1931 | 141 |
| 862 | 3300050494 | nmdc:mga06z11_3894_c1 | nmdc:mga06z11_3894_c1_5371_5799 | 141 |
| 863 | 3300050495 | nmdc:mga04h51_25330_c1 | nmdc:mga04h51_25330_c1_451_876 | 141 |
| 864 | 3300050495 | nmdc:mga04h51_7728_c1 | nmdc:mga04h51_7728_c1_1522_1950 | 141 |
| 865 | 3300050496 | nmdc:mga07m45_1622_c1 | nmdc:mga07m45_1622_c1_8114_8542 | 141 |
| 866 | 3300050496 | nmdc:mga07m45_6702_c1 | nmdc:mga07m45_6702_c1_4651_5076 | 141 |
| 867 | 3300050516 | nmdc:mga0sz30_2878_c1 | nmdc:mga0sz30_2878_c1_3788_4216 | 141 |
| 868 | 3300003347 | JGI26128J50194_1003477 | JGI26128J50194_10034772 | 142 |
| 869 | 3300005328 | Ga0070676_10011422 | Ga0070676_100114226 | 142 |
| 870 | 3300005328 | Ga0070676_11182796 | Ga0070676_111827961 | 142 |
| 871 | 3300005331 | Ga0070670_100072630 | Ga0070670_1000726304 | 142 |
| 872 | 3300005334 | Ga0068869_100079862 | Ga0068869_1000798623 | 142 |
| 873 | 3300005334 | Ga0068869_100264125 | Ga0068869_1002641252 | 142 |
| 874 | 3300005338 | Ga0068868_100043659 | Ga0068868_1000436592 | 142 |
| 875 | 3300005338 | Ga0068868_100849263 | Ga0068868_1008492632 | 142 |
| 876 | 3300005355 | Ga0070671_100046476 | Ga0070671_1000464763 | 142 |
| 877 | 3300005355 | Ga0070671_100059799 | Ga0070671_1000597993 | 142 |
| 878 | 3300005356 | Ga0070674_100287626 | Ga0070674_1002876261 | 142 |
| 879 | 3300005364 | Ga0070673_100001741 | Ga0070673_1000017413 | 142 |
| 880 | 3300005366 | Ga0070659_100559422 | Ga0070659_1005594221 | 142 |
| 881 | 3300005367 | Ga0070667_100003744 | Ga0070667_1000037448 | 142 |
| 882 | 3300005367 | Ga0070667_100136381 | Ga0070667_1001363812 | 142 |
| 883 | 3300005367 | Ga0070667_100401046 | Ga0070667_1004010462 | 142 |
| 884 | 3300005367 | Ga0070667_101013773 | Ga0070667_1010137732 | 142 |
| 885 | 3300005456 | Ga0070678_100063394 | Ga0070678_1000633944 | 142 |
| 886 | 3300005459 | Ga0068867_100004640 | Ga0068867_1000046401 | 142 |
| 887 | 3300005548 | Ga0070665_100041322 | Ga0070665_1000413226 | 142 |
| 888 | 3300005548 | Ga0070665_100806753 | Ga0070665_1008067531 | 142 |
| 889 | 3300005564 | Ga0070664_100437150 | Ga0070664_1004371501 | 142 |
| 890 | 3300005577 | Ga0068857_100166574 | Ga0068857_1001665744 | 142 |
| 891 | 3300005617 | Ga0068859_100630261 | Ga0068859_1006302612 | 142 |
| 892 | 3300005617 | Ga0068859_102172732 | Ga0068859_1021727321 | 142 |
| 893 | 3300005618 | Ga0068864_100004217 | Ga0068864_1000042178 | 142 |
| 894 | 3300005840 | Ga0068870_10012568 | Ga0068870_100125682 | 142 |
| 895 | 3300005841 | Ga0068863_100002662 | Ga0068863_10000266210 | 142 |
| 896 | 3300005842 | Ga0068858_101191011 | Ga0068858_1011910111 | 142 |
| 897 | 3300005843 | Ga0068860_100116350 | Ga0068860_1001163503 | 142 |
| 898 | 3300005843 | Ga0068860_100311452 | Ga0068860_1003114522 | 142 |
| 899 | 3300006042 | Ga0075368_10019412 | Ga0075368_100194125 | 142 |
| 900 | 3300006048 | Ga0075363_100383143 | Ga0075363_1003831432 | 142 |
| 901 | 3300006186 | Ga0075369_10039561 | Ga0075369_100395611 | 142 |
| 902 | 3300006195 | Ga0075366_10008996 | Ga0075366_100089963 | 142 |
| 903 | 3300006195 | Ga0075366_10020936 | Ga0075366_100209365 | 142 |
| 904 | 3300006195 | Ga0075366_10038797 | Ga0075366_100387972 | 142 |
| 905 | 3300006237 | Ga0097621_100415390 | Ga0097621_1004153901 | 142 |
| 906 | 3300006353 | Ga0075370_10000366 | Ga0075370_1000036610 | 142 |
| 907 | 3300006353 | Ga0075370_10010448 | Ga0075370_100104486 | 142 |
| 908 | 3300006353 | Ga0075370_10751327 | Ga0075370_107513271 | 142 |
| 909 | 3300006881 | Ga0068865_100252927 | Ga0068865_1002529272 | 142 |
| 910 | 3300006881 | Ga0068865_100757180 | Ga0068865_1007571802 | 142 |
| 911 | 3300006931 | Ga0097620_100630212 | Ga0097620_1006302122 | 142 |
| 912 | 3300006931 | Ga0097620_102172728 | Ga0097620_1021727282 | 142 |
| 913 | 3300009098 | Ga0105245_10017419 | Ga0105245_100174195 | 142 |
| 914 | 3300009098 | Ga0105245_11464193 | Ga0105245_114641932 | 142 |
| 915 | 3300009177 | Ga0105248_10108959 | Ga0105248_101089592 | 142 |
| 916 | 3300009551 | Ga0105238_11034900 | Ga0105238_110349002 | 142 |
| 917 | 3300009553 | Ga0105249_10312075 | Ga0105249_103120752 | 142 |
| 918 | 3300009553 | Ga0105249_10386522 | Ga0105249_103865222 | 142 |
| 919 | 3300011119 | Ga0105246_10200007 | Ga0105246_102000072 | 142 |
| 920 | 3300013306 | Ga0163162_10109032 | Ga0163162_101090322 | 142 |
| 921 | 3300013306 | Ga0163162_11243326 | Ga0163162_112433261 | 142 |
| 922 | 3300013308 | Ga0157375_10089129 | Ga0157375_100891292 | 142 |
| 923 | 3300013308 | Ga0157375_11244299 | Ga0157375_112442992 | 142 |
| 924 | 3300014325 | Ga0163163_10939065 | Ga0163163_109390652 | 142 |
| 925 | 3300014968 | Ga0157379_10245831 | Ga0157379_102458312 | 142 |
| 926 | 3300017792 | Ga0163161_10207972 | Ga0163161_102079723 | 142 |
| 927 | 3300025907 | Ga0207645_10015401 | Ga0207645_100154011 | 142 |
| 928 | 3300025924 | Ga0207694_11498981 | Ga0207694_114989811 | 142 |
| 929 | 3300025927 | Ga0207687_10137735 | Ga0207687_101377352 | 142 |
| 930 | 3300025927 | Ga0207687_10240758 | Ga0207687_102407583 | 142 |
| 931 | 3300025931 | Ga0207644_10015701 | Ga0207644_100157015 | 142 |
| 932 | 3300025931 | Ga0207644_10442976 | Ga0207644_104429762 | 142 |
| 933 | 3300025932 | Ga0207690_10433682 | Ga0207690_104336821 | 142 |
| 934 | 3300025941 | Ga0207711_10128035 | Ga0207711_101280353 | 142 |
| 935 | 3300025942 | Ga0207689_10079396 | Ga0207689_100793963 | 142 |
| 936 | 3300025961 | Ga0207712_10114397 | Ga0207712_101143972 | 142 |
| 937 | 3300025961 | Ga0207712_10315739 | Ga0207712_103157391 | 142 |
| 938 | 3300025986 | Ga0207658_10004811 | Ga0207658_100048113 | 142 |
| 939 | 3300025986 | Ga0207658_10333230 | Ga0207658_103332301 | 142 |
| 940 | 3300025986 | Ga0207658_10390154 | Ga0207658_103901542 | 142 |
| 941 | 3300025986 | Ga0207658_10480332 | Ga0207658_104803322 | 142 |
| 942 | 3300026023 | Ga0207677_10008704 | Ga0207677_100087045 | 142 |
| 943 | 3300026035 | Ga0207703_10551746 | Ga0207703_105517462 | 142 |
| 944 | 3300026088 | Ga0207641_10027510 | Ga0207641_100275102 | 142 |
| 945 | 3300026089 | Ga0207648_10152615 | Ga0207648_101526151 | 142 |
| 946 | 3300026095 | Ga0207676_10004330 | Ga0207676_100043303 | 142 |
| 947 | 3300026116 | Ga0207674_10017885 | Ga0207674_100178856 | 142 |
| 948 | 3300026116 | Ga0207674_10190465 | Ga0207674_101904651 | 142 |
| 949 | 3300027471 | Ga0209995_1023439 | Ga0209995_10234392 | 142 |
| 950 | 3300027526 | Ga0209968_1000406 | Ga0209968_10004067 | 142 |
| 951 | 3300027695 | Ga0209966_1001477 | Ga0209966_10014775 | 142 |
| 952 | 3300027866 | Ga0209813_10084932 | Ga0209813_100849322 | 142 |
| 953 | 3300028379 | Ga0268266_10054582 | Ga0268266_100545826 | 142 |
| 954 | 3300028381 | Ga0268264_10094702 | Ga0268264_100947023 | 142 |
| 955 | 3300028786 | Ga0307517_10000499 | Ga0307517_1000049935 | 142 |
| 956 | 3300028786 | Ga0307517_10053917 | Ga0307517_100539175 | 142 |
| 957 | 3300028794 | Ga0307515_10017831 | Ga0307515_1001783112 | 142 |
| 958 | 3300028794 | Ga0307515_10061230 | Ga0307515_100612306 | 142 |
| 959 | 3300028794 | Ga0307515_10303092 | Ga0307515_103030922 | 142 |
| 960 | 3300028794 | Ga0307515_10344822 | Ga0307515_103448221 | 142 |
| 961 | 3300030522 | Ga0307512_10113943 | Ga0307512_101139433 | 142 |
| 962 | 3300031456 | Ga0307513_10021752 | Ga0307513_100217527 | 142 |
| 963 | 3300031456 | Ga0307513_10302643 | Ga0307513_103026432 | 142 |
| 964 | 3300031507 | Ga0307509_10002631 | Ga0307509_100026319 | 142 |
| 965 | 3300031507 | Ga0307509_10004339 | Ga0307509_1000433921 | 142 |
| 966 | 3300031507 | Ga0307509_10012369 | Ga0307509_100123697 | 142 |
| 967 | 3300031507 | Ga0307509_10027391 | Ga0307509_100273915 | 142 |
| 968 | 3300031507 | Ga0307509_10066960 | Ga0307509_100669606 | 142 |
| 969 | 3300031507 | Ga0307509_10176895 | Ga0307509_101768953 | 142 |
| 970 | 3300031616 | Ga0307508_10017553 | Ga0307508_100175535 | 142 |
| 971 | 3300031616 | Ga0307508_10107934 | Ga0307508_101079342 | 142 |
| 972 | 3300031616 | Ga0307508_10165511 | Ga0307508_101655113 | 142 |
| 973 | 3300031616 | Ga0307508_10207068 | Ga0307508_102070682 | 142 |
| 974 | 3300031649 | Ga0307514_10016794 | Ga0307514_100167946 | 142 |
| 975 | 3300031649 | Ga0307514_10018499 | Ga0307514_100184996 | 142 |
| 976 | 3300031649 | Ga0307514_10432961 | Ga0307514_104329612 | 142 |
| 977 | 3300031730 | Ga0307516_10195244 | Ga0307516_101952442 | 142 |
| 978 | 3300031730 | Ga0307516_10261674 | Ga0307516_102616741 | 142 |
| 979 | 3300033179 | Ga0307507_10102485 | Ga0307507_101024852 | 142 |
| 980 | 3300033180 | Ga0307510_10002130 | Ga0307510_1000213014 | 142 |
| 981 | 3300033180 | Ga0307510_10091238 | Ga0307510_100912382 | 142 |
| 982 | 3300033180 | Ga0307510_10115814 | Ga0307510_101158144 | 142 |
| 983 | 3300033180 | Ga0307510_10304281 | Ga0307510_103042812 | 142 |
| 984 | 3300034820 | Ga0373959_0008650 | Ga0373959_0008650_368_805 | 142 |
| 985 | 3300035084 | Ga0373928_0124931 | Ga0373928_0124931_166_597 | 142 |
| 986 | 3300035085 | Ga0373929_0222344 | Ga0373929_0222344_33_461 | 142 |
| 987 | 3300035088 | Ga0373940_0001620 | Ga0373940_0001620_1236_1673 | 142 |
| 988 | 3300035090 | Ga0373949_0015829 | Ga0373949_0015829_1156_1587 | 142 |
| 989 | 3300035114 | Ga0373939_0000016 | Ga0373939_0000016_5316_5753 | 142 |
| 990 | 3300035114 | Ga0373939_0044187 | Ga0373939_0044187_628_1059 | 142 |
| 991 | 3300035691 | Ga0373931_0088685 | Ga0373931_0088685_292_729 | 142 |
| 992 | 3300035691 | Ga0373931_0427323 | Ga0373931_0427323_304_735 | 142 |
| 993 | 3300035695 | Ga0373927_0286590 | Ga0373927_0286590_270_701 | 142 |
| 994 | 3300035725 | Ga0373947_0765299 | Ga0373947_0765299_49_480 | 142 |
| 995 | 3300037068 | Ga0373925_0974648 | Ga0373925_0974648_48_479 | 142 |
| 996 | 3300041498 | Ga0451841_0212508 | Ga0451841_0212508_125_553 | 142 |
| 997 | 3300046457 | Ga0495590_0055228 | Ga0495590_0055228_229_657 | 142 |
| 998 | 3300046459 | Ga0495629_0440426 | Ga0495629_0440426_386_817 | 142 |
| 999 | 3300046459 | Ga0495629_0486510 | Ga0495629_0486510_128_559 | 142 |
| 1000 | 3300046461 | Ga0495641_0069493 | Ga0495641_0069493_748_1179 | 142 |
| 1001 | 3300046474 | Ga0495605_0054917 | Ga0495605_0054917_1196_1624 | 142 |
| 1002 | 3300046507 | Ga0495606_0212192 | Ga0495606_0212192_159_590 | 142 |
| 1003 | 3300046512 | Ga0495610_0226611 | Ga0495610_0226611_242_670 | 142 |
| 1004 | 3300046517 | Ga0495630_0035969 | Ga0495630_0035969_218_649 | 142 |
| 1005 | 3300046518 | Ga0495631_0130716 | Ga0495631_0130716_310_738 | 142 |
| 1006 | 3300046519 | Ga0495632_0005889 | Ga0495632_0005889_5890_6318 | 142 |
| 1007 | 3300046524 | Ga0495648_0193333 | Ga0495648_0193333_432_860 | 142 |
| 1008 | 3300046524 | Ga0495648_0267512 | Ga0495648_0267512_209_640 | 142 |
| 1009 | 3300046526 | Ga0495666_0035252 | Ga0495666_0035252_1454_1885 | 142 |
| 1010 | 3300046530 | Ga0495654_0233960 | Ga0495654_0233960_146_577 | 142 |
| 1011 | 3300046542 | Ga0495597_0021547 | Ga0495597_0021547_1022_1450 | 142 |
| 1012 | 3300046557 | Ga0495622_0305429 | Ga0495622_0305429_194_625 | 142 |
| 1013 | 3300046616 | Ga0495668_0070343 | Ga0495668_0070343_1122_1553 | 142 |
| 1014 | 3300046616 | Ga0495668_0142214 | Ga0495668_0142214_305_733 | 142 |
| 1015 | 3300046648 | Ga0495611_0470180 | Ga0495611_0470180_24_452 | 142 |
| 1016 | 3300046660 | Ga0495625_0061838 | Ga0495625_0061838_132_560 | 142 |
| 1017 | 3300046660 | Ga0495625_0326347 | Ga0495625_0326347_487_918 | 142 |
| 1018 | 3300046683 | Ga0495658_0223988 | Ga0495658_0223988_519_950 | 142 |
| 1019 | 3300046683 | Ga0495658_0687886 | Ga0495658_0687886_164_595 | 142 |
| 1020 | 3300046684 | Ga0495669_0105898 | Ga0495669_0105898_14_442 | 142 |
| 1021 | 3300046689 | Ga0495613_0621769 | Ga0495613_0621769_131_562 | 142 |
| 1022 | 3300046690 | Ga0495624_0109110 | Ga0495624_0109110_31_462 | 142 |
| 1023 | 3300046694 | Ga0495649_0013283 | Ga0495649_0013283_1730_2158 | 142 |
| 1024 | 3300046694 | Ga0495649_0376384 | Ga0495649_0376384_28_456 | 142 |
| 1025 | 3300046810 | Ga0495660_0045027 | Ga0495660_0045027_81_509 | 142 |
| 1026 | 3300047318 | Ga0495636_0338502 | Ga0495636_0338502_86_514 | 142 |
| 1027 | 3300047443 | Ga0495687_024124 | Ga0495687_024124_1037_1465 | 142 |
| 1028 | 3300047446 | Ga0495679_217375 | Ga0495679_217375_22_450 | 142 |
| 1029 | 3300047472 | Ga0495686_0077805 | Ga0495686_0077805_1415_1846 | 142 |
| 1030 | 3300048091 | Ga0495626_0407002 | Ga0495626_0407002_15_443 | 142 |
| 1031 | 3300048903 | Ga0496100_0348445 | Ga0496100_0348445_172_603 | 142 |
| 1032 | 3300048905 | Ga0496102_0279006 | Ga0496102_0279006_320_748 | 142 |
| 1033 | 3300048907 | Ga0496104_0030414 | Ga0496104_0030414_2035_2463 | 142 |
| 1034 | 3300048911 | Ga0496108_0112206 | Ga0496108_0112206_271_699 | 142 |
| 1035 | 3300048912 | Ga0496109_0074233 | Ga0496109_0074233_2643_3071 | 142 |
| 1036 | 3300048913 | Ga0496110_0324001 | Ga0496110_0324001_810_1238 | 142 |
| 1037 | 3300048915 | Ga0496112_0003758 | Ga0496112_0003758_10783_11211 | 142 |
| 1038 | 3300048916 | Ga0496113_0008289 | Ga0496113_0008289_4927_5355 | 142 |
| 1039 | 3300048924 | Ga0496121_0349519 | Ga0496121_0349519_484_915 | 142 |
| 1040 | 3300049460 | Ga0495682_0081502 | Ga0495682_0081502_632_1060 | 142 |
| 1041 | 3300050493 | nmdc:mga0k408_4161_c1 | nmdc:mga0k408_4161_c1_6414_6845 | 142 |
| 1042 | 3300050493 | nmdc:mga0k408_7389_c1 | nmdc:mga0k408_7389_c1_428_856 | 142 |
| 1043 | 3300050495 | nmdc:mga04h51_98167_c1 | nmdc:mga04h51_98167_c1_191_622 | 142 |
| 1044 | 3300050496 | nmdc:mga07m45_160_c1 | nmdc:mga07m45_160_c1_24164_24595 | 142 |
| 1045 | 3300050496 | nmdc:mga07m45_42054_c1 | nmdc:mga07m45_42054_c1_220_648 | 142 |
| 1046 | 3300050496 | nmdc:mga07m45_469_c1 | nmdc:mga07m45_469_c1_1116_1553 | 142 |
| 1047 | 3300053083 | Ga0495655_0198662 | Ga0495655_0198662_55_483 | 142 |
| 1048 | 3300053086 | Ga0500578_0026552 | Ga0500578_0026552_1511_1942 | 142 |
| 1049 | 3300053088 | Ga0500644_0003036 | Ga0500644_0003036_1717_2145 | 142 |
| 1050 | 3300053091 | Ga0500647_0171717 | Ga0500647_0171717_483_911 | 142 |
| 1051 | 3300053093 | Ga0500651_0060890 | Ga0500651_0060890_1726_2154 | 142 |
| 1052 | 3300053098 | Ga0500650_0328909 | Ga0500650_0328909_204_632 | 142 |
| 1053 | 3300053118 | Ga0500594_0000648 | Ga0500594_0000648_1965_2393 | 142 |
| 1054 | 3300053121 | Ga0500607_242573 | Ga0500607_242573_212_640 | 142 |
| 1055 | 3300053131 | Ga0500652_015634 | Ga0500652_015634_1582_2010 | 142 |
| 1056 | 3300053134 | Ga0500658_0010471 | Ga0500658_0010471_2041_2469 | 142 |
| 1057 | 3300053136 | Ga0500559_0000602 | Ga0500559_0000602_21972_22400 | 142 |
| 1058 | 3300053136 | Ga0500559_0299026 | Ga0500559_0299026_118_546 | 142 |
| 1059 | 3300053139 | Ga0500568_0047353 | Ga0500568_0047353_1091_1519 | 142 |
| 1060 | 3300053155 | Ga0500620_105003 | Ga0500620_105003_477_908 | 142 |
| 1061 | 3300053156 | Ga0500622_0197165 | Ga0500622_0197165_313_741 | 142 |
| 1062 | 3300053177 | Ga0500636_0274429 | Ga0500636_0274429_206_634 | 142 |
| 1063 | 3300053177 | Ga0500636_0331247 | Ga0500636_0331247_83_514 | 142 |
| 1064 | 3300053730 | Ga0500645_002532 | Ga0500645_002532_1356_1787 | 142 |
| 1065 | 3300053739 | Ga0500587_000910 | Ga0500587_000910_3359_3787 | 142 |
| 1066 | 3300059424 | Ga0590075_076040 | Ga0590075_076040_348_776 | 142 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar