F489360
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1064 | 457 | 1052 | 202 |
Family's Representative Sequence
| Representative Sequence | 3300050493|nmdc:mga0k408_185164_c1|nmdc:mga0k408_185164_c1_203_913 |
| Length | 236 |
| Sequence | MAAALFSIPAFSHSGPLLDLTNGPLQNHPPSGEIAMEKFTVLEGVAAPLRVVNVDTDMIIPKQYLKTIKRTGLGKGLFSEKRYKDDGSENPDFVLNKPAYRKAKILVAGDNFGCGSSREHAPWALADFGIRCVISTSFGDIFYNNSFKNGLLPIRVSPEDLEKLFEDAERGANATLTVDLEKQEIRGPDGGVVKFEIDPFRKHCLLNGLDDIGLTQAKDAHIGTYETKAKAERPWL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 2 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 3 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 4 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 5 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 6 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 7 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 8 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 9 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 10 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 11 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 12 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 13 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 14 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 15 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 20 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 23 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 24 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 25 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 26 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 27 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 28 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 29 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 30 | 3300003349 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM | Metagenome | Rhizosphere |
| 31 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 42 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 76 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 77 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 83 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 89 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 91 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 92 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 93 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 96 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 97 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 98 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 108 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 109 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 110 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 111 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 112 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 114 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 115 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 116 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 117 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 119 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 120 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 121 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 122 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 123 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 124 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 125 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 126 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 127 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 128 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 148 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 167 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 168 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300027252 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 245 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 246 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 250 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 251 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 252 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 253 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 254 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 255 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 256 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 257 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 258 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 259 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 260 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 261 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 262 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 263 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 264 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 265 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 266 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 267 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 268 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 269 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 270 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 271 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 272 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 273 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 274 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 275 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 276 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 277 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 278 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 279 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 280 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 281 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 282 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 283 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 284 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 285 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 286 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 287 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 288 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 289 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 290 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 292 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 293 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 294 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 295 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 296 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 297 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 298 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 299 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 300 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 301 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 302 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 303 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 304 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 305 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 306 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 307 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 308 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 309 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 310 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 311 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 312 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 313 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 314 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 315 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 316 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 317 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 318 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 319 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 320 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 375 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 376 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 377 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 378 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 379 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 380 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 383 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 384 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 385 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 386 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 387 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 388 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 389 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 390 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 391 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 392 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 393 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 394 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 399 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 400 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 404 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 413 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 424 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 425 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 426 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 427 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 428 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 429 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 430 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 432 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 444 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 446 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 447 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 448 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 449 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 450 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 451 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 452 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 453 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 456 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 457 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.59 |
| Metatranscriptomes | 0.28 |
| Isolates | 1.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.98 |
| Nodule | 0.28 |
| Rhizoplane | 7.71 |
| Rhizosphere | 84.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.16 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24032J14994_100170 | 3300001430 | Bacteria | 3277 |
| 2 | JGI24736J21556_1013782 | 3300001904 | Bacteria | 1303 |
| 3 | JGI24752J21851_1001950 | 3300001976 | Bacteria | 2747 |
| 4 | JGI24746J21847_1000605 | 3300001977 | Bacteria | 5447 |
| 5 | JGI24747J21853_1001825 | 3300001978 | Bacteria | 1654 |
| 6 | JGI24740J21852_10020453 | 3300001979 | Bacteria | 2308 |
| 7 | JGI24739J22299_10000119 | 3300001989 | Bacteria | 24437 |
| 8 | JGI24737J22298_10000258 | 3300001990 | Bacteria | 17613 |
| 9 | JGI24750J21931_1000164 | 3300002070 | Bacteria | 11020 |
| 10 | JGI24745J21846_1000103 | 3300002073 | Bacteria | 6407 |
| 11 | JGI24738J21930_10005193 | 3300002075 | Bacteria | 3142 |
| 12 | JGI24749J21850_1000093 | 3300002076 | Bacteria | 15913 |
| 13 | JGI24749J21850_1019507 | 3300002076 | Bacteria | 958 |
| 14 | JGI24744J21845_10001608 | 3300002077 | Bacteria | 4513 |
| 15 | JGI24035J26624_1000048 | 3300002126 | Bacteria | 9152 |
| 16 | JGI24033J26618_1001488 | 3300002155 | Bacteria | 2328 |
| 17 | JGI24034J26672_10000515 | 3300002239 | Bacteria | 5006 |
| 18 | JGI24034J26672_10001644 | 3300002239 | Bacteria | 2993 |
| 19 | JGI24742J22300_10000595 | 3300002244 | Bacteria | 5438 |
| 20 | JGI24751J29686_10018194 | 3300002459 | Bacteria | 1453 |
| 21 | JGI25153J46596_10001652 | 3300003215 | Bacteria | 13208 |
| 22 | JGI26129J50193_1002722 | 3300003349 | Bacteria | 1244 |
| 23 | JGI25404J52841_10005604 | 3300003659 | Bacteria | 2594 |
| 24 | Ga0065714_10135970 | 3300005288 | Bacteria | 1209 |
| 25 | Ga0065715_10088946 | 3300005293 | Bacteria | 21692 |
| 26 | Ga0065707_10104807 | 3300005295 | Bacteria | 2677 |
| 27 | Ga0065707_10280081 | 3300005295 | Bacteria | 1050 |
| 28 | Ga0070658_10009370 | 3300005327 | Bacteria | 7867 |
| 29 | Ga0070658_10188403 | 3300005327 | Bacteria | 1738 |
| 30 | Ga0070676_10000514 | 3300005328 | Bacteria | 18558 |
| 31 | Ga0070683_100005318 | 3300005329 | Bacteria | 10729 |
| 32 | Ga0070683_100025217 | 3300005329 | Bacteria | 5336 |
| 33 | Ga0070690_100008454 | 3300005330 | Bacteria | 5929 |
| 34 | Ga0070690_100054680 | 3300005330 | Bacteria | 2556 |
| 35 | Ga0070670_100002160 | 3300005331 | Bacteria | 16146 |
| 36 | Ga0070670_100123675 | 3300005331 | Bacteria | 2232 |
| 37 | Ga0070670_100200801 | 3300005331 | Bacteria | 1732 |
| 38 | Ga0070677_10000023 | 3300005333 | Bacteria | 44929 |
| 39 | Ga0070677_10031092 | 3300005333 | Bacteria | 2038 |
| 40 | Ga0068869_100000153 | 3300005334 | Bacteria | 34191 |
| 41 | Ga0068869_100009816 | 3300005334 | Bacteria | 6217 |
| 42 | Ga0070666_10003393 | 3300005335 | Bacteria | 9651 |
| 43 | Ga0070666_10397399 | 3300005335 | Bacteria | 991 |
| 44 | Ga0070680_100000814 | 3300005336 | Bacteria | 21982 |
| 45 | Ga0070680_100018221 | 3300005336 | Bacteria | 5546 |
| 46 | Ga0070682_100000445 | 3300005337 | Bacteria | 26505 |
| 47 | Ga0068868_100014021 | 3300005338 | Bacteria | 5897 |
| 48 | Ga0068868_100109589 | 3300005338 | Bacteria | 2242 |
| 49 | Ga0068868_100798126 | 3300005338 | Bacteria | 851 |
| 50 | Ga0070660_100001480 | 3300005339 | Bacteria | 16083 |
| 51 | Ga0070660_100130906 | 3300005339 | Bacteria | 2008 |
| 52 | Ga0070660_100610006 | 3300005339 | Bacteria | 913 |
| 53 | Ga0070689_100000880 | 3300005340 | Bacteria | 18718 |
| 54 | Ga0070689_100014559 | 3300005340 | Bacteria | 5717 |
| 55 | Ga0070689_100206405 | 3300005340 | Bacteria | 1606 |
| 56 | Ga0070691_10000320 | 3300005341 | Bacteria | 17013 |
| 57 | Ga0070687_100000187 | 3300005343 | Bacteria | 21513 |
| 58 | Ga0070687_100152213 | 3300005343 | Bacteria | 1359 |
| 59 | Ga0070687_100267744 | 3300005343 | Bacteria | 1069 |
| 60 | Ga0070687_100347057 | 3300005343 | Bacteria | 957 |
| 61 | Ga0070661_100001011 | 3300005344 | Bacteria | 19919 |
| 62 | Ga0070661_100096242 | 3300005344 | Bacteria | 2196 |
| 63 | Ga0070668_100002838 | 3300005347 | Bacteria | 12766 |
| 64 | Ga0070669_100000501 | 3300005353 | Bacteria | 29467 |
| 65 | Ga0070669_100043033 | 3300005353 | Bacteria | 3287 |
| 66 | Ga0070669_100147344 | 3300005353 | Bacteria | 1820 |
| 67 | Ga0070675_100001136 | 3300005354 | Bacteria | 19211 |
| 68 | Ga0070675_100080693 | 3300005354 | Bacteria | 2712 |
| 69 | Ga0070675_100521045 | 3300005354 | Bacteria | 1073 |
| 70 | Ga0070671_100000595 | 3300005355 | Bacteria | 25844 |
| 71 | Ga0070671_100007251 | 3300005355 | Bacteria | 8858 |
| 72 | Ga0070674_100000249 | 3300005356 | Bacteria | 26766 |
| 73 | Ga0070674_100001190 | 3300005356 | Bacteria | 13665 |
| 74 | Ga0070674_100094735 | 3300005356 | Bacteria | 2163 |
| 75 | Ga0070673_100000233 | 3300005364 | Bacteria | 27866 |
| 76 | Ga0070673_100002039 | 3300005364 | Bacteria | 12191 |
| 77 | Ga0070673_100160851 | 3300005364 | Bacteria | 1909 |
| 78 | Ga0070688_100000432 | 3300005365 | Bacteria | 21144 |
| 79 | Ga0070688_100009975 | 3300005365 | Bacteria | 5219 |
| 80 | Ga0070659_100000746 | 3300005366 | Bacteria | 23656 |
| 81 | Ga0070659_100275149 | 3300005366 | Bacteria | 1400 |
| 82 | Ga0070659_100471137 | 3300005366 | Bacteria | 1068 |
| 83 | Ga0070667_100001881 | 3300005367 | Bacteria | 18641 |
| 84 | Ga0070667_100164897 | 3300005367 | Bacteria | 1954 |
| 85 | Ga0070667_100252312 | 3300005367 | Bacteria | 1577 |
| 86 | Ga0070667_100653968 | 3300005367 | Bacteria | 970 |
| 87 | Ga0070703_10001482 | 3300005406 | Bacteria | 7053 |
| 88 | Ga0070709_10047309 | 3300005434 | Bacteria | 2679 |
| 89 | Ga0070709_10066235 | 3300005434 | Bacteria | 2316 |
| 90 | Ga0070714_100090724 | 3300005435 | Bacteria | 2676 |
| 91 | Ga0070714_100092299 | 3300005435 | Bacteria | 2654 |
| 92 | Ga0070714_100336049 | 3300005435 | Bacteria | 1415 |
| 93 | Ga0070714_100416631 | 3300005435 | Bacteria | 1272 |
| 94 | Ga0070714_100633367 | 3300005435 | Bacteria | 1028 |
| 95 | Ga0070713_100034550 | 3300005436 | Bacteria | 4063 |
| 96 | Ga0070713_100143336 | 3300005436 | Bacteria | 2118 |
| 97 | Ga0070713_100663707 | 3300005436 | Bacteria | 994 |
| 98 | Ga0070710_10010676 | 3300005437 | Bacteria | 4516 |
| 99 | Ga0070710_10014144 | 3300005437 | Bacteria | 4010 |
| 100 | Ga0070710_10021162 | 3300005437 | Bacteria | 3385 |
| 101 | Ga0070710_10114113 | 3300005437 | Bacteria | 1627 |
| 102 | Ga0070710_10330960 | 3300005437 | Bacteria | 1003 |
| 103 | Ga0070701_10010707 | 3300005438 | Bacteria | 4069 |
| 104 | Ga0070701_10039230 | 3300005438 | Bacteria | 2401 |
| 105 | Ga0070711_100015569 | 3300005439 | Bacteria | 4814 |
| 106 | Ga0070711_100042375 | 3300005439 | Bacteria | 3076 |
| 107 | Ga0070711_100066518 | 3300005439 | Bacteria | 2525 |
| 108 | Ga0070705_100000361 | 3300005440 | Bacteria | 26716 |
| 109 | Ga0070700_100000357 | 3300005441 | Bacteria | 23494 |
| 110 | Ga0070694_100009629 | 3300005444 | Bacteria | 5929 |
| 111 | Ga0070694_100105960 | 3300005444 | Bacteria | 1996 |
| 112 | Ga0070708_100011297 | 3300005445 | Bacteria | 7260 |
| 113 | Ga0070663_100006501 | 3300005455 | Bacteria | 7036 |
| 114 | Ga0070663_100014884 | 3300005455 | Bacteria | 5002 |
| 115 | Ga0070663_100588282 | 3300005455 | Bacteria | 934 |
| 116 | Ga0070678_100000438 | 3300005456 | Bacteria | 19678 |
| 117 | Ga0070662_100035557 | 3300005457 | Bacteria | 3519 |
| 118 | Ga0070662_100119158 | 3300005457 | Bacteria | 2021 |
| 119 | Ga0070662_100271458 | 3300005457 | Bacteria | 1369 |
| 120 | Ga0070681_10039781 | 3300005458 | Bacteria | 4713 |
| 121 | Ga0070681_10224839 | 3300005458 | Bacteria | 1792 |
| 122 | Ga0070681_10247774 | 3300005458 | Bacteria | 1694 |
| 123 | Ga0070681_10775096 | 3300005458 | Bacteria | 876 |
| 124 | Ga0068867_100001099 | 3300005459 | Bacteria | 18474 |
| 125 | Ga0068867_100079424 | 3300005459 | Bacteria | 2469 |
| 126 | Ga0068867_100248855 | 3300005459 | Bacteria | 1444 |
| 127 | Ga0070685_10006230 | 3300005466 | Bacteria | 6074 |
| 128 | Ga0070685_10158702 | 3300005466 | Bacteria | 1440 |
| 129 | Ga0070698_100194771 | 3300005471 | Bacteria | 1964 |
| 130 | Ga0070679_100002503 | 3300005530 | Bacteria | 16646 |
| 131 | Ga0070679_100023170 | 3300005530 | Bacteria | 6076 |
| 132 | Ga0070679_100149887 | 3300005530 | Bacteria | 2309 |
| 133 | Ga0070679_100376970 | 3300005530 | Bacteria | 1365 |
| 134 | Ga0070679_100832969 | 3300005530 | Bacteria | 866 |
| 135 | Ga0070684_100000101 | 3300005535 | Bacteria | 55960 |
| 136 | Ga0070684_100124599 | 3300005535 | Bacteria | 2320 |
| 137 | Ga0070684_100456395 | 3300005535 | Bacteria | 1181 |
| 138 | Ga0070684_100829745 | 3300005535 | Bacteria | 865 |
| 139 | Ga0068853_100158781 | 3300005539 | Bacteria | 2039 |
| 140 | Ga0068853_100210062 | 3300005539 | Bacteria | 1774 |
| 141 | Ga0068853_100221116 | 3300005539 | Bacteria | 1729 |
| 142 | Ga0070672_100035124 | 3300005543 | Bacteria | 3808 |
| 143 | Ga0070672_100126981 | 3300005543 | Bacteria | 2092 |
| 144 | Ga0070672_100336642 | 3300005543 | Bacteria | 1284 |
| 145 | Ga0070686_100000532 | 3300005544 | Bacteria | 22792 |
| 146 | Ga0070686_100006895 | 3300005544 | Bacteria | 6328 |
| 147 | Ga0070686_100012133 | 3300005544 | Bacteria | 4901 |
| 148 | Ga0070695_100005890 | 3300005545 | Bacteria | 7232 |
| 149 | Ga0070696_100007762 | 3300005546 | Bacteria | 7159 |
| 150 | Ga0070693_100003380 | 3300005547 | Bacteria | 7425 |
| 151 | Ga0070693_100096945 | 3300005547 | Bacteria | 1789 |
| 152 | Ga0070665_100069518 | 3300005548 | Bacteria | 3529 |
| 153 | Ga0070665_100168248 | 3300005548 | Bacteria | 2194 |
| 154 | Ga0070665_100328151 | 3300005548 | Bacteria | 1534 |
| 155 | Ga0070665_100423655 | 3300005548 | Bacteria | 1340 |
| 156 | Ga0070704_100009296 | 3300005549 | Bacteria | 5929 |
| 157 | Ga0068855_100047838 | 3300005563 | Bacteria | 5051 |
| 158 | Ga0068855_100317042 | 3300005563 | Bacteria | 1724 |
| 159 | Ga0068855_100512171 | 3300005563 | Bacteria | 1303 |
| 160 | Ga0068855_100563253 | 3300005563 | Bacteria | 1232 |
| 161 | Ga0070664_100020910 | 3300005564 | Bacteria | 5392 |
| 162 | Ga0070664_100061173 | 3300005564 | Bacteria | 3209 |
| 163 | Ga0070664_100251297 | 3300005564 | Bacteria | 1589 |
| 164 | Ga0070664_100571753 | 3300005564 | Bacteria | 1047 |
| 165 | Ga0070664_101026412 | 3300005564 | Bacteria | 775 |
| 166 | Ga0068857_100001072 | 3300005577 | Bacteria | 21170 |
| 167 | Ga0068854_100000794 | 3300005578 | Bacteria | 18790 |
| 168 | Ga0068856_100006877 | 3300005614 | Bacteria | 11126 |
| 169 | Ga0068856_100233955 | 3300005614 | Bacteria | 1853 |
| 170 | Ga0068856_100610393 | 3300005614 | Bacteria | 1112 |
| 171 | Ga0068856_101030412 | 3300005614 | Bacteria | 841 |
| 172 | Ga0070702_100006263 | 3300005615 | Bacteria | 5619 |
| 173 | Ga0070702_100053715 | 3300005615 | Bacteria | 2315 |
| 174 | Ga0068852_100000713 | 3300005616 | Bacteria | 21734 |
| 175 | Ga0068852_100086835 | 3300005616 | Bacteria | 2789 |
| 176 | Ga0068859_100001523 | 3300005617 | Bacteria | 23646 |
| 177 | Ga0068859_100120035 | 3300005617 | Bacteria | 2695 |
| 178 | Ga0068859_100132778 | 3300005617 | Bacteria | 2561 |
| 179 | Ga0068859_100209914 | 3300005617 | Bacteria | 2033 |
| 180 | Ga0068864_100000715 | 3300005618 | Bacteria | 27854 |
| 181 | Ga0068864_100369800 | 3300005618 | Bacteria | 1356 |
| 182 | Ga0068866_10003508 | 3300005718 | Bacteria | 6424 |
| 183 | Ga0068866_10008505 | 3300005718 | Bacteria | 4330 |
| 184 | Ga0068866_10050564 | 3300005718 | Bacteria | 2111 |
| 185 | Ga0068861_100000574 | 3300005719 | Bacteria | 21775 |
| 186 | Ga0068861_100039977 | 3300005719 | Bacteria | 3504 |
| 187 | Ga0068861_100270569 | 3300005719 | Bacteria | 1459 |
| 188 | Ga0068861_100326111 | 3300005719 | Bacteria | 1339 |
| 189 | Ga0068863_100001272 | 3300005841 | Bacteria | 25149 |
| 190 | Ga0068863_100650482 | 3300005841 | Bacteria | 1045 |
| 191 | Ga0068858_100008506 | 3300005842 | Bacteria | 9862 |
| 192 | Ga0068858_100138044 | 3300005842 | Bacteria | 2288 |
| 193 | Ga0068860_100001758 | 3300005843 | Bacteria | 23120 |
| 194 | Ga0068860_100956332 | 3300005843 | Bacteria | 874 |
| 195 | Ga0068862_100012556 | 3300005844 | Bacteria | 7012 |
| 196 | Ga0068862_100373271 | 3300005844 | Bacteria | 1328 |
| 197 | Ga0081455_10006443 | 3300005937 | Bacteria | 12579 |
| 198 | Ga0081455_10134401 | 3300005937 | Bacteria | 1930 |
| 199 | Ga0081540_1000059 | 3300005983 | Bacteria | 120226 |
| 200 | Ga0081540_1000315 | 3300005983 | Bacteria | 50137 |
| 201 | Ga0081540_1074331 | 3300005983 | Bacteria | 1558 |
| 202 | Ga0070717_10001112 | 3300006028 | Bacteria | 18150 |
| 203 | Ga0070717_10019038 | 3300006028 | Bacteria | 5376 |
| 204 | Ga0070717_10079374 | 3300006028 | Bacteria | 2752 |
| 205 | Ga0075365_10024221 | 3300006038 | Bacteria | 3825 |
| 206 | Ga0075365_10262497 | 3300006038 | Bacteria | 1214 |
| 207 | Ga0075365_10263274 | 3300006038 | Bacteria | 1212 |
| 208 | Ga0075368_10019777 | 3300006042 | Bacteria | 2543 |
| 209 | Ga0075368_10043616 | 3300006042 | Bacteria | 1768 |
| 210 | Ga0075363_100010754 | 3300006048 | Bacteria | 4361 |
| 211 | Ga0075363_100086699 | 3300006048 | Bacteria | 1719 |
| 212 | Ga0075363_100090840 | 3300006048 | Bacteria | 1680 |
| 213 | Ga0075364_10010261 | 3300006051 | Bacteria | 5652 |
| 214 | Ga0075364_10023768 | 3300006051 | Bacteria | 3883 |
| 215 | Ga0075364_10100697 | 3300006051 | Bacteria | 1923 |
| 216 | Ga0075364_10260687 | 3300006051 | Bacteria | 1178 |
| 217 | Ga0075432_10006215 | 3300006058 | Bacteria | 4061 |
| 218 | Ga0070716_100012500 | 3300006173 | Bacteria | 4305 |
| 219 | Ga0070712_100005942 | 3300006175 | Bacteria | 7545 |
| 220 | Ga0070712_100066126 | 3300006175 | Bacteria | 2568 |
| 221 | Ga0070712_100094588 | 3300006175 | Bacteria | 2196 |
| 222 | Ga0075362_10000822 | 3300006177 | Bacteria | 9288 |
| 223 | Ga0075367_10027428 | 3300006178 | Bacteria | 3240 |
| 224 | Ga0075367_10065510 | 3300006178 | Bacteria | 2176 |
| 225 | Ga0075367_10086064 | 3300006178 | Bacteria | 1907 |
| 226 | Ga0075367_10088828 | 3300006178 | Bacteria | 1878 |
| 227 | Ga0075367_10103932 | 3300006178 | Bacteria | 1738 |
| 228 | Ga0075367_10202824 | 3300006178 | Bacteria | 1239 |
| 229 | Ga0075369_10003689 | 3300006186 | Bacteria | 5598 |
| 230 | Ga0075366_10006442 | 3300006195 | Bacteria | 6432 |
| 231 | Ga0075366_10031143 | 3300006195 | Bacteria | 3138 |
| 232 | Ga0097621_100001018 | 3300006237 | Bacteria | 19728 |
| 233 | Ga0097621_100308450 | 3300006237 | Bacteria | 1399 |
| 234 | Ga0075370_10129884 | 3300006353 | Bacteria | 1470 |
| 235 | Ga0068871_100000012 | 3300006358 | Bacteria | 105267 |
| 236 | Ga0068871_100019484 | 3300006358 | Bacteria | 5181 |
| 237 | Ga0068871_100101539 | 3300006358 | Bacteria | 2411 |
| 238 | Ga0068871_100134500 | 3300006358 | Bacteria | 2099 |
| 239 | Ga0068871_100151669 | 3300006358 | Bacteria | 1977 |
| 240 | Ga0075428_100001200 | 3300006844 | Bacteria | 27756 |
| 241 | Ga0075428_100004407 | 3300006844 | Bacteria | 15544 |
| 242 | Ga0075430_100000032 | 3300006846 | Bacteria | 72679 |
| 243 | Ga0075431_100000003 | 3300006847 | Bacteria | 112884 |
| 244 | Ga0075431_100009024 | 3300006847 | Bacteria | 9998 |
| 245 | Ga0075431_100539395 | 3300006847 | Bacteria | 1155 |
| 246 | Ga0075433_10000072 | 3300006852 | Bacteria | 45390 |
| 247 | Ga0075433_10005026 | 3300006852 | Bacteria | 10365 |
| 248 | Ga0075434_100000341 | 3300006871 | Bacteria | 33666 |
| 249 | Ga0075434_100001937 | 3300006871 | Bacteria | 17946 |
| 250 | Ga0075434_100072274 | 3300006871 | Bacteria | 3442 |
| 251 | Ga0075434_100206696 | 3300006871 | Bacteria | 1984 |
| 252 | Ga0075429_100000631 | 3300006880 | Bacteria | 27160 |
| 253 | Ga0075429_100425132 | 3300006880 | Bacteria | 1163 |
| 254 | Ga0068865_100000328 | 3300006881 | Bacteria | 26279 |
| 255 | Ga0068865_100194589 | 3300006881 | Bacteria | 1570 |
| 256 | Ga0075436_100193136 | 3300006914 | Bacteria | 1441 |
| 257 | Ga0075436_100229708 | 3300006914 | Bacteria | 1318 |
| 258 | Ga0075436_100237128 | 3300006914 | Bacteria | 1297 |
| 259 | Ga0097620_100001523 | 3300006931 | Bacteria | 23646 |
| 260 | Ga0097620_100120036 | 3300006931 | Bacteria | 2695 |
| 261 | Ga0097620_100132777 | 3300006931 | Bacteria | 2561 |
| 262 | Ga0097620_100209925 | 3300006931 | Bacteria | 2033 |
| 263 | Ga0075435_100022993 | 3300007076 | Bacteria | 4814 |
| 264 | Ga0075435_100527551 | 3300007076 | Bacteria | 1022 |
| 265 | Ga0075435_100775166 | 3300007076 | Bacteria | 835 |
| 266 | Ga0105251_10100037 | 3300009011 | Bacteria | 1325 |
| 267 | Ga0105251_10141329 | 3300009011 | Bacteria | 1089 |
| 268 | Ga0105244_10023808 | 3300009036 | Bacteria | 3351 |
| 269 | Ga0105240_10028987 | 3300009093 | Bacteria | 7220 |
| 270 | Ga0105240_10045104 | 3300009093 | Bacteria | 5595 |
| 271 | Ga0105240_10083433 | 3300009093 | Bacteria | 3921 |
| 272 | Ga0105240_10103668 | 3300009093 | Bacteria | 3455 |
| 273 | Ga0105240_11517317 | 3300009093 | Bacteria | 702 |
| 274 | Ga0111539_10001373 | 3300009094 | Bacteria | 32376 |
| 275 | Ga0111539_10002936 | 3300009094 | Bacteria | 22607 |
| 276 | Ga0105245_10001404 | 3300009098 | Bacteria | 21834 |
| 277 | Ga0105245_10012824 | 3300009098 | Bacteria | 7303 |
| 278 | Ga0105245_10067818 | 3300009098 | Bacteria | 3232 |
| 279 | Ga0105245_10074327 | 3300009098 | Bacteria | 3093 |
| 280 | Ga0105247_10000881 | 3300009101 | Bacteria | 22689 |
| 281 | Ga0105247_10025277 | 3300009101 | Bacteria | 3582 |
| 282 | Ga0114129_10001551 | 3300009147 | Bacteria | 31169 |
| 283 | Ga0114129_10001730 | 3300009147 | Bacteria | 29754 |
| 284 | Ga0114129_10147946 | 3300009147 | Bacteria | 3216 |
| 285 | Ga0105243_10001028 | 3300009148 | Bacteria | 25704 |
| 286 | Ga0105243_10078105 | 3300009148 | Bacteria | 2694 |
| 287 | Ga0105243_10099928 | 3300009148 | Bacteria | 2406 |
| 288 | Ga0105243_10241028 | 3300009148 | Bacteria | 1609 |
| 289 | Ga0105243_10808076 | 3300009148 | Bacteria | 925 |
| 290 | Ga0105241_10002719 | 3300009174 | Bacteria | 13247 |
| 291 | Ga0105241_10023657 | 3300009174 | Bacteria | 4556 |
| 292 | Ga0105241_10249547 | 3300009174 | Bacteria | 1504 |
| 293 | Ga0105242_10000607 | 3300009176 | Bacteria | 28041 |
| 294 | Ga0105242_10109860 | 3300009176 | Bacteria | 2348 |
| 295 | Ga0105248_10000309 | 3300009177 | Bacteria | 58008 |
| 296 | Ga0105248_10351870 | 3300009177 | Bacteria | 1658 |
| 297 | Ga0105237_10010578 | 3300009545 | Bacteria | 9800 |
| 298 | Ga0105238_10046809 | 3300009551 | Bacteria | 4362 |
| 299 | Ga0105238_10072176 | 3300009551 | Bacteria | 3449 |
| 300 | Ga0105238_10146213 | 3300009551 | Bacteria | 2340 |
| 301 | Ga0105249_10000486 | 3300009553 | Bacteria | 36821 |
| 302 | Ga0099796_10067790 | 3300010159 | Bacteria | 1281 |
| 303 | Ga0105239_10006677 | 3300010375 | Bacteria | 13327 |
| 304 | Ga0105239_10114292 | 3300010375 | Bacteria | 2994 |
| 305 | Ga0105239_10475603 | 3300010375 | Bacteria | 1419 |
| 306 | Ga0105246_10000696 | 3300011119 | Bacteria | 18957 |
| 307 | Ga0105246_10047691 | 3300011119 | Bacteria | 2927 |
| 308 | Ga0157321_1010693 | 3300012487 | Bacteria | 705 |
| 309 | Ga0157373_10022136 | 3300013100 | Bacteria | 4612 |
| 310 | Ga0157371_10124619 | 3300013102 | Bacteria | 1832 |
| 311 | Ga0157370_10511489 | 3300013104 | Bacteria | 1102 |
| 312 | Ga0157369_10553187 | 3300013105 | Bacteria | 1189 |
| 313 | Ga0157374_10001864 | 3300013296 | Bacteria | 17741 |
| 314 | Ga0157374_10226231 | 3300013296 | Bacteria | 1837 |
| 315 | Ga0157374_10243059 | 3300013296 | Bacteria | 1770 |
| 316 | Ga0157374_10536335 | 3300013296 | Bacteria | 1177 |
| 317 | Ga0157378_10006042 | 3300013297 | Bacteria | 10605 |
| 318 | Ga0163162_10000992 | 3300013306 | Bacteria | 26439 |
| 319 | Ga0163162_10038755 | 3300013306 | Bacteria | 4757 |
| 320 | Ga0163162_10315183 | 3300013306 | Bacteria | 1697 |
| 321 | Ga0157372_10021474 | 3300013307 | Bacteria | 6975 |
| 322 | Ga0157372_11178524 | 3300013307 | Bacteria | 885 |
| 323 | Ga0157375_10002320 | 3300013308 | Bacteria | 16428 |
| 324 | Ga0157375_10465062 | 3300013308 | Bacteria | 1430 |
| 325 | Ga0157375_11007053 | 3300013308 | Bacteria | 973 |
| 326 | Ga0163163_10098473 | 3300014325 | Bacteria | 2945 |
| 327 | Ga0163163_10111585 | 3300014325 | Bacteria | 2763 |
| 328 | Ga0163163_10184987 | 3300014325 | Bacteria | 2131 |
| 329 | Ga0157380_10000711 | 3300014326 | Bacteria | 20809 |
| 330 | Ga0157380_10297865 | 3300014326 | Bacteria | 1484 |
| 331 | Ga0157377_10000336 | 3300014745 | Bacteria | 21014 |
| 332 | Ga0157379_10000678 | 3300014968 | Bacteria | 27608 |
| 333 | Ga0157376_10076565 | 3300014969 | Bacteria | 2859 |
| 334 | Ga0157376_10109765 | 3300014969 | Bacteria | 2426 |
| 335 | Ga0157376_10204882 | 3300014969 | Bacteria | 1818 |
| 336 | Ga0163161_10000534 | 3300017792 | Bacteria | 31044 |
| 337 | Ga0163161_10177822 | 3300017792 | Bacteria | 1630 |
| 338 | Ga0206351_10851411 | 3300020077 | Bacteria | 890 |
| 339 | Ga0206350_10637952 | 3300020080 | Bacteria | 894 |
| 340 | Ga0206354_10183665 | 3300020081 | Bacteria | 794 |
| 341 | Ga0213876_10207001 | 3300021384 | Bacteria | 1043 |
| 342 | Ga0213876_10288694 | 3300021384 | Bacteria | 872 |
| 343 | Ga0213871_10177663 | 3300021441 | Bacteria | 657 |
| 344 | Ga0207666_1000177 | 3300025271 | Bacteria | 9685 |
| 345 | Ga0207673_1000025 | 3300025290 | Bacteria | 11860 |
| 346 | Ga0207673_1021159 | 3300025290 | Bacteria | 880 |
| 347 | Ga0209758_1000469 | 3300025297 | Bacteria | 66568 |
| 348 | Ga0207697_10000374 | 3300025315 | Bacteria | 25123 |
| 349 | Ga0207696_1085800 | 3300025711 | Bacteria | 866 |
| 350 | Ga0207653_10009153 | 3300025885 | Bacteria | 3087 |
| 351 | Ga0207682_10000011 | 3300025893 | Bacteria | 85533 |
| 352 | Ga0207682_10000604 | 3300025893 | Bacteria | 16696 |
| 353 | Ga0207692_10030829 | 3300025898 | Bacteria | 2562 |
| 354 | Ga0207692_10089130 | 3300025898 | Bacteria | 1669 |
| 355 | Ga0207692_10119518 | 3300025898 | Bacteria | 1473 |
| 356 | Ga0207642_10000524 | 3300025899 | Bacteria | 11752 |
| 357 | Ga0207642_10118113 | 3300025899 | Bacteria | 1363 |
| 358 | Ga0207710_10000805 | 3300025900 | Bacteria | 16991 |
| 359 | Ga0207688_10000020 | 3300025901 | Bacteria | 51200 |
| 360 | Ga0207688_10000279 | 3300025901 | Bacteria | 23305 |
| 361 | Ga0207688_10499877 | 3300025901 | Bacteria | 761 |
| 362 | Ga0207680_10016116 | 3300025903 | Bacteria | 3916 |
| 363 | Ga0207680_10043051 | 3300025903 | Bacteria | 2645 |
| 364 | Ga0207647_10027730 | 3300025904 | Bacteria | 3689 |
| 365 | Ga0207685_10053819 | 3300025905 | Bacteria | 1565 |
| 366 | Ga0207699_10112179 | 3300025906 | Bacteria | 1749 |
| 367 | Ga0207699_10210624 | 3300025906 | Bacteria | 1322 |
| 368 | Ga0207645_10060646 | 3300025907 | Bacteria | 2415 |
| 369 | Ga0207654_10000818 | 3300025911 | Bacteria | 17142 |
| 370 | Ga0207654_10045738 | 3300025911 | Bacteria | 2493 |
| 371 | Ga0207654_10144309 | 3300025911 | Bacteria | 1522 |
| 372 | Ga0207707_10000689 | 3300025912 | Bacteria | 33589 |
| 373 | Ga0207707_10051458 | 3300025912 | Bacteria | 3587 |
| 374 | Ga0207707_10114124 | 3300025912 | Bacteria | 2361 |
| 375 | Ga0207707_10167329 | 3300025912 | Bacteria | 1921 |
| 376 | Ga0207707_10333038 | 3300025912 | Bacteria | 1309 |
| 377 | Ga0207707_10693232 | 3300025912 | Bacteria | 856 |
| 378 | Ga0207707_10887100 | 3300025912 | Bacteria | 738 |
| 379 | Ga0207695_10046209 | 3300025913 | Bacteria | 4616 |
| 380 | Ga0207695_10346493 | 3300025913 | Bacteria | 1373 |
| 381 | Ga0207695_10905729 | 3300025913 | Bacteria | 762 |
| 382 | Ga0207671_10024759 | 3300025914 | Bacteria | 4509 |
| 383 | Ga0207671_10762402 | 3300025914 | Bacteria | 768 |
| 384 | Ga0207693_10006663 | 3300025915 | Bacteria | 9540 |
| 385 | Ga0207693_10010431 | 3300025915 | Bacteria | 7539 |
| 386 | Ga0207693_10015052 | 3300025915 | Bacteria | 6209 |
| 387 | Ga0207693_10090807 | 3300025915 | Bacteria | 2394 |
| 388 | Ga0207663_10028739 | 3300025916 | Bacteria | 3258 |
| 389 | Ga0207663_10064670 | 3300025916 | Bacteria | 2335 |
| 390 | Ga0207663_10207282 | 3300025916 | Bacteria | 1418 |
| 391 | Ga0207663_10308647 | 3300025916 | Bacteria | 1185 |
| 392 | Ga0207660_10000442 | 3300025917 | Bacteria | 27342 |
| 393 | Ga0207660_10026455 | 3300025917 | Bacteria | 3951 |
| 394 | Ga0207660_10177737 | 3300025917 | Bacteria | 1651 |
| 395 | Ga0207662_10000249 | 3300025918 | Bacteria | 24950 |
| 396 | Ga0207662_10019805 | 3300025918 | Bacteria | 3834 |
| 397 | Ga0207662_10054156 | 3300025918 | Bacteria | 2392 |
| 398 | Ga0207657_10070172 | 3300025919 | Bacteria | 2970 |
| 399 | Ga0207657_10110272 | 3300025919 | Bacteria | 2273 |
| 400 | Ga0207657_10292629 | 3300025919 | Bacteria | 1291 |
| 401 | Ga0207649_10000057 | 3300025920 | Bacteria | 102314 |
| 402 | Ga0207649_10112813 | 3300025920 | Bacteria | 1819 |
| 403 | Ga0207652_10047059 | 3300025921 | Bacteria | 3684 |
| 404 | Ga0207652_10072938 | 3300025921 | Bacteria | 2985 |
| 405 | Ga0207652_10181847 | 3300025921 | Bacteria | 1890 |
| 406 | Ga0207652_10206046 | 3300025921 | Bacteria | 1770 |
| 407 | Ga0207652_10436836 | 3300025921 | Bacteria | 1180 |
| 408 | Ga0207681_10000181 | 3300025923 | Bacteria | 51755 |
| 409 | Ga0207681_10834303 | 3300025923 | Bacteria | 771 |
| 410 | Ga0207694_10033087 | 3300025924 | Bacteria | 3960 |
| 411 | Ga0207694_10063600 | 3300025924 | Bacteria | 2875 |
| 412 | Ga0207694_10154749 | 3300025924 | Bacteria | 1848 |
| 413 | Ga0207650_10001609 | 3300025925 | Bacteria | 16125 |
| 414 | Ga0207650_10097696 | 3300025925 | Bacteria | 2255 |
| 415 | Ga0207650_10156087 | 3300025925 | Bacteria | 1805 |
| 416 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 417 | Ga0207659_10043743 | 3300025926 | Bacteria | 3147 |
| 418 | Ga0207659_10163303 | 3300025926 | Bacteria | 1751 |
| 419 | Ga0207659_10605847 | 3300025926 | Bacteria | 934 |
| 420 | Ga0207687_10000061 | 3300025927 | Bacteria | 84113 |
| 421 | Ga0207687_10022684 | 3300025927 | Bacteria | 4180 |
| 422 | Ga0207687_10134612 | 3300025927 | Bacteria | 1868 |
| 423 | Ga0207687_10425291 | 3300025927 | Bacteria | 1097 |
| 424 | Ga0207700_10061550 | 3300025928 | Bacteria | 2847 |
| 425 | Ga0207700_10101299 | 3300025928 | Bacteria | 2297 |
| 426 | Ga0207700_10849511 | 3300025928 | Bacteria | 817 |
| 427 | Ga0207664_10044584 | 3300025929 | Bacteria | 3474 |
| 428 | Ga0207664_10115394 | 3300025929 | Bacteria | 2239 |
| 429 | Ga0207664_10154927 | 3300025929 | Bacteria | 1950 |
| 430 | Ga0207664_10518587 | 3300025929 | Bacteria | 1068 |
| 431 | Ga0207664_10671702 | 3300025929 | Bacteria | 931 |
| 432 | Ga0207644_10000315 | 3300025931 | Bacteria | 31527 |
| 433 | Ga0207644_10004323 | 3300025931 | Bacteria | 9212 |
| 434 | Ga0207644_10025117 | 3300025931 | Bacteria | 4094 |
| 435 | Ga0207690_10000445 | 3300025932 | Bacteria | 26765 |
| 436 | Ga0207690_10528477 | 3300025932 | Bacteria | 957 |
| 437 | Ga0207706_10002206 | 3300025933 | Bacteria | 18992 |
| 438 | Ga0207686_10005349 | 3300025934 | Bacteria | 6885 |
| 439 | Ga0207686_10033048 | 3300025934 | Bacteria | 3084 |
| 440 | Ga0207709_10000539 | 3300025935 | Bacteria | 32486 |
| 441 | Ga0207709_10009571 | 3300025935 | Bacteria | 5333 |
| 442 | Ga0207670_10000217 | 3300025936 | Bacteria | 37598 |
| 443 | Ga0207670_10448096 | 3300025936 | Bacteria | 1040 |
| 444 | Ga0207670_10495582 | 3300025936 | Bacteria | 991 |
| 445 | Ga0207669_10000147 | 3300025937 | Bacteria | 34031 |
| 446 | Ga0207669_10001178 | 3300025937 | Bacteria | 11092 |
| 447 | Ga0207704_10000299 | 3300025938 | Bacteria | 23415 |
| 448 | Ga0207704_10364507 | 3300025938 | Bacteria | 1129 |
| 449 | Ga0207665_10003176 | 3300025939 | Bacteria | 11002 |
| 450 | Ga0207691_10003210 | 3300025940 | Bacteria | 15950 |
| 451 | Ga0207691_10005305 | 3300025940 | Bacteria | 12439 |
| 452 | Ga0207691_10043403 | 3300025940 | Bacteria | 4144 |
| 453 | Ga0207691_10446209 | 3300025940 | Bacteria | 1101 |
| 454 | Ga0207711_10089361 | 3300025941 | Bacteria | 2706 |
| 455 | Ga0207689_10001029 | 3300025942 | Bacteria | 26794 |
| 456 | Ga0207689_10021476 | 3300025942 | Bacteria | 5427 |
| 457 | Ga0207661_10000215 | 3300025944 | Bacteria | 37435 |
| 458 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 459 | Ga0207679_10031711 | 3300025945 | Bacteria | 3701 |
| 460 | Ga0207679_10432510 | 3300025945 | Bacteria | 1164 |
| 461 | Ga0207679_10848767 | 3300025945 | Bacteria | 834 |
| 462 | Ga0207667_10014254 | 3300025949 | Bacteria | 9067 |
| 463 | Ga0207667_10038113 | 3300025949 | Bacteria | 5135 |
| 464 | Ga0207667_10107653 | 3300025949 | Bacteria | 2876 |
| 465 | Ga0207667_10154285 | 3300025949 | Bacteria | 2363 |
| 466 | Ga0207667_10247695 | 3300025949 | Bacteria | 1823 |
| 467 | Ga0207651_10019973 | 3300025960 | Bacteria | 4030 |
| 468 | Ga0207651_10109456 | 3300025960 | Bacteria | 2070 |
| 469 | Ga0207712_10000686 | 3300025961 | Bacteria | 26195 |
| 470 | Ga0207712_10053365 | 3300025961 | Bacteria | 2835 |
| 471 | Ga0207668_10000242 | 3300025972 | Bacteria | 36700 |
| 472 | Ga0207668_10113591 | 3300025972 | Bacteria | 2037 |
| 473 | Ga0207640_10028205 | 3300025981 | Bacteria | 3430 |
| 474 | Ga0207640_10146821 | 3300025981 | Bacteria | 1727 |
| 475 | Ga0207658_10016307 | 3300025986 | Bacteria | 5109 |
| 476 | Ga0207658_10116850 | 3300025986 | Bacteria | 2119 |
| 477 | Ga0207677_10009440 | 3300026023 | Bacteria | 5492 |
| 478 | Ga0207677_10491827 | 3300026023 | Bacteria | 1059 |
| 479 | Ga0207703_10004423 | 3300026035 | Bacteria | 11548 |
| 480 | Ga0207703_10022281 | 3300026035 | Bacteria | 4967 |
| 481 | Ga0207639_10048244 | 3300026041 | Bacteria | 3222 |
| 482 | Ga0207678_10001079 | 3300026067 | Bacteria | 24988 |
| 483 | Ga0207708_10000805 | 3300026075 | Bacteria | 23614 |
| 484 | Ga0207702_10002121 | 3300026078 | Bacteria | 19082 |
| 485 | Ga0207702_10530690 | 3300026078 | Bacteria | 1150 |
| 486 | Ga0207641_10005094 | 3300026088 | Bacteria | 11257 |
| 487 | Ga0207641_10005860 | 3300026088 | Bacteria | 10427 |
| 488 | Ga0207641_10105193 | 3300026088 | Bacteria | 2492 |
| 489 | Ga0207648_10000731 | 3300026089 | Bacteria | 36792 |
| 490 | Ga0207648_10011855 | 3300026089 | Bacteria | 8193 |
| 491 | Ga0207676_10000361 | 3300026095 | Bacteria | 38795 |
| 492 | Ga0207676_10005133 | 3300026095 | Bacteria | 9268 |
| 493 | Ga0207676_10108625 | 3300026095 | Bacteria | 2316 |
| 494 | Ga0207674_10002121 | 3300026116 | Bacteria | 25067 |
| 495 | Ga0207674_10284200 | 3300026116 | Bacteria | 1603 |
| 496 | Ga0207674_10404440 | 3300026116 | Bacteria | 1319 |
| 497 | Ga0207675_100001489 | 3300026118 | Bacteria | 23488 |
| 498 | Ga0207675_100040045 | 3300026118 | Bacteria | 4373 |
| 499 | Ga0207675_100044593 | 3300026118 | Bacteria | 4144 |
| 500 | Ga0207675_101505407 | 3300026118 | Bacteria | 694 |
| 501 | Ga0207683_10000034 | 3300026121 | Bacteria | 101817 |
| 502 | Ga0207683_10002523 | 3300026121 | Bacteria | 15985 |
| 503 | Ga0207683_10006107 | 3300026121 | Bacteria | 10314 |
| 504 | Ga0207698_10000304 | 3300026142 | Bacteria | 29523 |
| 505 | Ga0207698_10509200 | 3300026142 | Bacteria | 1173 |
| 506 | Ga0207698_10651508 | 3300026142 | Bacteria | 1043 |
| 507 | Ga0207698_10747296 | 3300026142 | Bacteria | 977 |
| 508 | Ga0209973_1001787 | 3300027252 | Bacteria | 1923 |
| 509 | Ga0210000_1005697 | 3300027462 | Bacteria | 1810 |
| 510 | Ga0209982_1004183 | 3300027552 | Bacteria | 2064 |
| 511 | Ga0210002_1006803 | 3300027617 | Bacteria | 1728 |
| 512 | Ga0209971_1025372 | 3300027682 | Bacteria | 1416 |
| 513 | Ga0209966_1005150 | 3300027695 | Bacteria | 2238 |
| 514 | Ga0209998_10001282 | 3300027717 | Bacteria | 6148 |
| 515 | Ga0209813_10006250 | 3300027866 | Bacteria | 2936 |
| 516 | Ga0209974_10002355 | 3300027876 | Bacteria | 6849 |
| 517 | Ga0207428_10000082 | 3300027907 | Bacteria | 133684 |
| 518 | Ga0207428_10000352 | 3300027907 | Bacteria | 59444 |
| 519 | Ga0207428_10040364 | 3300027907 | Bacteria | 3786 |
| 520 | Ga0207428_10149387 | 3300027907 | Bacteria | 1779 |
| 521 | Ga0207428_10262687 | 3300027907 | Bacteria | 1285 |
| 522 | Ga0265356_1014922 | 3300028017 | Bacteria | 845 |
| 523 | Ga0268266_10080780 | 3300028379 | Bacteria | 2833 |
| 524 | Ga0268266_10208955 | 3300028379 | Bacteria | 1789 |
| 525 | Ga0268266_10271437 | 3300028379 | Bacteria | 1574 |
| 526 | Ga0268266_10760434 | 3300028379 | Bacteria | 935 |
| 527 | Ga0268265_10001338 | 3300028380 | Bacteria | 21019 |
| 528 | Ga0268265_10280376 | 3300028380 | Bacteria | 1491 |
| 529 | Ga0268264_10026554 | 3300028381 | Bacteria | 4732 |
| 530 | Ga0265334_10126530 | 3300028573 | Bacteria | 911 |
| 531 | Ga0265338_10042722 | 3300028800 | Bacteria | 4216 |
| 532 | Ga0265338_10046571 | 3300028800 | Bacteria | 3973 |
| 533 | Ga0265330_10016019 | 3300031235 | Bacteria | 3464 |
| 534 | Ga0265330_10064897 | 3300031235 | Bacteria | 1585 |
| 535 | Ga0265330_10095205 | 3300031235 | Bacteria | 1276 |
| 536 | Ga0265332_10009149 | 3300031238 | Bacteria | 4429 |
| 537 | Ga0265328_10000024 | 3300031239 | Bacteria | 123047 |
| 538 | Ga0265328_10000062 | 3300031239 | Bacteria | 61951 |
| 539 | Ga0265328_10041847 | 3300031239 | Bacteria | 1687 |
| 540 | Ga0265320_10049948 | 3300031240 | Bacteria | 2035 |
| 541 | Ga0265325_10023519 | 3300031241 | Bacteria | 3362 |
| 542 | Ga0265325_10047176 | 3300031241 | Bacteria | 2231 |
| 543 | Ga0265329_10033535 | 3300031242 | Bacteria | 1660 |
| 544 | Ga0265340_10002509 | 3300031247 | Bacteria | 10431 |
| 545 | Ga0265340_10020501 | 3300031247 | Bacteria | 3397 |
| 546 | Ga0265340_10023384 | 3300031247 | Bacteria | 3152 |
| 547 | Ga0265340_10145467 | 3300031247 | Bacteria | 1082 |
| 548 | Ga0265340_10253202 | 3300031247 | Bacteria | 785 |
| 549 | Ga0265339_10027908 | 3300031249 | Bacteria | 3214 |
| 550 | Ga0265339_10040655 | 3300031249 | Bacteria | 2583 |
| 551 | Ga0265331_10009560 | 3300031250 | Bacteria | 5436 |
| 552 | Ga0265331_10012103 | 3300031250 | Bacteria | 4691 |
| 553 | Ga0265331_10038674 | 3300031250 | Bacteria | 2330 |
| 554 | Ga0265331_10069285 | 3300031250 | Bacteria | 1652 |
| 555 | Ga0265327_10009583 | 3300031251 | Bacteria | 6960 |
| 556 | Ga0265327_10010514 | 3300031251 | Bacteria | 6497 |
| 557 | Ga0265316_10000169 | 3300031344 | Bacteria | 73902 |
| 558 | Ga0265313_10006684 | 3300031595 | Bacteria | 8083 |
| 559 | Ga0265313_10054003 | 3300031595 | Bacteria | 1910 |
| 560 | Ga0316579_10148529 | 3300031691 | Bacteria | 1130 |
| 561 | Ga0265314_10001306 | 3300031711 | Bacteria | 28247 |
| 562 | Ga0265314_10020005 | 3300031711 | Bacteria | 5175 |
| 563 | Ga0265314_10144199 | 3300031711 | Bacteria | 1469 |
| 564 | Ga0265342_10000789 | 3300031712 | Bacteria | 31942 |
| 565 | Ga0265342_10000841 | 3300031712 | Bacteria | 30728 |
| 566 | Ga0265342_10007421 | 3300031712 | Bacteria | 8028 |
| 567 | Ga0265342_10065814 | 3300031712 | Bacteria | 2123 |
| 568 | Ga0316577_10207003 | 3300031733 | Bacteria | 1109 |
| 569 | Ga0307416_100395465 | 3300032002 | Bacteria | 1418 |
| 570 | Ga0307416_100647949 | 3300032002 | Bacteria | 1141 |
| 571 | Ga0373930_0035332 | 3300034816 | Bacteria | 1045 |
| 572 | Ga0373948_0001393 | 3300034817 | Bacteria | 3335 |
| 573 | Ga0373950_0001040 | 3300034818 | Bacteria | 3537 |
| 574 | Ga0373950_0005130 | 3300034818 | Bacteria | 1945 |
| 575 | Ga0373958_0026831 | 3300034819 | Bacteria | 1105 |
| 576 | Ga0373959_0007712 | 3300034820 | Bacteria | 1814 |
| 577 | Ga0373938_0019233 | 3300034957 | Bacteria | 1364 |
| 578 | Ga0373928_0001679 | 3300035084 | Bacteria | 4293 |
| 579 | Ga0373928_0035349 | 3300035084 | Bacteria | 1125 |
| 580 | Ga0373929_0011394 | 3300035085 | Bacteria | 1675 |
| 581 | Ga0373929_0018020 | 3300035085 | Bacteria | 1399 |
| 582 | Ga0373934_0013386 | 3300035086 | Bacteria | 3103 |
| 583 | Ga0373934_0067024 | 3300035086 | Bacteria | 1434 |
| 584 | Ga0373944_0134051 | 3300035089 | Bacteria | 863 |
| 585 | Ga0373949_0001470 | 3300035090 | Bacteria | 6725 |
| 586 | Ga0373949_0019248 | 3300035090 | Bacteria | 1554 |
| 587 | Ga0373951_0000695 | 3300035091 | Bacteria | 9241 |
| 588 | Ga0373951_0022194 | 3300035091 | Bacteria | 1460 |
| 589 | Ga0373952_0008157 | 3300035092 | Bacteria | 1981 |
| 590 | Ga0373923_0049783 | 3300035111 | Bacteria | 1753 |
| 591 | Ga0373932_0001842 | 3300035112 | Bacteria | 5676 |
| 592 | Ga0373932_0011205 | 3300035112 | Bacteria | 2186 |
| 593 | Ga0373936_0239826 | 3300035113 | Bacteria | 808 |
| 594 | Ga0373939_0001533 | 3300035114 | Bacteria | 5602 |
| 595 | Ga0373941_0003981 | 3300035115 | Bacteria | 3384 |
| 596 | Ga0373941_0067529 | 3300035115 | Bacteria | 1179 |
| 597 | Ga0373953_0035046 | 3300035117 | Bacteria | 1970 |
| 598 | Ga0373953_0162433 | 3300035117 | Bacteria | 960 |
| 599 | Ga0373954_0014658 | 3300035118 | Bacteria | 3497 |
| 600 | Ga0373954_0025923 | 3300035118 | Bacteria | 2684 |
| 601 | Ga0373956_0004403 | 3300035119 | Bacteria | 5639 |
| 602 | Ga0373956_0190037 | 3300035119 | Bacteria | 972 |
| 603 | Ga0373957_0003558 | 3300035120 | Bacteria | 4625 |
| 604 | Ga0373957_0052232 | 3300035120 | Bacteria | 1565 |
| 605 | Ga0373960_0001162 | 3300035121 | Bacteria | 5727 |
| 606 | Ga0373960_0016249 | 3300035121 | Bacteria | 1912 |
| 607 | Ga0373943_0000992 | 3300035170 | Bacteria | 12608 |
| 608 | Ga0373943_0005818 | 3300035170 | Bacteria | 5538 |
| 609 | Ga0373943_0035214 | 3300035170 | Bacteria | 2391 |
| 610 | Ga0373946_0019049 | 3300035171 | Bacteria | 2640 |
| 611 | Ga0373946_0053849 | 3300035171 | Bacteria | 1691 |
| 612 | Ga0373946_0194070 | 3300035171 | Bacteria | 969 |
| 613 | Ga0373955_0003642 | 3300035172 | Bacteria | 6781 |
| 614 | Ga0373955_0029028 | 3300035172 | Bacteria | 2873 |
| 615 | Ga0373942_0001447 | 3300035207 | Bacteria | 6091 |
| 616 | Ga0373942_0008953 | 3300035207 | Bacteria | 2339 |
| 617 | Ga0373962_0000468 | 3300035242 | Bacteria | 8934 |
| 618 | Ga0373962_0000929 | 3300035242 | Bacteria | 6738 |
| 619 | Ga0373962_0101869 | 3300035242 | Bacteria | 896 |
| 620 | Ga0373924_0013369 | 3300035410 | Bacteria | 3084 |
| 621 | Ga0373924_0015278 | 3300035410 | Bacteria | 2917 |
| 622 | Ga0373931_0000179 | 3300035691 | Bacteria | 27558 |
| 623 | Ga0373931_0003177 | 3300035691 | Bacteria | 7329 |
| 624 | Ga0373935_0068330 | 3300035692 | Bacteria | 2287 |
| 625 | Ga0373935_0069926 | 3300035692 | Bacteria | 2262 |
| 626 | Ga0373935_0090757 | 3300035692 | Bacteria | 2000 |
| 627 | Ga0373927_0003126 | 3300035695 | Bacteria | 11969 |
| 628 | Ga0373927_0078966 | 3300035695 | Bacteria | 2131 |
| 629 | Ga0373927_0082182 | 3300035695 | Bacteria | 2088 |
| 630 | Ga0373927_0099715 | 3300035695 | Bacteria | 1889 |
| 631 | Ga0373927_0584424 | 3300035695 | Bacteria | 738 |
| 632 | Ga0373933_0002265 | 3300035724 | Bacteria | 10966 |
| 633 | Ga0373947_0006073 | 3300035725 | Bacteria | 7039 |
| 634 | Ga0373947_0008855 | 3300035725 | Bacteria | 5790 |
| 635 | Ga0373947_0027605 | 3300035725 | Bacteria | 3323 |
| 636 | Ga0373937_0004474 | 3300036401 | Bacteria | 11870 |
| 637 | Ga0373937_0038449 | 3300036401 | Bacteria | 4359 |
| 638 | Ga0373937_0114369 | 3300036401 | Bacteria | 2512 |
| 639 | Ga0373937_0339201 | 3300036401 | Bacteria | 1423 |
| 640 | Ga0316582_0440567 | 3300036647 | Bacteria | 898 |
| 641 | Ga0373925_0006666 | 3300037068 | Bacteria | 8472 |
| 642 | Ga0373925_0017728 | 3300037068 | Bacteria | 5166 |
| 643 | Ga0373925_0021696 | 3300037068 | Bacteria | 4680 |
| 644 | Ga0373925_0054684 | 3300037068 | Bacteria | 2986 |
| 645 | Ga0373925_0200398 | 3300037068 | Bacteria | 1587 |
| 646 | Ga0373925_0223914 | 3300037068 | Bacteria | 1502 |
| 647 | Ga0395898_0086749 | 3300037466 | Bacteria | 3016 |
| 648 | Ga0436364_1035021 | 3300037853 | Bacteria | 1409 |
| 649 | Ga0436365_0318099 | 3300039437 | Bacteria | 866 |
| 650 | Ga0436365_0366367 | 3300039437 | Bacteria | 1653 |
| 651 | Ga0436365_0856773 | 3300039437 | Bacteria | 2495 |
| 652 | Ga0436365_1578283 | 3300039437 | Bacteria | 1046 |
| 653 | Ga0436365_1854878 | 3300039437 | Bacteria | 6880 |
| 654 | Ga0436360_0504011 | 3300039438 | Bacteria | 1016 |
| 655 | Ga0436360_0549825 | 3300039438 | Bacteria | 2067 |
| 656 | Ga0436360_0752551 | 3300039438 | Bacteria | 3704 |
| 657 | Ga0436360_1359514 | 3300039438 | Bacteria | 661 |
| 658 | Ga0436363_0754692 | 3300039450 | Bacteria | 683 |
| 659 | Ga0436363_1377017 | 3300039450 | Bacteria | 777 |
| 660 | Ga0436362_0747841 | 3300039453 | Bacteria | 850 |
| 661 | Ga0439456_037983 | 3300042013 | Bacteria | 1040 |
| 662 | Ga0439434_0058307 | 3300042435 | Bacteria | 1205 |
| 663 | Ga0466963_0167248 | 3300044694 | Bacteria | 1532 |
| 664 | Ga0453684_0000077 | 3300044712 | Bacteria | 435536 |
| 665 | Ga0453684_0335090 | 3300044712 | Bacteria | 1710 |
| 666 | Ga0466968_0002228 | 3300044735 | Bacteria | 7086 |
| 667 | Ga0466968_0419262 | 3300044735 | Bacteria | 658 |
| 668 | Ga0466970_0461550 | 3300044765 | Bacteria | 729 |
| 669 | Ga0466960_0480143 | 3300044901 | Bacteria | 726 |
| 670 | Ga0466959_0108232 | 3300045049 | Bacteria | 1986 |
| 671 | Ga0466959_0343411 | 3300045049 | Bacteria | 1018 |
| 672 | Ga0451576_0009171 | 3300045051 | Bacteria | 11498 |
| 673 | Ga0495603_0175656 | 3300046455 | Bacteria | 1240 |
| 674 | Ga0495603_0222782 | 3300046455 | Bacteria | 1088 |
| 675 | Ga0495629_0000062 | 3300046459 | Bacteria | 97169 |
| 676 | Ga0495629_0004556 | 3300046459 | Bacteria | 10367 |
| 677 | Ga0495629_0158289 | 3300046459 | Bacteria | 1573 |
| 678 | Ga0495638_0026888 | 3300046460 | Bacteria | 3727 |
| 679 | Ga0495641_0020006 | 3300046461 | Bacteria | 3408 |
| 680 | Ga0495641_0294315 | 3300046461 | Bacteria | 731 |
| 681 | Ga0495651_0008073 | 3300046462 | Bacteria | 8071 |
| 682 | Ga0495651_0021886 | 3300046462 | Bacteria | 4971 |
| 683 | Ga0495651_0076768 | 3300046462 | Bacteria | 2530 |
| 684 | Ga0495653_0015013 | 3300046463 | Bacteria | 6317 |
| 685 | Ga0495653_0028022 | 3300046463 | Bacteria | 4508 |
| 686 | Ga0495580_0124303 | 3300046472 | Bacteria | 1790 |
| 687 | Ga0495580_0133832 | 3300046472 | Bacteria | 1719 |
| 688 | Ga0495580_0339946 | 3300046472 | Bacteria | 1018 |
| 689 | Ga0495582_0031031 | 3300046473 | Bacteria | 2937 |
| 690 | Ga0495582_0373796 | 3300046473 | Bacteria | 821 |
| 691 | Ga0495605_0020124 | 3300046474 | Bacteria | 3550 |
| 692 | Ga0495639_0034490 | 3300046475 | Bacteria | 2264 |
| 693 | Ga0495662_0001185 | 3300046476 | Bacteria | 12876 |
| 694 | Ga0495664_0000434 | 3300046477 | Bacteria | 20493 |
| 695 | Ga0495664_0052190 | 3300046477 | Bacteria | 2429 |
| 696 | Ga0495594_0047133 | 3300046499 | Bacteria | 2367 |
| 697 | Ga0495608_0022048 | 3300046511 | Bacteria | 4366 |
| 698 | Ga0495608_0056862 | 3300046511 | Bacteria | 2582 |
| 699 | Ga0495608_0073810 | 3300046511 | Bacteria | 2224 |
| 700 | Ga0495618_0010670 | 3300046514 | Bacteria | 5561 |
| 701 | Ga0495618_0042884 | 3300046514 | Bacteria | 2853 |
| 702 | Ga0495620_0154997 | 3300046515 | Bacteria | 892 |
| 703 | Ga0495630_0042726 | 3300046517 | Bacteria | 3385 |
| 704 | Ga0495630_0047207 | 3300046517 | Bacteria | 3221 |
| 705 | Ga0495630_0052177 | 3300046517 | Bacteria | 3061 |
| 706 | Ga0495630_0057159 | 3300046517 | Bacteria | 2924 |
| 707 | Ga0495630_0175583 | 3300046517 | Bacteria | 1633 |
| 708 | Ga0495632_0094049 | 3300046519 | Bacteria | 1418 |
| 709 | Ga0495637_0093124 | 3300046520 | Bacteria | 1186 |
| 710 | Ga0495652_0006237 | 3300046529 | Bacteria | 11118 |
| 711 | Ga0495652_0033805 | 3300046529 | Bacteria | 4460 |
| 712 | Ga0495652_0051239 | 3300046529 | Bacteria | 3526 |
| 713 | Ga0495665_0036852 | 3300046531 | Bacteria | 2610 |
| 714 | Ga0495640_0003511 | 3300046533 | Bacteria | 12605 |
| 715 | Ga0495640_0126485 | 3300046533 | Bacteria | 1657 |
| 716 | Ga0495586_0148965 | 3300046535 | Bacteria | 1316 |
| 717 | Ga0495587_0010013 | 3300046536 | Bacteria | 6054 |
| 718 | Ga0495587_0071841 | 3300046536 | Bacteria | 2012 |
| 719 | Ga0495598_0014745 | 3300046537 | Bacteria | 1959 |
| 720 | Ga0495621_0004111 | 3300046539 | Bacteria | 4055 |
| 721 | Ga0495645_0000746 | 3300046543 | Bacteria | 22248 |
| 722 | Ga0495645_0081076 | 3300046543 | Bacteria | 2328 |
| 723 | Ga0495667_0006860 | 3300046559 | Bacteria | 7731 |
| 724 | Ga0495656_0025755 | 3300046615 | Bacteria | 2335 |
| 725 | Ga0495656_0054643 | 3300046615 | Bacteria | 1719 |
| 726 | Ga0495634_0001083 | 3300046642 | Bacteria | 25343 |
| 727 | Ga0495634_0002973 | 3300046642 | Bacteria | 13828 |
| 728 | Ga0495635_0000191 | 3300046663 | Bacteria | 38736 |
| 729 | Ga0495635_0009194 | 3300046663 | Bacteria | 6901 |
| 730 | Ga0495635_0045789 | 3300046663 | Bacteria | 3018 |
| 731 | Ga0495635_0285093 | 3300046663 | Bacteria | 1109 |
| 732 | Ga0495657_0013089 | 3300046675 | Bacteria | 6132 |
| 733 | Ga0495657_0077155 | 3300046675 | Bacteria | 2162 |
| 734 | Ga0495599_0019404 | 3300046678 | Bacteria | 4238 |
| 735 | Ga0495623_0001696 | 3300046679 | Bacteria | 14806 |
| 736 | Ga0495623_0373583 | 3300046679 | Bacteria | 772 |
| 737 | Ga0495646_0017448 | 3300046680 | Bacteria | 4553 |
| 738 | Ga0495647_0159565 | 3300046681 | Bacteria | 971 |
| 739 | Ga0495647_0212297 | 3300046681 | Bacteria | 852 |
| 740 | Ga0495658_0000109 | 3300046683 | Bacteria | 43760 |
| 741 | Ga0495658_0066143 | 3300046683 | Bacteria | 2087 |
| 742 | Ga0495658_0181247 | 3300046683 | Bacteria | 1307 |
| 743 | Ga0495658_0579663 | 3300046683 | Bacteria | 718 |
| 744 | Ga0495669_0138161 | 3300046684 | Bacteria | 1149 |
| 745 | Ga0495613_0031653 | 3300046689 | Bacteria | 3930 |
| 746 | Ga0495613_0078612 | 3300046689 | Bacteria | 2399 |
| 747 | Ga0495613_0237319 | 3300046689 | Bacteria | 1276 |
| 748 | Ga0495613_0456689 | 3300046689 | Bacteria | 865 |
| 749 | Ga0495624_0044312 | 3300046690 | Bacteria | 2836 |
| 750 | Ga0495600_0012096 | 3300046809 | Bacteria | 5390 |
| 751 | Ga0495600_0030521 | 3300046809 | Bacteria | 3492 |
| 752 | Ga0495581_0115200 | 3300047315 | Bacteria | 1563 |
| 753 | Ga0495604_0002530 | 3300047317 | Bacteria | 14585 |
| 754 | Ga0495604_0008733 | 3300047317 | Bacteria | 8009 |
| 755 | Ga0495604_0054322 | 3300047317 | Bacteria | 3091 |
| 756 | Ga0495674_0047398 | 3300047319 | Bacteria | 3811 |
| 757 | Ga0495674_0085149 | 3300047319 | Bacteria | 2708 |
| 758 | Ga0495672_0226140 | 3300047320 | Bacteria | 921 |
| 759 | Ga0495676_0094272 | 3300047321 | Bacteria | 2230 |
| 760 | Ga0495676_0179857 | 3300047321 | Bacteria | 1483 |
| 761 | Ga0495680_0000483 | 3300047322 | Bacteria | 44818 |
| 762 | Ga0495680_0252209 | 3300047322 | Bacteria | 1250 |
| 763 | Ga0495680_0309715 | 3300047322 | Bacteria | 1107 |
| 764 | Ga0495680_0404952 | 3300047322 | Bacteria | 941 |
| 765 | Ga0495675_0035911 | 3300047444 | Bacteria | 3163 |
| 766 | Ga0495677_0058129 | 3300047445 | Bacteria | 1430 |
| 767 | Ga0495684_0001760 | 3300047471 | Bacteria | 17401 |
| 768 | Ga0495684_0002479 | 3300047471 | Bacteria | 14711 |
| 769 | Ga0495684_0027128 | 3300047471 | Bacteria | 4397 |
| 770 | Ga0495684_0180563 | 3300047471 | Bacteria | 1564 |
| 771 | Ga0495684_0515381 | 3300047471 | Bacteria | 820 |
| 772 | Ga0495593_0001596 | 3300047673 | Bacteria | 13393 |
| 773 | Ga0495593_0016387 | 3300047673 | Bacteria | 4181 |
| 774 | Ga0495593_0050476 | 3300047673 | Bacteria | 2204 |
| 775 | Ga0495602_0031093 | 3300048088 | Bacteria | 5052 |
| 776 | Ga0495602_0037615 | 3300048088 | Bacteria | 4487 |
| 777 | Ga0495602_0082549 | 3300048088 | Bacteria | 2697 |
| 778 | Ga0496100_0001014 | 3300048903 | Bacteria | 13552 |
| 779 | Ga0496100_0009625 | 3300048903 | Bacteria | 5434 |
| 780 | Ga0496100_0175698 | 3300048903 | Bacteria | 1546 |
| 781 | Ga0496100_0422212 | 3300048903 | Bacteria | 1019 |
| 782 | Ga0496101_0001828 | 3300048904 | Bacteria | 12832 |
| 783 | Ga0496101_0035261 | 3300048904 | Bacteria | 3537 |
| 784 | Ga0496101_0141183 | 3300048904 | Bacteria | 1836 |
| 785 | Ga0496102_0000988 | 3300048905 | Bacteria | 26727 |
| 786 | Ga0496102_0055636 | 3300048905 | Bacteria | 3607 |
| 787 | Ga0496102_0258809 | 3300048905 | Bacteria | 1641 |
| 788 | Ga0496102_0420536 | 3300048905 | Bacteria | 1255 |
| 789 | Ga0496102_0447139 | 3300048905 | Bacteria | 1212 |
| 790 | Ga0496103_0000582 | 3300048906 | Bacteria | 28897 |
| 791 | Ga0496103_0005721 | 3300048906 | Bacteria | 7428 |
| 792 | Ga0496103_0035550 | 3300048906 | Bacteria | 3050 |
| 793 | Ga0496104_0000067 | 3300048907 | Bacteria | 108556 |
| 794 | Ga0496104_0000574 | 3300048907 | Bacteria | 31370 |
| 795 | Ga0496104_0007277 | 3300048907 | Bacteria | 9768 |
| 796 | Ga0496104_0013597 | 3300048907 | Bacteria | 7337 |
| 797 | Ga0496104_0051947 | 3300048907 | Bacteria | 3870 |
| 798 | Ga0496104_0300987 | 3300048907 | Bacteria | 1516 |
| 799 | Ga0496104_0534538 | 3300048907 | Bacteria | 1083 |
| 800 | Ga0496105_0001954 | 3300048908 | Bacteria | 14793 |
| 801 | Ga0496105_0006546 | 3300048908 | Bacteria | 8963 |
| 802 | Ga0496105_0028842 | 3300048908 | Bacteria | 4540 |
| 803 | Ga0496105_0077653 | 3300048908 | Bacteria | 2742 |
| 804 | Ga0496105_0092496 | 3300048908 | Bacteria | 2497 |
| 805 | Ga0496105_0111126 | 3300048908 | Bacteria | 2262 |
| 806 | Ga0496105_0189545 | 3300048908 | Bacteria | 1682 |
| 807 | Ga0496105_0658204 | 3300048908 | Bacteria | 807 |
| 808 | Ga0496106_0002154 | 3300048909 | Bacteria | 14716 |
| 809 | Ga0496106_0011737 | 3300048909 | Bacteria | 6468 |
| 810 | Ga0496106_0023714 | 3300048909 | Bacteria | 4559 |
| 811 | Ga0496107_0006560 | 3300048910 | Bacteria | 8007 |
| 812 | Ga0496107_0007065 | 3300048910 | Bacteria | 7734 |
| 813 | Ga0496107_0012178 | 3300048910 | Bacteria | 6000 |
| 814 | Ga0496107_0041111 | 3300048910 | Bacteria | 3320 |
| 815 | Ga0496107_0516656 | 3300048910 | Bacteria | 885 |
| 816 | Ga0496107_0746934 | 3300048910 | Bacteria | 718 |
| 817 | Ga0496108_0002765 | 3300048911 | Bacteria | 14044 |
| 818 | Ga0496108_0006074 | 3300048911 | Bacteria | 9765 |
| 819 | Ga0496108_0025713 | 3300048911 | Bacteria | 4853 |
| 820 | Ga0496108_0332063 | 3300048911 | Bacteria | 1326 |
| 821 | Ga0496109_0013377 | 3300048912 | Bacteria | 7115 |
| 822 | Ga0496109_0032046 | 3300048912 | Bacteria | 4721 |
| 823 | Ga0496109_0038333 | 3300048912 | Bacteria | 4332 |
| 824 | Ga0496109_0086166 | 3300048912 | Bacteria | 2900 |
| 825 | Ga0496109_0299035 | 3300048912 | Bacteria | 1517 |
| 826 | Ga0496109_0610264 | 3300048912 | Bacteria | 1027 |
| 827 | Ga0496109_1193246 | 3300048912 | Bacteria | 698 |
| 828 | Ga0496110_0011410 | 3300048913 | Bacteria | 7271 |
| 829 | Ga0496110_0026612 | 3300048913 | Bacteria | 4952 |
| 830 | Ga0496110_0037606 | 3300048913 | Bacteria | 4207 |
| 831 | Ga0496110_0091061 | 3300048913 | Bacteria | 2728 |
| 832 | Ga0496110_0219196 | 3300048913 | Bacteria | 1730 |
| 833 | Ga0496110_1159920 | 3300048913 | Bacteria | 681 |
| 834 | Ga0496111_0004190 | 3300048914 | Bacteria | 9074 |
| 835 | Ga0496111_0006677 | 3300048914 | Bacteria | 7505 |
| 836 | Ga0496111_0041909 | 3300048914 | Bacteria | 3286 |
| 837 | Ga0496111_0230408 | 3300048914 | Bacteria | 1376 |
| 838 | Ga0496111_0772410 | 3300048914 | Bacteria | 696 |
| 839 | Ga0496112_0006568 | 3300048915 | Bacteria | 10234 |
| 840 | Ga0496112_0017351 | 3300048915 | Bacteria | 6762 |
| 841 | Ga0496112_0028719 | 3300048915 | Bacteria | 5372 |
| 842 | Ga0496112_0080898 | 3300048915 | Bacteria | 3212 |
| 843 | Ga0496112_0236978 | 3300048915 | Bacteria | 1778 |
| 844 | Ga0496112_0301665 | 3300048915 | Bacteria | 1547 |
| 845 | Ga0496112_0340012 | 3300048915 | Bacteria | 1444 |
| 846 | Ga0496113_0001805 | 3300048916 | Bacteria | 12150 |
| 847 | Ga0496113_0465766 | 3300048916 | Bacteria | 1015 |
| 848 | Ga0496114_0010065 | 3300048917 | Bacteria | 7519 |
| 849 | Ga0496114_0067703 | 3300048917 | Bacteria | 2996 |
| 850 | Ga0496114_0116425 | 3300048917 | Bacteria | 2294 |
| 851 | Ga0496114_0119182 | 3300048917 | Bacteria | 2268 |
| 852 | Ga0496114_0149386 | 3300048917 | Bacteria | 2027 |
| 853 | Ga0496114_0598803 | 3300048917 | Bacteria | 972 |
| 854 | Ga0496115_0001071 | 3300048918 | Bacteria | 19818 |
| 855 | Ga0496115_0024471 | 3300048918 | Bacteria | 4694 |
| 856 | Ga0496115_0102231 | 3300048918 | Bacteria | 2350 |
| 857 | Ga0496115_0175960 | 3300048918 | Bacteria | 1769 |
| 858 | Ga0496115_0190245 | 3300048918 | Bacteria | 1695 |
| 859 | Ga0496115_0217606 | 3300048918 | Bacteria | 1576 |
| 860 | Ga0496119_0001667 | 3300048922 | Bacteria | 25946 |
| 861 | Ga0496121_0528065 | 3300048924 | Bacteria | 743 |
| 862 | Ga0496124_0349404 | 3300048927 | Bacteria | 1047 |
| 863 | Ga0496125_0276116 | 3300048928 | Bacteria | 1044 |
| 864 | Ga0496126_0119510 | 3300048929 | Bacteria | 2287 |
| 865 | Ga0496126_0189030 | 3300048929 | Bacteria | 1745 |
| 866 | Ga0496126_0534261 | 3300048929 | Bacteria | 933 |
| 867 | Ga0501031_0002368 | 3300049568 | Bacteria | 11954 |
| 868 | Ga0501031_0028797 | 3300049568 | Bacteria | 3620 |
| 869 | Ga0501031_0476964 | 3300049568 | Bacteria | 805 |
| 870 | Ga0501032_0000001 | 3300049569 | Bacteria | 422097 |
| 871 | Ga0501032_0005172 | 3300049569 | Bacteria | 9722 |
| 872 | Ga0501032_0034615 | 3300049569 | Bacteria | 3456 |
| 873 | Ga0501033_0000077 | 3300049570 | Bacteria | 92696 |
| 874 | Ga0501033_0026780 | 3300049570 | Bacteria | 4338 |
| 875 | Ga0501033_0039024 | 3300049570 | Bacteria | 3547 |
| 876 | Ga0501033_0051447 | 3300049570 | Bacteria | 3053 |
| 877 | Ga0501033_0119303 | 3300049570 | Bacteria | 1915 |
| 878 | Ga0501033_0322595 | 3300049570 | Bacteria | 1085 |
| 879 | Ga0501034_0000023 | 3300049571 | Bacteria | 263892 |
| 880 | Ga0501034_0013529 | 3300049571 | Bacteria | 8398 |
| 881 | Ga0501034_0038088 | 3300049571 | Bacteria | 4871 |
| 882 | Ga0501034_0091995 | 3300049571 | Bacteria | 3031 |
| 883 | Ga0501034_0094333 | 3300049571 | Bacteria | 2989 |
| 884 | Ga0501034_0409332 | 3300049571 | Bacteria | 1278 |
| 885 | Ga0501036_0000482 | 3300049572 | Bacteria | 28438 |
| 886 | Ga0501036_0006028 | 3300049572 | Bacteria | 9827 |
| 887 | Ga0501036_0062317 | 3300049572 | Bacteria | 3159 |
| 888 | Ga0501036_0106875 | 3300049572 | Bacteria | 2366 |
| 889 | Ga0501037_0000065 | 3300049573 | Bacteria | 96747 |
| 890 | Ga0501037_0017847 | 3300049573 | Bacteria | 5224 |
| 891 | Ga0501037_0277777 | 3300049573 | Bacteria | 1167 |
| 892 | Ga0501038_0000043 | 3300049574 | Bacteria | 113010 |
| 893 | Ga0501038_0014243 | 3300049574 | Bacteria | 7245 |
| 894 | Ga0501038_0129304 | 3300049574 | Bacteria | 2075 |
| 895 | Ga0501038_0348225 | 3300049574 | Bacteria | 1154 |
| 896 | Ga0501038_0380147 | 3300049574 | Bacteria | 1096 |
| 897 | Ga0501039_0000022 | 3300049575 | Bacteria | 160858 |
| 898 | Ga0501039_0005361 | 3300049575 | Bacteria | 9703 |
| 899 | Ga0501039_0056652 | 3300049575 | Bacteria | 3036 |
| 900 | Ga0501039_0080733 | 3300049575 | Bacteria | 2531 |
| 901 | Ga0501041_0062492 | 3300049577 | Bacteria | 2280 |
| 902 | Ga0501041_0139385 | 3300049577 | Bacteria | 1512 |
| 903 | Ga0501042_0023231 | 3300049578 | Bacteria | 4337 |
| 904 | Ga0501042_0110756 | 3300049578 | Bacteria | 1977 |
| 905 | Ga0501042_0164433 | 3300049578 | Bacteria | 1601 |
| 906 | Ga0501043_0000310 | 3300049579 | Bacteria | 44324 |
| 907 | Ga0501043_0027092 | 3300049579 | Bacteria | 4498 |
| 908 | Ga0501043_0175769 | 3300049579 | Bacteria | 1669 |
| 909 | Ga0501043_0253948 | 3300049579 | Bacteria | 1354 |
| 910 | Ga0501043_0563906 | 3300049579 | Bacteria | 845 |
| 911 | Ga0501046_0003995 | 3300049580 | Bacteria | 13466 |
| 912 | Ga0501047_0047790 | 3300049581 | Bacteria | 4133 |
| 913 | Ga0501047_0116322 | 3300049581 | Bacteria | 2556 |
| 914 | Ga0501047_0158048 | 3300049581 | Bacteria | 2139 |
| 915 | Ga0501047_0633832 | 3300049581 | Bacteria | 889 |
| 916 | Ga0501048_0024560 | 3300049582 | Bacteria | 4398 |
| 917 | Ga0501048_0101228 | 3300049582 | Bacteria | 2033 |
| 918 | Ga0501067_0003221 | 3300049583 | Bacteria | 8990 |
| 919 | Ga0501067_0039548 | 3300049583 | Bacteria | 2619 |
| 920 | Ga0501067_0185870 | 3300049583 | Bacteria | 1157 |
| 921 | Ga0501067_0230132 | 3300049583 | Bacteria | 1032 |
| 922 | Ga0501067_0288483 | 3300049583 | Bacteria | 914 |
| 923 | Ga0501068_0177511 | 3300049584 | Bacteria | 1346 |
| 924 | Ga0501069_0004930 | 3300049585 | Bacteria | 6922 |
| 925 | Ga0501069_0011625 | 3300049585 | Bacteria | 4667 |
| 926 | Ga0501069_0197148 | 3300049585 | Bacteria | 1166 |
| 927 | Ga0501069_0342264 | 3300049585 | Bacteria | 881 |
| 928 | Ga0501070_0009447 | 3300049586 | Bacteria | 8242 |
| 929 | Ga0501070_0016831 | 3300049586 | Bacteria | 6137 |
| 930 | Ga0501070_0055665 | 3300049586 | Bacteria | 3278 |
| 931 | Ga0501070_0086797 | 3300049586 | Bacteria | 2590 |
| 932 | Ga0501070_0516702 | 3300049586 | Bacteria | 958 |
| 933 | Ga0501071_0216513 | 3300049587 | Bacteria | 1441 |
| 934 | Ga0501072_0216317 | 3300049588 | Bacteria | 1527 |
| 935 | Ga0501072_0318627 | 3300049588 | Bacteria | 1236 |
| 936 | Ga0501072_0437972 | 3300049588 | Bacteria | 1035 |
| 937 | Ga0501073_0042012 | 3300049589 | Bacteria | 3228 |
| 938 | Ga0501073_0163199 | 3300049589 | Bacteria | 1543 |
| 939 | Ga0501074_0005559 | 3300049590 | Bacteria | 9066 |
| 940 | Ga0501074_0097865 | 3300049590 | Bacteria | 2100 |
| 941 | Ga0501074_0166052 | 3300049590 | Bacteria | 1576 |
| 942 | Ga0501074_0173054 | 3300049590 | Bacteria | 1541 |
| 943 | Ga0501074_0685133 | 3300049590 | Bacteria | 724 |
| 944 | Ga0501076_0016642 | 3300049592 | Bacteria | 5575 |
| 945 | Ga0501076_0059310 | 3300049592 | Bacteria | 3044 |
| 946 | Ga0501077_0009848 | 3300049593 | Bacteria | 5945 |
| 947 | Ga0501079_0016096 | 3300049741 | Bacteria | 5715 |
| 948 | Ga0501079_0534606 | 3300049741 | Bacteria | 922 |
| 949 | Ga0501079_0604464 | 3300049741 | Bacteria | 863 |
| 950 | Ga0501080_0034590 | 3300049742 | Bacteria | 4718 |
| 951 | Ga0501080_0076615 | 3300049742 | Bacteria | 3110 |
| 952 | Ga0501080_0083148 | 3300049742 | Bacteria | 2974 |
| 953 | Ga0501080_0319668 | 3300049742 | Bacteria | 1405 |
| 954 | Ga0501083_0010614 | 3300049744 | Bacteria | 6483 |
| 955 | Ga0501083_0015328 | 3300049744 | Bacteria | 5369 |
| 956 | Ga0501035_0000234 | 3300049822 | Bacteria | 66162 |
| 957 | Ga0501035_0015144 | 3300049822 | Bacteria | 7117 |
| 958 | Ga0501035_0015488 | 3300049822 | Bacteria | 7034 |
| 959 | Ga0501035_0018523 | 3300049822 | Bacteria | 6414 |
| 960 | Ga0501035_0199389 | 3300049822 | Bacteria | 1717 |
| 961 | Ga0501044_0000815 | 3300049823 | Bacteria | 37466 |
| 962 | Ga0501044_0003116 | 3300049823 | Bacteria | 18793 |
| 963 | Ga0501044_0021531 | 3300049823 | Bacteria | 6876 |
| 964 | Ga0501044_0053557 | 3300049823 | Bacteria | 4150 |
| 965 | Ga0501044_0076558 | 3300049823 | Bacteria | 3395 |
| 966 | Ga0501044_0125510 | 3300049823 | Bacteria | 2564 |
| 967 | Ga0501044_0823649 | 3300049823 | Bacteria | 806 |
| 968 | Ga0501044_1000079 | 3300049823 | Bacteria | 708 |
| 969 | Ga0501045_0033963 | 3300049824 | Bacteria | 3701 |
| 970 | Ga0501045_0198303 | 3300049824 | Bacteria | 1495 |
| 971 | nmdc:mga03683_39701_c1 | 3300050489 | Bacteria | 1928 |
| 972 | nmdc:mga03n38_155827_c1 | 3300050490 | Bacteria | 1153 |
| 973 | nmdc:mga03n38_220390_c1 | 3300050490 | Bacteria | 990 |
| 974 | nmdc:mga03n38_63002_c1 | 3300050490 | Bacteria | 1693 |
| 975 | nmdc:mga00v17_229690_c1 | 3300050491 | Bacteria | 1202 |
| 976 | nmdc:mga00v17_38016_c1 | 3300050491 | Bacteria | 2876 |
| 977 | nmdc:mga0yw44_171159_c1 | 3300050492 | Bacteria | 1426 |
| 978 | nmdc:mga0yw44_319235_c1 | 3300050492 | Bacteria | 1043 |
| 979 | nmdc:mga0yw44_330995_c1 | 3300050492 | Bacteria | 1024 |
| 980 | nmdc:mga0yw44_48825_c1 | 3300050492 | Bacteria | 2553 |
| 981 | nmdc:mga0k408_121548_c1 | 3300050493 | Bacteria | 1547 |
| 982 | nmdc:mga0k408_185164_c1 | 3300050493 | Bacteria | 1242 |
| 983 | nmdc:mga0k408_19359_c1 | 3300050493 | Bacteria | 3803 |
| 984 | nmdc:mga06z11_236203_c1 | 3300050494 | Bacteria | 1072 |
| 985 | nmdc:mga06z11_418312_c1 | 3300050494 | Bacteria | 808 |
| 986 | nmdc:mga06z11_8923_c1 | 3300050494 | Bacteria | 4205 |
| 987 | nmdc:mga04h51_7124_c1 | 3300050495 | Bacteria | 2936 |
| 988 | nmdc:mga04h51_93603_c1 | 3300050495 | Bacteria | 1085 |
| 989 | nmdc:mga07m45_317639_c1 | 3300050496 | Bacteria | 905 |
| 990 | nmdc:mga05p37_19_c2 | 3300050507 | Bacteria | 99994 |
| 991 | nmdc:mga05p37_216354_c1 | 3300050507 | Bacteria | 2314 |
| 992 | nmdc:mga09592_2070_c1 | 3300050508 | Bacteria | 16178 |
| 993 | nmdc:mga09592_238_c1 | 3300050508 | Bacteria | 40013 |
| 994 | nmdc:mga09592_96720_c1 | 3300050508 | Bacteria | 2526 |
| 995 | nmdc:mga0qj67_259_c1 | 3300050509 | Bacteria | 36242 |
| 996 | nmdc:mga06r32_2023_c1 | 3300050510 | Bacteria | 18128 |
| 997 | nmdc:mga06r32_349_c1 | 3300050510 | Bacteria | 38472 |
| 998 | nmdc:mga06r32_501245_c1 | 3300050510 | Bacteria | 1191 |
| 999 | nmdc:mga08y16_123581_c1 | 3300050511 | Bacteria | 2693 |
| 1000 | nmdc:mga08y16_222039_c1 | 3300050511 | Bacteria | 1956 |
| 1001 | nmdc:mga08y16_245149_c1 | 3300050511 | Bacteria | 1852 |
| 1002 | nmdc:mga08y16_2735_c1 | 3300050511 | Bacteria | 18090 |
| 1003 | nmdc:mga08y16_325_c1 | 3300050511 | Bacteria | 43258 |
| 1004 | nmdc:mga08y16_444751_c1 | 3300050511 | Bacteria | 1322 |
| 1005 | nmdc:mga0n895_120909_c1 | 3300050512 | Bacteria | 2640 |
| 1006 | nmdc:mga0n895_1215831_c1 | 3300050512 | Bacteria | 727 |
| 1007 | nmdc:mga0n895_281192_c1 | 3300050512 | Bacteria | 1687 |
| 1008 | nmdc:mga0n895_394_c1 | 3300050512 | Bacteria | 29311 |
| 1009 | nmdc:mga0n895_45970_c1 | 3300050512 | Bacteria | 4263 |
| 1010 | nmdc:mga0n895_506674_c1 | 3300050512 | Bacteria | 1216 |
| 1011 | nmdc:mga0n895_563681_c1 | 3300050512 | Bacteria | 1144 |
| 1012 | nmdc:mga0n895_9070_c1 | 3300050512 | Bacteria | 8677 |
| 1013 | nmdc:mga0rr50_13004_c1 | 3300050513 | Bacteria | 5402 |
| 1014 | nmdc:mga0rr50_522077_c1 | 3300050513 | Bacteria | 1010 |
| 1015 | nmdc:mga0rr50_748596_c1 | 3300050513 | Bacteria | 834 |
| 1016 | nmdc:mga0rr50_785_c1 | 3300050513 | Bacteria | 17098 |
| 1017 | nmdc:mga08x19_120826_c1 | 3300050514 | Bacteria | 1756 |
| 1018 | nmdc:mga08x19_207318_c1 | 3300050514 | Bacteria | 1345 |
| 1019 | nmdc:mga08x19_52251_c1 | 3300050514 | Bacteria | 2628 |
| 1020 | nmdc:mga0a205_10038_c1 | 3300050515 | Bacteria | 8688 |
| 1021 | nmdc:mga0a205_14874_c1 | 3300050515 | Bacteria | 4705 |
| 1022 | nmdc:mga0a205_249_c1 | 3300050515 | Bacteria | 38472 |
| 1023 | nmdc:mga0a205_337310_c1 | 3300050515 | Bacteria | 1376 |
| 1024 | Ga0495601_0000338 | 3300053077 | Bacteria | 24609 |
| 1025 | Ga0495601_0001346 | 3300053077 | Bacteria | 13508 |
| 1026 | Ga0495601_0022223 | 3300053077 | Bacteria | 3892 |
| 1027 | Ga0495612_0000152 | 3300053078 | Bacteria | 29021 |
| 1028 | Ga0495612_0058120 | 3300053078 | Bacteria | 1598 |
| 1029 | Ga0495655_0009189 | 3300053083 | Bacteria | 1907 |
| 1030 | Ga0495595_0022830 | 3300053084 | Bacteria | 2749 |
| 1031 | Ga0495595_0066508 | 3300053084 | Bacteria | 1697 |
| 1032 | Ga0495619_0000078 | 3300053085 | Bacteria | 72749 |
| 1033 | Ga0495619_0001083 | 3300053085 | Bacteria | 17884 |
| 1034 | Ga0495619_0018347 | 3300053085 | Bacteria | 4439 |
| 1035 | Ga0495619_0117573 | 3300053085 | Bacteria | 1821 |
| 1036 | Ga0495619_0257819 | 3300053085 | Bacteria | 1208 |
| 1037 | Ga0500646_0007709 | 3300053090 | Bacteria | 2750 |
| 1038 | Ga0500556_0102072 | 3300053104 | Bacteria | 1106 |
| 1039 | Ga0500595_012962 | 3300053119 | Bacteria | 3205 |
| 1040 | Ga0500642_0091120 | 3300053130 | Bacteria | 1409 |
| 1041 | Ga0500652_000169 | 3300053131 | Bacteria | 25198 |
| 1042 | Ga0500616_0006713 | 3300053153 | Bacteria | 7470 |
| 1043 | Ga0500627_0030433 | 3300053158 | Bacteria | 2260 |
| 1044 | Ga0500636_0006847 | 3300053177 | Bacteria | 6568 |
| 1045 | Ga0501084_0014744 | 3300054114 | Bacteria | 6483 |
| 1046 | Ga0501084_0074320 | 3300054114 | Bacteria | 2846 |
| 1047 | Ga0501084_0103789 | 3300054114 | Bacteria | 2388 |
| 1048 | Ga0501084_0400245 | 3300054114 | Bacteria | 1160 |
| 1049 | Ga0501082_0005652 | 3300060353 | Bacteria | 10849 |
| 1050 | Ga0501082_0169098 | 3300060353 | Bacteria | 1900 |
| 1051 | Ga0501082_0176866 | 3300060353 | Bacteria | 1856 |
| 1052 | Ga0530510_0002354 | 3300061734 | Bacteria | 12973 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009011 | Ga0105251_10100037 | Ga0105251_101000372 | 189 |
| 2 | 3300044735 | Ga0466968_0419262 | Ga0466968_0419262_62_640 | 192 |
| 3 | 3300005354 | Ga0070675_100521045 | Ga0070675_1005210451 | 196 |
| 4 | iso_pu_bacteria | 2545555834 | 2545677572 | 196 |
| 5 | iso_pu_bacteria | 2595698237 | 2596376607 | 196 |
| 6 | iso_pu_bacteria | 2738541281 | 2738743475 | 196 |
| 7 | iso_pu_bacteria | 2738543032 | 2739352382 | 196 |
| 8 | iso_pu_bacteria | 2829745981 | 2829746065 | 196 |
| 9 | iso_pu_bacteria | 2861691609 | 2861695880 | 196 |
| 10 | iso_pu_bacteria | 2889306138 | 2889306857 | 196 |
| 11 | iso_pu_bacteria | 2902330777 | 2902334408 | 196 |
| 12 | iso_pu_bacteria | 2902405164 | 2902411546 | 196 |
| 13 | iso_pu_bacteria | 2928125067 | 2928128666 | 196 |
| 14 | iso_pu_bacteria | 641522639 | 641640383 | 196 |
| 15 | iso_pu_bacteria | 643348564 | 643597820 | 196 |
| 16 | 3300037466 | Ga0395898_0086749 | Ga0395898_0086749_139_741 | 200 |
| 17 | 3300037853 | Ga0436364_1035021 | Ga0436364_1035021_147_749 | 200 |
| 18 | 3300039450 | Ga0436363_0754692 | Ga0436363_0754692_29_631 | 200 |
| 19 | 3300044735 | Ga0466968_0002228 | Ga0466968_0002228_551_1153 | 200 |
| 20 | 3300044765 | Ga0466970_0461550 | Ga0466970_0461550_98_700 | 200 |
| 21 | 3300044901 | Ga0466960_0480143 | Ga0466960_0480143_13_615 | 200 |
| 22 | 3300001430 | JGI24032J14994_100170 | JGI24032J14994_1001705 | 201 |
| 23 | 3300001904 | JGI24736J21556_1013782 | JGI24736J21556_10137823 | 201 |
| 24 | 3300001976 | JGI24752J21851_1001950 | JGI24752J21851_10019506 | 201 |
| 25 | 3300001977 | JGI24746J21847_1000605 | JGI24746J21847_10006053 | 201 |
| 26 | 3300001978 | JGI24747J21853_1001825 | JGI24747J21853_10018251 | 201 |
| 27 | 3300001979 | JGI24740J21852_10020453 | JGI24740J21852_100204532 | 201 |
| 28 | 3300001989 | JGI24739J22299_10000119 | JGI24739J22299_1000011916 | 201 |
| 29 | 3300001990 | JGI24737J22298_10000258 | JGI24737J22298_1000025814 | 201 |
| 30 | 3300002070 | JGI24750J21931_1000164 | JGI24750J21931_10001644 | 201 |
| 31 | 3300002073 | JGI24745J21846_1000103 | JGI24745J21846_10001036 | 201 |
| 32 | 3300002075 | JGI24738J21930_10005193 | JGI24738J21930_100051932 | 201 |
| 33 | 3300002076 | JGI24749J21850_1000093 | JGI24749J21850_10000934 | 201 |
| 34 | 3300002076 | JGI24749J21850_1019507 | JGI24749J21850_10195072 | 201 |
| 35 | 3300002077 | JGI24744J21845_10001608 | JGI24744J21845_100016085 | 201 |
| 36 | 3300002126 | JGI24035J26624_1000048 | JGI24035J26624_10000487 | 201 |
| 37 | 3300002155 | JGI24033J26618_1001488 | JGI24033J26618_10014882 | 201 |
| 38 | 3300002239 | JGI24034J26672_10000515 | JGI24034J26672_100005154 | 201 |
| 39 | 3300002239 | JGI24034J26672_10001644 | JGI24034J26672_100016443 | 201 |
| 40 | 3300002244 | JGI24742J22300_10000595 | JGI24742J22300_100005954 | 201 |
| 41 | 3300002459 | JGI24751J29686_10018194 | JGI24751J29686_100181942 | 201 |
| 42 | 3300003215 | JGI25153J46596_10001652 | JGI25153J46596_100016529 | 201 |
| 43 | 3300003349 | JGI26129J50193_1002722 | JGI26129J50193_10027222 | 201 |
| 44 | 3300003659 | JGI25404J52841_10005604 | JGI25404J52841_100056045 | 201 |
| 45 | 3300005288 | Ga0065714_10135970 | Ga0065714_101359702 | 201 |
| 46 | 3300005293 | Ga0065715_10088946 | Ga0065715_1008894623 | 201 |
| 47 | 3300005295 | Ga0065707_10104807 | Ga0065707_101048073 | 201 |
| 48 | 3300005295 | Ga0065707_10280081 | Ga0065707_102800812 | 201 |
| 49 | 3300005327 | Ga0070658_10009370 | Ga0070658_1000937011 | 201 |
| 50 | 3300005327 | Ga0070658_10188403 | Ga0070658_101884032 | 201 |
| 51 | 3300005328 | Ga0070676_10000514 | Ga0070676_1000051422 | 201 |
| 52 | 3300005329 | Ga0070683_100005318 | Ga0070683_1000053188 | 201 |
| 53 | 3300005329 | Ga0070683_100025217 | Ga0070683_1000252172 | 201 |
| 54 | 3300005330 | Ga0070690_100008454 | Ga0070690_1000084548 | 201 |
| 55 | 3300005330 | Ga0070690_100054680 | Ga0070690_1000546803 | 201 |
| 56 | 3300005331 | Ga0070670_100002160 | Ga0070670_1000021604 | 201 |
| 57 | 3300005331 | Ga0070670_100123675 | Ga0070670_1001236752 | 201 |
| 58 | 3300005331 | Ga0070670_100200801 | Ga0070670_1002008013 | 201 |
| 59 | 3300005333 | Ga0070677_10000023 | Ga0070677_1000002338 | 201 |
| 60 | 3300005333 | Ga0070677_10031092 | Ga0070677_100310922 | 201 |
| 61 | 3300005334 | Ga0068869_100000153 | Ga0068869_10000015333 | 201 |
| 62 | 3300005334 | Ga0068869_100009816 | Ga0068869_1000098167 | 201 |
| 63 | 3300005335 | Ga0070666_10003393 | Ga0070666_100033938 | 201 |
| 64 | 3300005335 | Ga0070666_10397399 | Ga0070666_103973992 | 201 |
| 65 | 3300005336 | Ga0070680_100000814 | Ga0070680_10000081419 | 201 |
| 66 | 3300005336 | Ga0070680_100018221 | Ga0070680_1000182214 | 201 |
| 67 | 3300005337 | Ga0070682_100000445 | Ga0070682_10000044512 | 201 |
| 68 | 3300005338 | Ga0068868_100014021 | Ga0068868_1000140215 | 201 |
| 69 | 3300005338 | Ga0068868_100109589 | Ga0068868_1001095892 | 201 |
| 70 | 3300005338 | Ga0068868_100798126 | Ga0068868_1007981261 | 201 |
| 71 | 3300005339 | Ga0070660_100001480 | Ga0070660_10000148017 | 201 |
| 72 | 3300005339 | Ga0070660_100130906 | Ga0070660_1001309062 | 201 |
| 73 | 3300005339 | Ga0070660_100610006 | Ga0070660_1006100061 | 201 |
| 74 | 3300005340 | Ga0070689_100000880 | Ga0070689_10000088018 | 201 |
| 75 | 3300005340 | Ga0070689_100014559 | Ga0070689_1000145596 | 201 |
| 76 | 3300005340 | Ga0070689_100206405 | Ga0070689_1002064052 | 201 |
| 77 | 3300005341 | Ga0070691_10000320 | Ga0070691_1000032012 | 201 |
| 78 | 3300005343 | Ga0070687_100000187 | Ga0070687_10000018718 | 201 |
| 79 | 3300005343 | Ga0070687_100152213 | Ga0070687_1001522132 | 201 |
| 80 | 3300005343 | Ga0070687_100267744 | Ga0070687_1002677442 | 201 |
| 81 | 3300005343 | Ga0070687_100347057 | Ga0070687_1003470572 | 201 |
| 82 | 3300005344 | Ga0070661_100001011 | Ga0070661_10000101114 | 201 |
| 83 | 3300005344 | Ga0070661_100096242 | Ga0070661_1000962422 | 201 |
| 84 | 3300005347 | Ga0070668_100002838 | Ga0070668_10000283812 | 201 |
| 85 | 3300005353 | Ga0070669_100000501 | Ga0070669_10000050133 | 201 |
| 86 | 3300005353 | Ga0070669_100043033 | Ga0070669_1000430332 | 201 |
| 87 | 3300005353 | Ga0070669_100147344 | Ga0070669_1001473441 | 201 |
| 88 | 3300005354 | Ga0070675_100001136 | Ga0070675_10000113612 | 201 |
| 89 | 3300005354 | Ga0070675_100080693 | Ga0070675_1000806932 | 201 |
| 90 | 3300005355 | Ga0070671_100000595 | Ga0070671_10000059530 | 201 |
| 91 | 3300005355 | Ga0070671_100007251 | Ga0070671_1000072518 | 201 |
| 92 | 3300005356 | Ga0070674_100000249 | Ga0070674_10000024931 | 201 |
| 93 | 3300005356 | Ga0070674_100001190 | Ga0070674_10000119010 | 201 |
| 94 | 3300005356 | Ga0070674_100094735 | Ga0070674_1000947354 | 201 |
| 95 | 3300005364 | Ga0070673_100000233 | Ga0070673_1000002331 | 201 |
| 96 | 3300005364 | Ga0070673_100002039 | Ga0070673_10000203915 | 201 |
| 97 | 3300005364 | Ga0070673_100160851 | Ga0070673_1001608513 | 201 |
| 98 | 3300005365 | Ga0070688_100000432 | Ga0070688_10000043210 | 201 |
| 99 | 3300005365 | Ga0070688_100009975 | Ga0070688_1000099755 | 201 |
| 100 | 3300005366 | Ga0070659_100000746 | Ga0070659_10000074623 | 201 |
| 101 | 3300005366 | Ga0070659_100275149 | Ga0070659_1002751491 | 201 |
| 102 | 3300005366 | Ga0070659_100471137 | Ga0070659_1004711371 | 201 |
| 103 | 3300005367 | Ga0070667_100001881 | Ga0070667_1000018819 | 201 |
| 104 | 3300005367 | Ga0070667_100164897 | Ga0070667_1001648972 | 201 |
| 105 | 3300005367 | Ga0070667_100252312 | Ga0070667_1002523123 | 201 |
| 106 | 3300005367 | Ga0070667_100653968 | Ga0070667_1006539681 | 201 |
| 107 | 3300005406 | Ga0070703_10001482 | Ga0070703_100014828 | 201 |
| 108 | 3300005434 | Ga0070709_10047309 | Ga0070709_100473095 | 201 |
| 109 | 3300005434 | Ga0070709_10066235 | Ga0070709_100662353 | 201 |
| 110 | 3300005435 | Ga0070714_100090724 | Ga0070714_1000907242 | 201 |
| 111 | 3300005435 | Ga0070714_100092299 | Ga0070714_1000922992 | 201 |
| 112 | 3300005435 | Ga0070714_100336049 | Ga0070714_1003360492 | 201 |
| 113 | 3300005435 | Ga0070714_100416631 | Ga0070714_1004166312 | 201 |
| 114 | 3300005435 | Ga0070714_100633367 | Ga0070714_1006333672 | 201 |
| 115 | 3300005436 | Ga0070713_100034550 | Ga0070713_1000345503 | 201 |
| 116 | 3300005436 | Ga0070713_100143336 | Ga0070713_1001433362 | 201 |
| 117 | 3300005436 | Ga0070713_100663707 | Ga0070713_1006637071 | 201 |
| 118 | 3300005437 | Ga0070710_10010676 | Ga0070710_100106765 | 201 |
| 119 | 3300005437 | Ga0070710_10014144 | Ga0070710_100141445 | 201 |
| 120 | 3300005437 | Ga0070710_10021162 | Ga0070710_100211623 | 201 |
| 121 | 3300005437 | Ga0070710_10114113 | Ga0070710_101141132 | 201 |
| 122 | 3300005437 | Ga0070710_10330960 | Ga0070710_103309602 | 201 |
| 123 | 3300005438 | Ga0070701_10010707 | Ga0070701_100107074 | 201 |
| 124 | 3300005438 | Ga0070701_10039230 | Ga0070701_100392304 | 201 |
| 125 | 3300005439 | Ga0070711_100015569 | Ga0070711_1000155696 | 201 |
| 126 | 3300005439 | Ga0070711_100042375 | Ga0070711_1000423752 | 201 |
| 127 | 3300005439 | Ga0070711_100066518 | Ga0070711_1000665182 | 201 |
| 128 | 3300005440 | Ga0070705_100000361 | Ga0070705_10000036110 | 201 |
| 129 | 3300005441 | Ga0070700_100000357 | Ga0070700_10000035723 | 201 |
| 130 | 3300005444 | Ga0070694_100009629 | Ga0070694_1000096298 | 201 |
| 131 | 3300005444 | Ga0070694_100105960 | Ga0070694_1001059602 | 201 |
| 132 | 3300005445 | Ga0070708_100011297 | Ga0070708_1000112978 | 201 |
| 133 | 3300005455 | Ga0070663_100006501 | Ga0070663_1000065012 | 201 |
| 134 | 3300005455 | Ga0070663_100014884 | Ga0070663_1000148845 | 201 |
| 135 | 3300005455 | Ga0070663_100588282 | Ga0070663_1005882822 | 201 |
| 136 | 3300005456 | Ga0070678_100000438 | Ga0070678_10000043813 | 201 |
| 137 | 3300005457 | Ga0070662_100035557 | Ga0070662_1000355573 | 201 |
| 138 | 3300005457 | Ga0070662_100119158 | Ga0070662_1001191582 | 201 |
| 139 | 3300005457 | Ga0070662_100271458 | Ga0070662_1002714583 | 201 |
| 140 | 3300005458 | Ga0070681_10039781 | Ga0070681_100397813 | 201 |
| 141 | 3300005458 | Ga0070681_10224839 | Ga0070681_102248393 | 201 |
| 142 | 3300005458 | Ga0070681_10247774 | Ga0070681_102477741 | 201 |
| 143 | 3300005458 | Ga0070681_10775096 | Ga0070681_107750961 | 201 |
| 144 | 3300005459 | Ga0068867_100001099 | Ga0068867_10000109923 | 201 |
| 145 | 3300005459 | Ga0068867_100079424 | Ga0068867_1000794241 | 201 |
| 146 | 3300005459 | Ga0068867_100248855 | Ga0068867_1002488552 | 201 |
| 147 | 3300005466 | Ga0070685_10006230 | Ga0070685_100062302 | 201 |
| 148 | 3300005466 | Ga0070685_10158702 | Ga0070685_101587022 | 201 |
| 149 | 3300005471 | Ga0070698_100194771 | Ga0070698_1001947714 | 201 |
| 150 | 3300005530 | Ga0070679_100002503 | Ga0070679_10000250312 | 201 |
| 151 | 3300005530 | Ga0070679_100023170 | Ga0070679_1000231705 | 201 |
| 152 | 3300005530 | Ga0070679_100149887 | Ga0070679_1001498875 | 201 |
| 153 | 3300005530 | Ga0070679_100376970 | Ga0070679_1003769703 | 201 |
| 154 | 3300005530 | Ga0070679_100832969 | Ga0070679_1008329692 | 201 |
| 155 | 3300005535 | Ga0070684_100000101 | Ga0070684_10000010155 | 201 |
| 156 | 3300005535 | Ga0070684_100124599 | Ga0070684_1001245993 | 201 |
| 157 | 3300005535 | Ga0070684_100456395 | Ga0070684_1004563951 | 201 |
| 158 | 3300005535 | Ga0070684_100829745 | Ga0070684_1008297452 | 201 |
| 159 | 3300005539 | Ga0068853_100158781 | Ga0068853_1001587814 | 201 |
| 160 | 3300005539 | Ga0068853_100210062 | Ga0068853_1002100622 | 201 |
| 161 | 3300005539 | Ga0068853_100221116 | Ga0068853_1002211162 | 201 |
| 162 | 3300005543 | Ga0070672_100035124 | Ga0070672_1000351241 | 201 |
| 163 | 3300005543 | Ga0070672_100126981 | Ga0070672_1001269814 | 201 |
| 164 | 3300005543 | Ga0070672_100336642 | Ga0070672_1003366423 | 201 |
| 165 | 3300005544 | Ga0070686_100000532 | Ga0070686_1000005321 | 201 |
| 166 | 3300005544 | Ga0070686_100006895 | Ga0070686_1000068955 | 201 |
| 167 | 3300005544 | Ga0070686_100012133 | Ga0070686_1000121337 | 201 |
| 168 | 3300005545 | Ga0070695_100005890 | Ga0070695_1000058906 | 201 |
| 169 | 3300005546 | Ga0070696_100007762 | Ga0070696_10000776210 | 201 |
| 170 | 3300005547 | Ga0070693_100003380 | Ga0070693_1000033807 | 201 |
| 171 | 3300005547 | Ga0070693_100096945 | Ga0070693_1000969453 | 201 |
| 172 | 3300005548 | Ga0070665_100069518 | Ga0070665_1000695184 | 201 |
| 173 | 3300005548 | Ga0070665_100168248 | Ga0070665_1001682483 | 201 |
| 174 | 3300005548 | Ga0070665_100328151 | Ga0070665_1003281511 | 201 |
| 175 | 3300005548 | Ga0070665_100423655 | Ga0070665_1004236552 | 201 |
| 176 | 3300005549 | Ga0070704_100009296 | Ga0070704_1000092968 | 201 |
| 177 | 3300005563 | Ga0068855_100047838 | Ga0068855_1000478385 | 201 |
| 178 | 3300005563 | Ga0068855_100317042 | Ga0068855_1003170422 | 201 |
| 179 | 3300005563 | Ga0068855_100512171 | Ga0068855_1005121712 | 201 |
| 180 | 3300005563 | Ga0068855_100563253 | Ga0068855_1005632532 | 201 |
| 181 | 3300005564 | Ga0070664_100020910 | Ga0070664_1000209107 | 201 |
| 182 | 3300005564 | Ga0070664_100061173 | Ga0070664_1000611735 | 201 |
| 183 | 3300005564 | Ga0070664_100251297 | Ga0070664_1002512972 | 201 |
| 184 | 3300005564 | Ga0070664_100571753 | Ga0070664_1005717531 | 201 |
| 185 | 3300005564 | Ga0070664_101026412 | Ga0070664_1010264121 | 201 |
| 186 | 3300005577 | Ga0068857_100001072 | Ga0068857_10000107210 | 201 |
| 187 | 3300005578 | Ga0068854_100000794 | Ga0068854_10000079414 | 201 |
| 188 | 3300005614 | Ga0068856_100006877 | Ga0068856_1000068779 | 201 |
| 189 | 3300005614 | Ga0068856_100233955 | Ga0068856_1002339553 | 201 |
| 190 | 3300005614 | Ga0068856_100610393 | Ga0068856_1006103933 | 201 |
| 191 | 3300005614 | Ga0068856_101030412 | Ga0068856_1010304121 | 201 |
| 192 | 3300005615 | Ga0070702_100006263 | Ga0070702_1000062635 | 201 |
| 193 | 3300005615 | Ga0070702_100053715 | Ga0070702_1000537155 | 201 |
| 194 | 3300005616 | Ga0068852_100000713 | Ga0068852_10000071321 | 201 |
| 195 | 3300005616 | Ga0068852_100086835 | Ga0068852_1000868353 | 201 |
| 196 | 3300005617 | Ga0068859_100001523 | Ga0068859_10000152310 | 201 |
| 197 | 3300005617 | Ga0068859_100120035 | Ga0068859_1001200353 | 201 |
| 198 | 3300005617 | Ga0068859_100132778 | Ga0068859_1001327784 | 201 |
| 199 | 3300005617 | Ga0068859_100209914 | Ga0068859_1002099143 | 201 |
| 200 | 3300005618 | Ga0068864_100000715 | Ga0068864_10000071518 | 201 |
| 201 | 3300005618 | Ga0068864_100369800 | Ga0068864_1003698002 | 201 |
| 202 | 3300005718 | Ga0068866_10003508 | Ga0068866_1000350810 | 201 |
| 203 | 3300005718 | Ga0068866_10008505 | Ga0068866_100085053 | 201 |
| 204 | 3300005718 | Ga0068866_10050564 | Ga0068866_100505641 | 201 |
| 205 | 3300005719 | Ga0068861_100000574 | Ga0068861_1000005747 | 201 |
| 206 | 3300005719 | Ga0068861_100039977 | Ga0068861_1000399774 | 201 |
| 207 | 3300005719 | Ga0068861_100270569 | Ga0068861_1002705691 | 201 |
| 208 | 3300005719 | Ga0068861_100326111 | Ga0068861_1003261112 | 201 |
| 209 | 3300005841 | Ga0068863_100001272 | Ga0068863_10000127225 | 201 |
| 210 | 3300005841 | Ga0068863_100650482 | Ga0068863_1006504822 | 201 |
| 211 | 3300005842 | Ga0068858_100008506 | Ga0068858_1000085068 | 201 |
| 212 | 3300005842 | Ga0068858_100138044 | Ga0068858_1001380443 | 201 |
| 213 | 3300005843 | Ga0068860_100001758 | Ga0068860_1000017582 | 201 |
| 214 | 3300005843 | Ga0068860_100956332 | Ga0068860_1009563321 | 201 |
| 215 | 3300005844 | Ga0068862_100012556 | Ga0068862_1000125568 | 201 |
| 216 | 3300005844 | Ga0068862_100373271 | Ga0068862_1003732712 | 201 |
| 217 | 3300005937 | Ga0081455_10006443 | Ga0081455_1000644315 | 201 |
| 218 | 3300005937 | Ga0081455_10134401 | Ga0081455_101344011 | 201 |
| 219 | 3300005983 | Ga0081540_1000059 | Ga0081540_100005938 | 201 |
| 220 | 3300005983 | Ga0081540_1000315 | Ga0081540_100031528 | 201 |
| 221 | 3300005983 | Ga0081540_1074331 | Ga0081540_10743311 | 201 |
| 222 | 3300006028 | Ga0070717_10001112 | Ga0070717_100011127 | 201 |
| 223 | 3300006028 | Ga0070717_10019038 | Ga0070717_100190385 | 201 |
| 224 | 3300006028 | Ga0070717_10079374 | Ga0070717_100793742 | 201 |
| 225 | 3300006038 | Ga0075365_10024221 | Ga0075365_100242213 | 201 |
| 226 | 3300006038 | Ga0075365_10262497 | Ga0075365_102624972 | 201 |
| 227 | 3300006038 | Ga0075365_10263274 | Ga0075365_102632742 | 201 |
| 228 | 3300006042 | Ga0075368_10019777 | Ga0075368_100197773 | 201 |
| 229 | 3300006042 | Ga0075368_10043616 | Ga0075368_100436161 | 201 |
| 230 | 3300006048 | Ga0075363_100010754 | Ga0075363_1000107542 | 201 |
| 231 | 3300006048 | Ga0075363_100086699 | Ga0075363_1000866992 | 201 |
| 232 | 3300006048 | Ga0075363_100090840 | Ga0075363_1000908403 | 201 |
| 233 | 3300006051 | Ga0075364_10010261 | Ga0075364_100102614 | 201 |
| 234 | 3300006051 | Ga0075364_10023768 | Ga0075364_100237683 | 201 |
| 235 | 3300006051 | Ga0075364_10100697 | Ga0075364_101006971 | 201 |
| 236 | 3300006051 | Ga0075364_10260687 | Ga0075364_102606872 | 201 |
| 237 | 3300006058 | Ga0075432_10006215 | Ga0075432_100062156 | 201 |
| 238 | 3300006173 | Ga0070716_100012500 | Ga0070716_1000125002 | 201 |
| 239 | 3300006175 | Ga0070712_100005942 | Ga0070712_1000059427 | 201 |
| 240 | 3300006175 | Ga0070712_100066126 | Ga0070712_1000661264 | 201 |
| 241 | 3300006175 | Ga0070712_100094588 | Ga0070712_1000945883 | 201 |
| 242 | 3300006177 | Ga0075362_10000822 | Ga0075362_100008223 | 201 |
| 243 | 3300006178 | Ga0075367_10027428 | Ga0075367_100274282 | 201 |
| 244 | 3300006178 | Ga0075367_10065510 | Ga0075367_100655102 | 201 |
| 245 | 3300006178 | Ga0075367_10086064 | Ga0075367_100860643 | 201 |
| 246 | 3300006178 | Ga0075367_10088828 | Ga0075367_100888283 | 201 |
| 247 | 3300006178 | Ga0075367_10103932 | Ga0075367_101039322 | 201 |
| 248 | 3300006178 | Ga0075367_10202824 | Ga0075367_102028242 | 201 |
| 249 | 3300006186 | Ga0075369_10003689 | Ga0075369_100036896 | 201 |
| 250 | 3300006195 | Ga0075366_10006442 | Ga0075366_100064424 | 201 |
| 251 | 3300006195 | Ga0075366_10031143 | Ga0075366_100311433 | 201 |
| 252 | 3300006237 | Ga0097621_100001018 | Ga0097621_1000010183 | 201 |
| 253 | 3300006237 | Ga0097621_100308450 | Ga0097621_1003084502 | 201 |
| 254 | 3300006353 | Ga0075370_10129884 | Ga0075370_101298841 | 201 |
| 255 | 3300006358 | Ga0068871_100000012 | Ga0068871_10000001226 | 201 |
| 256 | 3300006358 | Ga0068871_100019484 | Ga0068871_1000194848 | 201 |
| 257 | 3300006358 | Ga0068871_100101539 | Ga0068871_1001015392 | 201 |
| 258 | 3300006358 | Ga0068871_100134500 | Ga0068871_1001345003 | 201 |
| 259 | 3300006358 | Ga0068871_100151669 | Ga0068871_1001516693 | 201 |
| 260 | 3300006844 | Ga0075428_100001200 | Ga0075428_1000012001 | 201 |
| 261 | 3300006844 | Ga0075428_100004407 | Ga0075428_1000044072 | 201 |
| 262 | 3300006846 | Ga0075430_100000032 | Ga0075430_10000003244 | 201 |
| 263 | 3300006847 | Ga0075431_100000003 | Ga0075431_1000000033 | 201 |
| 264 | 3300006847 | Ga0075431_100009024 | Ga0075431_1000090247 | 201 |
| 265 | 3300006847 | Ga0075431_100539395 | Ga0075431_1005393952 | 201 |
| 266 | 3300006852 | Ga0075433_10000072 | Ga0075433_100000722 | 201 |
| 267 | 3300006852 | Ga0075433_10005026 | Ga0075433_1000502611 | 201 |
| 268 | 3300006871 | Ga0075434_100000341 | Ga0075434_10000034125 | 201 |
| 269 | 3300006871 | Ga0075434_100001937 | Ga0075434_1000019371 | 201 |
| 270 | 3300006871 | Ga0075434_100072274 | Ga0075434_1000722747 | 201 |
| 271 | 3300006871 | Ga0075434_100206696 | Ga0075434_1002066962 | 201 |
| 272 | 3300006880 | Ga0075429_100000631 | Ga0075429_10000063127 | 201 |
| 273 | 3300006880 | Ga0075429_100425132 | Ga0075429_1004251321 | 201 |
| 274 | 3300006881 | Ga0068865_100000328 | Ga0068865_10000032825 | 201 |
| 275 | 3300006881 | Ga0068865_100194589 | Ga0068865_1001945892 | 201 |
| 276 | 3300006914 | Ga0075436_100193136 | Ga0075436_1001931361 | 201 |
| 277 | 3300006914 | Ga0075436_100229708 | Ga0075436_1002297082 | 201 |
| 278 | 3300006914 | Ga0075436_100237128 | Ga0075436_1002371282 | 201 |
| 279 | 3300006931 | Ga0097620_100001523 | Ga0097620_10000152310 | 201 |
| 280 | 3300006931 | Ga0097620_100120036 | Ga0097620_1001200363 | 201 |
| 281 | 3300006931 | Ga0097620_100132777 | Ga0097620_1001327774 | 201 |
| 282 | 3300006931 | Ga0097620_100209925 | Ga0097620_1002099253 | 201 |
| 283 | 3300007076 | Ga0075435_100022993 | Ga0075435_1000229932 | 201 |
| 284 | 3300007076 | Ga0075435_100527551 | Ga0075435_1005275512 | 201 |
| 285 | 3300007076 | Ga0075435_100775166 | Ga0075435_1007751662 | 201 |
| 286 | 3300009011 | Ga0105251_10141329 | Ga0105251_101413292 | 201 |
| 287 | 3300009036 | Ga0105244_10023808 | Ga0105244_100238081 | 201 |
| 288 | 3300009093 | Ga0105240_10028987 | Ga0105240_1002898710 | 201 |
| 289 | 3300009093 | Ga0105240_10045104 | Ga0105240_100451042 | 201 |
| 290 | 3300009093 | Ga0105240_10083433 | Ga0105240_100834331 | 201 |
| 291 | 3300009093 | Ga0105240_10103668 | Ga0105240_101036681 | 201 |
| 292 | 3300009093 | Ga0105240_11517317 | Ga0105240_115173171 | 201 |
| 293 | 3300009094 | Ga0111539_10001373 | Ga0111539_100013732 | 201 |
| 294 | 3300009094 | Ga0111539_10002936 | Ga0111539_100029369 | 201 |
| 295 | 3300009098 | Ga0105245_10001404 | Ga0105245_100014046 | 201 |
| 296 | 3300009098 | Ga0105245_10012824 | Ga0105245_1001282410 | 201 |
| 297 | 3300009098 | Ga0105245_10067818 | Ga0105245_100678185 | 201 |
| 298 | 3300009098 | Ga0105245_10074327 | Ga0105245_100743273 | 201 |
| 299 | 3300009101 | Ga0105247_10000881 | Ga0105247_1000088114 | 201 |
| 300 | 3300009101 | Ga0105247_10025277 | Ga0105247_100252774 | 201 |
| 301 | 3300009147 | Ga0114129_10001551 | Ga0114129_1000155132 | 201 |
| 302 | 3300009147 | Ga0114129_10001730 | Ga0114129_1000173030 | 201 |
| 303 | 3300009147 | Ga0114129_10147946 | Ga0114129_101479463 | 201 |
| 304 | 3300009148 | Ga0105243_10001028 | Ga0105243_1000102823 | 201 |
| 305 | 3300009148 | Ga0105243_10078105 | Ga0105243_100781052 | 201 |
| 306 | 3300009148 | Ga0105243_10099928 | Ga0105243_100999282 | 201 |
| 307 | 3300009148 | Ga0105243_10241028 | Ga0105243_102410282 | 201 |
| 308 | 3300009148 | Ga0105243_10808076 | Ga0105243_108080762 | 201 |
| 309 | 3300009174 | Ga0105241_10002719 | Ga0105241_100027199 | 201 |
| 310 | 3300009174 | Ga0105241_10023657 | Ga0105241_100236575 | 201 |
| 311 | 3300009174 | Ga0105241_10249547 | Ga0105241_102495472 | 201 |
| 312 | 3300009176 | Ga0105242_10000607 | Ga0105242_1000060723 | 201 |
| 313 | 3300009176 | Ga0105242_10109860 | Ga0105242_101098603 | 201 |
| 314 | 3300009177 | Ga0105248_10000309 | Ga0105248_1000030912 | 201 |
| 315 | 3300009177 | Ga0105248_10351870 | Ga0105248_103518701 | 201 |
| 316 | 3300009545 | Ga0105237_10010578 | Ga0105237_100105786 | 201 |
| 317 | 3300009551 | Ga0105238_10046809 | Ga0105238_100468093 | 201 |
| 318 | 3300009551 | Ga0105238_10072176 | Ga0105238_100721762 | 201 |
| 319 | 3300009551 | Ga0105238_10146213 | Ga0105238_101462131 | 201 |
| 320 | 3300009553 | Ga0105249_10000486 | Ga0105249_1000048637 | 201 |
| 321 | 3300010159 | Ga0099796_10067790 | Ga0099796_100677902 | 201 |
| 322 | 3300010375 | Ga0105239_10006677 | Ga0105239_1000667715 | 201 |
| 323 | 3300010375 | Ga0105239_10114292 | Ga0105239_101142922 | 201 |
| 324 | 3300010375 | Ga0105239_10475603 | Ga0105239_104756032 | 201 |
| 325 | 3300011119 | Ga0105246_10000696 | Ga0105246_100006969 | 201 |
| 326 | 3300011119 | Ga0105246_10047691 | Ga0105246_100476912 | 201 |
| 327 | 3300012487 | Ga0157321_1010693 | Ga0157321_10106931 | 201 |
| 328 | 3300013100 | Ga0157373_10022136 | Ga0157373_100221366 | 201 |
| 329 | 3300013102 | Ga0157371_10124619 | Ga0157371_101246192 | 201 |
| 330 | 3300013104 | Ga0157370_10511489 | Ga0157370_105114892 | 201 |
| 331 | 3300013105 | Ga0157369_10553187 | Ga0157369_105531871 | 201 |
| 332 | 3300013296 | Ga0157374_10001864 | Ga0157374_1000186419 | 201 |
| 333 | 3300013296 | Ga0157374_10226231 | Ga0157374_102262313 | 201 |
| 334 | 3300013296 | Ga0157374_10243059 | Ga0157374_102430592 | 201 |
| 335 | 3300013296 | Ga0157374_10536335 | Ga0157374_105363352 | 201 |
| 336 | 3300013297 | Ga0157378_10006042 | Ga0157378_100060428 | 201 |
| 337 | 3300013306 | Ga0163162_10000992 | Ga0163162_1000099224 | 201 |
| 338 | 3300013306 | Ga0163162_10038755 | Ga0163162_100387554 | 201 |
| 339 | 3300013306 | Ga0163162_10315183 | Ga0163162_103151832 | 201 |
| 340 | 3300013307 | Ga0157372_10021474 | Ga0157372_100214747 | 201 |
| 341 | 3300013307 | Ga0157372_11178524 | Ga0157372_111785241 | 201 |
| 342 | 3300013308 | Ga0157375_10002320 | Ga0157375_100023206 | 201 |
| 343 | 3300013308 | Ga0157375_10465062 | Ga0157375_104650622 | 201 |
| 344 | 3300013308 | Ga0157375_11007053 | Ga0157375_110070532 | 201 |
| 345 | 3300014325 | Ga0163163_10098473 | Ga0163163_100984734 | 201 |
| 346 | 3300014325 | Ga0163163_10111585 | Ga0163163_101115852 | 201 |
| 347 | 3300014325 | Ga0163163_10184987 | Ga0163163_101849872 | 201 |
| 348 | 3300014326 | Ga0157380_10000711 | Ga0157380_100007115 | 201 |
| 349 | 3300014326 | Ga0157380_10297865 | Ga0157380_102978653 | 201 |
| 350 | 3300014745 | Ga0157377_10000336 | Ga0157377_100003366 | 201 |
| 351 | 3300014968 | Ga0157379_10000678 | Ga0157379_1000067828 | 201 |
| 352 | 3300014969 | Ga0157376_10076565 | Ga0157376_100765652 | 201 |
| 353 | 3300014969 | Ga0157376_10109765 | Ga0157376_101097652 | 201 |
| 354 | 3300014969 | Ga0157376_10204882 | Ga0157376_102048823 | 201 |
| 355 | 3300017792 | Ga0163161_10000534 | Ga0163161_1000053411 | 201 |
| 356 | 3300017792 | Ga0163161_10177822 | Ga0163161_101778223 | 201 |
| 357 | 3300020077 | Ga0206351_10851411 | Ga0206351_108514111 | 201 |
| 358 | 3300020080 | Ga0206350_10637952 | Ga0206350_106379521 | 201 |
| 359 | 3300020081 | Ga0206354_10183665 | Ga0206354_101836651 | 201 |
| 360 | 3300021384 | Ga0213876_10207001 | Ga0213876_102070012 | 201 |
| 361 | 3300021384 | Ga0213876_10288694 | Ga0213876_102886942 | 201 |
| 362 | 3300021441 | Ga0213871_10177663 | Ga0213871_101776631 | 201 |
| 363 | 3300025271 | Ga0207666_1000177 | Ga0207666_10001779 | 201 |
| 364 | 3300025290 | Ga0207673_1000025 | Ga0207673_100002513 | 201 |
| 365 | 3300025290 | Ga0207673_1021159 | Ga0207673_10211591 | 201 |
| 366 | 3300025297 | Ga0209758_1000469 | Ga0209758_100046960 | 201 |
| 367 | 3300025315 | Ga0207697_10000374 | Ga0207697_100003749 | 201 |
| 368 | 3300025711 | Ga0207696_1085800 | Ga0207696_10858002 | 201 |
| 369 | 3300025885 | Ga0207653_10009153 | Ga0207653_100091534 | 201 |
| 370 | 3300025893 | Ga0207682_10000011 | Ga0207682_1000001163 | 201 |
| 371 | 3300025893 | Ga0207682_10000604 | Ga0207682_1000060415 | 201 |
| 372 | 3300025898 | Ga0207692_10030829 | Ga0207692_100308292 | 201 |
| 373 | 3300025898 | Ga0207692_10089130 | Ga0207692_100891302 | 201 |
| 374 | 3300025898 | Ga0207692_10119518 | Ga0207692_101195182 | 201 |
| 375 | 3300025899 | Ga0207642_10000524 | Ga0207642_1000052416 | 201 |
| 376 | 3300025899 | Ga0207642_10118113 | Ga0207642_101181133 | 201 |
| 377 | 3300025900 | Ga0207710_10000805 | Ga0207710_1000080518 | 201 |
| 378 | 3300025901 | Ga0207688_10000020 | Ga0207688_1000002052 | 201 |
| 379 | 3300025901 | Ga0207688_10000279 | Ga0207688_1000027923 | 201 |
| 380 | 3300025901 | Ga0207688_10499877 | Ga0207688_104998771 | 201 |
| 381 | 3300025903 | Ga0207680_10016116 | Ga0207680_100161163 | 201 |
| 382 | 3300025903 | Ga0207680_10043051 | Ga0207680_100430512 | 201 |
| 383 | 3300025904 | Ga0207647_10027730 | Ga0207647_100277303 | 201 |
| 384 | 3300025905 | Ga0207685_10053819 | Ga0207685_100538192 | 201 |
| 385 | 3300025906 | Ga0207699_10112179 | Ga0207699_101121792 | 201 |
| 386 | 3300025906 | Ga0207699_10210624 | Ga0207699_102106241 | 201 |
| 387 | 3300025907 | Ga0207645_10060646 | Ga0207645_100606462 | 201 |
| 388 | 3300025911 | Ga0207654_10000818 | Ga0207654_100008186 | 201 |
| 389 | 3300025911 | Ga0207654_10045738 | Ga0207654_100457382 | 201 |
| 390 | 3300025911 | Ga0207654_10144309 | Ga0207654_101443092 | 201 |
| 391 | 3300025912 | Ga0207707_10000689 | Ga0207707_1000068912 | 201 |
| 392 | 3300025912 | Ga0207707_10051458 | Ga0207707_100514586 | 201 |
| 393 | 3300025912 | Ga0207707_10114124 | Ga0207707_101141243 | 201 |
| 394 | 3300025912 | Ga0207707_10167329 | Ga0207707_101673292 | 201 |
| 395 | 3300025912 | Ga0207707_10333038 | Ga0207707_103330382 | 201 |
| 396 | 3300025912 | Ga0207707_10693232 | Ga0207707_106932321 | 201 |
| 397 | 3300025912 | Ga0207707_10887100 | Ga0207707_108871001 | 201 |
| 398 | 3300025913 | Ga0207695_10046209 | Ga0207695_100462095 | 201 |
| 399 | 3300025913 | Ga0207695_10346493 | Ga0207695_103464932 | 201 |
| 400 | 3300025913 | Ga0207695_10905729 | Ga0207695_109057291 | 201 |
| 401 | 3300025914 | Ga0207671_10024759 | Ga0207671_100247591 | 201 |
| 402 | 3300025914 | Ga0207671_10762402 | Ga0207671_107624021 | 201 |
| 403 | 3300025915 | Ga0207693_10006663 | Ga0207693_100066637 | 201 |
| 404 | 3300025915 | Ga0207693_10010431 | Ga0207693_100104315 | 201 |
| 405 | 3300025915 | Ga0207693_10015052 | Ga0207693_100150526 | 201 |
| 406 | 3300025915 | Ga0207693_10090807 | Ga0207693_100908072 | 201 |
| 407 | 3300025916 | Ga0207663_10028739 | Ga0207663_100287393 | 201 |
| 408 | 3300025916 | Ga0207663_10064670 | Ga0207663_100646703 | 201 |
| 409 | 3300025916 | Ga0207663_10207282 | Ga0207663_102072822 | 201 |
| 410 | 3300025916 | Ga0207663_10308647 | Ga0207663_103086471 | 201 |
| 411 | 3300025917 | Ga0207660_10000442 | Ga0207660_1000044222 | 201 |
| 412 | 3300025917 | Ga0207660_10026455 | Ga0207660_100264552 | 201 |
| 413 | 3300025917 | Ga0207660_10177737 | Ga0207660_101777372 | 201 |
| 414 | 3300025918 | Ga0207662_10000249 | Ga0207662_1000024911 | 201 |
| 415 | 3300025918 | Ga0207662_10019805 | Ga0207662_100198051 | 201 |
| 416 | 3300025918 | Ga0207662_10054156 | Ga0207662_100541565 | 201 |
| 417 | 3300025919 | Ga0207657_10070172 | Ga0207657_100701723 | 201 |
| 418 | 3300025919 | Ga0207657_10110272 | Ga0207657_101102724 | 201 |
| 419 | 3300025919 | Ga0207657_10292629 | Ga0207657_102926292 | 201 |
| 420 | 3300025920 | Ga0207649_10000057 | Ga0207649_1000005783 | 201 |
| 421 | 3300025920 | Ga0207649_10112813 | Ga0207649_101128133 | 201 |
| 422 | 3300025921 | Ga0207652_10047059 | Ga0207652_100470596 | 201 |
| 423 | 3300025921 | Ga0207652_10072938 | Ga0207652_100729382 | 201 |
| 424 | 3300025921 | Ga0207652_10181847 | Ga0207652_101818471 | 201 |
| 425 | 3300025921 | Ga0207652_10206046 | Ga0207652_102060462 | 201 |
| 426 | 3300025921 | Ga0207652_10436836 | Ga0207652_104368362 | 201 |
| 427 | 3300025923 | Ga0207681_10000181 | Ga0207681_1000018133 | 201 |
| 428 | 3300025923 | Ga0207681_10834303 | Ga0207681_108343032 | 201 |
| 429 | 3300025924 | Ga0207694_10033087 | Ga0207694_100330871 | 201 |
| 430 | 3300025924 | Ga0207694_10063600 | Ga0207694_100636003 | 201 |
| 431 | 3300025924 | Ga0207694_10154749 | Ga0207694_101547491 | 201 |
| 432 | 3300025925 | Ga0207650_10001609 | Ga0207650_1000160915 | 201 |
| 433 | 3300025925 | Ga0207650_10097696 | Ga0207650_100976964 | 201 |
| 434 | 3300025925 | Ga0207650_10156087 | Ga0207650_101560872 | 201 |
| 435 | 3300025926 | Ga0207659_10000028 | Ga0207659_1000002851 | 201 |
| 436 | 3300025926 | Ga0207659_10043743 | Ga0207659_100437432 | 201 |
| 437 | 3300025926 | Ga0207659_10163303 | Ga0207659_101633032 | 201 |
| 438 | 3300025926 | Ga0207659_10605847 | Ga0207659_106058472 | 201 |
| 439 | 3300025927 | Ga0207687_10000061 | Ga0207687_1000006145 | 201 |
| 440 | 3300025927 | Ga0207687_10022684 | Ga0207687_100226844 | 201 |
| 441 | 3300025927 | Ga0207687_10134612 | Ga0207687_101346122 | 201 |
| 442 | 3300025927 | Ga0207687_10425291 | Ga0207687_104252912 | 201 |
| 443 | 3300025928 | Ga0207700_10061550 | Ga0207700_100615505 | 201 |
| 444 | 3300025928 | Ga0207700_10101299 | Ga0207700_101012992 | 201 |
| 445 | 3300025928 | Ga0207700_10849511 | Ga0207700_108495111 | 201 |
| 446 | 3300025929 | Ga0207664_10044584 | Ga0207664_100445843 | 201 |
| 447 | 3300025929 | Ga0207664_10115394 | Ga0207664_101153943 | 201 |
| 448 | 3300025929 | Ga0207664_10154927 | Ga0207664_101549272 | 201 |
| 449 | 3300025929 | Ga0207664_10518587 | Ga0207664_105185872 | 201 |
| 450 | 3300025929 | Ga0207664_10671702 | Ga0207664_106717022 | 201 |
| 451 | 3300025931 | Ga0207644_10000315 | Ga0207644_1000031526 | 201 |
| 452 | 3300025931 | Ga0207644_10004323 | Ga0207644_100043236 | 201 |
| 453 | 3300025931 | Ga0207644_10025117 | Ga0207644_100251174 | 201 |
| 454 | 3300025932 | Ga0207690_10000445 | Ga0207690_1000044524 | 201 |
| 455 | 3300025932 | Ga0207690_10528477 | Ga0207690_105284772 | 201 |
| 456 | 3300025933 | Ga0207706_10002206 | Ga0207706_1000220617 | 201 |
| 457 | 3300025934 | Ga0207686_10005349 | Ga0207686_100053492 | 201 |
| 458 | 3300025934 | Ga0207686_10033048 | Ga0207686_100330485 | 201 |
| 459 | 3300025935 | Ga0207709_10000539 | Ga0207709_1000053932 | 201 |
| 460 | 3300025935 | Ga0207709_10009571 | Ga0207709_100095716 | 201 |
| 461 | 3300025936 | Ga0207670_10000217 | Ga0207670_1000021724 | 201 |
| 462 | 3300025936 | Ga0207670_10448096 | Ga0207670_104480962 | 201 |
| 463 | 3300025936 | Ga0207670_10495582 | Ga0207670_104955822 | 201 |
| 464 | 3300025937 | Ga0207669_10000147 | Ga0207669_1000014723 | 201 |
| 465 | 3300025937 | Ga0207669_10001178 | Ga0207669_100011786 | 201 |
| 466 | 3300025938 | Ga0207704_10000299 | Ga0207704_1000029918 | 201 |
| 467 | 3300025938 | Ga0207704_10364507 | Ga0207704_103645072 | 201 |
| 468 | 3300025939 | Ga0207665_10003176 | Ga0207665_1000317610 | 201 |
| 469 | 3300025940 | Ga0207691_10003210 | Ga0207691_1000321012 | 201 |
| 470 | 3300025940 | Ga0207691_10005305 | Ga0207691_1000530513 | 201 |
| 471 | 3300025940 | Ga0207691_10043403 | Ga0207691_100434035 | 201 |
| 472 | 3300025940 | Ga0207691_10446209 | Ga0207691_104462091 | 201 |
| 473 | 3300025941 | Ga0207711_10089361 | Ga0207711_100893611 | 201 |
| 474 | 3300025942 | Ga0207689_10001029 | Ga0207689_1000102921 | 201 |
| 475 | 3300025942 | Ga0207689_10021476 | Ga0207689_100214764 | 201 |
| 476 | 3300025944 | Ga0207661_10000215 | Ga0207661_1000021533 | 201 |
| 477 | 3300025945 | Ga0207679_10000026 | Ga0207679_10000026151 | 201 |
| 478 | 3300025945 | Ga0207679_10031711 | Ga0207679_100317115 | 201 |
| 479 | 3300025945 | Ga0207679_10432510 | Ga0207679_104325101 | 201 |
| 480 | 3300025945 | Ga0207679_10848767 | Ga0207679_108487671 | 201 |
| 481 | 3300025949 | Ga0207667_10014254 | Ga0207667_100142542 | 201 |
| 482 | 3300025949 | Ga0207667_10038113 | Ga0207667_100381136 | 201 |
| 483 | 3300025949 | Ga0207667_10107653 | Ga0207667_101076532 | 201 |
| 484 | 3300025949 | Ga0207667_10154285 | Ga0207667_101542853 | 201 |
| 485 | 3300025949 | Ga0207667_10247695 | Ga0207667_102476952 | 201 |
| 486 | 3300025960 | Ga0207651_10019973 | Ga0207651_100199732 | 201 |
| 487 | 3300025960 | Ga0207651_10109456 | Ga0207651_101094563 | 201 |
| 488 | 3300025961 | Ga0207712_10000686 | Ga0207712_1000068624 | 201 |
| 489 | 3300025961 | Ga0207712_10053365 | Ga0207712_100533651 | 201 |
| 490 | 3300025972 | Ga0207668_10000242 | Ga0207668_1000024223 | 201 |
| 491 | 3300025972 | Ga0207668_10113591 | Ga0207668_101135913 | 201 |
| 492 | 3300025981 | Ga0207640_10028205 | Ga0207640_100282056 | 201 |
| 493 | 3300025981 | Ga0207640_10146821 | Ga0207640_101468212 | 201 |
| 494 | 3300025986 | Ga0207658_10016307 | Ga0207658_100163076 | 201 |
| 495 | 3300025986 | Ga0207658_10116850 | Ga0207658_101168502 | 201 |
| 496 | 3300026023 | Ga0207677_10009440 | Ga0207677_100094406 | 201 |
| 497 | 3300026023 | Ga0207677_10491827 | Ga0207677_104918271 | 201 |
| 498 | 3300026035 | Ga0207703_10004423 | Ga0207703_100044239 | 201 |
| 499 | 3300026035 | Ga0207703_10022281 | Ga0207703_100222813 | 201 |
| 500 | 3300026041 | Ga0207639_10048244 | Ga0207639_100482442 | 201 |
| 501 | 3300026067 | Ga0207678_10001079 | Ga0207678_1000107923 | 201 |
| 502 | 3300026075 | Ga0207708_10000805 | Ga0207708_1000080523 | 201 |
| 503 | 3300026078 | Ga0207702_10002121 | Ga0207702_100021218 | 201 |
| 504 | 3300026078 | Ga0207702_10530690 | Ga0207702_105306901 | 201 |
| 505 | 3300026088 | Ga0207641_10005094 | Ga0207641_100050941 | 201 |
| 506 | 3300026088 | Ga0207641_10005860 | Ga0207641_100058609 | 201 |
| 507 | 3300026088 | Ga0207641_10105193 | Ga0207641_101051931 | 201 |
| 508 | 3300026089 | Ga0207648_10000731 | Ga0207648_100007319 | 201 |
| 509 | 3300026089 | Ga0207648_10011855 | Ga0207648_100118554 | 201 |
| 510 | 3300026095 | Ga0207676_10000361 | Ga0207676_1000036132 | 201 |
| 511 | 3300026095 | Ga0207676_10005133 | Ga0207676_1000513310 | 201 |
| 512 | 3300026095 | Ga0207676_10108625 | Ga0207676_101086252 | 201 |
| 513 | 3300026116 | Ga0207674_10002121 | Ga0207674_100021219 | 201 |
| 514 | 3300026116 | Ga0207674_10284200 | Ga0207674_102842002 | 201 |
| 515 | 3300026116 | Ga0207674_10404440 | Ga0207674_104044402 | 201 |
| 516 | 3300026118 | Ga0207675_100001489 | Ga0207675_10000148923 | 201 |
| 517 | 3300026118 | Ga0207675_100040045 | Ga0207675_1000400451 | 201 |
| 518 | 3300026118 | Ga0207675_100044593 | Ga0207675_1000445935 | 201 |
| 519 | 3300026118 | Ga0207675_101505407 | Ga0207675_1015054071 | 201 |
| 520 | 3300026121 | Ga0207683_10000034 | Ga0207683_1000003448 | 201 |
| 521 | 3300026121 | Ga0207683_10002523 | Ga0207683_1000252313 | 201 |
| 522 | 3300026121 | Ga0207683_10006107 | Ga0207683_1000610710 | 201 |
| 523 | 3300026142 | Ga0207698_10000304 | Ga0207698_100003045 | 201 |
| 524 | 3300026142 | Ga0207698_10509200 | Ga0207698_105092001 | 201 |
| 525 | 3300026142 | Ga0207698_10651508 | Ga0207698_106515082 | 201 |
| 526 | 3300026142 | Ga0207698_10747296 | Ga0207698_107472961 | 201 |
| 527 | 3300027252 | Ga0209973_1001787 | Ga0209973_10017872 | 201 |
| 528 | 3300027462 | Ga0210000_1005697 | Ga0210000_10056972 | 201 |
| 529 | 3300027552 | Ga0209982_1004183 | Ga0209982_10041833 | 201 |
| 530 | 3300027617 | Ga0210002_1006803 | Ga0210002_10068033 | 201 |
| 531 | 3300027682 | Ga0209971_1025372 | Ga0209971_10253722 | 201 |
| 532 | 3300027695 | Ga0209966_1005150 | Ga0209966_10051503 | 201 |
| 533 | 3300027717 | Ga0209998_10001282 | Ga0209998_100012828 | 201 |
| 534 | 3300027866 | Ga0209813_10006250 | Ga0209813_100062504 | 201 |
| 535 | 3300027876 | Ga0209974_10002355 | Ga0209974_100023559 | 201 |
| 536 | 3300027907 | Ga0207428_10000082 | Ga0207428_1000008299 | 201 |
| 537 | 3300027907 | Ga0207428_10000352 | Ga0207428_1000035243 | 201 |
| 538 | 3300027907 | Ga0207428_10040364 | Ga0207428_100403642 | 201 |
| 539 | 3300027907 | Ga0207428_10149387 | Ga0207428_101493873 | 201 |
| 540 | 3300027907 | Ga0207428_10262687 | Ga0207428_102626871 | 201 |
| 541 | 3300028017 | Ga0265356_1014922 | Ga0265356_10149221 | 201 |
| 542 | 3300028379 | Ga0268266_10080780 | Ga0268266_100807805 | 201 |
| 543 | 3300028379 | Ga0268266_10208955 | Ga0268266_102089552 | 201 |
| 544 | 3300028379 | Ga0268266_10271437 | Ga0268266_102714372 | 201 |
| 545 | 3300028379 | Ga0268266_10760434 | Ga0268266_107604342 | 201 |
| 546 | 3300028380 | Ga0268265_10001338 | Ga0268265_1000133823 | 201 |
| 547 | 3300028380 | Ga0268265_10280376 | Ga0268265_102803762 | 201 |
| 548 | 3300028381 | Ga0268264_10026554 | Ga0268264_100265542 | 201 |
| 549 | 3300028573 | Ga0265334_10126530 | Ga0265334_101265302 | 201 |
| 550 | 3300028800 | Ga0265338_10042722 | Ga0265338_100427224 | 201 |
| 551 | 3300028800 | Ga0265338_10046571 | Ga0265338_100465713 | 201 |
| 552 | 3300031235 | Ga0265330_10016019 | Ga0265330_100160195 | 201 |
| 553 | 3300031235 | Ga0265330_10064897 | Ga0265330_100648971 | 201 |
| 554 | 3300031235 | Ga0265330_10095205 | Ga0265330_100952052 | 201 |
| 555 | 3300031238 | Ga0265332_10009149 | Ga0265332_100091495 | 201 |
| 556 | 3300031239 | Ga0265328_10000024 | Ga0265328_1000002416 | 201 |
| 557 | 3300031239 | Ga0265328_10000062 | Ga0265328_1000006217 | 201 |
| 558 | 3300031239 | Ga0265328_10041847 | Ga0265328_100418472 | 201 |
| 559 | 3300031240 | Ga0265320_10049948 | Ga0265320_100499482 | 201 |
| 560 | 3300031241 | Ga0265325_10023519 | Ga0265325_100235193 | 201 |
| 561 | 3300031241 | Ga0265325_10047176 | Ga0265325_100471764 | 201 |
| 562 | 3300031242 | Ga0265329_10033535 | Ga0265329_100335352 | 201 |
| 563 | 3300031247 | Ga0265340_10002509 | Ga0265340_1000250913 | 201 |
| 564 | 3300031247 | Ga0265340_10020501 | Ga0265340_100205015 | 201 |
| 565 | 3300031247 | Ga0265340_10023384 | Ga0265340_100233847 | 201 |
| 566 | 3300031247 | Ga0265340_10145467 | Ga0265340_101454671 | 201 |
| 567 | 3300031247 | Ga0265340_10253202 | Ga0265340_102532021 | 201 |
| 568 | 3300031249 | Ga0265339_10027908 | Ga0265339_100279082 | 201 |
| 569 | 3300031249 | Ga0265339_10040655 | Ga0265339_100406555 | 201 |
| 570 | 3300031250 | Ga0265331_10009560 | Ga0265331_100095602 | 201 |
| 571 | 3300031250 | Ga0265331_10012103 | Ga0265331_100121034 | 201 |
| 572 | 3300031250 | Ga0265331_10038674 | Ga0265331_100386742 | 201 |
| 573 | 3300031250 | Ga0265331_10069285 | Ga0265331_100692852 | 201 |
| 574 | 3300031251 | Ga0265327_10009583 | Ga0265327_100095838 | 201 |
| 575 | 3300031251 | Ga0265327_10010514 | Ga0265327_100105144 | 201 |
| 576 | 3300031344 | Ga0265316_10000169 | Ga0265316_1000016916 | 201 |
| 577 | 3300031595 | Ga0265313_10006684 | Ga0265313_100066849 | 201 |
| 578 | 3300031595 | Ga0265313_10054003 | Ga0265313_100540032 | 201 |
| 579 | 3300031691 | Ga0316579_10148529 | Ga0316579_101485292 | 201 |
| 580 | 3300031711 | Ga0265314_10001306 | Ga0265314_1000130632 | 201 |
| 581 | 3300031711 | Ga0265314_10020005 | Ga0265314_100200052 | 201 |
| 582 | 3300031711 | Ga0265314_10144199 | Ga0265314_101441993 | 201 |
| 583 | 3300031712 | Ga0265342_10000789 | Ga0265342_1000078924 | 201 |
| 584 | 3300031712 | Ga0265342_10000841 | Ga0265342_1000084122 | 201 |
| 585 | 3300031712 | Ga0265342_10007421 | Ga0265342_100074219 | 201 |
| 586 | 3300031712 | Ga0265342_10065814 | Ga0265342_100658142 | 201 |
| 587 | 3300031733 | Ga0316577_10207003 | Ga0316577_102070032 | 201 |
| 588 | 3300032002 | Ga0307416_100395465 | Ga0307416_1003954652 | 201 |
| 589 | 3300032002 | Ga0307416_100647949 | Ga0307416_1006479492 | 201 |
| 590 | 3300034816 | Ga0373930_0035332 | Ga0373930_0035332_311_973 | 201 |
| 591 | 3300034817 | Ga0373948_0001393 | Ga0373948_0001393_1712_2317 | 201 |
| 592 | 3300034818 | Ga0373950_0001040 | Ga0373950_0001040_317_922 | 201 |
| 593 | 3300034818 | Ga0373950_0005130 | Ga0373950_0005130_55_660 | 201 |
| 594 | 3300034819 | Ga0373958_0026831 | Ga0373958_0026831_417_1022 | 201 |
| 595 | 3300034820 | Ga0373959_0007712 | Ga0373959_0007712_472_1077 | 201 |
| 596 | 3300034957 | Ga0373938_0019233 | Ga0373938_0019233_355_1017 | 201 |
| 597 | 3300035084 | Ga0373928_0001679 | Ga0373928_0001679_483_1088 | 201 |
| 598 | 3300035084 | Ga0373928_0035349 | Ga0373928_0035349_244_906 | 201 |
| 599 | 3300035085 | Ga0373929_0011394 | Ga0373929_0011394_1009_1614 | 201 |
| 600 | 3300035085 | Ga0373929_0018020 | Ga0373929_0018020_371_1033 | 201 |
| 601 | 3300035086 | Ga0373934_0013386 | Ga0373934_0013386_1989_2594 | 201 |
| 602 | 3300035086 | Ga0373934_0067024 | Ga0373934_0067024_223_828 | 201 |
| 603 | 3300035089 | Ga0373944_0134051 | Ga0373944_0134051_152_757 | 201 |
| 604 | 3300035090 | Ga0373949_0001470 | Ga0373949_0001470_2034_2639 | 201 |
| 605 | 3300035090 | Ga0373949_0019248 | Ga0373949_0019248_155_760 | 201 |
| 606 | 3300035091 | Ga0373951_0000695 | Ga0373951_0000695_7507_8112 | 201 |
| 607 | 3300035091 | Ga0373951_0022194 | Ga0373951_0022194_689_1294 | 201 |
| 608 | 3300035092 | Ga0373952_0008157 | Ga0373952_0008157_1336_1941 | 201 |
| 609 | 3300035111 | Ga0373923_0049783 | Ga0373923_0049783_725_1330 | 201 |
| 610 | 3300035112 | Ga0373932_0001842 | Ga0373932_0001842_4310_4915 | 201 |
| 611 | 3300035112 | Ga0373932_0011205 | Ga0373932_0011205_395_1057 | 201 |
| 612 | 3300035113 | Ga0373936_0239826 | Ga0373936_0239826_35_640 | 201 |
| 613 | 3300035114 | Ga0373939_0001533 | Ga0373939_0001533_1739_2344 | 201 |
| 614 | 3300035115 | Ga0373941_0003981 | Ga0373941_0003981_1768_2373 | 201 |
| 615 | 3300035115 | Ga0373941_0067529 | Ga0373941_0067529_408_1013 | 201 |
| 616 | 3300035117 | Ga0373953_0035046 | Ga0373953_0035046_1237_1842 | 201 |
| 617 | 3300035117 | Ga0373953_0162433 | Ga0373953_0162433_255_860 | 201 |
| 618 | 3300035118 | Ga0373954_0014658 | Ga0373954_0014658_1518_2123 | 201 |
| 619 | 3300035118 | Ga0373954_0025923 | Ga0373954_0025923_724_1329 | 201 |
| 620 | 3300035119 | Ga0373956_0004403 | Ga0373956_0004403_282_887 | 201 |
| 621 | 3300035119 | Ga0373956_0190037 | Ga0373956_0190037_10_615 | 201 |
| 622 | 3300035120 | Ga0373957_0003558 | Ga0373957_0003558_2717_3322 | 201 |
| 623 | 3300035120 | Ga0373957_0052232 | Ga0373957_0052232_736_1341 | 201 |
| 624 | 3300035121 | Ga0373960_0001162 | Ga0373960_0001162_80_742 | 201 |
| 625 | 3300035121 | Ga0373960_0016249 | Ga0373960_0016249_1217_1822 | 201 |
| 626 | 3300035170 | Ga0373943_0000992 | Ga0373943_0000992_4296_4901 | 201 |
| 627 | 3300035170 | Ga0373943_0005818 | Ga0373943_0005818_3610_4272 | 201 |
| 628 | 3300035170 | Ga0373943_0035214 | Ga0373943_0035214_350_955 | 201 |
| 629 | 3300035171 | Ga0373946_0019049 | Ga0373946_0019049_1629_2234 | 201 |
| 630 | 3300035171 | Ga0373946_0053849 | Ga0373946_0053849_682_1287 | 201 |
| 631 | 3300035171 | Ga0373946_0194070 | Ga0373946_0194070_328_933 | 201 |
| 632 | 3300035172 | Ga0373955_0003642 | Ga0373955_0003642_2513_3118 | 201 |
| 633 | 3300035172 | Ga0373955_0029028 | Ga0373955_0029028_1586_2191 | 201 |
| 634 | 3300035207 | Ga0373942_0001447 | Ga0373942_0001447_3303_3908 | 201 |
| 635 | 3300035207 | Ga0373942_0008953 | Ga0373942_0008953_1462_2067 | 201 |
| 636 | 3300035242 | Ga0373962_0000468 | Ga0373962_0000468_4322_4927 | 201 |
| 637 | 3300035242 | Ga0373962_0000929 | Ga0373962_0000929_2253_2858 | 201 |
| 638 | 3300035242 | Ga0373962_0101869 | Ga0373962_0101869_133_738 | 201 |
| 639 | 3300035410 | Ga0373924_0013369 | Ga0373924_0013369_1630_2235 | 201 |
| 640 | 3300035410 | Ga0373924_0015278 | Ga0373924_0015278_1473_2078 | 201 |
| 641 | 3300035691 | Ga0373931_0000179 | Ga0373931_0000179_4338_4943 | 201 |
| 642 | 3300035691 | Ga0373931_0003177 | Ga0373931_0003177_1470_2075 | 201 |
| 643 | 3300035692 | Ga0373935_0068330 | Ga0373935_0068330_1354_1959 | 201 |
| 644 | 3300035692 | Ga0373935_0069926 | Ga0373935_0069926_792_1397 | 201 |
| 645 | 3300035692 | Ga0373935_0090757 | Ga0373935_0090757_981_1586 | 201 |
| 646 | 3300035695 | Ga0373927_0003126 | Ga0373927_0003126_11276_11881 | 201 |
| 647 | 3300035695 | Ga0373927_0078966 | Ga0373927_0078966_1470_2075 | 201 |
| 648 | 3300035695 | Ga0373927_0082182 | Ga0373927_0082182_927_1532 | 201 |
| 649 | 3300035695 | Ga0373927_0099715 | Ga0373927_0099715_116_721 | 201 |
| 650 | 3300035695 | Ga0373927_0584424 | Ga0373927_0584424_94_699 | 201 |
| 651 | 3300035724 | Ga0373933_0002265 | Ga0373933_0002265_9353_9958 | 201 |
| 652 | 3300035725 | Ga0373947_0006073 | Ga0373947_0006073_3625_4230 | 201 |
| 653 | 3300035725 | Ga0373947_0008855 | Ga0373947_0008855_3600_4205 | 201 |
| 654 | 3300035725 | Ga0373947_0027605 | Ga0373947_0027605_1842_2447 | 201 |
| 655 | 3300036401 | Ga0373937_0004474 | Ga0373937_0004474_10326_10931 | 201 |
| 656 | 3300036401 | Ga0373937_0038449 | Ga0373937_0038449_142_747 | 201 |
| 657 | 3300036401 | Ga0373937_0114369 | Ga0373937_0114369_1274_1921 | 201 |
| 658 | 3300036401 | Ga0373937_0339201 | Ga0373937_0339201_578_1222 | 201 |
| 659 | 3300036647 | Ga0316582_0440567 | Ga0316582_0440567_136_741 | 201 |
| 660 | 3300037068 | Ga0373925_0006666 | Ga0373925_0006666_607_1212 | 201 |
| 661 | 3300037068 | Ga0373925_0017728 | Ga0373925_0017728_49_654 | 201 |
| 662 | 3300037068 | Ga0373925_0021696 | Ga0373925_0021696_2751_3356 | 201 |
| 663 | 3300037068 | Ga0373925_0054684 | Ga0373925_0054684_284_889 | 201 |
| 664 | 3300037068 | Ga0373925_0200398 | Ga0373925_0200398_554_1159 | 201 |
| 665 | 3300037068 | Ga0373925_0223914 | Ga0373925_0223914_783_1388 | 201 |
| 666 | 3300039437 | Ga0436365_0318099 | Ga0436365_0318099_125_730 | 201 |
| 667 | 3300039437 | Ga0436365_0366367 | Ga0436365_0366367_66_671 | 201 |
| 668 | 3300039437 | Ga0436365_0856773 | Ga0436365_0856773_1369_1989 | 201 |
| 669 | 3300039437 | Ga0436365_1578283 | Ga0436365_1578283_149_754 | 201 |
| 670 | 3300039437 | Ga0436365_1854878 | Ga0436365_1854878_1932_2537 | 201 |
| 671 | 3300039438 | Ga0436360_0504011 | Ga0436360_0504011_182_787 | 201 |
| 672 | 3300039438 | Ga0436360_0549825 | Ga0436360_0549825_610_1215 | 201 |
| 673 | 3300039438 | Ga0436360_0752551 | Ga0436360_0752551_2210_2815 | 201 |
| 674 | 3300039438 | Ga0436360_1359514 | Ga0436360_1359514_36_641 | 201 |
| 675 | 3300039450 | Ga0436363_1377017 | Ga0436363_1377017_56_661 | 201 |
| 676 | 3300039453 | Ga0436362_0747841 | Ga0436362_0747841_196_801 | 201 |
| 677 | 3300042013 | Ga0439456_037983 | Ga0439456_037983_172_777 | 201 |
| 678 | 3300042435 | Ga0439434_0058307 | Ga0439434_0058307_465_1070 | 201 |
| 679 | 3300044694 | Ga0466963_0167248 | Ga0466963_0167248_419_1024 | 201 |
| 680 | 3300044712 | Ga0453684_0000077 | Ga0453684_0000077_16593_17216 | 201 |
| 681 | 3300044712 | Ga0453684_0335090 | Ga0453684_0335090_552_1157 | 201 |
| 682 | 3300045049 | Ga0466959_0108232 | Ga0466959_0108232_1003_1608 | 201 |
| 683 | 3300045049 | Ga0466959_0343411 | Ga0466959_0343411_83_688 | 201 |
| 684 | 3300045051 | Ga0451576_0009171 | Ga0451576_0009171_5266_5871 | 201 |
| 685 | 3300046455 | Ga0495603_0175656 | Ga0495603_0175656_21_626 | 201 |
| 686 | 3300046455 | Ga0495603_0222782 | Ga0495603_0222782_169_774 | 201 |
| 687 | 3300046459 | Ga0495629_0000062 | Ga0495629_0000062_12781_13386 | 201 |
| 688 | 3300046459 | Ga0495629_0004556 | Ga0495629_0004556_8870_9475 | 201 |
| 689 | 3300046459 | Ga0495629_0158289 | Ga0495629_0158289_187_792 | 201 |
| 690 | 3300046460 | Ga0495638_0026888 | Ga0495638_0026888_2407_3012 | 201 |
| 691 | 3300046461 | Ga0495641_0020006 | Ga0495641_0020006_2208_2813 | 201 |
| 692 | 3300046461 | Ga0495641_0294315 | Ga0495641_0294315_45_650 | 201 |
| 693 | 3300046462 | Ga0495651_0008073 | Ga0495651_0008073_4475_5080 | 201 |
| 694 | 3300046462 | Ga0495651_0021886 | Ga0495651_0021886_34_681 | 201 |
| 695 | 3300046462 | Ga0495651_0076768 | Ga0495651_0076768_709_1314 | 201 |
| 696 | 3300046463 | Ga0495653_0015013 | Ga0495653_0015013_3261_3866 | 201 |
| 697 | 3300046463 | Ga0495653_0028022 | Ga0495653_0028022_2232_2837 | 201 |
| 698 | 3300046472 | Ga0495580_0124303 | Ga0495580_0124303_72_677 | 201 |
| 699 | 3300046472 | Ga0495580_0133832 | Ga0495580_0133832_50_655 | 201 |
| 700 | 3300046472 | Ga0495580_0339946 | Ga0495580_0339946_384_989 | 201 |
| 701 | 3300046473 | Ga0495582_0031031 | Ga0495582_0031031_1003_1608 | 201 |
| 702 | 3300046473 | Ga0495582_0373796 | Ga0495582_0373796_173_778 | 201 |
| 703 | 3300046474 | Ga0495605_0020124 | Ga0495605_0020124_2542_3147 | 201 |
| 704 | 3300046475 | Ga0495639_0034490 | Ga0495639_0034490_1442_2047 | 201 |
| 705 | 3300046476 | Ga0495662_0001185 | Ga0495662_0001185_1194_1799 | 201 |
| 706 | 3300046477 | Ga0495664_0000434 | Ga0495664_0000434_16103_16708 | 201 |
| 707 | 3300046477 | Ga0495664_0052190 | Ga0495664_0052190_203_808 | 201 |
| 708 | 3300046499 | Ga0495594_0047133 | Ga0495594_0047133_359_1021 | 201 |
| 709 | 3300046511 | Ga0495608_0022048 | Ga0495608_0022048_1062_1667 | 201 |
| 710 | 3300046511 | Ga0495608_0056862 | Ga0495608_0056862_1417_2022 | 201 |
| 711 | 3300046511 | Ga0495608_0073810 | Ga0495608_0073810_704_1309 | 201 |
| 712 | 3300046514 | Ga0495618_0010670 | Ga0495618_0010670_4141_4746 | 201 |
| 713 | 3300046514 | Ga0495618_0042884 | Ga0495618_0042884_746_1351 | 201 |
| 714 | 3300046515 | Ga0495620_0154997 | Ga0495620_0154997_65_670 | 201 |
| 715 | 3300046517 | Ga0495630_0042726 | Ga0495630_0042726_655_1260 | 201 |
| 716 | 3300046517 | Ga0495630_0047207 | Ga0495630_0047207_2296_2901 | 201 |
| 717 | 3300046517 | Ga0495630_0052177 | Ga0495630_0052177_2385_2990 | 201 |
| 718 | 3300046517 | Ga0495630_0057159 | Ga0495630_0057159_1675_2280 | 201 |
| 719 | 3300046517 | Ga0495630_0175583 | Ga0495630_0175583_700_1305 | 201 |
| 720 | 3300046519 | Ga0495632_0094049 | Ga0495632_0094049_675_1280 | 201 |
| 721 | 3300046520 | Ga0495637_0093124 | Ga0495637_0093124_475_1080 | 201 |
| 722 | 3300046529 | Ga0495652_0006237 | Ga0495652_0006237_5956_6561 | 201 |
| 723 | 3300046529 | Ga0495652_0033805 | Ga0495652_0033805_425_1030 | 201 |
| 724 | 3300046529 | Ga0495652_0051239 | Ga0495652_0051239_1841_2446 | 201 |
| 725 | 3300046531 | Ga0495665_0036852 | Ga0495665_0036852_1173_1778 | 201 |
| 726 | 3300046533 | Ga0495640_0003511 | Ga0495640_0003511_11914_12519 | 201 |
| 727 | 3300046533 | Ga0495640_0126485 | Ga0495640_0126485_609_1214 | 201 |
| 728 | 3300046535 | Ga0495586_0148965 | Ga0495586_0148965_393_998 | 201 |
| 729 | 3300046536 | Ga0495587_0010013 | Ga0495587_0010013_973_1578 | 201 |
| 730 | 3300046536 | Ga0495587_0071841 | Ga0495587_0071841_295_900 | 201 |
| 731 | 3300046537 | Ga0495598_0014745 | Ga0495598_0014745_549_1154 | 201 |
| 732 | 3300046539 | Ga0495621_0004111 | Ga0495621_0004111_529_1134 | 201 |
| 733 | 3300046543 | Ga0495645_0000746 | Ga0495645_0000746_1989_2594 | 201 |
| 734 | 3300046543 | Ga0495645_0081076 | Ga0495645_0081076_671_1276 | 201 |
| 735 | 3300046559 | Ga0495667_0006860 | Ga0495667_0006860_5174_5779 | 201 |
| 736 | 3300046615 | Ga0495656_0025755 | Ga0495656_0025755_1617_2222 | 201 |
| 737 | 3300046615 | Ga0495656_0054643 | Ga0495656_0054643_164_769 | 201 |
| 738 | 3300046642 | Ga0495634_0001083 | Ga0495634_0001083_6997_7602 | 201 |
| 739 | 3300046642 | Ga0495634_0002973 | Ga0495634_0002973_8799_9404 | 201 |
| 740 | 3300046663 | Ga0495635_0000191 | Ga0495635_0000191_9419_10024 | 201 |
| 741 | 3300046663 | Ga0495635_0009194 | Ga0495635_0009194_4583_5188 | 201 |
| 742 | 3300046663 | Ga0495635_0045789 | Ga0495635_0045789_741_1346 | 201 |
| 743 | 3300046663 | Ga0495635_0285093 | Ga0495635_0285093_145_750 | 201 |
| 744 | 3300046675 | Ga0495657_0013089 | Ga0495657_0013089_382_987 | 201 |
| 745 | 3300046675 | Ga0495657_0077155 | Ga0495657_0077155_876_1481 | 201 |
| 746 | 3300046678 | Ga0495599_0019404 | Ga0495599_0019404_3504_4109 | 201 |
| 747 | 3300046679 | Ga0495623_0001696 | Ga0495623_0001696_5703_6308 | 201 |
| 748 | 3300046679 | Ga0495623_0373583 | Ga0495623_0373583_143_748 | 201 |
| 749 | 3300046680 | Ga0495646_0017448 | Ga0495646_0017448_2280_2885 | 201 |
| 750 | 3300046681 | Ga0495647_0159565 | Ga0495647_0159565_290_895 | 201 |
| 751 | 3300046681 | Ga0495647_0212297 | Ga0495647_0212297_222_827 | 201 |
| 752 | 3300046683 | Ga0495658_0000109 | Ga0495658_0000109_5253_5858 | 201 |
| 753 | 3300046683 | Ga0495658_0066143 | Ga0495658_0066143_341_946 | 201 |
| 754 | 3300046683 | Ga0495658_0181247 | Ga0495658_0181247_199_843 | 201 |
| 755 | 3300046683 | Ga0495658_0579663 | Ga0495658_0579663_51_656 | 201 |
| 756 | 3300046684 | Ga0495669_0138161 | Ga0495669_0138161_315_920 | 201 |
| 757 | 3300046689 | Ga0495613_0031653 | Ga0495613_0031653_2144_2749 | 201 |
| 758 | 3300046689 | Ga0495613_0078612 | Ga0495613_0078612_301_906 | 201 |
| 759 | 3300046689 | Ga0495613_0237319 | Ga0495613_0237319_318_923 | 201 |
| 760 | 3300046689 | Ga0495613_0456689 | Ga0495613_0456689_153_797 | 201 |
| 761 | 3300046690 | Ga0495624_0044312 | Ga0495624_0044312_633_1238 | 201 |
| 762 | 3300046809 | Ga0495600_0012096 | Ga0495600_0012096_3610_4215 | 201 |
| 763 | 3300046809 | Ga0495600_0030521 | Ga0495600_0030521_844_1449 | 201 |
| 764 | 3300047315 | Ga0495581_0115200 | Ga0495581_0115200_516_1121 | 201 |
| 765 | 3300047317 | Ga0495604_0002530 | Ga0495604_0002530_8449_9054 | 201 |
| 766 | 3300047317 | Ga0495604_0008733 | Ga0495604_0008733_5048_5653 | 201 |
| 767 | 3300047317 | Ga0495604_0054322 | Ga0495604_0054322_25_630 | 201 |
| 768 | 3300047319 | Ga0495674_0047398 | Ga0495674_0047398_864_1469 | 201 |
| 769 | 3300047319 | Ga0495674_0085149 | Ga0495674_0085149_308_946 | 201 |
| 770 | 3300047320 | Ga0495672_0226140 | Ga0495672_0226140_152_757 | 201 |
| 771 | 3300047321 | Ga0495676_0094272 | Ga0495676_0094272_433_1038 | 201 |
| 772 | 3300047321 | Ga0495676_0179857 | Ga0495676_0179857_13_618 | 201 |
| 773 | 3300047322 | Ga0495680_0000483 | Ga0495680_0000483_28046_28651 | 201 |
| 774 | 3300047322 | Ga0495680_0252209 | Ga0495680_0252209_185_790 | 201 |
| 775 | 3300047322 | Ga0495680_0309715 | Ga0495680_0309715_466_1071 | 201 |
| 776 | 3300047322 | Ga0495680_0404952 | Ga0495680_0404952_168_815 | 201 |
| 777 | 3300047444 | Ga0495675_0035911 | Ga0495675_0035911_1691_2296 | 201 |
| 778 | 3300047445 | Ga0495677_0058129 | Ga0495677_0058129_750_1355 | 201 |
| 779 | 3300047471 | Ga0495684_0001760 | Ga0495684_0001760_5983_6588 | 201 |
| 780 | 3300047471 | Ga0495684_0002479 | Ga0495684_0002479_3240_3845 | 201 |
| 781 | 3300047471 | Ga0495684_0027128 | Ga0495684_0027128_2285_2890 | 201 |
| 782 | 3300047471 | Ga0495684_0180563 | Ga0495684_0180563_292_897 | 201 |
| 783 | 3300047471 | Ga0495684_0515381 | Ga0495684_0515381_157_762 | 201 |
| 784 | 3300047673 | Ga0495593_0001596 | Ga0495593_0001596_3211_3816 | 201 |
| 785 | 3300047673 | Ga0495593_0016387 | Ga0495593_0016387_2004_2609 | 201 |
| 786 | 3300047673 | Ga0495593_0050476 | Ga0495593_0050476_1401_2006 | 201 |
| 787 | 3300048088 | Ga0495602_0031093 | Ga0495602_0031093_1126_1731 | 201 |
| 788 | 3300048088 | Ga0495602_0037615 | Ga0495602_0037615_775_1380 | 201 |
| 789 | 3300048088 | Ga0495602_0082549 | Ga0495602_0082549_845_1450 | 201 |
| 790 | 3300048903 | Ga0496100_0001014 | Ga0496100_0001014_1838_2443 | 201 |
| 791 | 3300048903 | Ga0496100_0009625 | Ga0496100_0009625_4373_4978 | 201 |
| 792 | 3300048903 | Ga0496100_0175698 | Ga0496100_0175698_765_1370 | 201 |
| 793 | 3300048903 | Ga0496100_0422212 | Ga0496100_0422212_113_718 | 201 |
| 794 | 3300048904 | Ga0496101_0001828 | Ga0496101_0001828_7111_7716 | 201 |
| 795 | 3300048904 | Ga0496101_0035261 | Ga0496101_0035261_1839_2444 | 201 |
| 796 | 3300048904 | Ga0496101_0141183 | Ga0496101_0141183_302_907 | 201 |
| 797 | 3300048905 | Ga0496102_0000988 | Ga0496102_0000988_11643_12248 | 201 |
| 798 | 3300048905 | Ga0496102_0055636 | Ga0496102_0055636_1288_1893 | 201 |
| 799 | 3300048905 | Ga0496102_0258809 | Ga0496102_0258809_831_1436 | 201 |
| 800 | 3300048905 | Ga0496102_0420536 | Ga0496102_0420536_516_1121 | 201 |
| 801 | 3300048905 | Ga0496102_0447139 | Ga0496102_0447139_562_1167 | 201 |
| 802 | 3300048906 | Ga0496103_0000582 | Ga0496103_0000582_1476_2081 | 201 |
| 803 | 3300048906 | Ga0496103_0005721 | Ga0496103_0005721_5138_5743 | 201 |
| 804 | 3300048906 | Ga0496103_0035550 | Ga0496103_0035550_1899_2504 | 201 |
| 805 | 3300048907 | Ga0496104_0000067 | Ga0496104_0000067_102227_102832 | 201 |
| 806 | 3300048907 | Ga0496104_0000574 | Ga0496104_0000574_29712_30317 | 201 |
| 807 | 3300048907 | Ga0496104_0007277 | Ga0496104_0007277_8508_9113 | 201 |
| 808 | 3300048907 | Ga0496104_0013597 | Ga0496104_0013597_237_842 | 201 |
| 809 | 3300048907 | Ga0496104_0051947 | Ga0496104_0051947_1031_1636 | 201 |
| 810 | 3300048907 | Ga0496104_0300987 | Ga0496104_0300987_265_870 | 201 |
| 811 | 3300048907 | Ga0496104_0534538 | Ga0496104_0534538_352_957 | 201 |
| 812 | 3300048908 | Ga0496105_0001954 | Ga0496105_0001954_12786_13391 | 201 |
| 813 | 3300048908 | Ga0496105_0006546 | Ga0496105_0006546_2416_3021 | 201 |
| 814 | 3300048908 | Ga0496105_0028842 | Ga0496105_0028842_2142_2747 | 201 |
| 815 | 3300048908 | Ga0496105_0077653 | Ga0496105_0077653_914_1519 | 201 |
| 816 | 3300048908 | Ga0496105_0092496 | Ga0496105_0092496_484_1089 | 201 |
| 817 | 3300048908 | Ga0496105_0111126 | Ga0496105_0111126_1146_1751 | 201 |
| 818 | 3300048908 | Ga0496105_0189545 | Ga0496105_0189545_731_1336 | 201 |
| 819 | 3300048908 | Ga0496105_0658204 | Ga0496105_0658204_47_652 | 201 |
| 820 | 3300048909 | Ga0496106_0002154 | Ga0496106_0002154_1832_2437 | 201 |
| 821 | 3300048909 | Ga0496106_0011737 | Ga0496106_0011737_899_1504 | 201 |
| 822 | 3300048909 | Ga0496106_0023714 | Ga0496106_0023714_3939_4544 | 201 |
| 823 | 3300048910 | Ga0496107_0006560 | Ga0496107_0006560_5441_6046 | 201 |
| 824 | 3300048910 | Ga0496107_0007065 | Ga0496107_0007065_671_1276 | 201 |
| 825 | 3300048910 | Ga0496107_0012178 | Ga0496107_0012178_3623_4228 | 201 |
| 826 | 3300048910 | Ga0496107_0041111 | Ga0496107_0041111_2702_3307 | 201 |
| 827 | 3300048910 | Ga0496107_0516656 | Ga0496107_0516656_37_642 | 201 |
| 828 | 3300048910 | Ga0496107_0746934 | Ga0496107_0746934_40_645 | 201 |
| 829 | 3300048911 | Ga0496108_0002765 | Ga0496108_0002765_8949_9554 | 201 |
| 830 | 3300048911 | Ga0496108_0006074 | Ga0496108_0006074_8278_8883 | 201 |
| 831 | 3300048911 | Ga0496108_0025713 | Ga0496108_0025713_1257_1862 | 201 |
| 832 | 3300048911 | Ga0496108_0332063 | Ga0496108_0332063_662_1267 | 201 |
| 833 | 3300048912 | Ga0496109_0013377 | Ga0496109_0013377_2155_2760 | 201 |
| 834 | 3300048912 | Ga0496109_0032046 | Ga0496109_0032046_2767_3372 | 201 |
| 835 | 3300048912 | Ga0496109_0038333 | Ga0496109_0038333_1801_2406 | 201 |
| 836 | 3300048912 | Ga0496109_0086166 | Ga0496109_0086166_1794_2399 | 201 |
| 837 | 3300048912 | Ga0496109_0299035 | Ga0496109_0299035_13_618 | 201 |
| 838 | 3300048912 | Ga0496109_0610264 | Ga0496109_0610264_303_908 | 201 |
| 839 | 3300048912 | Ga0496109_1193246 | Ga0496109_1193246_41_646 | 201 |
| 840 | 3300048913 | Ga0496110_0011410 | Ga0496110_0011410_4416_5021 | 201 |
| 841 | 3300048913 | Ga0496110_0026612 | Ga0496110_0026612_1384_1989 | 201 |
| 842 | 3300048913 | Ga0496110_0037606 | Ga0496110_0037606_2750_3355 | 201 |
| 843 | 3300048913 | Ga0496110_0091061 | Ga0496110_0091061_176_781 | 201 |
| 844 | 3300048913 | Ga0496110_0219196 | Ga0496110_0219196_126_731 | 201 |
| 845 | 3300048913 | Ga0496110_1159920 | Ga0496110_1159920_55_660 | 201 |
| 846 | 3300048914 | Ga0496111_0004190 | Ga0496111_0004190_2262_2867 | 201 |
| 847 | 3300048914 | Ga0496111_0006677 | Ga0496111_0006677_3902_4507 | 201 |
| 848 | 3300048914 | Ga0496111_0041909 | Ga0496111_0041909_868_1473 | 201 |
| 849 | 3300048914 | Ga0496111_0230408 | Ga0496111_0230408_396_1001 | 201 |
| 850 | 3300048914 | Ga0496111_0772410 | Ga0496111_0772410_70_675 | 201 |
| 851 | 3300048915 | Ga0496112_0006568 | Ga0496112_0006568_6922_7527 | 201 |
| 852 | 3300048915 | Ga0496112_0017351 | Ga0496112_0017351_2676_3281 | 201 |
| 853 | 3300048915 | Ga0496112_0028719 | Ga0496112_0028719_3967_4572 | 201 |
| 854 | 3300048915 | Ga0496112_0080898 | Ga0496112_0080898_378_983 | 201 |
| 855 | 3300048915 | Ga0496112_0236978 | Ga0496112_0236978_82_687 | 201 |
| 856 | 3300048915 | Ga0496112_0301665 | Ga0496112_0301665_419_1024 | 201 |
| 857 | 3300048915 | Ga0496112_0340012 | Ga0496112_0340012_93_698 | 201 |
| 858 | 3300048916 | Ga0496113_0001805 | Ga0496113_0001805_8915_9520 | 201 |
| 859 | 3300048916 | Ga0496113_0465766 | Ga0496113_0465766_277_882 | 201 |
| 860 | 3300048917 | Ga0496114_0010065 | Ga0496114_0010065_4271_4876 | 201 |
| 861 | 3300048917 | Ga0496114_0067703 | Ga0496114_0067703_468_1073 | 201 |
| 862 | 3300048917 | Ga0496114_0116425 | Ga0496114_0116425_559_1164 | 201 |
| 863 | 3300048917 | Ga0496114_0119182 | Ga0496114_0119182_227_832 | 201 |
| 864 | 3300048917 | Ga0496114_0149386 | Ga0496114_0149386_1315_1920 | 201 |
| 865 | 3300048917 | Ga0496114_0598803 | Ga0496114_0598803_21_626 | 201 |
| 866 | 3300048918 | Ga0496115_0001071 | Ga0496115_0001071_455_1060 | 201 |
| 867 | 3300048918 | Ga0496115_0024471 | Ga0496115_0024471_998_1603 | 201 |
| 868 | 3300048918 | Ga0496115_0102231 | Ga0496115_0102231_1468_2073 | 201 |
| 869 | 3300048918 | Ga0496115_0175960 | Ga0496115_0175960_783_1388 | 201 |
| 870 | 3300048918 | Ga0496115_0190245 | Ga0496115_0190245_16_621 | 201 |
| 871 | 3300048918 | Ga0496115_0217606 | Ga0496115_0217606_358_963 | 201 |
| 872 | 3300048922 | Ga0496119_0001667 | Ga0496119_0001667_12252_12857 | 201 |
| 873 | 3300048924 | Ga0496121_0528065 | Ga0496121_0528065_82_687 | 201 |
| 874 | 3300048927 | Ga0496124_0349404 | Ga0496124_0349404_63_668 | 201 |
| 875 | 3300048928 | Ga0496125_0276116 | Ga0496125_0276116_139_744 | 201 |
| 876 | 3300048929 | Ga0496126_0119510 | Ga0496126_0119510_1367_1972 | 201 |
| 877 | 3300048929 | Ga0496126_0189030 | Ga0496126_0189030_1007_1612 | 201 |
| 878 | 3300048929 | Ga0496126_0534261 | Ga0496126_0534261_157_762 | 201 |
| 879 | 3300049568 | Ga0501031_0002368 | Ga0501031_0002368_8978_9583 | 201 |
| 880 | 3300049568 | Ga0501031_0028797 | Ga0501031_0028797_1209_1865 | 201 |
| 881 | 3300049568 | Ga0501031_0476964 | Ga0501031_0476964_42_647 | 201 |
| 882 | 3300049569 | Ga0501032_0000001 | Ga0501032_0000001_57277_57882 | 201 |
| 883 | 3300049569 | Ga0501032_0005172 | Ga0501032_0005172_4163_4819 | 201 |
| 884 | 3300049569 | Ga0501032_0034615 | Ga0501032_0034615_387_1064 | 201 |
| 885 | 3300049570 | Ga0501033_0000077 | Ga0501033_0000077_22132_22737 | 201 |
| 886 | 3300049570 | Ga0501033_0026780 | Ga0501033_0026780_2400_3005 | 201 |
| 887 | 3300049570 | Ga0501033_0039024 | Ga0501033_0039024_865_1542 | 201 |
| 888 | 3300049570 | Ga0501033_0051447 | Ga0501033_0051447_2073_2729 | 201 |
| 889 | 3300049570 | Ga0501033_0119303 | Ga0501033_0119303_890_1546 | 201 |
| 890 | 3300049570 | Ga0501033_0322595 | Ga0501033_0322595_273_878 | 201 |
| 891 | 3300049571 | Ga0501034_0000023 | Ga0501034_0000023_89208_89813 | 201 |
| 892 | 3300049571 | Ga0501034_0013529 | Ga0501034_0013529_5988_6665 | 201 |
| 893 | 3300049571 | Ga0501034_0038088 | Ga0501034_0038088_1966_2571 | 201 |
| 894 | 3300049571 | Ga0501034_0091995 | Ga0501034_0091995_2146_2751 | 201 |
| 895 | 3300049571 | Ga0501034_0094333 | Ga0501034_0094333_1569_2225 | 201 |
| 896 | 3300049571 | Ga0501034_0409332 | Ga0501034_0409332_151_756 | 201 |
| 897 | 3300049572 | Ga0501036_0000482 | Ga0501036_0000482_4946_5551 | 201 |
| 898 | 3300049572 | Ga0501036_0006028 | Ga0501036_0006028_4302_4958 | 201 |
| 899 | 3300049572 | Ga0501036_0062317 | Ga0501036_0062317_1913_2518 | 201 |
| 900 | 3300049572 | Ga0501036_0106875 | Ga0501036_0106875_358_1035 | 201 |
| 901 | 3300049573 | Ga0501037_0000065 | Ga0501037_0000065_93494_94099 | 201 |
| 902 | 3300049573 | Ga0501037_0017847 | Ga0501037_0017847_2632_3288 | 201 |
| 903 | 3300049573 | Ga0501037_0277777 | Ga0501037_0277777_255_932 | 201 |
| 904 | 3300049574 | Ga0501038_0000043 | Ga0501038_0000043_53030_53635 | 201 |
| 905 | 3300049574 | Ga0501038_0014243 | Ga0501038_0014243_2372_3028 | 201 |
| 906 | 3300049574 | Ga0501038_0129304 | Ga0501038_0129304_413_1090 | 201 |
| 907 | 3300049574 | Ga0501038_0348225 | Ga0501038_0348225_417_1022 | 201 |
| 908 | 3300049574 | Ga0501038_0380147 | Ga0501038_0380147_395_1000 | 201 |
| 909 | 3300049575 | Ga0501039_0000022 | Ga0501039_0000022_120679_121284 | 201 |
| 910 | 3300049575 | Ga0501039_0005361 | Ga0501039_0005361_7797_8453 | 201 |
| 911 | 3300049575 | Ga0501039_0056652 | Ga0501039_0056652_284_961 | 201 |
| 912 | 3300049575 | Ga0501039_0080733 | Ga0501039_0080733_297_902 | 201 |
| 913 | 3300049577 | Ga0501041_0062492 | Ga0501041_0062492_133_738 | 201 |
| 914 | 3300049577 | Ga0501041_0139385 | Ga0501041_0139385_564_1169 | 201 |
| 915 | 3300049578 | Ga0501042_0023231 | Ga0501042_0023231_1491_2147 | 201 |
| 916 | 3300049578 | Ga0501042_0110756 | Ga0501042_0110756_70_675 | 201 |
| 917 | 3300049578 | Ga0501042_0164433 | Ga0501042_0164433_824_1492 | 201 |
| 918 | 3300049579 | Ga0501043_0000310 | Ga0501043_0000310_35033_35638 | 201 |
| 919 | 3300049579 | Ga0501043_0027092 | Ga0501043_0027092_2053_2709 | 201 |
| 920 | 3300049579 | Ga0501043_0175769 | Ga0501043_0175769_607_1284 | 201 |
| 921 | 3300049579 | Ga0501043_0253948 | Ga0501043_0253948_422_1090 | 201 |
| 922 | 3300049579 | Ga0501043_0563906 | Ga0501043_0563906_38_643 | 201 |
| 923 | 3300049580 | Ga0501046_0003995 | Ga0501046_0003995_7693_8349 | 201 |
| 924 | 3300049581 | Ga0501047_0047790 | Ga0501047_0047790_2073_2729 | 201 |
| 925 | 3300049581 | Ga0501047_0116322 | Ga0501047_0116322_374_1030 | 201 |
| 926 | 3300049581 | Ga0501047_0158048 | Ga0501047_0158048_743_1420 | 201 |
| 927 | 3300049581 | Ga0501047_0633832 | Ga0501047_0633832_233_838 | 201 |
| 928 | 3300049582 | Ga0501048_0024560 | Ga0501048_0024560_2321_2977 | 201 |
| 929 | 3300049582 | Ga0501048_0101228 | Ga0501048_0101228_914_1582 | 201 |
| 930 | 3300049583 | Ga0501067_0003221 | Ga0501067_0003221_4306_4962 | 201 |
| 931 | 3300049583 | Ga0501067_0039548 | Ga0501067_0039548_38_643 | 201 |
| 932 | 3300049583 | Ga0501067_0185870 | Ga0501067_0185870_343_948 | 201 |
| 933 | 3300049583 | Ga0501067_0230132 | Ga0501067_0230132_77_682 | 201 |
| 934 | 3300049583 | Ga0501067_0288483 | Ga0501067_0288483_219_824 | 201 |
| 935 | 3300049584 | Ga0501068_0177511 | Ga0501068_0177511_40_645 | 201 |
| 936 | 3300049585 | Ga0501069_0004930 | Ga0501069_0004930_4144_4800 | 201 |
| 937 | 3300049585 | Ga0501069_0011625 | Ga0501069_0011625_3225_3830 | 201 |
| 938 | 3300049585 | Ga0501069_0197148 | Ga0501069_0197148_550_1155 | 201 |
| 939 | 3300049585 | Ga0501069_0342264 | Ga0501069_0342264_84_689 | 201 |
| 940 | 3300049586 | Ga0501070_0009447 | Ga0501070_0009447_3694_4299 | 201 |
| 941 | 3300049586 | Ga0501070_0016831 | Ga0501070_0016831_638_1315 | 201 |
| 942 | 3300049586 | Ga0501070_0055665 | Ga0501070_0055665_1346_2002 | 201 |
| 943 | 3300049586 | Ga0501070_0086797 | Ga0501070_0086797_770_1375 | 201 |
| 944 | 3300049586 | Ga0501070_0516702 | Ga0501070_0516702_93_698 | 201 |
| 945 | 3300049587 | Ga0501071_0216513 | Ga0501071_0216513_80_685 | 201 |
| 946 | 3300049588 | Ga0501072_0216317 | Ga0501072_0216317_167_772 | 201 |
| 947 | 3300049588 | Ga0501072_0318627 | Ga0501072_0318627_541_1146 | 201 |
| 948 | 3300049588 | Ga0501072_0437972 | Ga0501072_0437972_99_755 | 201 |
| 949 | 3300049589 | Ga0501073_0042012 | Ga0501073_0042012_1422_2078 | 201 |
| 950 | 3300049589 | Ga0501073_0163199 | Ga0501073_0163199_471_1076 | 201 |
| 951 | 3300049590 | Ga0501074_0005559 | Ga0501074_0005559_5816_6472 | 201 |
| 952 | 3300049590 | Ga0501074_0097865 | Ga0501074_0097865_49_717 | 201 |
| 953 | 3300049590 | Ga0501074_0166052 | Ga0501074_0166052_577_1182 | 201 |
| 954 | 3300049590 | Ga0501074_0173054 | Ga0501074_0173054_96_701 | 201 |
| 955 | 3300049590 | Ga0501074_0685133 | Ga0501074_0685133_42_647 | 201 |
| 956 | 3300049592 | Ga0501076_0016642 | Ga0501076_0016642_2461_3129 | 201 |
| 957 | 3300049592 | Ga0501076_0059310 | Ga0501076_0059310_615_1271 | 201 |
| 958 | 3300049593 | Ga0501077_0009848 | Ga0501077_0009848_2930_3598 | 201 |
| 959 | 3300049741 | Ga0501079_0016096 | Ga0501079_0016096_4347_5015 | 201 |
| 960 | 3300049741 | Ga0501079_0534606 | Ga0501079_0534606_66_671 | 201 |
| 961 | 3300049741 | Ga0501079_0604464 | Ga0501079_0604464_21_626 | 201 |
| 962 | 3300049742 | Ga0501080_0034590 | Ga0501080_0034590_2287_2943 | 201 |
| 963 | 3300049742 | Ga0501080_0076615 | Ga0501080_0076615_49_654 | 201 |
| 964 | 3300049742 | Ga0501080_0083148 | Ga0501080_0083148_416_1021 | 201 |
| 965 | 3300049742 | Ga0501080_0319668 | Ga0501080_0319668_459_1064 | 201 |
| 966 | 3300049744 | Ga0501083_0010614 | Ga0501083_0010614_2378_3034 | 201 |
| 967 | 3300049744 | Ga0501083_0015328 | Ga0501083_0015328_1864_2469 | 201 |
| 968 | 3300049822 | Ga0501035_0000234 | Ga0501035_0000234_62338_62943 | 201 |
| 969 | 3300049822 | Ga0501035_0015144 | Ga0501035_0015144_4731_5336 | 201 |
| 970 | 3300049822 | Ga0501035_0015488 | Ga0501035_0015488_1346_2002 | 201 |
| 971 | 3300049822 | Ga0501035_0018523 | Ga0501035_0018523_238_915 | 201 |
| 972 | 3300049822 | Ga0501035_0199389 | Ga0501035_0199389_862_1467 | 201 |
| 973 | 3300049823 | Ga0501044_0000815 | Ga0501044_0000815_26691_27347 | 201 |
| 974 | 3300049823 | Ga0501044_0003116 | Ga0501044_0003116_1359_1964 | 201 |
| 975 | 3300049823 | Ga0501044_0021531 | Ga0501044_0021531_968_1573 | 201 |
| 976 | 3300049823 | Ga0501044_0053557 | Ga0501044_0053557_2073_2729 | 201 |
| 977 | 3300049823 | Ga0501044_0076558 | Ga0501044_0076558_1710_2315 | 201 |
| 978 | 3300049823 | Ga0501044_0125510 | Ga0501044_0125510_1289_1894 | 201 |
| 979 | 3300049823 | Ga0501044_0823649 | Ga0501044_0823649_141_746 | 201 |
| 980 | 3300049823 | Ga0501044_1000079 | Ga0501044_1000079_58_663 | 201 |
| 981 | 3300049824 | Ga0501045_0033963 | Ga0501045_0033963_388_1056 | 201 |
| 982 | 3300049824 | Ga0501045_0198303 | Ga0501045_0198303_371_1027 | 201 |
| 983 | 3300050489 | nmdc:mga03683_39701_c1 | nmdc:mga03683_39701_c1_165_770 | 201 |
| 984 | 3300050490 | nmdc:mga03n38_155827_c1 | nmdc:mga03n38_155827_c1_503_1108 | 201 |
| 985 | 3300050490 | nmdc:mga03n38_220390_c1 | nmdc:mga03n38_220390_c1_223_828 | 201 |
| 986 | 3300050490 | nmdc:mga03n38_63002_c1 | nmdc:mga03n38_63002_c1_606_1211 | 201 |
| 987 | 3300050491 | nmdc:mga00v17_229690_c1 | nmdc:mga00v17_229690_c1_503_1108 | 201 |
| 988 | 3300050491 | nmdc:mga00v17_38016_c1 | nmdc:mga00v17_38016_c1_2138_2743 | 201 |
| 989 | 3300050492 | nmdc:mga0yw44_171159_c1 | nmdc:mga0yw44_171159_c1_697_1302 | 201 |
| 990 | 3300050492 | nmdc:mga0yw44_319235_c1 | nmdc:mga0yw44_319235_c1_339_944 | 201 |
| 991 | 3300050492 | nmdc:mga0yw44_330995_c1 | nmdc:mga0yw44_330995_c1_358_963 | 201 |
| 992 | 3300050492 | nmdc:mga0yw44_48825_c1 | nmdc:mga0yw44_48825_c1_1293_1898 | 201 |
| 993 | 3300050493 | nmdc:mga0k408_121548_c1 | nmdc:mga0k408_121548_c1_293_898 | 201 |
| 994 | 3300050493 | nmdc:mga0k408_185164_c1 | nmdc:mga0k408_185164_c1_203_913 | 201 |
| 995 | 3300050493 | nmdc:mga0k408_19359_c1 | nmdc:mga0k408_19359_c1_2855_3460 | 201 |
| 996 | 3300050494 | nmdc:mga06z11_236203_c1 | nmdc:mga06z11_236203_c1_297_902 | 201 |
| 997 | 3300050494 | nmdc:mga06z11_418312_c1 | nmdc:mga06z11_418312_c1_55_660 | 201 |
| 998 | 3300050494 | nmdc:mga06z11_8923_c1 | nmdc:mga06z11_8923_c1_1513_2142 | 201 |
| 999 | 3300050495 | nmdc:mga04h51_7124_c1 | nmdc:mga04h51_7124_c1_272_877 | 201 |
| 1000 | 3300050495 | nmdc:mga04h51_93603_c1 | nmdc:mga04h51_93603_c1_260_865 | 201 |
| 1001 | 3300050496 | nmdc:mga07m45_317639_c1 | nmdc:mga07m45_317639_c1_290_895 | 201 |
| 1002 | 3300050507 | nmdc:mga05p37_19_c2 | nmdc:mga05p37_19_c2_43287_43916 | 201 |
| 1003 | 3300050507 | nmdc:mga05p37_216354_c1 | nmdc:mga05p37_216354_c1_1205_1810 | 201 |
| 1004 | 3300050508 | nmdc:mga09592_2070_c1 | nmdc:mga09592_2070_c1_8658_9350 | 201 |
| 1005 | 3300050508 | nmdc:mga09592_238_c1 | nmdc:mga09592_238_c1_155_784 | 201 |
| 1006 | 3300050508 | nmdc:mga09592_96720_c1 | nmdc:mga09592_96720_c1_1831_2460 | 201 |
| 1007 | 3300050509 | nmdc:mga0qj67_259_c1 | nmdc:mga0qj67_259_c1_24481_25110 | 201 |
| 1008 | 3300050510 | nmdc:mga06r32_2023_c1 | nmdc:mga06r32_2023_c1_12400_13029 | 201 |
| 1009 | 3300050510 | nmdc:mga06r32_349_c1 | nmdc:mga06r32_349_c1_26614_27306 | 201 |
| 1010 | 3300050510 | nmdc:mga06r32_501245_c1 | nmdc:mga06r32_501245_c1_460_1065 | 201 |
| 1011 | 3300050511 | nmdc:mga08y16_123581_c1 | nmdc:mga08y16_123581_c1_108_713 | 201 |
| 1012 | 3300050511 | nmdc:mga08y16_222039_c1 | nmdc:mga08y16_222039_c1_986_1639 | 201 |
| 1013 | 3300050511 | nmdc:mga08y16_245149_c1 | nmdc:mga08y16_245149_c1_831_1436 | 201 |
| 1014 | 3300050511 | nmdc:mga08y16_2735_c1 | nmdc:mga08y16_2735_c1_17170_17799 | 201 |
| 1015 | 3300050511 | nmdc:mga08y16_325_c1 | nmdc:mga08y16_325_c1_41606_42298 | 201 |
| 1016 | 3300050511 | nmdc:mga08y16_444751_c1 | nmdc:mga08y16_444751_c1_244_849 | 201 |
| 1017 | 3300050512 | nmdc:mga0n895_120909_c1 | nmdc:mga0n895_120909_c1_31_636 | 201 |
| 1018 | 3300050512 | nmdc:mga0n895_1215831_c1 | nmdc:mga0n895_1215831_c1_109_714 | 201 |
| 1019 | 3300050512 | nmdc:mga0n895_281192_c1 | nmdc:mga0n895_281192_c1_759_1364 | 201 |
| 1020 | 3300050512 | nmdc:mga0n895_394_c1 | nmdc:mga0n895_394_c1_6682_7311 | 201 |
| 1021 | 3300050512 | nmdc:mga0n895_45970_c1 | nmdc:mga0n895_45970_c1_956_1561 | 201 |
| 1022 | 3300050512 | nmdc:mga0n895_506674_c1 | nmdc:mga0n895_506674_c1_254_859 | 201 |
| 1023 | 3300050512 | nmdc:mga0n895_563681_c1 | nmdc:mga0n895_563681_c1_236_841 | 201 |
| 1024 | 3300050512 | nmdc:mga0n895_9070_c1 | nmdc:mga0n895_9070_c1_831_1436 | 201 |
| 1025 | 3300050513 | nmdc:mga0rr50_13004_c1 | nmdc:mga0rr50_13004_c1_3367_3972 | 201 |
| 1026 | 3300050513 | nmdc:mga0rr50_522077_c1 | nmdc:mga0rr50_522077_c1_102_707 | 201 |
| 1027 | 3300050513 | nmdc:mga0rr50_748596_c1 | nmdc:mga0rr50_748596_c1_149_754 | 201 |
| 1028 | 3300050513 | nmdc:mga0rr50_785_c1 | nmdc:mga0rr50_785_c1_1558_2187 | 201 |
| 1029 | 3300050514 | nmdc:mga08x19_120826_c1 | nmdc:mga08x19_120826_c1_942_1547 | 201 |
| 1030 | 3300050514 | nmdc:mga08x19_207318_c1 | nmdc:mga08x19_207318_c1_387_992 | 201 |
| 1031 | 3300050514 | nmdc:mga08x19_52251_c1 | nmdc:mga08x19_52251_c1_1866_2471 | 201 |
| 1032 | 3300050515 | nmdc:mga0a205_10038_c1 | nmdc:mga0a205_10038_c1_7025_7630 | 201 |
| 1033 | 3300050515 | nmdc:mga0a205_14874_c1 | nmdc:mga0a205_14874_c1_1084_1689 | 201 |
| 1034 | 3300050515 | nmdc:mga0a205_249_c1 | nmdc:mga0a205_249_c1_26711_27340 | 201 |
| 1035 | 3300050515 | nmdc:mga0a205_337310_c1 | nmdc:mga0a205_337310_c1_445_1050 | 201 |
| 1036 | 3300053077 | Ga0495601_0000338 | Ga0495601_0000338_10540_11145 | 201 |
| 1037 | 3300053077 | Ga0495601_0001346 | Ga0495601_0001346_2268_2873 | 201 |
| 1038 | 3300053077 | Ga0495601_0022223 | Ga0495601_0022223_2315_2920 | 201 |
| 1039 | 3300053078 | Ga0495612_0000152 | Ga0495612_0000152_19102_19707 | 201 |
| 1040 | 3300053078 | Ga0495612_0058120 | Ga0495612_0058120_246_851 | 201 |
| 1041 | 3300053083 | Ga0495655_0009189 | Ga0495655_0009189_220_825 | 201 |
| 1042 | 3300053084 | Ga0495595_0022830 | Ga0495595_0022830_951_1556 | 201 |
| 1043 | 3300053084 | Ga0495595_0066508 | Ga0495595_0066508_880_1485 | 201 |
| 1044 | 3300053085 | Ga0495619_0000078 | Ga0495619_0000078_58068_58673 | 201 |
| 1045 | 3300053085 | Ga0495619_0001083 | Ga0495619_0001083_7460_8065 | 201 |
| 1046 | 3300053085 | Ga0495619_0018347 | Ga0495619_0018347_1520_2125 | 201 |
| 1047 | 3300053085 | Ga0495619_0117573 | Ga0495619_0117573_186_791 | 201 |
| 1048 | 3300053085 | Ga0495619_0257819 | Ga0495619_0257819_155_760 | 201 |
| 1049 | 3300053090 | Ga0500646_0007709 | Ga0500646_0007709_274_879 | 201 |
| 1050 | 3300053104 | Ga0500556_0102072 | Ga0500556_0102072_30_635 | 201 |
| 1051 | 3300053119 | Ga0500595_012962 | Ga0500595_012962_2211_2816 | 201 |
| 1052 | 3300053130 | Ga0500642_0091120 | Ga0500642_0091120_776_1381 | 201 |
| 1053 | 3300053131 | Ga0500652_000169 | Ga0500652_000169_17173_17778 | 201 |
| 1054 | 3300053153 | Ga0500616_0006713 | Ga0500616_0006713_492_1097 | 201 |
| 1055 | 3300053158 | Ga0500627_0030433 | Ga0500627_0030433_282_887 | 201 |
| 1056 | 3300053177 | Ga0500636_0006847 | Ga0500636_0006847_3484_4089 | 201 |
| 1057 | 3300054114 | Ga0501084_0014744 | Ga0501084_0014744_2884_3540 | 201 |
| 1058 | 3300054114 | Ga0501084_0074320 | Ga0501084_0074320_1334_1939 | 201 |
| 1059 | 3300054114 | Ga0501084_0103789 | Ga0501084_0103789_122_727 | 201 |
| 1060 | 3300054114 | Ga0501084_0400245 | Ga0501084_0400245_394_999 | 201 |
| 1061 | 3300060353 | Ga0501082_0005652 | Ga0501082_0005652_537_1193 | 201 |
| 1062 | 3300060353 | Ga0501082_0169098 | Ga0501082_0169098_133_738 | 201 |
| 1063 | 3300060353 | Ga0501082_0176866 | Ga0501082_0176866_1161_1766 | 201 |
| 1064 | 3300061734 | Ga0530510_0002354 | Ga0530510_0002354_17_622 | 201 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3h5j-assembly1.cif.gz_A | leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.8584 | 1 | 175 |
| 3q3w-assembly1.cif.gz_A | isopropylmalate isomerase small subunit from campylobacter jejuni. | 0.8583 | 1 | 176 |
| 2hcu-assembly1.cif.gz_A | crystal structure of smu.1381 (or leud) from streptococcus mutans | 0.854 | 1 | 175 |
| 3h5j-assembly1.cif.gz_A | leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.8536 | 1 | 175 |
| 3h5e-assembly2.cif.gz_B | leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis | 0.8428 | 4 | 162 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O14289_535_712_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.8802 | 1 | 178 | 3.20.19.10 |
| af_O14289_535_712_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.8613 | 1 | 178 | 3.20.19.10 |
| 3h5jA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.8584 | 1 | 175 | 3.20.19.10 |
| af_Q2FWK0_1_171_3.20.19.10 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.8566 | 2 | 175 | 3.20.19.10 |
| 3h5jA00 | Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 | 0.8536 | 1 | 175 | 3.20.19.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E3QQN6-F1-model_v4 | 3-isopropylmalate dehydratase | 0.9805 | 102 | 200 |
GO:0009098
GO:0016829 |
| AF-A0A7C1YE99-F1-model_v4 | 3-isopropylmalate dehydratase small subunit | 0.9783 | 121 | 200 |
|
| AF-A0A4S0LI89-F1-model_v4 | deleted | 0.9722 | 53 | 170 |
|
| AF-A0A4S0LI89-F1-model_v4 | deleted | 0.9642 | 53 | 170 |
|
| AF-A0A7S0FG31-F1-model_v4 | 3-isopropylmalate dehydratase (EC 4.2.1.33) | 0.9621 | 76 | 200 |
GO:0003861
GO:0009098 GO:0009316 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar