F489360

General Info

Members Datasets Scaffolds Average Seq Length
1064 457 1052 202

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_185164_c1|nmdc:mga0k408_185164_c1_203_913
Length 236
Sequence MAAALFSIPAFSHSGPLLDLTNGPLQNHPPSGEIAMEKFTVLEGVAAPLRVVNVDTDMIIPKQYLKTIKRTGLGKGLFSEKRYKDDGSENPDFVLNKPAYRKAKILVAGDNFGCGSSREHAPWALADFGIRCVISTSFGDIFYNNSFKNGLLPIRVSPEDLEKLFEDAERGANATLTVDLEKQEIRGPDGGVVKFEIDPFRKHCLLNGLDDIGLTQAKDAHIGTYETKAKAERPWL

Samples

Sample ID Description Type Environment
1 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
2 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
3 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
4 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
5 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
6 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
7 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
8 2902330777 Methylobacterium sp. 2A Isolate Unclassified
9 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
10 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
11 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
14 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
15 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
20 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
23 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
24 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
25 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
26 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
27 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
28 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
31 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
37 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
40 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
41 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
61 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
69 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
70 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
71 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
75 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
76 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
77 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
78 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
82 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
83 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
84 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
85 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
86 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
87 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
96 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
97 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
98 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
108 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
109 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
110 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
111 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
112 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
113 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
114 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
115 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
116 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
117 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
118 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
119 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
120 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
121 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
122 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
123 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
124 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
125 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
126 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
127 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
128 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
129 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
148 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
149 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
150 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
151 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
152 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
153 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
154 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
155 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
156 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
157 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
163 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
167 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
168 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
243 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
245 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
250 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
251 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
252 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
253 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
254 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
255 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
256 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
257 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
258 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
259 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
260 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
261 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
262 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
263 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
264 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
265 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
266 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
267 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
268 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
269 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
270 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
271 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
272 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
273 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
274 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
275 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
276 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
277 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
278 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
279 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
280 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
281 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
282 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
283 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
285 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
286 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
287 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
288 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
289 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
290 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
291 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
292 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
293 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
294 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
295 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
296 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
297 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
298 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
299 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
300 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
301 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
302 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
303 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
304 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
305 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
306 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
307 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
308 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
309 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
310 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
311 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
312 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
313 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
314 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
315 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
316 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
317 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
318 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
319 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
320 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
321 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
322 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
323 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
324 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
325 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
326 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
327 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
328 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
329 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
330 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
331 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
332 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
333 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
334 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
335 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
336 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
337 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
338 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
339 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
340 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
341 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
342 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
343 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
344 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
345 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
346 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
349 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
350 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
351 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
352 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
353 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
354 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
355 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
356 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
361 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
362 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
363 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
364 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
365 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
366 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
367 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
368 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
369 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
370 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
371 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
372 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
373 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
374 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
375 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
376 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
377 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
378 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
379 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
380 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
381 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
382 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
383 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
384 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
385 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
386 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
387 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
388 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
389 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
390 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
391 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
392 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
393 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
394 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
395 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
412 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
413 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
414 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
415 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
416 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
417 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
418 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
419 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
420 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
423 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
424 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
425 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
426 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
427 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
428 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
429 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
430 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
431 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
432 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
433 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
434 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
435 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
436 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
437 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
438 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
439 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
440 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
441 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
442 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
443 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
444 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
445 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
446 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
447 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
448 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
449 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
450 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
451 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
452 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
453 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
454 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
455 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
456 641522639 Methylobacterium sp. 4-46 Isolate Nodule
457 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0.28
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.98
Nodule 0.28
Rhizoplane 7.71
Rhizosphere 84.87
Stem 0
Stem Tuber 0
Unclassified 2.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24032J14994_100170 3300001430 Bacteria 3277
2 JGI24736J21556_1013782 3300001904 Bacteria 1303
3 JGI24752J21851_1001950 3300001976 Bacteria 2747
4 JGI24746J21847_1000605 3300001977 Bacteria 5447
5 JGI24747J21853_1001825 3300001978 Bacteria 1654
6 JGI24740J21852_10020453 3300001979 Bacteria 2308
7 JGI24739J22299_10000119 3300001989 Bacteria 24437
8 JGI24737J22298_10000258 3300001990 Bacteria 17613
9 JGI24750J21931_1000164 3300002070 Bacteria 11020
10 JGI24745J21846_1000103 3300002073 Bacteria 6407
11 JGI24738J21930_10005193 3300002075 Bacteria 3142
12 JGI24749J21850_1000093 3300002076 Bacteria 15913
13 JGI24749J21850_1019507 3300002076 Bacteria 958
14 JGI24744J21845_10001608 3300002077 Bacteria 4513
15 JGI24035J26624_1000048 3300002126 Bacteria 9152
16 JGI24033J26618_1001488 3300002155 Bacteria 2328
17 JGI24034J26672_10000515 3300002239 Bacteria 5006
18 JGI24034J26672_10001644 3300002239 Bacteria 2993
19 JGI24742J22300_10000595 3300002244 Bacteria 5438
20 JGI24751J29686_10018194 3300002459 Bacteria 1453
21 JGI25153J46596_10001652 3300003215 Bacteria 13208
22 JGI26129J50193_1002722 3300003349 Bacteria 1244
23 JGI25404J52841_10005604 3300003659 Bacteria 2594
24 Ga0065714_10135970 3300005288 Bacteria 1209
25 Ga0065715_10088946 3300005293 Bacteria 21692
26 Ga0065707_10104807 3300005295 Bacteria 2677
27 Ga0065707_10280081 3300005295 Bacteria 1050
28 Ga0070658_10009370 3300005327 Bacteria 7867
29 Ga0070658_10188403 3300005327 Bacteria 1738
30 Ga0070676_10000514 3300005328 Bacteria 18558
31 Ga0070683_100005318 3300005329 Bacteria 10729
32 Ga0070683_100025217 3300005329 Bacteria 5336
33 Ga0070690_100008454 3300005330 Bacteria 5929
34 Ga0070690_100054680 3300005330 Bacteria 2556
35 Ga0070670_100002160 3300005331 Bacteria 16146
36 Ga0070670_100123675 3300005331 Bacteria 2232
37 Ga0070670_100200801 3300005331 Bacteria 1732
38 Ga0070677_10000023 3300005333 Bacteria 44929
39 Ga0070677_10031092 3300005333 Bacteria 2038
40 Ga0068869_100000153 3300005334 Bacteria 34191
41 Ga0068869_100009816 3300005334 Bacteria 6217
42 Ga0070666_10003393 3300005335 Bacteria 9651
43 Ga0070666_10397399 3300005335 Bacteria 991
44 Ga0070680_100000814 3300005336 Bacteria 21982
45 Ga0070680_100018221 3300005336 Bacteria 5546
46 Ga0070682_100000445 3300005337 Bacteria 26505
47 Ga0068868_100014021 3300005338 Bacteria 5897
48 Ga0068868_100109589 3300005338 Bacteria 2242
49 Ga0068868_100798126 3300005338 Bacteria 851
50 Ga0070660_100001480 3300005339 Bacteria 16083
51 Ga0070660_100130906 3300005339 Bacteria 2008
52 Ga0070660_100610006 3300005339 Bacteria 913
53 Ga0070689_100000880 3300005340 Bacteria 18718
54 Ga0070689_100014559 3300005340 Bacteria 5717
55 Ga0070689_100206405 3300005340 Bacteria 1606
56 Ga0070691_10000320 3300005341 Bacteria 17013
57 Ga0070687_100000187 3300005343 Bacteria 21513
58 Ga0070687_100152213 3300005343 Bacteria 1359
59 Ga0070687_100267744 3300005343 Bacteria 1069
60 Ga0070687_100347057 3300005343 Bacteria 957
61 Ga0070661_100001011 3300005344 Bacteria 19919
62 Ga0070661_100096242 3300005344 Bacteria 2196
63 Ga0070668_100002838 3300005347 Bacteria 12766
64 Ga0070669_100000501 3300005353 Bacteria 29467
65 Ga0070669_100043033 3300005353 Bacteria 3287
66 Ga0070669_100147344 3300005353 Bacteria 1820
67 Ga0070675_100001136 3300005354 Bacteria 19211
68 Ga0070675_100080693 3300005354 Bacteria 2712
69 Ga0070675_100521045 3300005354 Bacteria 1073
70 Ga0070671_100000595 3300005355 Bacteria 25844
71 Ga0070671_100007251 3300005355 Bacteria 8858
72 Ga0070674_100000249 3300005356 Bacteria 26766
73 Ga0070674_100001190 3300005356 Bacteria 13665
74 Ga0070674_100094735 3300005356 Bacteria 2163
75 Ga0070673_100000233 3300005364 Bacteria 27866
76 Ga0070673_100002039 3300005364 Bacteria 12191
77 Ga0070673_100160851 3300005364 Bacteria 1909
78 Ga0070688_100000432 3300005365 Bacteria 21144
79 Ga0070688_100009975 3300005365 Bacteria 5219
80 Ga0070659_100000746 3300005366 Bacteria 23656
81 Ga0070659_100275149 3300005366 Bacteria 1400
82 Ga0070659_100471137 3300005366 Bacteria 1068
83 Ga0070667_100001881 3300005367 Bacteria 18641
84 Ga0070667_100164897 3300005367 Bacteria 1954
85 Ga0070667_100252312 3300005367 Bacteria 1577
86 Ga0070667_100653968 3300005367 Bacteria 970
87 Ga0070703_10001482 3300005406 Bacteria 7053
88 Ga0070709_10047309 3300005434 Bacteria 2679
89 Ga0070709_10066235 3300005434 Bacteria 2316
90 Ga0070714_100090724 3300005435 Bacteria 2676
91 Ga0070714_100092299 3300005435 Bacteria 2654
92 Ga0070714_100336049 3300005435 Bacteria 1415
93 Ga0070714_100416631 3300005435 Bacteria 1272
94 Ga0070714_100633367 3300005435 Bacteria 1028
95 Ga0070713_100034550 3300005436 Bacteria 4063
96 Ga0070713_100143336 3300005436 Bacteria 2118
97 Ga0070713_100663707 3300005436 Bacteria 994
98 Ga0070710_10010676 3300005437 Bacteria 4516
99 Ga0070710_10014144 3300005437 Bacteria 4010
100 Ga0070710_10021162 3300005437 Bacteria 3385
101 Ga0070710_10114113 3300005437 Bacteria 1627
102 Ga0070710_10330960 3300005437 Bacteria 1003
103 Ga0070701_10010707 3300005438 Bacteria 4069
104 Ga0070701_10039230 3300005438 Bacteria 2401
105 Ga0070711_100015569 3300005439 Bacteria 4814
106 Ga0070711_100042375 3300005439 Bacteria 3076
107 Ga0070711_100066518 3300005439 Bacteria 2525
108 Ga0070705_100000361 3300005440 Bacteria 26716
109 Ga0070700_100000357 3300005441 Bacteria 23494
110 Ga0070694_100009629 3300005444 Bacteria 5929
111 Ga0070694_100105960 3300005444 Bacteria 1996
112 Ga0070708_100011297 3300005445 Bacteria 7260
113 Ga0070663_100006501 3300005455 Bacteria 7036
114 Ga0070663_100014884 3300005455 Bacteria 5002
115 Ga0070663_100588282 3300005455 Bacteria 934
116 Ga0070678_100000438 3300005456 Bacteria 19678
117 Ga0070662_100035557 3300005457 Bacteria 3519
118 Ga0070662_100119158 3300005457 Bacteria 2021
119 Ga0070662_100271458 3300005457 Bacteria 1369
120 Ga0070681_10039781 3300005458 Bacteria 4713
121 Ga0070681_10224839 3300005458 Bacteria 1792
122 Ga0070681_10247774 3300005458 Bacteria 1694
123 Ga0070681_10775096 3300005458 Bacteria 876
124 Ga0068867_100001099 3300005459 Bacteria 18474
125 Ga0068867_100079424 3300005459 Bacteria 2469
126 Ga0068867_100248855 3300005459 Bacteria 1444
127 Ga0070685_10006230 3300005466 Bacteria 6074
128 Ga0070685_10158702 3300005466 Bacteria 1440
129 Ga0070698_100194771 3300005471 Bacteria 1964
130 Ga0070679_100002503 3300005530 Bacteria 16646
131 Ga0070679_100023170 3300005530 Bacteria 6076
132 Ga0070679_100149887 3300005530 Bacteria 2309
133 Ga0070679_100376970 3300005530 Bacteria 1365
134 Ga0070679_100832969 3300005530 Bacteria 866
135 Ga0070684_100000101 3300005535 Bacteria 55960
136 Ga0070684_100124599 3300005535 Bacteria 2320
137 Ga0070684_100456395 3300005535 Bacteria 1181
138 Ga0070684_100829745 3300005535 Bacteria 865
139 Ga0068853_100158781 3300005539 Bacteria 2039
140 Ga0068853_100210062 3300005539 Bacteria 1774
141 Ga0068853_100221116 3300005539 Bacteria 1729
142 Ga0070672_100035124 3300005543 Bacteria 3808
143 Ga0070672_100126981 3300005543 Bacteria 2092
144 Ga0070672_100336642 3300005543 Bacteria 1284
145 Ga0070686_100000532 3300005544 Bacteria 22792
146 Ga0070686_100006895 3300005544 Bacteria 6328
147 Ga0070686_100012133 3300005544 Bacteria 4901
148 Ga0070695_100005890 3300005545 Bacteria 7232
149 Ga0070696_100007762 3300005546 Bacteria 7159
150 Ga0070693_100003380 3300005547 Bacteria 7425
151 Ga0070693_100096945 3300005547 Bacteria 1789
152 Ga0070665_100069518 3300005548 Bacteria 3529
153 Ga0070665_100168248 3300005548 Bacteria 2194
154 Ga0070665_100328151 3300005548 Bacteria 1534
155 Ga0070665_100423655 3300005548 Bacteria 1340
156 Ga0070704_100009296 3300005549 Bacteria 5929
157 Ga0068855_100047838 3300005563 Bacteria 5051
158 Ga0068855_100317042 3300005563 Bacteria 1724
159 Ga0068855_100512171 3300005563 Bacteria 1303
160 Ga0068855_100563253 3300005563 Bacteria 1232
161 Ga0070664_100020910 3300005564 Bacteria 5392
162 Ga0070664_100061173 3300005564 Bacteria 3209
163 Ga0070664_100251297 3300005564 Bacteria 1589
164 Ga0070664_100571753 3300005564 Bacteria 1047
165 Ga0070664_101026412 3300005564 Bacteria 775
166 Ga0068857_100001072 3300005577 Bacteria 21170
167 Ga0068854_100000794 3300005578 Bacteria 18790
168 Ga0068856_100006877 3300005614 Bacteria 11126
169 Ga0068856_100233955 3300005614 Bacteria 1853
170 Ga0068856_100610393 3300005614 Bacteria 1112
171 Ga0068856_101030412 3300005614 Bacteria 841
172 Ga0070702_100006263 3300005615 Bacteria 5619
173 Ga0070702_100053715 3300005615 Bacteria 2315
174 Ga0068852_100000713 3300005616 Bacteria 21734
175 Ga0068852_100086835 3300005616 Bacteria 2789
176 Ga0068859_100001523 3300005617 Bacteria 23646
177 Ga0068859_100120035 3300005617 Bacteria 2695
178 Ga0068859_100132778 3300005617 Bacteria 2561
179 Ga0068859_100209914 3300005617 Bacteria 2033
180 Ga0068864_100000715 3300005618 Bacteria 27854
181 Ga0068864_100369800 3300005618 Bacteria 1356
182 Ga0068866_10003508 3300005718 Bacteria 6424
183 Ga0068866_10008505 3300005718 Bacteria 4330
184 Ga0068866_10050564 3300005718 Bacteria 2111
185 Ga0068861_100000574 3300005719 Bacteria 21775
186 Ga0068861_100039977 3300005719 Bacteria 3504
187 Ga0068861_100270569 3300005719 Bacteria 1459
188 Ga0068861_100326111 3300005719 Bacteria 1339
189 Ga0068863_100001272 3300005841 Bacteria 25149
190 Ga0068863_100650482 3300005841 Bacteria 1045
191 Ga0068858_100008506 3300005842 Bacteria 9862
192 Ga0068858_100138044 3300005842 Bacteria 2288
193 Ga0068860_100001758 3300005843 Bacteria 23120
194 Ga0068860_100956332 3300005843 Bacteria 874
195 Ga0068862_100012556 3300005844 Bacteria 7012
196 Ga0068862_100373271 3300005844 Bacteria 1328
197 Ga0081455_10006443 3300005937 Bacteria 12579
198 Ga0081455_10134401 3300005937 Bacteria 1930
199 Ga0081540_1000059 3300005983 Bacteria 120226
200 Ga0081540_1000315 3300005983 Bacteria 50137
201 Ga0081540_1074331 3300005983 Bacteria 1558
202 Ga0070717_10001112 3300006028 Bacteria 18150
203 Ga0070717_10019038 3300006028 Bacteria 5376
204 Ga0070717_10079374 3300006028 Bacteria 2752
205 Ga0075365_10024221 3300006038 Bacteria 3825
206 Ga0075365_10262497 3300006038 Bacteria 1214
207 Ga0075365_10263274 3300006038 Bacteria 1212
208 Ga0075368_10019777 3300006042 Bacteria 2543
209 Ga0075368_10043616 3300006042 Bacteria 1768
210 Ga0075363_100010754 3300006048 Bacteria 4361
211 Ga0075363_100086699 3300006048 Bacteria 1719
212 Ga0075363_100090840 3300006048 Bacteria 1680
213 Ga0075364_10010261 3300006051 Bacteria 5652
214 Ga0075364_10023768 3300006051 Bacteria 3883
215 Ga0075364_10100697 3300006051 Bacteria 1923
216 Ga0075364_10260687 3300006051 Bacteria 1178
217 Ga0075432_10006215 3300006058 Bacteria 4061
218 Ga0070716_100012500 3300006173 Bacteria 4305
219 Ga0070712_100005942 3300006175 Bacteria 7545
220 Ga0070712_100066126 3300006175 Bacteria 2568
221 Ga0070712_100094588 3300006175 Bacteria 2196
222 Ga0075362_10000822 3300006177 Bacteria 9288
223 Ga0075367_10027428 3300006178 Bacteria 3240
224 Ga0075367_10065510 3300006178 Bacteria 2176
225 Ga0075367_10086064 3300006178 Bacteria 1907
226 Ga0075367_10088828 3300006178 Bacteria 1878
227 Ga0075367_10103932 3300006178 Bacteria 1738
228 Ga0075367_10202824 3300006178 Bacteria 1239
229 Ga0075369_10003689 3300006186 Bacteria 5598
230 Ga0075366_10006442 3300006195 Bacteria 6432
231 Ga0075366_10031143 3300006195 Bacteria 3138
232 Ga0097621_100001018 3300006237 Bacteria 19728
233 Ga0097621_100308450 3300006237 Bacteria 1399
234 Ga0075370_10129884 3300006353 Bacteria 1470
235 Ga0068871_100000012 3300006358 Bacteria 105267
236 Ga0068871_100019484 3300006358 Bacteria 5181
237 Ga0068871_100101539 3300006358 Bacteria 2411
238 Ga0068871_100134500 3300006358 Bacteria 2099
239 Ga0068871_100151669 3300006358 Bacteria 1977
240 Ga0075428_100001200 3300006844 Bacteria 27756
241 Ga0075428_100004407 3300006844 Bacteria 15544
242 Ga0075430_100000032 3300006846 Bacteria 72679
243 Ga0075431_100000003 3300006847 Bacteria 112884
244 Ga0075431_100009024 3300006847 Bacteria 9998
245 Ga0075431_100539395 3300006847 Bacteria 1155
246 Ga0075433_10000072 3300006852 Bacteria 45390
247 Ga0075433_10005026 3300006852 Bacteria 10365
248 Ga0075434_100000341 3300006871 Bacteria 33666
249 Ga0075434_100001937 3300006871 Bacteria 17946
250 Ga0075434_100072274 3300006871 Bacteria 3442
251 Ga0075434_100206696 3300006871 Bacteria 1984
252 Ga0075429_100000631 3300006880 Bacteria 27160
253 Ga0075429_100425132 3300006880 Bacteria 1163
254 Ga0068865_100000328 3300006881 Bacteria 26279
255 Ga0068865_100194589 3300006881 Bacteria 1570
256 Ga0075436_100193136 3300006914 Bacteria 1441
257 Ga0075436_100229708 3300006914 Bacteria 1318
258 Ga0075436_100237128 3300006914 Bacteria 1297
259 Ga0097620_100001523 3300006931 Bacteria 23646
260 Ga0097620_100120036 3300006931 Bacteria 2695
261 Ga0097620_100132777 3300006931 Bacteria 2561
262 Ga0097620_100209925 3300006931 Bacteria 2033
263 Ga0075435_100022993 3300007076 Bacteria 4814
264 Ga0075435_100527551 3300007076 Bacteria 1022
265 Ga0075435_100775166 3300007076 Bacteria 835
266 Ga0105251_10100037 3300009011 Bacteria 1325
267 Ga0105251_10141329 3300009011 Bacteria 1089
268 Ga0105244_10023808 3300009036 Bacteria 3351
269 Ga0105240_10028987 3300009093 Bacteria 7220
270 Ga0105240_10045104 3300009093 Bacteria 5595
271 Ga0105240_10083433 3300009093 Bacteria 3921
272 Ga0105240_10103668 3300009093 Bacteria 3455
273 Ga0105240_11517317 3300009093 Bacteria 702
274 Ga0111539_10001373 3300009094 Bacteria 32376
275 Ga0111539_10002936 3300009094 Bacteria 22607
276 Ga0105245_10001404 3300009098 Bacteria 21834
277 Ga0105245_10012824 3300009098 Bacteria 7303
278 Ga0105245_10067818 3300009098 Bacteria 3232
279 Ga0105245_10074327 3300009098 Bacteria 3093
280 Ga0105247_10000881 3300009101 Bacteria 22689
281 Ga0105247_10025277 3300009101 Bacteria 3582
282 Ga0114129_10001551 3300009147 Bacteria 31169
283 Ga0114129_10001730 3300009147 Bacteria 29754
284 Ga0114129_10147946 3300009147 Bacteria 3216
285 Ga0105243_10001028 3300009148 Bacteria 25704
286 Ga0105243_10078105 3300009148 Bacteria 2694
287 Ga0105243_10099928 3300009148 Bacteria 2406
288 Ga0105243_10241028 3300009148 Bacteria 1609
289 Ga0105243_10808076 3300009148 Bacteria 925
290 Ga0105241_10002719 3300009174 Bacteria 13247
291 Ga0105241_10023657 3300009174 Bacteria 4556
292 Ga0105241_10249547 3300009174 Bacteria 1504
293 Ga0105242_10000607 3300009176 Bacteria 28041
294 Ga0105242_10109860 3300009176 Bacteria 2348
295 Ga0105248_10000309 3300009177 Bacteria 58008
296 Ga0105248_10351870 3300009177 Bacteria 1658
297 Ga0105237_10010578 3300009545 Bacteria 9800
298 Ga0105238_10046809 3300009551 Bacteria 4362
299 Ga0105238_10072176 3300009551 Bacteria 3449
300 Ga0105238_10146213 3300009551 Bacteria 2340
301 Ga0105249_10000486 3300009553 Bacteria 36821
302 Ga0099796_10067790 3300010159 Bacteria 1281
303 Ga0105239_10006677 3300010375 Bacteria 13327
304 Ga0105239_10114292 3300010375 Bacteria 2994
305 Ga0105239_10475603 3300010375 Bacteria 1419
306 Ga0105246_10000696 3300011119 Bacteria 18957
307 Ga0105246_10047691 3300011119 Bacteria 2927
308 Ga0157321_1010693 3300012487 Bacteria 705
309 Ga0157373_10022136 3300013100 Bacteria 4612
310 Ga0157371_10124619 3300013102 Bacteria 1832
311 Ga0157370_10511489 3300013104 Bacteria 1102
312 Ga0157369_10553187 3300013105 Bacteria 1189
313 Ga0157374_10001864 3300013296 Bacteria 17741
314 Ga0157374_10226231 3300013296 Bacteria 1837
315 Ga0157374_10243059 3300013296 Bacteria 1770
316 Ga0157374_10536335 3300013296 Bacteria 1177
317 Ga0157378_10006042 3300013297 Bacteria 10605
318 Ga0163162_10000992 3300013306 Bacteria 26439
319 Ga0163162_10038755 3300013306 Bacteria 4757
320 Ga0163162_10315183 3300013306 Bacteria 1697
321 Ga0157372_10021474 3300013307 Bacteria 6975
322 Ga0157372_11178524 3300013307 Bacteria 885
323 Ga0157375_10002320 3300013308 Bacteria 16428
324 Ga0157375_10465062 3300013308 Bacteria 1430
325 Ga0157375_11007053 3300013308 Bacteria 973
326 Ga0163163_10098473 3300014325 Bacteria 2945
327 Ga0163163_10111585 3300014325 Bacteria 2763
328 Ga0163163_10184987 3300014325 Bacteria 2131
329 Ga0157380_10000711 3300014326 Bacteria 20809
330 Ga0157380_10297865 3300014326 Bacteria 1484
331 Ga0157377_10000336 3300014745 Bacteria 21014
332 Ga0157379_10000678 3300014968 Bacteria 27608
333 Ga0157376_10076565 3300014969 Bacteria 2859
334 Ga0157376_10109765 3300014969 Bacteria 2426
335 Ga0157376_10204882 3300014969 Bacteria 1818
336 Ga0163161_10000534 3300017792 Bacteria 31044
337 Ga0163161_10177822 3300017792 Bacteria 1630
338 Ga0206351_10851411 3300020077 Bacteria 890
339 Ga0206350_10637952 3300020080 Bacteria 894
340 Ga0206354_10183665 3300020081 Bacteria 794
341 Ga0213876_10207001 3300021384 Bacteria 1043
342 Ga0213876_10288694 3300021384 Bacteria 872
343 Ga0213871_10177663 3300021441 Bacteria 657
344 Ga0207666_1000177 3300025271 Bacteria 9685
345 Ga0207673_1000025 3300025290 Bacteria 11860
346 Ga0207673_1021159 3300025290 Bacteria 880
347 Ga0209758_1000469 3300025297 Bacteria 66568
348 Ga0207697_10000374 3300025315 Bacteria 25123
349 Ga0207696_1085800 3300025711 Bacteria 866
350 Ga0207653_10009153 3300025885 Bacteria 3087
351 Ga0207682_10000011 3300025893 Bacteria 85533
352 Ga0207682_10000604 3300025893 Bacteria 16696
353 Ga0207692_10030829 3300025898 Bacteria 2562
354 Ga0207692_10089130 3300025898 Bacteria 1669
355 Ga0207692_10119518 3300025898 Bacteria 1473
356 Ga0207642_10000524 3300025899 Bacteria 11752
357 Ga0207642_10118113 3300025899 Bacteria 1363
358 Ga0207710_10000805 3300025900 Bacteria 16991
359 Ga0207688_10000020 3300025901 Bacteria 51200
360 Ga0207688_10000279 3300025901 Bacteria 23305
361 Ga0207688_10499877 3300025901 Bacteria 761
362 Ga0207680_10016116 3300025903 Bacteria 3916
363 Ga0207680_10043051 3300025903 Bacteria 2645
364 Ga0207647_10027730 3300025904 Bacteria 3689
365 Ga0207685_10053819 3300025905 Bacteria 1565
366 Ga0207699_10112179 3300025906 Bacteria 1749
367 Ga0207699_10210624 3300025906 Bacteria 1322
368 Ga0207645_10060646 3300025907 Bacteria 2415
369 Ga0207654_10000818 3300025911 Bacteria 17142
370 Ga0207654_10045738 3300025911 Bacteria 2493
371 Ga0207654_10144309 3300025911 Bacteria 1522
372 Ga0207707_10000689 3300025912 Bacteria 33589
373 Ga0207707_10051458 3300025912 Bacteria 3587
374 Ga0207707_10114124 3300025912 Bacteria 2361
375 Ga0207707_10167329 3300025912 Bacteria 1921
376 Ga0207707_10333038 3300025912 Bacteria 1309
377 Ga0207707_10693232 3300025912 Bacteria 856
378 Ga0207707_10887100 3300025912 Bacteria 738
379 Ga0207695_10046209 3300025913 Bacteria 4616
380 Ga0207695_10346493 3300025913 Bacteria 1373
381 Ga0207695_10905729 3300025913 Bacteria 762
382 Ga0207671_10024759 3300025914 Bacteria 4509
383 Ga0207671_10762402 3300025914 Bacteria 768
384 Ga0207693_10006663 3300025915 Bacteria 9540
385 Ga0207693_10010431 3300025915 Bacteria 7539
386 Ga0207693_10015052 3300025915 Bacteria 6209
387 Ga0207693_10090807 3300025915 Bacteria 2394
388 Ga0207663_10028739 3300025916 Bacteria 3258
389 Ga0207663_10064670 3300025916 Bacteria 2335
390 Ga0207663_10207282 3300025916 Bacteria 1418
391 Ga0207663_10308647 3300025916 Bacteria 1185
392 Ga0207660_10000442 3300025917 Bacteria 27342
393 Ga0207660_10026455 3300025917 Bacteria 3951
394 Ga0207660_10177737 3300025917 Bacteria 1651
395 Ga0207662_10000249 3300025918 Bacteria 24950
396 Ga0207662_10019805 3300025918 Bacteria 3834
397 Ga0207662_10054156 3300025918 Bacteria 2392
398 Ga0207657_10070172 3300025919 Bacteria 2970
399 Ga0207657_10110272 3300025919 Bacteria 2273
400 Ga0207657_10292629 3300025919 Bacteria 1291
401 Ga0207649_10000057 3300025920 Bacteria 102314
402 Ga0207649_10112813 3300025920 Bacteria 1819
403 Ga0207652_10047059 3300025921 Bacteria 3684
404 Ga0207652_10072938 3300025921 Bacteria 2985
405 Ga0207652_10181847 3300025921 Bacteria 1890
406 Ga0207652_10206046 3300025921 Bacteria 1770
407 Ga0207652_10436836 3300025921 Bacteria 1180
408 Ga0207681_10000181 3300025923 Bacteria 51755
409 Ga0207681_10834303 3300025923 Bacteria 771
410 Ga0207694_10033087 3300025924 Bacteria 3960
411 Ga0207694_10063600 3300025924 Bacteria 2875
412 Ga0207694_10154749 3300025924 Bacteria 1848
413 Ga0207650_10001609 3300025925 Bacteria 16125
414 Ga0207650_10097696 3300025925 Bacteria 2255
415 Ga0207650_10156087 3300025925 Bacteria 1805
416 Ga0207659_10000028 3300025926 Bacteria 130804
417 Ga0207659_10043743 3300025926 Bacteria 3147
418 Ga0207659_10163303 3300025926 Bacteria 1751
419 Ga0207659_10605847 3300025926 Bacteria 934
420 Ga0207687_10000061 3300025927 Bacteria 84113
421 Ga0207687_10022684 3300025927 Bacteria 4180
422 Ga0207687_10134612 3300025927 Bacteria 1868
423 Ga0207687_10425291 3300025927 Bacteria 1097
424 Ga0207700_10061550 3300025928 Bacteria 2847
425 Ga0207700_10101299 3300025928 Bacteria 2297
426 Ga0207700_10849511 3300025928 Bacteria 817
427 Ga0207664_10044584 3300025929 Bacteria 3474
428 Ga0207664_10115394 3300025929 Bacteria 2239
429 Ga0207664_10154927 3300025929 Bacteria 1950
430 Ga0207664_10518587 3300025929 Bacteria 1068
431 Ga0207664_10671702 3300025929 Bacteria 931
432 Ga0207644_10000315 3300025931 Bacteria 31527
433 Ga0207644_10004323 3300025931 Bacteria 9212
434 Ga0207644_10025117 3300025931 Bacteria 4094
435 Ga0207690_10000445 3300025932 Bacteria 26765
436 Ga0207690_10528477 3300025932 Bacteria 957
437 Ga0207706_10002206 3300025933 Bacteria 18992
438 Ga0207686_10005349 3300025934 Bacteria 6885
439 Ga0207686_10033048 3300025934 Bacteria 3084
440 Ga0207709_10000539 3300025935 Bacteria 32486
441 Ga0207709_10009571 3300025935 Bacteria 5333
442 Ga0207670_10000217 3300025936 Bacteria 37598
443 Ga0207670_10448096 3300025936 Bacteria 1040
444 Ga0207670_10495582 3300025936 Bacteria 991
445 Ga0207669_10000147 3300025937 Bacteria 34031
446 Ga0207669_10001178 3300025937 Bacteria 11092
447 Ga0207704_10000299 3300025938 Bacteria 23415
448 Ga0207704_10364507 3300025938 Bacteria 1129
449 Ga0207665_10003176 3300025939 Bacteria 11002
450 Ga0207691_10003210 3300025940 Bacteria 15950
451 Ga0207691_10005305 3300025940 Bacteria 12439
452 Ga0207691_10043403 3300025940 Bacteria 4144
453 Ga0207691_10446209 3300025940 Bacteria 1101
454 Ga0207711_10089361 3300025941 Bacteria 2706
455 Ga0207689_10001029 3300025942 Bacteria 26794
456 Ga0207689_10021476 3300025942 Bacteria 5427
457 Ga0207661_10000215 3300025944 Bacteria 37435
458 Ga0207679_10000026 3300025945 Bacteria 200073
459 Ga0207679_10031711 3300025945 Bacteria 3701
460 Ga0207679_10432510 3300025945 Bacteria 1164
461 Ga0207679_10848767 3300025945 Bacteria 834
462 Ga0207667_10014254 3300025949 Bacteria 9067
463 Ga0207667_10038113 3300025949 Bacteria 5135
464 Ga0207667_10107653 3300025949 Bacteria 2876
465 Ga0207667_10154285 3300025949 Bacteria 2363
466 Ga0207667_10247695 3300025949 Bacteria 1823
467 Ga0207651_10019973 3300025960 Bacteria 4030
468 Ga0207651_10109456 3300025960 Bacteria 2070
469 Ga0207712_10000686 3300025961 Bacteria 26195
470 Ga0207712_10053365 3300025961 Bacteria 2835
471 Ga0207668_10000242 3300025972 Bacteria 36700
472 Ga0207668_10113591 3300025972 Bacteria 2037
473 Ga0207640_10028205 3300025981 Bacteria 3430
474 Ga0207640_10146821 3300025981 Bacteria 1727
475 Ga0207658_10016307 3300025986 Bacteria 5109
476 Ga0207658_10116850 3300025986 Bacteria 2119
477 Ga0207677_10009440 3300026023 Bacteria 5492
478 Ga0207677_10491827 3300026023 Bacteria 1059
479 Ga0207703_10004423 3300026035 Bacteria 11548
480 Ga0207703_10022281 3300026035 Bacteria 4967
481 Ga0207639_10048244 3300026041 Bacteria 3222
482 Ga0207678_10001079 3300026067 Bacteria 24988
483 Ga0207708_10000805 3300026075 Bacteria 23614
484 Ga0207702_10002121 3300026078 Bacteria 19082
485 Ga0207702_10530690 3300026078 Bacteria 1150
486 Ga0207641_10005094 3300026088 Bacteria 11257
487 Ga0207641_10005860 3300026088 Bacteria 10427
488 Ga0207641_10105193 3300026088 Bacteria 2492
489 Ga0207648_10000731 3300026089 Bacteria 36792
490 Ga0207648_10011855 3300026089 Bacteria 8193
491 Ga0207676_10000361 3300026095 Bacteria 38795
492 Ga0207676_10005133 3300026095 Bacteria 9268
493 Ga0207676_10108625 3300026095 Bacteria 2316
494 Ga0207674_10002121 3300026116 Bacteria 25067
495 Ga0207674_10284200 3300026116 Bacteria 1603
496 Ga0207674_10404440 3300026116 Bacteria 1319
497 Ga0207675_100001489 3300026118 Bacteria 23488
498 Ga0207675_100040045 3300026118 Bacteria 4373
499 Ga0207675_100044593 3300026118 Bacteria 4144
500 Ga0207675_101505407 3300026118 Bacteria 694
501 Ga0207683_10000034 3300026121 Bacteria 101817
502 Ga0207683_10002523 3300026121 Bacteria 15985
503 Ga0207683_10006107 3300026121 Bacteria 10314
504 Ga0207698_10000304 3300026142 Bacteria 29523
505 Ga0207698_10509200 3300026142 Bacteria 1173
506 Ga0207698_10651508 3300026142 Bacteria 1043
507 Ga0207698_10747296 3300026142 Bacteria 977
508 Ga0209973_1001787 3300027252 Bacteria 1923
509 Ga0210000_1005697 3300027462 Bacteria 1810
510 Ga0209982_1004183 3300027552 Bacteria 2064
511 Ga0210002_1006803 3300027617 Bacteria 1728
512 Ga0209971_1025372 3300027682 Bacteria 1416
513 Ga0209966_1005150 3300027695 Bacteria 2238
514 Ga0209998_10001282 3300027717 Bacteria 6148
515 Ga0209813_10006250 3300027866 Bacteria 2936
516 Ga0209974_10002355 3300027876 Bacteria 6849
517 Ga0207428_10000082 3300027907 Bacteria 133684
518 Ga0207428_10000352 3300027907 Bacteria 59444
519 Ga0207428_10040364 3300027907 Bacteria 3786
520 Ga0207428_10149387 3300027907 Bacteria 1779
521 Ga0207428_10262687 3300027907 Bacteria 1285
522 Ga0265356_1014922 3300028017 Bacteria 845
523 Ga0268266_10080780 3300028379 Bacteria 2833
524 Ga0268266_10208955 3300028379 Bacteria 1789
525 Ga0268266_10271437 3300028379 Bacteria 1574
526 Ga0268266_10760434 3300028379 Bacteria 935
527 Ga0268265_10001338 3300028380 Bacteria 21019
528 Ga0268265_10280376 3300028380 Bacteria 1491
529 Ga0268264_10026554 3300028381 Bacteria 4732
530 Ga0265334_10126530 3300028573 Bacteria 911
531 Ga0265338_10042722 3300028800 Bacteria 4216
532 Ga0265338_10046571 3300028800 Bacteria 3973
533 Ga0265330_10016019 3300031235 Bacteria 3464
534 Ga0265330_10064897 3300031235 Bacteria 1585
535 Ga0265330_10095205 3300031235 Bacteria 1276
536 Ga0265332_10009149 3300031238 Bacteria 4429
537 Ga0265328_10000024 3300031239 Bacteria 123047
538 Ga0265328_10000062 3300031239 Bacteria 61951
539 Ga0265328_10041847 3300031239 Bacteria 1687
540 Ga0265320_10049948 3300031240 Bacteria 2035
541 Ga0265325_10023519 3300031241 Bacteria 3362
542 Ga0265325_10047176 3300031241 Bacteria 2231
543 Ga0265329_10033535 3300031242 Bacteria 1660
544 Ga0265340_10002509 3300031247 Bacteria 10431
545 Ga0265340_10020501 3300031247 Bacteria 3397
546 Ga0265340_10023384 3300031247 Bacteria 3152
547 Ga0265340_10145467 3300031247 Bacteria 1082
548 Ga0265340_10253202 3300031247 Bacteria 785
549 Ga0265339_10027908 3300031249 Bacteria 3214
550 Ga0265339_10040655 3300031249 Bacteria 2583
551 Ga0265331_10009560 3300031250 Bacteria 5436
552 Ga0265331_10012103 3300031250 Bacteria 4691
553 Ga0265331_10038674 3300031250 Bacteria 2330
554 Ga0265331_10069285 3300031250 Bacteria 1652
555 Ga0265327_10009583 3300031251 Bacteria 6960
556 Ga0265327_10010514 3300031251 Bacteria 6497
557 Ga0265316_10000169 3300031344 Bacteria 73902
558 Ga0265313_10006684 3300031595 Bacteria 8083
559 Ga0265313_10054003 3300031595 Bacteria 1910
560 Ga0316579_10148529 3300031691 Bacteria 1130
561 Ga0265314_10001306 3300031711 Bacteria 28247
562 Ga0265314_10020005 3300031711 Bacteria 5175
563 Ga0265314_10144199 3300031711 Bacteria 1469
564 Ga0265342_10000789 3300031712 Bacteria 31942
565 Ga0265342_10000841 3300031712 Bacteria 30728
566 Ga0265342_10007421 3300031712 Bacteria 8028
567 Ga0265342_10065814 3300031712 Bacteria 2123
568 Ga0316577_10207003 3300031733 Bacteria 1109
569 Ga0307416_100395465 3300032002 Bacteria 1418
570 Ga0307416_100647949 3300032002 Bacteria 1141
571 Ga0373930_0035332 3300034816 Bacteria 1045
572 Ga0373948_0001393 3300034817 Bacteria 3335
573 Ga0373950_0001040 3300034818 Bacteria 3537
574 Ga0373950_0005130 3300034818 Bacteria 1945
575 Ga0373958_0026831 3300034819 Bacteria 1105
576 Ga0373959_0007712 3300034820 Bacteria 1814
577 Ga0373938_0019233 3300034957 Bacteria 1364
578 Ga0373928_0001679 3300035084 Bacteria 4293
579 Ga0373928_0035349 3300035084 Bacteria 1125
580 Ga0373929_0011394 3300035085 Bacteria 1675
581 Ga0373929_0018020 3300035085 Bacteria 1399
582 Ga0373934_0013386 3300035086 Bacteria 3103
583 Ga0373934_0067024 3300035086 Bacteria 1434
584 Ga0373944_0134051 3300035089 Bacteria 863
585 Ga0373949_0001470 3300035090 Bacteria 6725
586 Ga0373949_0019248 3300035090 Bacteria 1554
587 Ga0373951_0000695 3300035091 Bacteria 9241
588 Ga0373951_0022194 3300035091 Bacteria 1460
589 Ga0373952_0008157 3300035092 Bacteria 1981
590 Ga0373923_0049783 3300035111 Bacteria 1753
591 Ga0373932_0001842 3300035112 Bacteria 5676
592 Ga0373932_0011205 3300035112 Bacteria 2186
593 Ga0373936_0239826 3300035113 Bacteria 808
594 Ga0373939_0001533 3300035114 Bacteria 5602
595 Ga0373941_0003981 3300035115 Bacteria 3384
596 Ga0373941_0067529 3300035115 Bacteria 1179
597 Ga0373953_0035046 3300035117 Bacteria 1970
598 Ga0373953_0162433 3300035117 Bacteria 960
599 Ga0373954_0014658 3300035118 Bacteria 3497
600 Ga0373954_0025923 3300035118 Bacteria 2684
601 Ga0373956_0004403 3300035119 Bacteria 5639
602 Ga0373956_0190037 3300035119 Bacteria 972
603 Ga0373957_0003558 3300035120 Bacteria 4625
604 Ga0373957_0052232 3300035120 Bacteria 1565
605 Ga0373960_0001162 3300035121 Bacteria 5727
606 Ga0373960_0016249 3300035121 Bacteria 1912
607 Ga0373943_0000992 3300035170 Bacteria 12608
608 Ga0373943_0005818 3300035170 Bacteria 5538
609 Ga0373943_0035214 3300035170 Bacteria 2391
610 Ga0373946_0019049 3300035171 Bacteria 2640
611 Ga0373946_0053849 3300035171 Bacteria 1691
612 Ga0373946_0194070 3300035171 Bacteria 969
613 Ga0373955_0003642 3300035172 Bacteria 6781
614 Ga0373955_0029028 3300035172 Bacteria 2873
615 Ga0373942_0001447 3300035207 Bacteria 6091
616 Ga0373942_0008953 3300035207 Bacteria 2339
617 Ga0373962_0000468 3300035242 Bacteria 8934
618 Ga0373962_0000929 3300035242 Bacteria 6738
619 Ga0373962_0101869 3300035242 Bacteria 896
620 Ga0373924_0013369 3300035410 Bacteria 3084
621 Ga0373924_0015278 3300035410 Bacteria 2917
622 Ga0373931_0000179 3300035691 Bacteria 27558
623 Ga0373931_0003177 3300035691 Bacteria 7329
624 Ga0373935_0068330 3300035692 Bacteria 2287
625 Ga0373935_0069926 3300035692 Bacteria 2262
626 Ga0373935_0090757 3300035692 Bacteria 2000
627 Ga0373927_0003126 3300035695 Bacteria 11969
628 Ga0373927_0078966 3300035695 Bacteria 2131
629 Ga0373927_0082182 3300035695 Bacteria 2088
630 Ga0373927_0099715 3300035695 Bacteria 1889
631 Ga0373927_0584424 3300035695 Bacteria 738
632 Ga0373933_0002265 3300035724 Bacteria 10966
633 Ga0373947_0006073 3300035725 Bacteria 7039
634 Ga0373947_0008855 3300035725 Bacteria 5790
635 Ga0373947_0027605 3300035725 Bacteria 3323
636 Ga0373937_0004474 3300036401 Bacteria 11870
637 Ga0373937_0038449 3300036401 Bacteria 4359
638 Ga0373937_0114369 3300036401 Bacteria 2512
639 Ga0373937_0339201 3300036401 Bacteria 1423
640 Ga0316582_0440567 3300036647 Bacteria 898
641 Ga0373925_0006666 3300037068 Bacteria 8472
642 Ga0373925_0017728 3300037068 Bacteria 5166
643 Ga0373925_0021696 3300037068 Bacteria 4680
644 Ga0373925_0054684 3300037068 Bacteria 2986
645 Ga0373925_0200398 3300037068 Bacteria 1587
646 Ga0373925_0223914 3300037068 Bacteria 1502
647 Ga0395898_0086749 3300037466 Bacteria 3016
648 Ga0436364_1035021 3300037853 Bacteria 1409
649 Ga0436365_0318099 3300039437 Bacteria 866
650 Ga0436365_0366367 3300039437 Bacteria 1653
651 Ga0436365_0856773 3300039437 Bacteria 2495
652 Ga0436365_1578283 3300039437 Bacteria 1046
653 Ga0436365_1854878 3300039437 Bacteria 6880
654 Ga0436360_0504011 3300039438 Bacteria 1016
655 Ga0436360_0549825 3300039438 Bacteria 2067
656 Ga0436360_0752551 3300039438 Bacteria 3704
657 Ga0436360_1359514 3300039438 Bacteria 661
658 Ga0436363_0754692 3300039450 Bacteria 683
659 Ga0436363_1377017 3300039450 Bacteria 777
660 Ga0436362_0747841 3300039453 Bacteria 850
661 Ga0439456_037983 3300042013 Bacteria 1040
662 Ga0439434_0058307 3300042435 Bacteria 1205
663 Ga0466963_0167248 3300044694 Bacteria 1532
664 Ga0453684_0000077 3300044712 Bacteria 435536
665 Ga0453684_0335090 3300044712 Bacteria 1710
666 Ga0466968_0002228 3300044735 Bacteria 7086
667 Ga0466968_0419262 3300044735 Bacteria 658
668 Ga0466970_0461550 3300044765 Bacteria 729
669 Ga0466960_0480143 3300044901 Bacteria 726
670 Ga0466959_0108232 3300045049 Bacteria 1986
671 Ga0466959_0343411 3300045049 Bacteria 1018
672 Ga0451576_0009171 3300045051 Bacteria 11498
673 Ga0495603_0175656 3300046455 Bacteria 1240
674 Ga0495603_0222782 3300046455 Bacteria 1088
675 Ga0495629_0000062 3300046459 Bacteria 97169
676 Ga0495629_0004556 3300046459 Bacteria 10367
677 Ga0495629_0158289 3300046459 Bacteria 1573
678 Ga0495638_0026888 3300046460 Bacteria 3727
679 Ga0495641_0020006 3300046461 Bacteria 3408
680 Ga0495641_0294315 3300046461 Bacteria 731
681 Ga0495651_0008073 3300046462 Bacteria 8071
682 Ga0495651_0021886 3300046462 Bacteria 4971
683 Ga0495651_0076768 3300046462 Bacteria 2530
684 Ga0495653_0015013 3300046463 Bacteria 6317
685 Ga0495653_0028022 3300046463 Bacteria 4508
686 Ga0495580_0124303 3300046472 Bacteria 1790
687 Ga0495580_0133832 3300046472 Bacteria 1719
688 Ga0495580_0339946 3300046472 Bacteria 1018
689 Ga0495582_0031031 3300046473 Bacteria 2937
690 Ga0495582_0373796 3300046473 Bacteria 821
691 Ga0495605_0020124 3300046474 Bacteria 3550
692 Ga0495639_0034490 3300046475 Bacteria 2264
693 Ga0495662_0001185 3300046476 Bacteria 12876
694 Ga0495664_0000434 3300046477 Bacteria 20493
695 Ga0495664_0052190 3300046477 Bacteria 2429
696 Ga0495594_0047133 3300046499 Bacteria 2367
697 Ga0495608_0022048 3300046511 Bacteria 4366
698 Ga0495608_0056862 3300046511 Bacteria 2582
699 Ga0495608_0073810 3300046511 Bacteria 2224
700 Ga0495618_0010670 3300046514 Bacteria 5561
701 Ga0495618_0042884 3300046514 Bacteria 2853
702 Ga0495620_0154997 3300046515 Bacteria 892
703 Ga0495630_0042726 3300046517 Bacteria 3385
704 Ga0495630_0047207 3300046517 Bacteria 3221
705 Ga0495630_0052177 3300046517 Bacteria 3061
706 Ga0495630_0057159 3300046517 Bacteria 2924
707 Ga0495630_0175583 3300046517 Bacteria 1633
708 Ga0495632_0094049 3300046519 Bacteria 1418
709 Ga0495637_0093124 3300046520 Bacteria 1186
710 Ga0495652_0006237 3300046529 Bacteria 11118
711 Ga0495652_0033805 3300046529 Bacteria 4460
712 Ga0495652_0051239 3300046529 Bacteria 3526
713 Ga0495665_0036852 3300046531 Bacteria 2610
714 Ga0495640_0003511 3300046533 Bacteria 12605
715 Ga0495640_0126485 3300046533 Bacteria 1657
716 Ga0495586_0148965 3300046535 Bacteria 1316
717 Ga0495587_0010013 3300046536 Bacteria 6054
718 Ga0495587_0071841 3300046536 Bacteria 2012
719 Ga0495598_0014745 3300046537 Bacteria 1959
720 Ga0495621_0004111 3300046539 Bacteria 4055
721 Ga0495645_0000746 3300046543 Bacteria 22248
722 Ga0495645_0081076 3300046543 Bacteria 2328
723 Ga0495667_0006860 3300046559 Bacteria 7731
724 Ga0495656_0025755 3300046615 Bacteria 2335
725 Ga0495656_0054643 3300046615 Bacteria 1719
726 Ga0495634_0001083 3300046642 Bacteria 25343
727 Ga0495634_0002973 3300046642 Bacteria 13828
728 Ga0495635_0000191 3300046663 Bacteria 38736
729 Ga0495635_0009194 3300046663 Bacteria 6901
730 Ga0495635_0045789 3300046663 Bacteria 3018
731 Ga0495635_0285093 3300046663 Bacteria 1109
732 Ga0495657_0013089 3300046675 Bacteria 6132
733 Ga0495657_0077155 3300046675 Bacteria 2162
734 Ga0495599_0019404 3300046678 Bacteria 4238
735 Ga0495623_0001696 3300046679 Bacteria 14806
736 Ga0495623_0373583 3300046679 Bacteria 772
737 Ga0495646_0017448 3300046680 Bacteria 4553
738 Ga0495647_0159565 3300046681 Bacteria 971
739 Ga0495647_0212297 3300046681 Bacteria 852
740 Ga0495658_0000109 3300046683 Bacteria 43760
741 Ga0495658_0066143 3300046683 Bacteria 2087
742 Ga0495658_0181247 3300046683 Bacteria 1307
743 Ga0495658_0579663 3300046683 Bacteria 718
744 Ga0495669_0138161 3300046684 Bacteria 1149
745 Ga0495613_0031653 3300046689 Bacteria 3930
746 Ga0495613_0078612 3300046689 Bacteria 2399
747 Ga0495613_0237319 3300046689 Bacteria 1276
748 Ga0495613_0456689 3300046689 Bacteria 865
749 Ga0495624_0044312 3300046690 Bacteria 2836
750 Ga0495600_0012096 3300046809 Bacteria 5390
751 Ga0495600_0030521 3300046809 Bacteria 3492
752 Ga0495581_0115200 3300047315 Bacteria 1563
753 Ga0495604_0002530 3300047317 Bacteria 14585
754 Ga0495604_0008733 3300047317 Bacteria 8009
755 Ga0495604_0054322 3300047317 Bacteria 3091
756 Ga0495674_0047398 3300047319 Bacteria 3811
757 Ga0495674_0085149 3300047319 Bacteria 2708
758 Ga0495672_0226140 3300047320 Bacteria 921
759 Ga0495676_0094272 3300047321 Bacteria 2230
760 Ga0495676_0179857 3300047321 Bacteria 1483
761 Ga0495680_0000483 3300047322 Bacteria 44818
762 Ga0495680_0252209 3300047322 Bacteria 1250
763 Ga0495680_0309715 3300047322 Bacteria 1107
764 Ga0495680_0404952 3300047322 Bacteria 941
765 Ga0495675_0035911 3300047444 Bacteria 3163
766 Ga0495677_0058129 3300047445 Bacteria 1430
767 Ga0495684_0001760 3300047471 Bacteria 17401
768 Ga0495684_0002479 3300047471 Bacteria 14711
769 Ga0495684_0027128 3300047471 Bacteria 4397
770 Ga0495684_0180563 3300047471 Bacteria 1564
771 Ga0495684_0515381 3300047471 Bacteria 820
772 Ga0495593_0001596 3300047673 Bacteria 13393
773 Ga0495593_0016387 3300047673 Bacteria 4181
774 Ga0495593_0050476 3300047673 Bacteria 2204
775 Ga0495602_0031093 3300048088 Bacteria 5052
776 Ga0495602_0037615 3300048088 Bacteria 4487
777 Ga0495602_0082549 3300048088 Bacteria 2697
778 Ga0496100_0001014 3300048903 Bacteria 13552
779 Ga0496100_0009625 3300048903 Bacteria 5434
780 Ga0496100_0175698 3300048903 Bacteria 1546
781 Ga0496100_0422212 3300048903 Bacteria 1019
782 Ga0496101_0001828 3300048904 Bacteria 12832
783 Ga0496101_0035261 3300048904 Bacteria 3537
784 Ga0496101_0141183 3300048904 Bacteria 1836
785 Ga0496102_0000988 3300048905 Bacteria 26727
786 Ga0496102_0055636 3300048905 Bacteria 3607
787 Ga0496102_0258809 3300048905 Bacteria 1641
788 Ga0496102_0420536 3300048905 Bacteria 1255
789 Ga0496102_0447139 3300048905 Bacteria 1212
790 Ga0496103_0000582 3300048906 Bacteria 28897
791 Ga0496103_0005721 3300048906 Bacteria 7428
792 Ga0496103_0035550 3300048906 Bacteria 3050
793 Ga0496104_0000067 3300048907 Bacteria 108556
794 Ga0496104_0000574 3300048907 Bacteria 31370
795 Ga0496104_0007277 3300048907 Bacteria 9768
796 Ga0496104_0013597 3300048907 Bacteria 7337
797 Ga0496104_0051947 3300048907 Bacteria 3870
798 Ga0496104_0300987 3300048907 Bacteria 1516
799 Ga0496104_0534538 3300048907 Bacteria 1083
800 Ga0496105_0001954 3300048908 Bacteria 14793
801 Ga0496105_0006546 3300048908 Bacteria 8963
802 Ga0496105_0028842 3300048908 Bacteria 4540
803 Ga0496105_0077653 3300048908 Bacteria 2742
804 Ga0496105_0092496 3300048908 Bacteria 2497
805 Ga0496105_0111126 3300048908 Bacteria 2262
806 Ga0496105_0189545 3300048908 Bacteria 1682
807 Ga0496105_0658204 3300048908 Bacteria 807
808 Ga0496106_0002154 3300048909 Bacteria 14716
809 Ga0496106_0011737 3300048909 Bacteria 6468
810 Ga0496106_0023714 3300048909 Bacteria 4559
811 Ga0496107_0006560 3300048910 Bacteria 8007
812 Ga0496107_0007065 3300048910 Bacteria 7734
813 Ga0496107_0012178 3300048910 Bacteria 6000
814 Ga0496107_0041111 3300048910 Bacteria 3320
815 Ga0496107_0516656 3300048910 Bacteria 885
816 Ga0496107_0746934 3300048910 Bacteria 718
817 Ga0496108_0002765 3300048911 Bacteria 14044
818 Ga0496108_0006074 3300048911 Bacteria 9765
819 Ga0496108_0025713 3300048911 Bacteria 4853
820 Ga0496108_0332063 3300048911 Bacteria 1326
821 Ga0496109_0013377 3300048912 Bacteria 7115
822 Ga0496109_0032046 3300048912 Bacteria 4721
823 Ga0496109_0038333 3300048912 Bacteria 4332
824 Ga0496109_0086166 3300048912 Bacteria 2900
825 Ga0496109_0299035 3300048912 Bacteria 1517
826 Ga0496109_0610264 3300048912 Bacteria 1027
827 Ga0496109_1193246 3300048912 Bacteria 698
828 Ga0496110_0011410 3300048913 Bacteria 7271
829 Ga0496110_0026612 3300048913 Bacteria 4952
830 Ga0496110_0037606 3300048913 Bacteria 4207
831 Ga0496110_0091061 3300048913 Bacteria 2728
832 Ga0496110_0219196 3300048913 Bacteria 1730
833 Ga0496110_1159920 3300048913 Bacteria 681
834 Ga0496111_0004190 3300048914 Bacteria 9074
835 Ga0496111_0006677 3300048914 Bacteria 7505
836 Ga0496111_0041909 3300048914 Bacteria 3286
837 Ga0496111_0230408 3300048914 Bacteria 1376
838 Ga0496111_0772410 3300048914 Bacteria 696
839 Ga0496112_0006568 3300048915 Bacteria 10234
840 Ga0496112_0017351 3300048915 Bacteria 6762
841 Ga0496112_0028719 3300048915 Bacteria 5372
842 Ga0496112_0080898 3300048915 Bacteria 3212
843 Ga0496112_0236978 3300048915 Bacteria 1778
844 Ga0496112_0301665 3300048915 Bacteria 1547
845 Ga0496112_0340012 3300048915 Bacteria 1444
846 Ga0496113_0001805 3300048916 Bacteria 12150
847 Ga0496113_0465766 3300048916 Bacteria 1015
848 Ga0496114_0010065 3300048917 Bacteria 7519
849 Ga0496114_0067703 3300048917 Bacteria 2996
850 Ga0496114_0116425 3300048917 Bacteria 2294
851 Ga0496114_0119182 3300048917 Bacteria 2268
852 Ga0496114_0149386 3300048917 Bacteria 2027
853 Ga0496114_0598803 3300048917 Bacteria 972
854 Ga0496115_0001071 3300048918 Bacteria 19818
855 Ga0496115_0024471 3300048918 Bacteria 4694
856 Ga0496115_0102231 3300048918 Bacteria 2350
857 Ga0496115_0175960 3300048918 Bacteria 1769
858 Ga0496115_0190245 3300048918 Bacteria 1695
859 Ga0496115_0217606 3300048918 Bacteria 1576
860 Ga0496119_0001667 3300048922 Bacteria 25946
861 Ga0496121_0528065 3300048924 Bacteria 743
862 Ga0496124_0349404 3300048927 Bacteria 1047
863 Ga0496125_0276116 3300048928 Bacteria 1044
864 Ga0496126_0119510 3300048929 Bacteria 2287
865 Ga0496126_0189030 3300048929 Bacteria 1745
866 Ga0496126_0534261 3300048929 Bacteria 933
867 Ga0501031_0002368 3300049568 Bacteria 11954
868 Ga0501031_0028797 3300049568 Bacteria 3620
869 Ga0501031_0476964 3300049568 Bacteria 805
870 Ga0501032_0000001 3300049569 Bacteria 422097
871 Ga0501032_0005172 3300049569 Bacteria 9722
872 Ga0501032_0034615 3300049569 Bacteria 3456
873 Ga0501033_0000077 3300049570 Bacteria 92696
874 Ga0501033_0026780 3300049570 Bacteria 4338
875 Ga0501033_0039024 3300049570 Bacteria 3547
876 Ga0501033_0051447 3300049570 Bacteria 3053
877 Ga0501033_0119303 3300049570 Bacteria 1915
878 Ga0501033_0322595 3300049570 Bacteria 1085
879 Ga0501034_0000023 3300049571 Bacteria 263892
880 Ga0501034_0013529 3300049571 Bacteria 8398
881 Ga0501034_0038088 3300049571 Bacteria 4871
882 Ga0501034_0091995 3300049571 Bacteria 3031
883 Ga0501034_0094333 3300049571 Bacteria 2989
884 Ga0501034_0409332 3300049571 Bacteria 1278
885 Ga0501036_0000482 3300049572 Bacteria 28438
886 Ga0501036_0006028 3300049572 Bacteria 9827
887 Ga0501036_0062317 3300049572 Bacteria 3159
888 Ga0501036_0106875 3300049572 Bacteria 2366
889 Ga0501037_0000065 3300049573 Bacteria 96747
890 Ga0501037_0017847 3300049573 Bacteria 5224
891 Ga0501037_0277777 3300049573 Bacteria 1167
892 Ga0501038_0000043 3300049574 Bacteria 113010
893 Ga0501038_0014243 3300049574 Bacteria 7245
894 Ga0501038_0129304 3300049574 Bacteria 2075
895 Ga0501038_0348225 3300049574 Bacteria 1154
896 Ga0501038_0380147 3300049574 Bacteria 1096
897 Ga0501039_0000022 3300049575 Bacteria 160858
898 Ga0501039_0005361 3300049575 Bacteria 9703
899 Ga0501039_0056652 3300049575 Bacteria 3036
900 Ga0501039_0080733 3300049575 Bacteria 2531
901 Ga0501041_0062492 3300049577 Bacteria 2280
902 Ga0501041_0139385 3300049577 Bacteria 1512
903 Ga0501042_0023231 3300049578 Bacteria 4337
904 Ga0501042_0110756 3300049578 Bacteria 1977
905 Ga0501042_0164433 3300049578 Bacteria 1601
906 Ga0501043_0000310 3300049579 Bacteria 44324
907 Ga0501043_0027092 3300049579 Bacteria 4498
908 Ga0501043_0175769 3300049579 Bacteria 1669
909 Ga0501043_0253948 3300049579 Bacteria 1354
910 Ga0501043_0563906 3300049579 Bacteria 845
911 Ga0501046_0003995 3300049580 Bacteria 13466
912 Ga0501047_0047790 3300049581 Bacteria 4133
913 Ga0501047_0116322 3300049581 Bacteria 2556
914 Ga0501047_0158048 3300049581 Bacteria 2139
915 Ga0501047_0633832 3300049581 Bacteria 889
916 Ga0501048_0024560 3300049582 Bacteria 4398
917 Ga0501048_0101228 3300049582 Bacteria 2033
918 Ga0501067_0003221 3300049583 Bacteria 8990
919 Ga0501067_0039548 3300049583 Bacteria 2619
920 Ga0501067_0185870 3300049583 Bacteria 1157
921 Ga0501067_0230132 3300049583 Bacteria 1032
922 Ga0501067_0288483 3300049583 Bacteria 914
923 Ga0501068_0177511 3300049584 Bacteria 1346
924 Ga0501069_0004930 3300049585 Bacteria 6922
925 Ga0501069_0011625 3300049585 Bacteria 4667
926 Ga0501069_0197148 3300049585 Bacteria 1166
927 Ga0501069_0342264 3300049585 Bacteria 881
928 Ga0501070_0009447 3300049586 Bacteria 8242
929 Ga0501070_0016831 3300049586 Bacteria 6137
930 Ga0501070_0055665 3300049586 Bacteria 3278
931 Ga0501070_0086797 3300049586 Bacteria 2590
932 Ga0501070_0516702 3300049586 Bacteria 958
933 Ga0501071_0216513 3300049587 Bacteria 1441
934 Ga0501072_0216317 3300049588 Bacteria 1527
935 Ga0501072_0318627 3300049588 Bacteria 1236
936 Ga0501072_0437972 3300049588 Bacteria 1035
937 Ga0501073_0042012 3300049589 Bacteria 3228
938 Ga0501073_0163199 3300049589 Bacteria 1543
939 Ga0501074_0005559 3300049590 Bacteria 9066
940 Ga0501074_0097865 3300049590 Bacteria 2100
941 Ga0501074_0166052 3300049590 Bacteria 1576
942 Ga0501074_0173054 3300049590 Bacteria 1541
943 Ga0501074_0685133 3300049590 Bacteria 724
944 Ga0501076_0016642 3300049592 Bacteria 5575
945 Ga0501076_0059310 3300049592 Bacteria 3044
946 Ga0501077_0009848 3300049593 Bacteria 5945
947 Ga0501079_0016096 3300049741 Bacteria 5715
948 Ga0501079_0534606 3300049741 Bacteria 922
949 Ga0501079_0604464 3300049741 Bacteria 863
950 Ga0501080_0034590 3300049742 Bacteria 4718
951 Ga0501080_0076615 3300049742 Bacteria 3110
952 Ga0501080_0083148 3300049742 Bacteria 2974
953 Ga0501080_0319668 3300049742 Bacteria 1405
954 Ga0501083_0010614 3300049744 Bacteria 6483
955 Ga0501083_0015328 3300049744 Bacteria 5369
956 Ga0501035_0000234 3300049822 Bacteria 66162
957 Ga0501035_0015144 3300049822 Bacteria 7117
958 Ga0501035_0015488 3300049822 Bacteria 7034
959 Ga0501035_0018523 3300049822 Bacteria 6414
960 Ga0501035_0199389 3300049822 Bacteria 1717
961 Ga0501044_0000815 3300049823 Bacteria 37466
962 Ga0501044_0003116 3300049823 Bacteria 18793
963 Ga0501044_0021531 3300049823 Bacteria 6876
964 Ga0501044_0053557 3300049823 Bacteria 4150
965 Ga0501044_0076558 3300049823 Bacteria 3395
966 Ga0501044_0125510 3300049823 Bacteria 2564
967 Ga0501044_0823649 3300049823 Bacteria 806
968 Ga0501044_1000079 3300049823 Bacteria 708
969 Ga0501045_0033963 3300049824 Bacteria 3701
970 Ga0501045_0198303 3300049824 Bacteria 1495
971 nmdc:mga03683_39701_c1 3300050489 Bacteria 1928
972 nmdc:mga03n38_155827_c1 3300050490 Bacteria 1153
973 nmdc:mga03n38_220390_c1 3300050490 Bacteria 990
974 nmdc:mga03n38_63002_c1 3300050490 Bacteria 1693
975 nmdc:mga00v17_229690_c1 3300050491 Bacteria 1202
976 nmdc:mga00v17_38016_c1 3300050491 Bacteria 2876
977 nmdc:mga0yw44_171159_c1 3300050492 Bacteria 1426
978 nmdc:mga0yw44_319235_c1 3300050492 Bacteria 1043
979 nmdc:mga0yw44_330995_c1 3300050492 Bacteria 1024
980 nmdc:mga0yw44_48825_c1 3300050492 Bacteria 2553
981 nmdc:mga0k408_121548_c1 3300050493 Bacteria 1547
982 nmdc:mga0k408_185164_c1 3300050493 Bacteria 1242
983 nmdc:mga0k408_19359_c1 3300050493 Bacteria 3803
984 nmdc:mga06z11_236203_c1 3300050494 Bacteria 1072
985 nmdc:mga06z11_418312_c1 3300050494 Bacteria 808
986 nmdc:mga06z11_8923_c1 3300050494 Bacteria 4205
987 nmdc:mga04h51_7124_c1 3300050495 Bacteria 2936
988 nmdc:mga04h51_93603_c1 3300050495 Bacteria 1085
989 nmdc:mga07m45_317639_c1 3300050496 Bacteria 905
990 nmdc:mga05p37_19_c2 3300050507 Bacteria 99994
991 nmdc:mga05p37_216354_c1 3300050507 Bacteria 2314
992 nmdc:mga09592_2070_c1 3300050508 Bacteria 16178
993 nmdc:mga09592_238_c1 3300050508 Bacteria 40013
994 nmdc:mga09592_96720_c1 3300050508 Bacteria 2526
995 nmdc:mga0qj67_259_c1 3300050509 Bacteria 36242
996 nmdc:mga06r32_2023_c1 3300050510 Bacteria 18128
997 nmdc:mga06r32_349_c1 3300050510 Bacteria 38472
998 nmdc:mga06r32_501245_c1 3300050510 Bacteria 1191
999 nmdc:mga08y16_123581_c1 3300050511 Bacteria 2693
1000 nmdc:mga08y16_222039_c1 3300050511 Bacteria 1956
1001 nmdc:mga08y16_245149_c1 3300050511 Bacteria 1852
1002 nmdc:mga08y16_2735_c1 3300050511 Bacteria 18090
1003 nmdc:mga08y16_325_c1 3300050511 Bacteria 43258
1004 nmdc:mga08y16_444751_c1 3300050511 Bacteria 1322
1005 nmdc:mga0n895_120909_c1 3300050512 Bacteria 2640
1006 nmdc:mga0n895_1215831_c1 3300050512 Bacteria 727
1007 nmdc:mga0n895_281192_c1 3300050512 Bacteria 1687
1008 nmdc:mga0n895_394_c1 3300050512 Bacteria 29311
1009 nmdc:mga0n895_45970_c1 3300050512 Bacteria 4263
1010 nmdc:mga0n895_506674_c1 3300050512 Bacteria 1216
1011 nmdc:mga0n895_563681_c1 3300050512 Bacteria 1144
1012 nmdc:mga0n895_9070_c1 3300050512 Bacteria 8677
1013 nmdc:mga0rr50_13004_c1 3300050513 Bacteria 5402
1014 nmdc:mga0rr50_522077_c1 3300050513 Bacteria 1010
1015 nmdc:mga0rr50_748596_c1 3300050513 Bacteria 834
1016 nmdc:mga0rr50_785_c1 3300050513 Bacteria 17098
1017 nmdc:mga08x19_120826_c1 3300050514 Bacteria 1756
1018 nmdc:mga08x19_207318_c1 3300050514 Bacteria 1345
1019 nmdc:mga08x19_52251_c1 3300050514 Bacteria 2628
1020 nmdc:mga0a205_10038_c1 3300050515 Bacteria 8688
1021 nmdc:mga0a205_14874_c1 3300050515 Bacteria 4705
1022 nmdc:mga0a205_249_c1 3300050515 Bacteria 38472
1023 nmdc:mga0a205_337310_c1 3300050515 Bacteria 1376
1024 Ga0495601_0000338 3300053077 Bacteria 24609
1025 Ga0495601_0001346 3300053077 Bacteria 13508
1026 Ga0495601_0022223 3300053077 Bacteria 3892
1027 Ga0495612_0000152 3300053078 Bacteria 29021
1028 Ga0495612_0058120 3300053078 Bacteria 1598
1029 Ga0495655_0009189 3300053083 Bacteria 1907
1030 Ga0495595_0022830 3300053084 Bacteria 2749
1031 Ga0495595_0066508 3300053084 Bacteria 1697
1032 Ga0495619_0000078 3300053085 Bacteria 72749
1033 Ga0495619_0001083 3300053085 Bacteria 17884
1034 Ga0495619_0018347 3300053085 Bacteria 4439
1035 Ga0495619_0117573 3300053085 Bacteria 1821
1036 Ga0495619_0257819 3300053085 Bacteria 1208
1037 Ga0500646_0007709 3300053090 Bacteria 2750
1038 Ga0500556_0102072 3300053104 Bacteria 1106
1039 Ga0500595_012962 3300053119 Bacteria 3205
1040 Ga0500642_0091120 3300053130 Bacteria 1409
1041 Ga0500652_000169 3300053131 Bacteria 25198
1042 Ga0500616_0006713 3300053153 Bacteria 7470
1043 Ga0500627_0030433 3300053158 Bacteria 2260
1044 Ga0500636_0006847 3300053177 Bacteria 6568
1045 Ga0501084_0014744 3300054114 Bacteria 6483
1046 Ga0501084_0074320 3300054114 Bacteria 2846
1047 Ga0501084_0103789 3300054114 Bacteria 2388
1048 Ga0501084_0400245 3300054114 Bacteria 1160
1049 Ga0501082_0005652 3300060353 Bacteria 10849
1050 Ga0501082_0169098 3300060353 Bacteria 1900
1051 Ga0501082_0176866 3300060353 Bacteria 1856
1052 Ga0530510_0002354 3300061734 Bacteria 12973

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009011 Ga0105251_10100037 Ga0105251_101000372 189
2 3300044735 Ga0466968_0419262 Ga0466968_0419262_62_640 192
3 3300005354 Ga0070675_100521045 Ga0070675_1005210451 196
4 iso_pu_bacteria 2545555834 2545677572 196
5 iso_pu_bacteria 2595698237 2596376607 196
6 iso_pu_bacteria 2738541281 2738743475 196
7 iso_pu_bacteria 2738543032 2739352382 196
8 iso_pu_bacteria 2829745981 2829746065 196
9 iso_pu_bacteria 2861691609 2861695880 196
10 iso_pu_bacteria 2889306138 2889306857 196
11 iso_pu_bacteria 2902330777 2902334408 196
12 iso_pu_bacteria 2902405164 2902411546 196
13 iso_pu_bacteria 2928125067 2928128666 196
14 iso_pu_bacteria 641522639 641640383 196
15 iso_pu_bacteria 643348564 643597820 196
16 3300037466 Ga0395898_0086749 Ga0395898_0086749_139_741 200
17 3300037853 Ga0436364_1035021 Ga0436364_1035021_147_749 200
18 3300039450 Ga0436363_0754692 Ga0436363_0754692_29_631 200
19 3300044735 Ga0466968_0002228 Ga0466968_0002228_551_1153 200
20 3300044765 Ga0466970_0461550 Ga0466970_0461550_98_700 200
21 3300044901 Ga0466960_0480143 Ga0466960_0480143_13_615 200
22 3300001430 JGI24032J14994_100170 JGI24032J14994_1001705 201
23 3300001904 JGI24736J21556_1013782 JGI24736J21556_10137823 201
24 3300001976 JGI24752J21851_1001950 JGI24752J21851_10019506 201
25 3300001977 JGI24746J21847_1000605 JGI24746J21847_10006053 201
26 3300001978 JGI24747J21853_1001825 JGI24747J21853_10018251 201
27 3300001979 JGI24740J21852_10020453 JGI24740J21852_100204532 201
28 3300001989 JGI24739J22299_10000119 JGI24739J22299_1000011916 201
29 3300001990 JGI24737J22298_10000258 JGI24737J22298_1000025814 201
30 3300002070 JGI24750J21931_1000164 JGI24750J21931_10001644 201
31 3300002073 JGI24745J21846_1000103 JGI24745J21846_10001036 201
32 3300002075 JGI24738J21930_10005193 JGI24738J21930_100051932 201
33 3300002076 JGI24749J21850_1000093 JGI24749J21850_10000934 201
34 3300002076 JGI24749J21850_1019507 JGI24749J21850_10195072 201
35 3300002077 JGI24744J21845_10001608 JGI24744J21845_100016085 201
36 3300002126 JGI24035J26624_1000048 JGI24035J26624_10000487 201
37 3300002155 JGI24033J26618_1001488 JGI24033J26618_10014882 201
38 3300002239 JGI24034J26672_10000515 JGI24034J26672_100005154 201
39 3300002239 JGI24034J26672_10001644 JGI24034J26672_100016443 201
40 3300002244 JGI24742J22300_10000595 JGI24742J22300_100005954 201
41 3300002459 JGI24751J29686_10018194 JGI24751J29686_100181942 201
42 3300003215 JGI25153J46596_10001652 JGI25153J46596_100016529 201
43 3300003349 JGI26129J50193_1002722 JGI26129J50193_10027222 201
44 3300003659 JGI25404J52841_10005604 JGI25404J52841_100056045 201
45 3300005288 Ga0065714_10135970 Ga0065714_101359702 201
46 3300005293 Ga0065715_10088946 Ga0065715_1008894623 201
47 3300005295 Ga0065707_10104807 Ga0065707_101048073 201
48 3300005295 Ga0065707_10280081 Ga0065707_102800812 201
49 3300005327 Ga0070658_10009370 Ga0070658_1000937011 201
50 3300005327 Ga0070658_10188403 Ga0070658_101884032 201
51 3300005328 Ga0070676_10000514 Ga0070676_1000051422 201
52 3300005329 Ga0070683_100005318 Ga0070683_1000053188 201
53 3300005329 Ga0070683_100025217 Ga0070683_1000252172 201
54 3300005330 Ga0070690_100008454 Ga0070690_1000084548 201
55 3300005330 Ga0070690_100054680 Ga0070690_1000546803 201
56 3300005331 Ga0070670_100002160 Ga0070670_1000021604 201
57 3300005331 Ga0070670_100123675 Ga0070670_1001236752 201
58 3300005331 Ga0070670_100200801 Ga0070670_1002008013 201
59 3300005333 Ga0070677_10000023 Ga0070677_1000002338 201
60 3300005333 Ga0070677_10031092 Ga0070677_100310922 201
61 3300005334 Ga0068869_100000153 Ga0068869_10000015333 201
62 3300005334 Ga0068869_100009816 Ga0068869_1000098167 201
63 3300005335 Ga0070666_10003393 Ga0070666_100033938 201
64 3300005335 Ga0070666_10397399 Ga0070666_103973992 201
65 3300005336 Ga0070680_100000814 Ga0070680_10000081419 201
66 3300005336 Ga0070680_100018221 Ga0070680_1000182214 201
67 3300005337 Ga0070682_100000445 Ga0070682_10000044512 201
68 3300005338 Ga0068868_100014021 Ga0068868_1000140215 201
69 3300005338 Ga0068868_100109589 Ga0068868_1001095892 201
70 3300005338 Ga0068868_100798126 Ga0068868_1007981261 201
71 3300005339 Ga0070660_100001480 Ga0070660_10000148017 201
72 3300005339 Ga0070660_100130906 Ga0070660_1001309062 201
73 3300005339 Ga0070660_100610006 Ga0070660_1006100061 201
74 3300005340 Ga0070689_100000880 Ga0070689_10000088018 201
75 3300005340 Ga0070689_100014559 Ga0070689_1000145596 201
76 3300005340 Ga0070689_100206405 Ga0070689_1002064052 201
77 3300005341 Ga0070691_10000320 Ga0070691_1000032012 201
78 3300005343 Ga0070687_100000187 Ga0070687_10000018718 201
79 3300005343 Ga0070687_100152213 Ga0070687_1001522132 201
80 3300005343 Ga0070687_100267744 Ga0070687_1002677442 201
81 3300005343 Ga0070687_100347057 Ga0070687_1003470572 201
82 3300005344 Ga0070661_100001011 Ga0070661_10000101114 201
83 3300005344 Ga0070661_100096242 Ga0070661_1000962422 201
84 3300005347 Ga0070668_100002838 Ga0070668_10000283812 201
85 3300005353 Ga0070669_100000501 Ga0070669_10000050133 201
86 3300005353 Ga0070669_100043033 Ga0070669_1000430332 201
87 3300005353 Ga0070669_100147344 Ga0070669_1001473441 201
88 3300005354 Ga0070675_100001136 Ga0070675_10000113612 201
89 3300005354 Ga0070675_100080693 Ga0070675_1000806932 201
90 3300005355 Ga0070671_100000595 Ga0070671_10000059530 201
91 3300005355 Ga0070671_100007251 Ga0070671_1000072518 201
92 3300005356 Ga0070674_100000249 Ga0070674_10000024931 201
93 3300005356 Ga0070674_100001190 Ga0070674_10000119010 201
94 3300005356 Ga0070674_100094735 Ga0070674_1000947354 201
95 3300005364 Ga0070673_100000233 Ga0070673_1000002331 201
96 3300005364 Ga0070673_100002039 Ga0070673_10000203915 201
97 3300005364 Ga0070673_100160851 Ga0070673_1001608513 201
98 3300005365 Ga0070688_100000432 Ga0070688_10000043210 201
99 3300005365 Ga0070688_100009975 Ga0070688_1000099755 201
100 3300005366 Ga0070659_100000746 Ga0070659_10000074623 201
101 3300005366 Ga0070659_100275149 Ga0070659_1002751491 201
102 3300005366 Ga0070659_100471137 Ga0070659_1004711371 201
103 3300005367 Ga0070667_100001881 Ga0070667_1000018819 201
104 3300005367 Ga0070667_100164897 Ga0070667_1001648972 201
105 3300005367 Ga0070667_100252312 Ga0070667_1002523123 201
106 3300005367 Ga0070667_100653968 Ga0070667_1006539681 201
107 3300005406 Ga0070703_10001482 Ga0070703_100014828 201
108 3300005434 Ga0070709_10047309 Ga0070709_100473095 201
109 3300005434 Ga0070709_10066235 Ga0070709_100662353 201
110 3300005435 Ga0070714_100090724 Ga0070714_1000907242 201
111 3300005435 Ga0070714_100092299 Ga0070714_1000922992 201
112 3300005435 Ga0070714_100336049 Ga0070714_1003360492 201
113 3300005435 Ga0070714_100416631 Ga0070714_1004166312 201
114 3300005435 Ga0070714_100633367 Ga0070714_1006333672 201
115 3300005436 Ga0070713_100034550 Ga0070713_1000345503 201
116 3300005436 Ga0070713_100143336 Ga0070713_1001433362 201
117 3300005436 Ga0070713_100663707 Ga0070713_1006637071 201
118 3300005437 Ga0070710_10010676 Ga0070710_100106765 201
119 3300005437 Ga0070710_10014144 Ga0070710_100141445 201
120 3300005437 Ga0070710_10021162 Ga0070710_100211623 201
121 3300005437 Ga0070710_10114113 Ga0070710_101141132 201
122 3300005437 Ga0070710_10330960 Ga0070710_103309602 201
123 3300005438 Ga0070701_10010707 Ga0070701_100107074 201
124 3300005438 Ga0070701_10039230 Ga0070701_100392304 201
125 3300005439 Ga0070711_100015569 Ga0070711_1000155696 201
126 3300005439 Ga0070711_100042375 Ga0070711_1000423752 201
127 3300005439 Ga0070711_100066518 Ga0070711_1000665182 201
128 3300005440 Ga0070705_100000361 Ga0070705_10000036110 201
129 3300005441 Ga0070700_100000357 Ga0070700_10000035723 201
130 3300005444 Ga0070694_100009629 Ga0070694_1000096298 201
131 3300005444 Ga0070694_100105960 Ga0070694_1001059602 201
132 3300005445 Ga0070708_100011297 Ga0070708_1000112978 201
133 3300005455 Ga0070663_100006501 Ga0070663_1000065012 201
134 3300005455 Ga0070663_100014884 Ga0070663_1000148845 201
135 3300005455 Ga0070663_100588282 Ga0070663_1005882822 201
136 3300005456 Ga0070678_100000438 Ga0070678_10000043813 201
137 3300005457 Ga0070662_100035557 Ga0070662_1000355573 201
138 3300005457 Ga0070662_100119158 Ga0070662_1001191582 201
139 3300005457 Ga0070662_100271458 Ga0070662_1002714583 201
140 3300005458 Ga0070681_10039781 Ga0070681_100397813 201
141 3300005458 Ga0070681_10224839 Ga0070681_102248393 201
142 3300005458 Ga0070681_10247774 Ga0070681_102477741 201
143 3300005458 Ga0070681_10775096 Ga0070681_107750961 201
144 3300005459 Ga0068867_100001099 Ga0068867_10000109923 201
145 3300005459 Ga0068867_100079424 Ga0068867_1000794241 201
146 3300005459 Ga0068867_100248855 Ga0068867_1002488552 201
147 3300005466 Ga0070685_10006230 Ga0070685_100062302 201
148 3300005466 Ga0070685_10158702 Ga0070685_101587022 201
149 3300005471 Ga0070698_100194771 Ga0070698_1001947714 201
150 3300005530 Ga0070679_100002503 Ga0070679_10000250312 201
151 3300005530 Ga0070679_100023170 Ga0070679_1000231705 201
152 3300005530 Ga0070679_100149887 Ga0070679_1001498875 201
153 3300005530 Ga0070679_100376970 Ga0070679_1003769703 201
154 3300005530 Ga0070679_100832969 Ga0070679_1008329692 201
155 3300005535 Ga0070684_100000101 Ga0070684_10000010155 201
156 3300005535 Ga0070684_100124599 Ga0070684_1001245993 201
157 3300005535 Ga0070684_100456395 Ga0070684_1004563951 201
158 3300005535 Ga0070684_100829745 Ga0070684_1008297452 201
159 3300005539 Ga0068853_100158781 Ga0068853_1001587814 201
160 3300005539 Ga0068853_100210062 Ga0068853_1002100622 201
161 3300005539 Ga0068853_100221116 Ga0068853_1002211162 201
162 3300005543 Ga0070672_100035124 Ga0070672_1000351241 201
163 3300005543 Ga0070672_100126981 Ga0070672_1001269814 201
164 3300005543 Ga0070672_100336642 Ga0070672_1003366423 201
165 3300005544 Ga0070686_100000532 Ga0070686_1000005321 201
166 3300005544 Ga0070686_100006895 Ga0070686_1000068955 201
167 3300005544 Ga0070686_100012133 Ga0070686_1000121337 201
168 3300005545 Ga0070695_100005890 Ga0070695_1000058906 201
169 3300005546 Ga0070696_100007762 Ga0070696_10000776210 201
170 3300005547 Ga0070693_100003380 Ga0070693_1000033807 201
171 3300005547 Ga0070693_100096945 Ga0070693_1000969453 201
172 3300005548 Ga0070665_100069518 Ga0070665_1000695184 201
173 3300005548 Ga0070665_100168248 Ga0070665_1001682483 201
174 3300005548 Ga0070665_100328151 Ga0070665_1003281511 201
175 3300005548 Ga0070665_100423655 Ga0070665_1004236552 201
176 3300005549 Ga0070704_100009296 Ga0070704_1000092968 201
177 3300005563 Ga0068855_100047838 Ga0068855_1000478385 201
178 3300005563 Ga0068855_100317042 Ga0068855_1003170422 201
179 3300005563 Ga0068855_100512171 Ga0068855_1005121712 201
180 3300005563 Ga0068855_100563253 Ga0068855_1005632532 201
181 3300005564 Ga0070664_100020910 Ga0070664_1000209107 201
182 3300005564 Ga0070664_100061173 Ga0070664_1000611735 201
183 3300005564 Ga0070664_100251297 Ga0070664_1002512972 201
184 3300005564 Ga0070664_100571753 Ga0070664_1005717531 201
185 3300005564 Ga0070664_101026412 Ga0070664_1010264121 201
186 3300005577 Ga0068857_100001072 Ga0068857_10000107210 201
187 3300005578 Ga0068854_100000794 Ga0068854_10000079414 201
188 3300005614 Ga0068856_100006877 Ga0068856_1000068779 201
189 3300005614 Ga0068856_100233955 Ga0068856_1002339553 201
190 3300005614 Ga0068856_100610393 Ga0068856_1006103933 201
191 3300005614 Ga0068856_101030412 Ga0068856_1010304121 201
192 3300005615 Ga0070702_100006263 Ga0070702_1000062635 201
193 3300005615 Ga0070702_100053715 Ga0070702_1000537155 201
194 3300005616 Ga0068852_100000713 Ga0068852_10000071321 201
195 3300005616 Ga0068852_100086835 Ga0068852_1000868353 201
196 3300005617 Ga0068859_100001523 Ga0068859_10000152310 201
197 3300005617 Ga0068859_100120035 Ga0068859_1001200353 201
198 3300005617 Ga0068859_100132778 Ga0068859_1001327784 201
199 3300005617 Ga0068859_100209914 Ga0068859_1002099143 201
200 3300005618 Ga0068864_100000715 Ga0068864_10000071518 201
201 3300005618 Ga0068864_100369800 Ga0068864_1003698002 201
202 3300005718 Ga0068866_10003508 Ga0068866_1000350810 201
203 3300005718 Ga0068866_10008505 Ga0068866_100085053 201
204 3300005718 Ga0068866_10050564 Ga0068866_100505641 201
205 3300005719 Ga0068861_100000574 Ga0068861_1000005747 201
206 3300005719 Ga0068861_100039977 Ga0068861_1000399774 201
207 3300005719 Ga0068861_100270569 Ga0068861_1002705691 201
208 3300005719 Ga0068861_100326111 Ga0068861_1003261112 201
209 3300005841 Ga0068863_100001272 Ga0068863_10000127225 201
210 3300005841 Ga0068863_100650482 Ga0068863_1006504822 201
211 3300005842 Ga0068858_100008506 Ga0068858_1000085068 201
212 3300005842 Ga0068858_100138044 Ga0068858_1001380443 201
213 3300005843 Ga0068860_100001758 Ga0068860_1000017582 201
214 3300005843 Ga0068860_100956332 Ga0068860_1009563321 201
215 3300005844 Ga0068862_100012556 Ga0068862_1000125568 201
216 3300005844 Ga0068862_100373271 Ga0068862_1003732712 201
217 3300005937 Ga0081455_10006443 Ga0081455_1000644315 201
218 3300005937 Ga0081455_10134401 Ga0081455_101344011 201
219 3300005983 Ga0081540_1000059 Ga0081540_100005938 201
220 3300005983 Ga0081540_1000315 Ga0081540_100031528 201
221 3300005983 Ga0081540_1074331 Ga0081540_10743311 201
222 3300006028 Ga0070717_10001112 Ga0070717_100011127 201
223 3300006028 Ga0070717_10019038 Ga0070717_100190385 201
224 3300006028 Ga0070717_10079374 Ga0070717_100793742 201
225 3300006038 Ga0075365_10024221 Ga0075365_100242213 201
226 3300006038 Ga0075365_10262497 Ga0075365_102624972 201
227 3300006038 Ga0075365_10263274 Ga0075365_102632742 201
228 3300006042 Ga0075368_10019777 Ga0075368_100197773 201
229 3300006042 Ga0075368_10043616 Ga0075368_100436161 201
230 3300006048 Ga0075363_100010754 Ga0075363_1000107542 201
231 3300006048 Ga0075363_100086699 Ga0075363_1000866992 201
232 3300006048 Ga0075363_100090840 Ga0075363_1000908403 201
233 3300006051 Ga0075364_10010261 Ga0075364_100102614 201
234 3300006051 Ga0075364_10023768 Ga0075364_100237683 201
235 3300006051 Ga0075364_10100697 Ga0075364_101006971 201
236 3300006051 Ga0075364_10260687 Ga0075364_102606872 201
237 3300006058 Ga0075432_10006215 Ga0075432_100062156 201
238 3300006173 Ga0070716_100012500 Ga0070716_1000125002 201
239 3300006175 Ga0070712_100005942 Ga0070712_1000059427 201
240 3300006175 Ga0070712_100066126 Ga0070712_1000661264 201
241 3300006175 Ga0070712_100094588 Ga0070712_1000945883 201
242 3300006177 Ga0075362_10000822 Ga0075362_100008223 201
243 3300006178 Ga0075367_10027428 Ga0075367_100274282 201
244 3300006178 Ga0075367_10065510 Ga0075367_100655102 201
245 3300006178 Ga0075367_10086064 Ga0075367_100860643 201
246 3300006178 Ga0075367_10088828 Ga0075367_100888283 201
247 3300006178 Ga0075367_10103932 Ga0075367_101039322 201
248 3300006178 Ga0075367_10202824 Ga0075367_102028242 201
249 3300006186 Ga0075369_10003689 Ga0075369_100036896 201
250 3300006195 Ga0075366_10006442 Ga0075366_100064424 201
251 3300006195 Ga0075366_10031143 Ga0075366_100311433 201
252 3300006237 Ga0097621_100001018 Ga0097621_1000010183 201
253 3300006237 Ga0097621_100308450 Ga0097621_1003084502 201
254 3300006353 Ga0075370_10129884 Ga0075370_101298841 201
255 3300006358 Ga0068871_100000012 Ga0068871_10000001226 201
256 3300006358 Ga0068871_100019484 Ga0068871_1000194848 201
257 3300006358 Ga0068871_100101539 Ga0068871_1001015392 201
258 3300006358 Ga0068871_100134500 Ga0068871_1001345003 201
259 3300006358 Ga0068871_100151669 Ga0068871_1001516693 201
260 3300006844 Ga0075428_100001200 Ga0075428_1000012001 201
261 3300006844 Ga0075428_100004407 Ga0075428_1000044072 201
262 3300006846 Ga0075430_100000032 Ga0075430_10000003244 201
263 3300006847 Ga0075431_100000003 Ga0075431_1000000033 201
264 3300006847 Ga0075431_100009024 Ga0075431_1000090247 201
265 3300006847 Ga0075431_100539395 Ga0075431_1005393952 201
266 3300006852 Ga0075433_10000072 Ga0075433_100000722 201
267 3300006852 Ga0075433_10005026 Ga0075433_1000502611 201
268 3300006871 Ga0075434_100000341 Ga0075434_10000034125 201
269 3300006871 Ga0075434_100001937 Ga0075434_1000019371 201
270 3300006871 Ga0075434_100072274 Ga0075434_1000722747 201
271 3300006871 Ga0075434_100206696 Ga0075434_1002066962 201
272 3300006880 Ga0075429_100000631 Ga0075429_10000063127 201
273 3300006880 Ga0075429_100425132 Ga0075429_1004251321 201
274 3300006881 Ga0068865_100000328 Ga0068865_10000032825 201
275 3300006881 Ga0068865_100194589 Ga0068865_1001945892 201
276 3300006914 Ga0075436_100193136 Ga0075436_1001931361 201
277 3300006914 Ga0075436_100229708 Ga0075436_1002297082 201
278 3300006914 Ga0075436_100237128 Ga0075436_1002371282 201
279 3300006931 Ga0097620_100001523 Ga0097620_10000152310 201
280 3300006931 Ga0097620_100120036 Ga0097620_1001200363 201
281 3300006931 Ga0097620_100132777 Ga0097620_1001327774 201
282 3300006931 Ga0097620_100209925 Ga0097620_1002099253 201
283 3300007076 Ga0075435_100022993 Ga0075435_1000229932 201
284 3300007076 Ga0075435_100527551 Ga0075435_1005275512 201
285 3300007076 Ga0075435_100775166 Ga0075435_1007751662 201
286 3300009011 Ga0105251_10141329 Ga0105251_101413292 201
287 3300009036 Ga0105244_10023808 Ga0105244_100238081 201
288 3300009093 Ga0105240_10028987 Ga0105240_1002898710 201
289 3300009093 Ga0105240_10045104 Ga0105240_100451042 201
290 3300009093 Ga0105240_10083433 Ga0105240_100834331 201
291 3300009093 Ga0105240_10103668 Ga0105240_101036681 201
292 3300009093 Ga0105240_11517317 Ga0105240_115173171 201
293 3300009094 Ga0111539_10001373 Ga0111539_100013732 201
294 3300009094 Ga0111539_10002936 Ga0111539_100029369 201
295 3300009098 Ga0105245_10001404 Ga0105245_100014046 201
296 3300009098 Ga0105245_10012824 Ga0105245_1001282410 201
297 3300009098 Ga0105245_10067818 Ga0105245_100678185 201
298 3300009098 Ga0105245_10074327 Ga0105245_100743273 201
299 3300009101 Ga0105247_10000881 Ga0105247_1000088114 201
300 3300009101 Ga0105247_10025277 Ga0105247_100252774 201
301 3300009147 Ga0114129_10001551 Ga0114129_1000155132 201
302 3300009147 Ga0114129_10001730 Ga0114129_1000173030 201
303 3300009147 Ga0114129_10147946 Ga0114129_101479463 201
304 3300009148 Ga0105243_10001028 Ga0105243_1000102823 201
305 3300009148 Ga0105243_10078105 Ga0105243_100781052 201
306 3300009148 Ga0105243_10099928 Ga0105243_100999282 201
307 3300009148 Ga0105243_10241028 Ga0105243_102410282 201
308 3300009148 Ga0105243_10808076 Ga0105243_108080762 201
309 3300009174 Ga0105241_10002719 Ga0105241_100027199 201
310 3300009174 Ga0105241_10023657 Ga0105241_100236575 201
311 3300009174 Ga0105241_10249547 Ga0105241_102495472 201
312 3300009176 Ga0105242_10000607 Ga0105242_1000060723 201
313 3300009176 Ga0105242_10109860 Ga0105242_101098603 201
314 3300009177 Ga0105248_10000309 Ga0105248_1000030912 201
315 3300009177 Ga0105248_10351870 Ga0105248_103518701 201
316 3300009545 Ga0105237_10010578 Ga0105237_100105786 201
317 3300009551 Ga0105238_10046809 Ga0105238_100468093 201
318 3300009551 Ga0105238_10072176 Ga0105238_100721762 201
319 3300009551 Ga0105238_10146213 Ga0105238_101462131 201
320 3300009553 Ga0105249_10000486 Ga0105249_1000048637 201
321 3300010159 Ga0099796_10067790 Ga0099796_100677902 201
322 3300010375 Ga0105239_10006677 Ga0105239_1000667715 201
323 3300010375 Ga0105239_10114292 Ga0105239_101142922 201
324 3300010375 Ga0105239_10475603 Ga0105239_104756032 201
325 3300011119 Ga0105246_10000696 Ga0105246_100006969 201
326 3300011119 Ga0105246_10047691 Ga0105246_100476912 201
327 3300012487 Ga0157321_1010693 Ga0157321_10106931 201
328 3300013100 Ga0157373_10022136 Ga0157373_100221366 201
329 3300013102 Ga0157371_10124619 Ga0157371_101246192 201
330 3300013104 Ga0157370_10511489 Ga0157370_105114892 201
331 3300013105 Ga0157369_10553187 Ga0157369_105531871 201
332 3300013296 Ga0157374_10001864 Ga0157374_1000186419 201
333 3300013296 Ga0157374_10226231 Ga0157374_102262313 201
334 3300013296 Ga0157374_10243059 Ga0157374_102430592 201
335 3300013296 Ga0157374_10536335 Ga0157374_105363352 201
336 3300013297 Ga0157378_10006042 Ga0157378_100060428 201
337 3300013306 Ga0163162_10000992 Ga0163162_1000099224 201
338 3300013306 Ga0163162_10038755 Ga0163162_100387554 201
339 3300013306 Ga0163162_10315183 Ga0163162_103151832 201
340 3300013307 Ga0157372_10021474 Ga0157372_100214747 201
341 3300013307 Ga0157372_11178524 Ga0157372_111785241 201
342 3300013308 Ga0157375_10002320 Ga0157375_100023206 201
343 3300013308 Ga0157375_10465062 Ga0157375_104650622 201
344 3300013308 Ga0157375_11007053 Ga0157375_110070532 201
345 3300014325 Ga0163163_10098473 Ga0163163_100984734 201
346 3300014325 Ga0163163_10111585 Ga0163163_101115852 201
347 3300014325 Ga0163163_10184987 Ga0163163_101849872 201
348 3300014326 Ga0157380_10000711 Ga0157380_100007115 201
349 3300014326 Ga0157380_10297865 Ga0157380_102978653 201
350 3300014745 Ga0157377_10000336 Ga0157377_100003366 201
351 3300014968 Ga0157379_10000678 Ga0157379_1000067828 201
352 3300014969 Ga0157376_10076565 Ga0157376_100765652 201
353 3300014969 Ga0157376_10109765 Ga0157376_101097652 201
354 3300014969 Ga0157376_10204882 Ga0157376_102048823 201
355 3300017792 Ga0163161_10000534 Ga0163161_1000053411 201
356 3300017792 Ga0163161_10177822 Ga0163161_101778223 201
357 3300020077 Ga0206351_10851411 Ga0206351_108514111 201
358 3300020080 Ga0206350_10637952 Ga0206350_106379521 201
359 3300020081 Ga0206354_10183665 Ga0206354_101836651 201
360 3300021384 Ga0213876_10207001 Ga0213876_102070012 201
361 3300021384 Ga0213876_10288694 Ga0213876_102886942 201
362 3300021441 Ga0213871_10177663 Ga0213871_101776631 201
363 3300025271 Ga0207666_1000177 Ga0207666_10001779 201
364 3300025290 Ga0207673_1000025 Ga0207673_100002513 201
365 3300025290 Ga0207673_1021159 Ga0207673_10211591 201
366 3300025297 Ga0209758_1000469 Ga0209758_100046960 201
367 3300025315 Ga0207697_10000374 Ga0207697_100003749 201
368 3300025711 Ga0207696_1085800 Ga0207696_10858002 201
369 3300025885 Ga0207653_10009153 Ga0207653_100091534 201
370 3300025893 Ga0207682_10000011 Ga0207682_1000001163 201
371 3300025893 Ga0207682_10000604 Ga0207682_1000060415 201
372 3300025898 Ga0207692_10030829 Ga0207692_100308292 201
373 3300025898 Ga0207692_10089130 Ga0207692_100891302 201
374 3300025898 Ga0207692_10119518 Ga0207692_101195182 201
375 3300025899 Ga0207642_10000524 Ga0207642_1000052416 201
376 3300025899 Ga0207642_10118113 Ga0207642_101181133 201
377 3300025900 Ga0207710_10000805 Ga0207710_1000080518 201
378 3300025901 Ga0207688_10000020 Ga0207688_1000002052 201
379 3300025901 Ga0207688_10000279 Ga0207688_1000027923 201
380 3300025901 Ga0207688_10499877 Ga0207688_104998771 201
381 3300025903 Ga0207680_10016116 Ga0207680_100161163 201
382 3300025903 Ga0207680_10043051 Ga0207680_100430512 201
383 3300025904 Ga0207647_10027730 Ga0207647_100277303 201
384 3300025905 Ga0207685_10053819 Ga0207685_100538192 201
385 3300025906 Ga0207699_10112179 Ga0207699_101121792 201
386 3300025906 Ga0207699_10210624 Ga0207699_102106241 201
387 3300025907 Ga0207645_10060646 Ga0207645_100606462 201
388 3300025911 Ga0207654_10000818 Ga0207654_100008186 201
389 3300025911 Ga0207654_10045738 Ga0207654_100457382 201
390 3300025911 Ga0207654_10144309 Ga0207654_101443092 201
391 3300025912 Ga0207707_10000689 Ga0207707_1000068912 201
392 3300025912 Ga0207707_10051458 Ga0207707_100514586 201
393 3300025912 Ga0207707_10114124 Ga0207707_101141243 201
394 3300025912 Ga0207707_10167329 Ga0207707_101673292 201
395 3300025912 Ga0207707_10333038 Ga0207707_103330382 201
396 3300025912 Ga0207707_10693232 Ga0207707_106932321 201
397 3300025912 Ga0207707_10887100 Ga0207707_108871001 201
398 3300025913 Ga0207695_10046209 Ga0207695_100462095 201
399 3300025913 Ga0207695_10346493 Ga0207695_103464932 201
400 3300025913 Ga0207695_10905729 Ga0207695_109057291 201
401 3300025914 Ga0207671_10024759 Ga0207671_100247591 201
402 3300025914 Ga0207671_10762402 Ga0207671_107624021 201
403 3300025915 Ga0207693_10006663 Ga0207693_100066637 201
404 3300025915 Ga0207693_10010431 Ga0207693_100104315 201
405 3300025915 Ga0207693_10015052 Ga0207693_100150526 201
406 3300025915 Ga0207693_10090807 Ga0207693_100908072 201
407 3300025916 Ga0207663_10028739 Ga0207663_100287393 201
408 3300025916 Ga0207663_10064670 Ga0207663_100646703 201
409 3300025916 Ga0207663_10207282 Ga0207663_102072822 201
410 3300025916 Ga0207663_10308647 Ga0207663_103086471 201
411 3300025917 Ga0207660_10000442 Ga0207660_1000044222 201
412 3300025917 Ga0207660_10026455 Ga0207660_100264552 201
413 3300025917 Ga0207660_10177737 Ga0207660_101777372 201
414 3300025918 Ga0207662_10000249 Ga0207662_1000024911 201
415 3300025918 Ga0207662_10019805 Ga0207662_100198051 201
416 3300025918 Ga0207662_10054156 Ga0207662_100541565 201
417 3300025919 Ga0207657_10070172 Ga0207657_100701723 201
418 3300025919 Ga0207657_10110272 Ga0207657_101102724 201
419 3300025919 Ga0207657_10292629 Ga0207657_102926292 201
420 3300025920 Ga0207649_10000057 Ga0207649_1000005783 201
421 3300025920 Ga0207649_10112813 Ga0207649_101128133 201
422 3300025921 Ga0207652_10047059 Ga0207652_100470596 201
423 3300025921 Ga0207652_10072938 Ga0207652_100729382 201
424 3300025921 Ga0207652_10181847 Ga0207652_101818471 201
425 3300025921 Ga0207652_10206046 Ga0207652_102060462 201
426 3300025921 Ga0207652_10436836 Ga0207652_104368362 201
427 3300025923 Ga0207681_10000181 Ga0207681_1000018133 201
428 3300025923 Ga0207681_10834303 Ga0207681_108343032 201
429 3300025924 Ga0207694_10033087 Ga0207694_100330871 201
430 3300025924 Ga0207694_10063600 Ga0207694_100636003 201
431 3300025924 Ga0207694_10154749 Ga0207694_101547491 201
432 3300025925 Ga0207650_10001609 Ga0207650_1000160915 201
433 3300025925 Ga0207650_10097696 Ga0207650_100976964 201
434 3300025925 Ga0207650_10156087 Ga0207650_101560872 201
435 3300025926 Ga0207659_10000028 Ga0207659_1000002851 201
436 3300025926 Ga0207659_10043743 Ga0207659_100437432 201
437 3300025926 Ga0207659_10163303 Ga0207659_101633032 201
438 3300025926 Ga0207659_10605847 Ga0207659_106058472 201
439 3300025927 Ga0207687_10000061 Ga0207687_1000006145 201
440 3300025927 Ga0207687_10022684 Ga0207687_100226844 201
441 3300025927 Ga0207687_10134612 Ga0207687_101346122 201
442 3300025927 Ga0207687_10425291 Ga0207687_104252912 201
443 3300025928 Ga0207700_10061550 Ga0207700_100615505 201
444 3300025928 Ga0207700_10101299 Ga0207700_101012992 201
445 3300025928 Ga0207700_10849511 Ga0207700_108495111 201
446 3300025929 Ga0207664_10044584 Ga0207664_100445843 201
447 3300025929 Ga0207664_10115394 Ga0207664_101153943 201
448 3300025929 Ga0207664_10154927 Ga0207664_101549272 201
449 3300025929 Ga0207664_10518587 Ga0207664_105185872 201
450 3300025929 Ga0207664_10671702 Ga0207664_106717022 201
451 3300025931 Ga0207644_10000315 Ga0207644_1000031526 201
452 3300025931 Ga0207644_10004323 Ga0207644_100043236 201
453 3300025931 Ga0207644_10025117 Ga0207644_100251174 201
454 3300025932 Ga0207690_10000445 Ga0207690_1000044524 201
455 3300025932 Ga0207690_10528477 Ga0207690_105284772 201
456 3300025933 Ga0207706_10002206 Ga0207706_1000220617 201
457 3300025934 Ga0207686_10005349 Ga0207686_100053492 201
458 3300025934 Ga0207686_10033048 Ga0207686_100330485 201
459 3300025935 Ga0207709_10000539 Ga0207709_1000053932 201
460 3300025935 Ga0207709_10009571 Ga0207709_100095716 201
461 3300025936 Ga0207670_10000217 Ga0207670_1000021724 201
462 3300025936 Ga0207670_10448096 Ga0207670_104480962 201
463 3300025936 Ga0207670_10495582 Ga0207670_104955822 201
464 3300025937 Ga0207669_10000147 Ga0207669_1000014723 201
465 3300025937 Ga0207669_10001178 Ga0207669_100011786 201
466 3300025938 Ga0207704_10000299 Ga0207704_1000029918 201
467 3300025938 Ga0207704_10364507 Ga0207704_103645072 201
468 3300025939 Ga0207665_10003176 Ga0207665_1000317610 201
469 3300025940 Ga0207691_10003210 Ga0207691_1000321012 201
470 3300025940 Ga0207691_10005305 Ga0207691_1000530513 201
471 3300025940 Ga0207691_10043403 Ga0207691_100434035 201
472 3300025940 Ga0207691_10446209 Ga0207691_104462091 201
473 3300025941 Ga0207711_10089361 Ga0207711_100893611 201
474 3300025942 Ga0207689_10001029 Ga0207689_1000102921 201
475 3300025942 Ga0207689_10021476 Ga0207689_100214764 201
476 3300025944 Ga0207661_10000215 Ga0207661_1000021533 201
477 3300025945 Ga0207679_10000026 Ga0207679_10000026151 201
478 3300025945 Ga0207679_10031711 Ga0207679_100317115 201
479 3300025945 Ga0207679_10432510 Ga0207679_104325101 201
480 3300025945 Ga0207679_10848767 Ga0207679_108487671 201
481 3300025949 Ga0207667_10014254 Ga0207667_100142542 201
482 3300025949 Ga0207667_10038113 Ga0207667_100381136 201
483 3300025949 Ga0207667_10107653 Ga0207667_101076532 201
484 3300025949 Ga0207667_10154285 Ga0207667_101542853 201
485 3300025949 Ga0207667_10247695 Ga0207667_102476952 201
486 3300025960 Ga0207651_10019973 Ga0207651_100199732 201
487 3300025960 Ga0207651_10109456 Ga0207651_101094563 201
488 3300025961 Ga0207712_10000686 Ga0207712_1000068624 201
489 3300025961 Ga0207712_10053365 Ga0207712_100533651 201
490 3300025972 Ga0207668_10000242 Ga0207668_1000024223 201
491 3300025972 Ga0207668_10113591 Ga0207668_101135913 201
492 3300025981 Ga0207640_10028205 Ga0207640_100282056 201
493 3300025981 Ga0207640_10146821 Ga0207640_101468212 201
494 3300025986 Ga0207658_10016307 Ga0207658_100163076 201
495 3300025986 Ga0207658_10116850 Ga0207658_101168502 201
496 3300026023 Ga0207677_10009440 Ga0207677_100094406 201
497 3300026023 Ga0207677_10491827 Ga0207677_104918271 201
498 3300026035 Ga0207703_10004423 Ga0207703_100044239 201
499 3300026035 Ga0207703_10022281 Ga0207703_100222813 201
500 3300026041 Ga0207639_10048244 Ga0207639_100482442 201
501 3300026067 Ga0207678_10001079 Ga0207678_1000107923 201
502 3300026075 Ga0207708_10000805 Ga0207708_1000080523 201
503 3300026078 Ga0207702_10002121 Ga0207702_100021218 201
504 3300026078 Ga0207702_10530690 Ga0207702_105306901 201
505 3300026088 Ga0207641_10005094 Ga0207641_100050941 201
506 3300026088 Ga0207641_10005860 Ga0207641_100058609 201
507 3300026088 Ga0207641_10105193 Ga0207641_101051931 201
508 3300026089 Ga0207648_10000731 Ga0207648_100007319 201
509 3300026089 Ga0207648_10011855 Ga0207648_100118554 201
510 3300026095 Ga0207676_10000361 Ga0207676_1000036132 201
511 3300026095 Ga0207676_10005133 Ga0207676_1000513310 201
512 3300026095 Ga0207676_10108625 Ga0207676_101086252 201
513 3300026116 Ga0207674_10002121 Ga0207674_100021219 201
514 3300026116 Ga0207674_10284200 Ga0207674_102842002 201
515 3300026116 Ga0207674_10404440 Ga0207674_104044402 201
516 3300026118 Ga0207675_100001489 Ga0207675_10000148923 201
517 3300026118 Ga0207675_100040045 Ga0207675_1000400451 201
518 3300026118 Ga0207675_100044593 Ga0207675_1000445935 201
519 3300026118 Ga0207675_101505407 Ga0207675_1015054071 201
520 3300026121 Ga0207683_10000034 Ga0207683_1000003448 201
521 3300026121 Ga0207683_10002523 Ga0207683_1000252313 201
522 3300026121 Ga0207683_10006107 Ga0207683_1000610710 201
523 3300026142 Ga0207698_10000304 Ga0207698_100003045 201
524 3300026142 Ga0207698_10509200 Ga0207698_105092001 201
525 3300026142 Ga0207698_10651508 Ga0207698_106515082 201
526 3300026142 Ga0207698_10747296 Ga0207698_107472961 201
527 3300027252 Ga0209973_1001787 Ga0209973_10017872 201
528 3300027462 Ga0210000_1005697 Ga0210000_10056972 201
529 3300027552 Ga0209982_1004183 Ga0209982_10041833 201
530 3300027617 Ga0210002_1006803 Ga0210002_10068033 201
531 3300027682 Ga0209971_1025372 Ga0209971_10253722 201
532 3300027695 Ga0209966_1005150 Ga0209966_10051503 201
533 3300027717 Ga0209998_10001282 Ga0209998_100012828 201
534 3300027866 Ga0209813_10006250 Ga0209813_100062504 201
535 3300027876 Ga0209974_10002355 Ga0209974_100023559 201
536 3300027907 Ga0207428_10000082 Ga0207428_1000008299 201
537 3300027907 Ga0207428_10000352 Ga0207428_1000035243 201
538 3300027907 Ga0207428_10040364 Ga0207428_100403642 201
539 3300027907 Ga0207428_10149387 Ga0207428_101493873 201
540 3300027907 Ga0207428_10262687 Ga0207428_102626871 201
541 3300028017 Ga0265356_1014922 Ga0265356_10149221 201
542 3300028379 Ga0268266_10080780 Ga0268266_100807805 201
543 3300028379 Ga0268266_10208955 Ga0268266_102089552 201
544 3300028379 Ga0268266_10271437 Ga0268266_102714372 201
545 3300028379 Ga0268266_10760434 Ga0268266_107604342 201
546 3300028380 Ga0268265_10001338 Ga0268265_1000133823 201
547 3300028380 Ga0268265_10280376 Ga0268265_102803762 201
548 3300028381 Ga0268264_10026554 Ga0268264_100265542 201
549 3300028573 Ga0265334_10126530 Ga0265334_101265302 201
550 3300028800 Ga0265338_10042722 Ga0265338_100427224 201
551 3300028800 Ga0265338_10046571 Ga0265338_100465713 201
552 3300031235 Ga0265330_10016019 Ga0265330_100160195 201
553 3300031235 Ga0265330_10064897 Ga0265330_100648971 201
554 3300031235 Ga0265330_10095205 Ga0265330_100952052 201
555 3300031238 Ga0265332_10009149 Ga0265332_100091495 201
556 3300031239 Ga0265328_10000024 Ga0265328_1000002416 201
557 3300031239 Ga0265328_10000062 Ga0265328_1000006217 201
558 3300031239 Ga0265328_10041847 Ga0265328_100418472 201
559 3300031240 Ga0265320_10049948 Ga0265320_100499482 201
560 3300031241 Ga0265325_10023519 Ga0265325_100235193 201
561 3300031241 Ga0265325_10047176 Ga0265325_100471764 201
562 3300031242 Ga0265329_10033535 Ga0265329_100335352 201
563 3300031247 Ga0265340_10002509 Ga0265340_1000250913 201
564 3300031247 Ga0265340_10020501 Ga0265340_100205015 201
565 3300031247 Ga0265340_10023384 Ga0265340_100233847 201
566 3300031247 Ga0265340_10145467 Ga0265340_101454671 201
567 3300031247 Ga0265340_10253202 Ga0265340_102532021 201
568 3300031249 Ga0265339_10027908 Ga0265339_100279082 201
569 3300031249 Ga0265339_10040655 Ga0265339_100406555 201
570 3300031250 Ga0265331_10009560 Ga0265331_100095602 201
571 3300031250 Ga0265331_10012103 Ga0265331_100121034 201
572 3300031250 Ga0265331_10038674 Ga0265331_100386742 201
573 3300031250 Ga0265331_10069285 Ga0265331_100692852 201
574 3300031251 Ga0265327_10009583 Ga0265327_100095838 201
575 3300031251 Ga0265327_10010514 Ga0265327_100105144 201
576 3300031344 Ga0265316_10000169 Ga0265316_1000016916 201
577 3300031595 Ga0265313_10006684 Ga0265313_100066849 201
578 3300031595 Ga0265313_10054003 Ga0265313_100540032 201
579 3300031691 Ga0316579_10148529 Ga0316579_101485292 201
580 3300031711 Ga0265314_10001306 Ga0265314_1000130632 201
581 3300031711 Ga0265314_10020005 Ga0265314_100200052 201
582 3300031711 Ga0265314_10144199 Ga0265314_101441993 201
583 3300031712 Ga0265342_10000789 Ga0265342_1000078924 201
584 3300031712 Ga0265342_10000841 Ga0265342_1000084122 201
585 3300031712 Ga0265342_10007421 Ga0265342_100074219 201
586 3300031712 Ga0265342_10065814 Ga0265342_100658142 201
587 3300031733 Ga0316577_10207003 Ga0316577_102070032 201
588 3300032002 Ga0307416_100395465 Ga0307416_1003954652 201
589 3300032002 Ga0307416_100647949 Ga0307416_1006479492 201
590 3300034816 Ga0373930_0035332 Ga0373930_0035332_311_973 201
591 3300034817 Ga0373948_0001393 Ga0373948_0001393_1712_2317 201
592 3300034818 Ga0373950_0001040 Ga0373950_0001040_317_922 201
593 3300034818 Ga0373950_0005130 Ga0373950_0005130_55_660 201
594 3300034819 Ga0373958_0026831 Ga0373958_0026831_417_1022 201
595 3300034820 Ga0373959_0007712 Ga0373959_0007712_472_1077 201
596 3300034957 Ga0373938_0019233 Ga0373938_0019233_355_1017 201
597 3300035084 Ga0373928_0001679 Ga0373928_0001679_483_1088 201
598 3300035084 Ga0373928_0035349 Ga0373928_0035349_244_906 201
599 3300035085 Ga0373929_0011394 Ga0373929_0011394_1009_1614 201
600 3300035085 Ga0373929_0018020 Ga0373929_0018020_371_1033 201
601 3300035086 Ga0373934_0013386 Ga0373934_0013386_1989_2594 201
602 3300035086 Ga0373934_0067024 Ga0373934_0067024_223_828 201
603 3300035089 Ga0373944_0134051 Ga0373944_0134051_152_757 201
604 3300035090 Ga0373949_0001470 Ga0373949_0001470_2034_2639 201
605 3300035090 Ga0373949_0019248 Ga0373949_0019248_155_760 201
606 3300035091 Ga0373951_0000695 Ga0373951_0000695_7507_8112 201
607 3300035091 Ga0373951_0022194 Ga0373951_0022194_689_1294 201
608 3300035092 Ga0373952_0008157 Ga0373952_0008157_1336_1941 201
609 3300035111 Ga0373923_0049783 Ga0373923_0049783_725_1330 201
610 3300035112 Ga0373932_0001842 Ga0373932_0001842_4310_4915 201
611 3300035112 Ga0373932_0011205 Ga0373932_0011205_395_1057 201
612 3300035113 Ga0373936_0239826 Ga0373936_0239826_35_640 201
613 3300035114 Ga0373939_0001533 Ga0373939_0001533_1739_2344 201
614 3300035115 Ga0373941_0003981 Ga0373941_0003981_1768_2373 201
615 3300035115 Ga0373941_0067529 Ga0373941_0067529_408_1013 201
616 3300035117 Ga0373953_0035046 Ga0373953_0035046_1237_1842 201
617 3300035117 Ga0373953_0162433 Ga0373953_0162433_255_860 201
618 3300035118 Ga0373954_0014658 Ga0373954_0014658_1518_2123 201
619 3300035118 Ga0373954_0025923 Ga0373954_0025923_724_1329 201
620 3300035119 Ga0373956_0004403 Ga0373956_0004403_282_887 201
621 3300035119 Ga0373956_0190037 Ga0373956_0190037_10_615 201
622 3300035120 Ga0373957_0003558 Ga0373957_0003558_2717_3322 201
623 3300035120 Ga0373957_0052232 Ga0373957_0052232_736_1341 201
624 3300035121 Ga0373960_0001162 Ga0373960_0001162_80_742 201
625 3300035121 Ga0373960_0016249 Ga0373960_0016249_1217_1822 201
626 3300035170 Ga0373943_0000992 Ga0373943_0000992_4296_4901 201
627 3300035170 Ga0373943_0005818 Ga0373943_0005818_3610_4272 201
628 3300035170 Ga0373943_0035214 Ga0373943_0035214_350_955 201
629 3300035171 Ga0373946_0019049 Ga0373946_0019049_1629_2234 201
630 3300035171 Ga0373946_0053849 Ga0373946_0053849_682_1287 201
631 3300035171 Ga0373946_0194070 Ga0373946_0194070_328_933 201
632 3300035172 Ga0373955_0003642 Ga0373955_0003642_2513_3118 201
633 3300035172 Ga0373955_0029028 Ga0373955_0029028_1586_2191 201
634 3300035207 Ga0373942_0001447 Ga0373942_0001447_3303_3908 201
635 3300035207 Ga0373942_0008953 Ga0373942_0008953_1462_2067 201
636 3300035242 Ga0373962_0000468 Ga0373962_0000468_4322_4927 201
637 3300035242 Ga0373962_0000929 Ga0373962_0000929_2253_2858 201
638 3300035242 Ga0373962_0101869 Ga0373962_0101869_133_738 201
639 3300035410 Ga0373924_0013369 Ga0373924_0013369_1630_2235 201
640 3300035410 Ga0373924_0015278 Ga0373924_0015278_1473_2078 201
641 3300035691 Ga0373931_0000179 Ga0373931_0000179_4338_4943 201
642 3300035691 Ga0373931_0003177 Ga0373931_0003177_1470_2075 201
643 3300035692 Ga0373935_0068330 Ga0373935_0068330_1354_1959 201
644 3300035692 Ga0373935_0069926 Ga0373935_0069926_792_1397 201
645 3300035692 Ga0373935_0090757 Ga0373935_0090757_981_1586 201
646 3300035695 Ga0373927_0003126 Ga0373927_0003126_11276_11881 201
647 3300035695 Ga0373927_0078966 Ga0373927_0078966_1470_2075 201
648 3300035695 Ga0373927_0082182 Ga0373927_0082182_927_1532 201
649 3300035695 Ga0373927_0099715 Ga0373927_0099715_116_721 201
650 3300035695 Ga0373927_0584424 Ga0373927_0584424_94_699 201
651 3300035724 Ga0373933_0002265 Ga0373933_0002265_9353_9958 201
652 3300035725 Ga0373947_0006073 Ga0373947_0006073_3625_4230 201
653 3300035725 Ga0373947_0008855 Ga0373947_0008855_3600_4205 201
654 3300035725 Ga0373947_0027605 Ga0373947_0027605_1842_2447 201
655 3300036401 Ga0373937_0004474 Ga0373937_0004474_10326_10931 201
656 3300036401 Ga0373937_0038449 Ga0373937_0038449_142_747 201
657 3300036401 Ga0373937_0114369 Ga0373937_0114369_1274_1921 201
658 3300036401 Ga0373937_0339201 Ga0373937_0339201_578_1222 201
659 3300036647 Ga0316582_0440567 Ga0316582_0440567_136_741 201
660 3300037068 Ga0373925_0006666 Ga0373925_0006666_607_1212 201
661 3300037068 Ga0373925_0017728 Ga0373925_0017728_49_654 201
662 3300037068 Ga0373925_0021696 Ga0373925_0021696_2751_3356 201
663 3300037068 Ga0373925_0054684 Ga0373925_0054684_284_889 201
664 3300037068 Ga0373925_0200398 Ga0373925_0200398_554_1159 201
665 3300037068 Ga0373925_0223914 Ga0373925_0223914_783_1388 201
666 3300039437 Ga0436365_0318099 Ga0436365_0318099_125_730 201
667 3300039437 Ga0436365_0366367 Ga0436365_0366367_66_671 201
668 3300039437 Ga0436365_0856773 Ga0436365_0856773_1369_1989 201
669 3300039437 Ga0436365_1578283 Ga0436365_1578283_149_754 201
670 3300039437 Ga0436365_1854878 Ga0436365_1854878_1932_2537 201
671 3300039438 Ga0436360_0504011 Ga0436360_0504011_182_787 201
672 3300039438 Ga0436360_0549825 Ga0436360_0549825_610_1215 201
673 3300039438 Ga0436360_0752551 Ga0436360_0752551_2210_2815 201
674 3300039438 Ga0436360_1359514 Ga0436360_1359514_36_641 201
675 3300039450 Ga0436363_1377017 Ga0436363_1377017_56_661 201
676 3300039453 Ga0436362_0747841 Ga0436362_0747841_196_801 201
677 3300042013 Ga0439456_037983 Ga0439456_037983_172_777 201
678 3300042435 Ga0439434_0058307 Ga0439434_0058307_465_1070 201
679 3300044694 Ga0466963_0167248 Ga0466963_0167248_419_1024 201
680 3300044712 Ga0453684_0000077 Ga0453684_0000077_16593_17216 201
681 3300044712 Ga0453684_0335090 Ga0453684_0335090_552_1157 201
682 3300045049 Ga0466959_0108232 Ga0466959_0108232_1003_1608 201
683 3300045049 Ga0466959_0343411 Ga0466959_0343411_83_688 201
684 3300045051 Ga0451576_0009171 Ga0451576_0009171_5266_5871 201
685 3300046455 Ga0495603_0175656 Ga0495603_0175656_21_626 201
686 3300046455 Ga0495603_0222782 Ga0495603_0222782_169_774 201
687 3300046459 Ga0495629_0000062 Ga0495629_0000062_12781_13386 201
688 3300046459 Ga0495629_0004556 Ga0495629_0004556_8870_9475 201
689 3300046459 Ga0495629_0158289 Ga0495629_0158289_187_792 201
690 3300046460 Ga0495638_0026888 Ga0495638_0026888_2407_3012 201
691 3300046461 Ga0495641_0020006 Ga0495641_0020006_2208_2813 201
692 3300046461 Ga0495641_0294315 Ga0495641_0294315_45_650 201
693 3300046462 Ga0495651_0008073 Ga0495651_0008073_4475_5080 201
694 3300046462 Ga0495651_0021886 Ga0495651_0021886_34_681 201
695 3300046462 Ga0495651_0076768 Ga0495651_0076768_709_1314 201
696 3300046463 Ga0495653_0015013 Ga0495653_0015013_3261_3866 201
697 3300046463 Ga0495653_0028022 Ga0495653_0028022_2232_2837 201
698 3300046472 Ga0495580_0124303 Ga0495580_0124303_72_677 201
699 3300046472 Ga0495580_0133832 Ga0495580_0133832_50_655 201
700 3300046472 Ga0495580_0339946 Ga0495580_0339946_384_989 201
701 3300046473 Ga0495582_0031031 Ga0495582_0031031_1003_1608 201
702 3300046473 Ga0495582_0373796 Ga0495582_0373796_173_778 201
703 3300046474 Ga0495605_0020124 Ga0495605_0020124_2542_3147 201
704 3300046475 Ga0495639_0034490 Ga0495639_0034490_1442_2047 201
705 3300046476 Ga0495662_0001185 Ga0495662_0001185_1194_1799 201
706 3300046477 Ga0495664_0000434 Ga0495664_0000434_16103_16708 201
707 3300046477 Ga0495664_0052190 Ga0495664_0052190_203_808 201
708 3300046499 Ga0495594_0047133 Ga0495594_0047133_359_1021 201
709 3300046511 Ga0495608_0022048 Ga0495608_0022048_1062_1667 201
710 3300046511 Ga0495608_0056862 Ga0495608_0056862_1417_2022 201
711 3300046511 Ga0495608_0073810 Ga0495608_0073810_704_1309 201
712 3300046514 Ga0495618_0010670 Ga0495618_0010670_4141_4746 201
713 3300046514 Ga0495618_0042884 Ga0495618_0042884_746_1351 201
714 3300046515 Ga0495620_0154997 Ga0495620_0154997_65_670 201
715 3300046517 Ga0495630_0042726 Ga0495630_0042726_655_1260 201
716 3300046517 Ga0495630_0047207 Ga0495630_0047207_2296_2901 201
717 3300046517 Ga0495630_0052177 Ga0495630_0052177_2385_2990 201
718 3300046517 Ga0495630_0057159 Ga0495630_0057159_1675_2280 201
719 3300046517 Ga0495630_0175583 Ga0495630_0175583_700_1305 201
720 3300046519 Ga0495632_0094049 Ga0495632_0094049_675_1280 201
721 3300046520 Ga0495637_0093124 Ga0495637_0093124_475_1080 201
722 3300046529 Ga0495652_0006237 Ga0495652_0006237_5956_6561 201
723 3300046529 Ga0495652_0033805 Ga0495652_0033805_425_1030 201
724 3300046529 Ga0495652_0051239 Ga0495652_0051239_1841_2446 201
725 3300046531 Ga0495665_0036852 Ga0495665_0036852_1173_1778 201
726 3300046533 Ga0495640_0003511 Ga0495640_0003511_11914_12519 201
727 3300046533 Ga0495640_0126485 Ga0495640_0126485_609_1214 201
728 3300046535 Ga0495586_0148965 Ga0495586_0148965_393_998 201
729 3300046536 Ga0495587_0010013 Ga0495587_0010013_973_1578 201
730 3300046536 Ga0495587_0071841 Ga0495587_0071841_295_900 201
731 3300046537 Ga0495598_0014745 Ga0495598_0014745_549_1154 201
732 3300046539 Ga0495621_0004111 Ga0495621_0004111_529_1134 201
733 3300046543 Ga0495645_0000746 Ga0495645_0000746_1989_2594 201
734 3300046543 Ga0495645_0081076 Ga0495645_0081076_671_1276 201
735 3300046559 Ga0495667_0006860 Ga0495667_0006860_5174_5779 201
736 3300046615 Ga0495656_0025755 Ga0495656_0025755_1617_2222 201
737 3300046615 Ga0495656_0054643 Ga0495656_0054643_164_769 201
738 3300046642 Ga0495634_0001083 Ga0495634_0001083_6997_7602 201
739 3300046642 Ga0495634_0002973 Ga0495634_0002973_8799_9404 201
740 3300046663 Ga0495635_0000191 Ga0495635_0000191_9419_10024 201
741 3300046663 Ga0495635_0009194 Ga0495635_0009194_4583_5188 201
742 3300046663 Ga0495635_0045789 Ga0495635_0045789_741_1346 201
743 3300046663 Ga0495635_0285093 Ga0495635_0285093_145_750 201
744 3300046675 Ga0495657_0013089 Ga0495657_0013089_382_987 201
745 3300046675 Ga0495657_0077155 Ga0495657_0077155_876_1481 201
746 3300046678 Ga0495599_0019404 Ga0495599_0019404_3504_4109 201
747 3300046679 Ga0495623_0001696 Ga0495623_0001696_5703_6308 201
748 3300046679 Ga0495623_0373583 Ga0495623_0373583_143_748 201
749 3300046680 Ga0495646_0017448 Ga0495646_0017448_2280_2885 201
750 3300046681 Ga0495647_0159565 Ga0495647_0159565_290_895 201
751 3300046681 Ga0495647_0212297 Ga0495647_0212297_222_827 201
752 3300046683 Ga0495658_0000109 Ga0495658_0000109_5253_5858 201
753 3300046683 Ga0495658_0066143 Ga0495658_0066143_341_946 201
754 3300046683 Ga0495658_0181247 Ga0495658_0181247_199_843 201
755 3300046683 Ga0495658_0579663 Ga0495658_0579663_51_656 201
756 3300046684 Ga0495669_0138161 Ga0495669_0138161_315_920 201
757 3300046689 Ga0495613_0031653 Ga0495613_0031653_2144_2749 201
758 3300046689 Ga0495613_0078612 Ga0495613_0078612_301_906 201
759 3300046689 Ga0495613_0237319 Ga0495613_0237319_318_923 201
760 3300046689 Ga0495613_0456689 Ga0495613_0456689_153_797 201
761 3300046690 Ga0495624_0044312 Ga0495624_0044312_633_1238 201
762 3300046809 Ga0495600_0012096 Ga0495600_0012096_3610_4215 201
763 3300046809 Ga0495600_0030521 Ga0495600_0030521_844_1449 201
764 3300047315 Ga0495581_0115200 Ga0495581_0115200_516_1121 201
765 3300047317 Ga0495604_0002530 Ga0495604_0002530_8449_9054 201
766 3300047317 Ga0495604_0008733 Ga0495604_0008733_5048_5653 201
767 3300047317 Ga0495604_0054322 Ga0495604_0054322_25_630 201
768 3300047319 Ga0495674_0047398 Ga0495674_0047398_864_1469 201
769 3300047319 Ga0495674_0085149 Ga0495674_0085149_308_946 201
770 3300047320 Ga0495672_0226140 Ga0495672_0226140_152_757 201
771 3300047321 Ga0495676_0094272 Ga0495676_0094272_433_1038 201
772 3300047321 Ga0495676_0179857 Ga0495676_0179857_13_618 201
773 3300047322 Ga0495680_0000483 Ga0495680_0000483_28046_28651 201
774 3300047322 Ga0495680_0252209 Ga0495680_0252209_185_790 201
775 3300047322 Ga0495680_0309715 Ga0495680_0309715_466_1071 201
776 3300047322 Ga0495680_0404952 Ga0495680_0404952_168_815 201
777 3300047444 Ga0495675_0035911 Ga0495675_0035911_1691_2296 201
778 3300047445 Ga0495677_0058129 Ga0495677_0058129_750_1355 201
779 3300047471 Ga0495684_0001760 Ga0495684_0001760_5983_6588 201
780 3300047471 Ga0495684_0002479 Ga0495684_0002479_3240_3845 201
781 3300047471 Ga0495684_0027128 Ga0495684_0027128_2285_2890 201
782 3300047471 Ga0495684_0180563 Ga0495684_0180563_292_897 201
783 3300047471 Ga0495684_0515381 Ga0495684_0515381_157_762 201
784 3300047673 Ga0495593_0001596 Ga0495593_0001596_3211_3816 201
785 3300047673 Ga0495593_0016387 Ga0495593_0016387_2004_2609 201
786 3300047673 Ga0495593_0050476 Ga0495593_0050476_1401_2006 201
787 3300048088 Ga0495602_0031093 Ga0495602_0031093_1126_1731 201
788 3300048088 Ga0495602_0037615 Ga0495602_0037615_775_1380 201
789 3300048088 Ga0495602_0082549 Ga0495602_0082549_845_1450 201
790 3300048903 Ga0496100_0001014 Ga0496100_0001014_1838_2443 201
791 3300048903 Ga0496100_0009625 Ga0496100_0009625_4373_4978 201
792 3300048903 Ga0496100_0175698 Ga0496100_0175698_765_1370 201
793 3300048903 Ga0496100_0422212 Ga0496100_0422212_113_718 201
794 3300048904 Ga0496101_0001828 Ga0496101_0001828_7111_7716 201
795 3300048904 Ga0496101_0035261 Ga0496101_0035261_1839_2444 201
796 3300048904 Ga0496101_0141183 Ga0496101_0141183_302_907 201
797 3300048905 Ga0496102_0000988 Ga0496102_0000988_11643_12248 201
798 3300048905 Ga0496102_0055636 Ga0496102_0055636_1288_1893 201
799 3300048905 Ga0496102_0258809 Ga0496102_0258809_831_1436 201
800 3300048905 Ga0496102_0420536 Ga0496102_0420536_516_1121 201
801 3300048905 Ga0496102_0447139 Ga0496102_0447139_562_1167 201
802 3300048906 Ga0496103_0000582 Ga0496103_0000582_1476_2081 201
803 3300048906 Ga0496103_0005721 Ga0496103_0005721_5138_5743 201
804 3300048906 Ga0496103_0035550 Ga0496103_0035550_1899_2504 201
805 3300048907 Ga0496104_0000067 Ga0496104_0000067_102227_102832 201
806 3300048907 Ga0496104_0000574 Ga0496104_0000574_29712_30317 201
807 3300048907 Ga0496104_0007277 Ga0496104_0007277_8508_9113 201
808 3300048907 Ga0496104_0013597 Ga0496104_0013597_237_842 201
809 3300048907 Ga0496104_0051947 Ga0496104_0051947_1031_1636 201
810 3300048907 Ga0496104_0300987 Ga0496104_0300987_265_870 201
811 3300048907 Ga0496104_0534538 Ga0496104_0534538_352_957 201
812 3300048908 Ga0496105_0001954 Ga0496105_0001954_12786_13391 201
813 3300048908 Ga0496105_0006546 Ga0496105_0006546_2416_3021 201
814 3300048908 Ga0496105_0028842 Ga0496105_0028842_2142_2747 201
815 3300048908 Ga0496105_0077653 Ga0496105_0077653_914_1519 201
816 3300048908 Ga0496105_0092496 Ga0496105_0092496_484_1089 201
817 3300048908 Ga0496105_0111126 Ga0496105_0111126_1146_1751 201
818 3300048908 Ga0496105_0189545 Ga0496105_0189545_731_1336 201
819 3300048908 Ga0496105_0658204 Ga0496105_0658204_47_652 201
820 3300048909 Ga0496106_0002154 Ga0496106_0002154_1832_2437 201
821 3300048909 Ga0496106_0011737 Ga0496106_0011737_899_1504 201
822 3300048909 Ga0496106_0023714 Ga0496106_0023714_3939_4544 201
823 3300048910 Ga0496107_0006560 Ga0496107_0006560_5441_6046 201
824 3300048910 Ga0496107_0007065 Ga0496107_0007065_671_1276 201
825 3300048910 Ga0496107_0012178 Ga0496107_0012178_3623_4228 201
826 3300048910 Ga0496107_0041111 Ga0496107_0041111_2702_3307 201
827 3300048910 Ga0496107_0516656 Ga0496107_0516656_37_642 201
828 3300048910 Ga0496107_0746934 Ga0496107_0746934_40_645 201
829 3300048911 Ga0496108_0002765 Ga0496108_0002765_8949_9554 201
830 3300048911 Ga0496108_0006074 Ga0496108_0006074_8278_8883 201
831 3300048911 Ga0496108_0025713 Ga0496108_0025713_1257_1862 201
832 3300048911 Ga0496108_0332063 Ga0496108_0332063_662_1267 201
833 3300048912 Ga0496109_0013377 Ga0496109_0013377_2155_2760 201
834 3300048912 Ga0496109_0032046 Ga0496109_0032046_2767_3372 201
835 3300048912 Ga0496109_0038333 Ga0496109_0038333_1801_2406 201
836 3300048912 Ga0496109_0086166 Ga0496109_0086166_1794_2399 201
837 3300048912 Ga0496109_0299035 Ga0496109_0299035_13_618 201
838 3300048912 Ga0496109_0610264 Ga0496109_0610264_303_908 201
839 3300048912 Ga0496109_1193246 Ga0496109_1193246_41_646 201
840 3300048913 Ga0496110_0011410 Ga0496110_0011410_4416_5021 201
841 3300048913 Ga0496110_0026612 Ga0496110_0026612_1384_1989 201
842 3300048913 Ga0496110_0037606 Ga0496110_0037606_2750_3355 201
843 3300048913 Ga0496110_0091061 Ga0496110_0091061_176_781 201
844 3300048913 Ga0496110_0219196 Ga0496110_0219196_126_731 201
845 3300048913 Ga0496110_1159920 Ga0496110_1159920_55_660 201
846 3300048914 Ga0496111_0004190 Ga0496111_0004190_2262_2867 201
847 3300048914 Ga0496111_0006677 Ga0496111_0006677_3902_4507 201
848 3300048914 Ga0496111_0041909 Ga0496111_0041909_868_1473 201
849 3300048914 Ga0496111_0230408 Ga0496111_0230408_396_1001 201
850 3300048914 Ga0496111_0772410 Ga0496111_0772410_70_675 201
851 3300048915 Ga0496112_0006568 Ga0496112_0006568_6922_7527 201
852 3300048915 Ga0496112_0017351 Ga0496112_0017351_2676_3281 201
853 3300048915 Ga0496112_0028719 Ga0496112_0028719_3967_4572 201
854 3300048915 Ga0496112_0080898 Ga0496112_0080898_378_983 201
855 3300048915 Ga0496112_0236978 Ga0496112_0236978_82_687 201
856 3300048915 Ga0496112_0301665 Ga0496112_0301665_419_1024 201
857 3300048915 Ga0496112_0340012 Ga0496112_0340012_93_698 201
858 3300048916 Ga0496113_0001805 Ga0496113_0001805_8915_9520 201
859 3300048916 Ga0496113_0465766 Ga0496113_0465766_277_882 201
860 3300048917 Ga0496114_0010065 Ga0496114_0010065_4271_4876 201
861 3300048917 Ga0496114_0067703 Ga0496114_0067703_468_1073 201
862 3300048917 Ga0496114_0116425 Ga0496114_0116425_559_1164 201
863 3300048917 Ga0496114_0119182 Ga0496114_0119182_227_832 201
864 3300048917 Ga0496114_0149386 Ga0496114_0149386_1315_1920 201
865 3300048917 Ga0496114_0598803 Ga0496114_0598803_21_626 201
866 3300048918 Ga0496115_0001071 Ga0496115_0001071_455_1060 201
867 3300048918 Ga0496115_0024471 Ga0496115_0024471_998_1603 201
868 3300048918 Ga0496115_0102231 Ga0496115_0102231_1468_2073 201
869 3300048918 Ga0496115_0175960 Ga0496115_0175960_783_1388 201
870 3300048918 Ga0496115_0190245 Ga0496115_0190245_16_621 201
871 3300048918 Ga0496115_0217606 Ga0496115_0217606_358_963 201
872 3300048922 Ga0496119_0001667 Ga0496119_0001667_12252_12857 201
873 3300048924 Ga0496121_0528065 Ga0496121_0528065_82_687 201
874 3300048927 Ga0496124_0349404 Ga0496124_0349404_63_668 201
875 3300048928 Ga0496125_0276116 Ga0496125_0276116_139_744 201
876 3300048929 Ga0496126_0119510 Ga0496126_0119510_1367_1972 201
877 3300048929 Ga0496126_0189030 Ga0496126_0189030_1007_1612 201
878 3300048929 Ga0496126_0534261 Ga0496126_0534261_157_762 201
879 3300049568 Ga0501031_0002368 Ga0501031_0002368_8978_9583 201
880 3300049568 Ga0501031_0028797 Ga0501031_0028797_1209_1865 201
881 3300049568 Ga0501031_0476964 Ga0501031_0476964_42_647 201
882 3300049569 Ga0501032_0000001 Ga0501032_0000001_57277_57882 201
883 3300049569 Ga0501032_0005172 Ga0501032_0005172_4163_4819 201
884 3300049569 Ga0501032_0034615 Ga0501032_0034615_387_1064 201
885 3300049570 Ga0501033_0000077 Ga0501033_0000077_22132_22737 201
886 3300049570 Ga0501033_0026780 Ga0501033_0026780_2400_3005 201
887 3300049570 Ga0501033_0039024 Ga0501033_0039024_865_1542 201
888 3300049570 Ga0501033_0051447 Ga0501033_0051447_2073_2729 201
889 3300049570 Ga0501033_0119303 Ga0501033_0119303_890_1546 201
890 3300049570 Ga0501033_0322595 Ga0501033_0322595_273_878 201
891 3300049571 Ga0501034_0000023 Ga0501034_0000023_89208_89813 201
892 3300049571 Ga0501034_0013529 Ga0501034_0013529_5988_6665 201
893 3300049571 Ga0501034_0038088 Ga0501034_0038088_1966_2571 201
894 3300049571 Ga0501034_0091995 Ga0501034_0091995_2146_2751 201
895 3300049571 Ga0501034_0094333 Ga0501034_0094333_1569_2225 201
896 3300049571 Ga0501034_0409332 Ga0501034_0409332_151_756 201
897 3300049572 Ga0501036_0000482 Ga0501036_0000482_4946_5551 201
898 3300049572 Ga0501036_0006028 Ga0501036_0006028_4302_4958 201
899 3300049572 Ga0501036_0062317 Ga0501036_0062317_1913_2518 201
900 3300049572 Ga0501036_0106875 Ga0501036_0106875_358_1035 201
901 3300049573 Ga0501037_0000065 Ga0501037_0000065_93494_94099 201
902 3300049573 Ga0501037_0017847 Ga0501037_0017847_2632_3288 201
903 3300049573 Ga0501037_0277777 Ga0501037_0277777_255_932 201
904 3300049574 Ga0501038_0000043 Ga0501038_0000043_53030_53635 201
905 3300049574 Ga0501038_0014243 Ga0501038_0014243_2372_3028 201
906 3300049574 Ga0501038_0129304 Ga0501038_0129304_413_1090 201
907 3300049574 Ga0501038_0348225 Ga0501038_0348225_417_1022 201
908 3300049574 Ga0501038_0380147 Ga0501038_0380147_395_1000 201
909 3300049575 Ga0501039_0000022 Ga0501039_0000022_120679_121284 201
910 3300049575 Ga0501039_0005361 Ga0501039_0005361_7797_8453 201
911 3300049575 Ga0501039_0056652 Ga0501039_0056652_284_961 201
912 3300049575 Ga0501039_0080733 Ga0501039_0080733_297_902 201
913 3300049577 Ga0501041_0062492 Ga0501041_0062492_133_738 201
914 3300049577 Ga0501041_0139385 Ga0501041_0139385_564_1169 201
915 3300049578 Ga0501042_0023231 Ga0501042_0023231_1491_2147 201
916 3300049578 Ga0501042_0110756 Ga0501042_0110756_70_675 201
917 3300049578 Ga0501042_0164433 Ga0501042_0164433_824_1492 201
918 3300049579 Ga0501043_0000310 Ga0501043_0000310_35033_35638 201
919 3300049579 Ga0501043_0027092 Ga0501043_0027092_2053_2709 201
920 3300049579 Ga0501043_0175769 Ga0501043_0175769_607_1284 201
921 3300049579 Ga0501043_0253948 Ga0501043_0253948_422_1090 201
922 3300049579 Ga0501043_0563906 Ga0501043_0563906_38_643 201
923 3300049580 Ga0501046_0003995 Ga0501046_0003995_7693_8349 201
924 3300049581 Ga0501047_0047790 Ga0501047_0047790_2073_2729 201
925 3300049581 Ga0501047_0116322 Ga0501047_0116322_374_1030 201
926 3300049581 Ga0501047_0158048 Ga0501047_0158048_743_1420 201
927 3300049581 Ga0501047_0633832 Ga0501047_0633832_233_838 201
928 3300049582 Ga0501048_0024560 Ga0501048_0024560_2321_2977 201
929 3300049582 Ga0501048_0101228 Ga0501048_0101228_914_1582 201
930 3300049583 Ga0501067_0003221 Ga0501067_0003221_4306_4962 201
931 3300049583 Ga0501067_0039548 Ga0501067_0039548_38_643 201
932 3300049583 Ga0501067_0185870 Ga0501067_0185870_343_948 201
933 3300049583 Ga0501067_0230132 Ga0501067_0230132_77_682 201
934 3300049583 Ga0501067_0288483 Ga0501067_0288483_219_824 201
935 3300049584 Ga0501068_0177511 Ga0501068_0177511_40_645 201
936 3300049585 Ga0501069_0004930 Ga0501069_0004930_4144_4800 201
937 3300049585 Ga0501069_0011625 Ga0501069_0011625_3225_3830 201
938 3300049585 Ga0501069_0197148 Ga0501069_0197148_550_1155 201
939 3300049585 Ga0501069_0342264 Ga0501069_0342264_84_689 201
940 3300049586 Ga0501070_0009447 Ga0501070_0009447_3694_4299 201
941 3300049586 Ga0501070_0016831 Ga0501070_0016831_638_1315 201
942 3300049586 Ga0501070_0055665 Ga0501070_0055665_1346_2002 201
943 3300049586 Ga0501070_0086797 Ga0501070_0086797_770_1375 201
944 3300049586 Ga0501070_0516702 Ga0501070_0516702_93_698 201
945 3300049587 Ga0501071_0216513 Ga0501071_0216513_80_685 201
946 3300049588 Ga0501072_0216317 Ga0501072_0216317_167_772 201
947 3300049588 Ga0501072_0318627 Ga0501072_0318627_541_1146 201
948 3300049588 Ga0501072_0437972 Ga0501072_0437972_99_755 201
949 3300049589 Ga0501073_0042012 Ga0501073_0042012_1422_2078 201
950 3300049589 Ga0501073_0163199 Ga0501073_0163199_471_1076 201
951 3300049590 Ga0501074_0005559 Ga0501074_0005559_5816_6472 201
952 3300049590 Ga0501074_0097865 Ga0501074_0097865_49_717 201
953 3300049590 Ga0501074_0166052 Ga0501074_0166052_577_1182 201
954 3300049590 Ga0501074_0173054 Ga0501074_0173054_96_701 201
955 3300049590 Ga0501074_0685133 Ga0501074_0685133_42_647 201
956 3300049592 Ga0501076_0016642 Ga0501076_0016642_2461_3129 201
957 3300049592 Ga0501076_0059310 Ga0501076_0059310_615_1271 201
958 3300049593 Ga0501077_0009848 Ga0501077_0009848_2930_3598 201
959 3300049741 Ga0501079_0016096 Ga0501079_0016096_4347_5015 201
960 3300049741 Ga0501079_0534606 Ga0501079_0534606_66_671 201
961 3300049741 Ga0501079_0604464 Ga0501079_0604464_21_626 201
962 3300049742 Ga0501080_0034590 Ga0501080_0034590_2287_2943 201
963 3300049742 Ga0501080_0076615 Ga0501080_0076615_49_654 201
964 3300049742 Ga0501080_0083148 Ga0501080_0083148_416_1021 201
965 3300049742 Ga0501080_0319668 Ga0501080_0319668_459_1064 201
966 3300049744 Ga0501083_0010614 Ga0501083_0010614_2378_3034 201
967 3300049744 Ga0501083_0015328 Ga0501083_0015328_1864_2469 201
968 3300049822 Ga0501035_0000234 Ga0501035_0000234_62338_62943 201
969 3300049822 Ga0501035_0015144 Ga0501035_0015144_4731_5336 201
970 3300049822 Ga0501035_0015488 Ga0501035_0015488_1346_2002 201
971 3300049822 Ga0501035_0018523 Ga0501035_0018523_238_915 201
972 3300049822 Ga0501035_0199389 Ga0501035_0199389_862_1467 201
973 3300049823 Ga0501044_0000815 Ga0501044_0000815_26691_27347 201
974 3300049823 Ga0501044_0003116 Ga0501044_0003116_1359_1964 201
975 3300049823 Ga0501044_0021531 Ga0501044_0021531_968_1573 201
976 3300049823 Ga0501044_0053557 Ga0501044_0053557_2073_2729 201
977 3300049823 Ga0501044_0076558 Ga0501044_0076558_1710_2315 201
978 3300049823 Ga0501044_0125510 Ga0501044_0125510_1289_1894 201
979 3300049823 Ga0501044_0823649 Ga0501044_0823649_141_746 201
980 3300049823 Ga0501044_1000079 Ga0501044_1000079_58_663 201
981 3300049824 Ga0501045_0033963 Ga0501045_0033963_388_1056 201
982 3300049824 Ga0501045_0198303 Ga0501045_0198303_371_1027 201
983 3300050489 nmdc:mga03683_39701_c1 nmdc:mga03683_39701_c1_165_770 201
984 3300050490 nmdc:mga03n38_155827_c1 nmdc:mga03n38_155827_c1_503_1108 201
985 3300050490 nmdc:mga03n38_220390_c1 nmdc:mga03n38_220390_c1_223_828 201
986 3300050490 nmdc:mga03n38_63002_c1 nmdc:mga03n38_63002_c1_606_1211 201
987 3300050491 nmdc:mga00v17_229690_c1 nmdc:mga00v17_229690_c1_503_1108 201
988 3300050491 nmdc:mga00v17_38016_c1 nmdc:mga00v17_38016_c1_2138_2743 201
989 3300050492 nmdc:mga0yw44_171159_c1 nmdc:mga0yw44_171159_c1_697_1302 201
990 3300050492 nmdc:mga0yw44_319235_c1 nmdc:mga0yw44_319235_c1_339_944 201
991 3300050492 nmdc:mga0yw44_330995_c1 nmdc:mga0yw44_330995_c1_358_963 201
992 3300050492 nmdc:mga0yw44_48825_c1 nmdc:mga0yw44_48825_c1_1293_1898 201
993 3300050493 nmdc:mga0k408_121548_c1 nmdc:mga0k408_121548_c1_293_898 201
994 3300050493 nmdc:mga0k408_185164_c1 nmdc:mga0k408_185164_c1_203_913 201
995 3300050493 nmdc:mga0k408_19359_c1 nmdc:mga0k408_19359_c1_2855_3460 201
996 3300050494 nmdc:mga06z11_236203_c1 nmdc:mga06z11_236203_c1_297_902 201
997 3300050494 nmdc:mga06z11_418312_c1 nmdc:mga06z11_418312_c1_55_660 201
998 3300050494 nmdc:mga06z11_8923_c1 nmdc:mga06z11_8923_c1_1513_2142 201
999 3300050495 nmdc:mga04h51_7124_c1 nmdc:mga04h51_7124_c1_272_877 201
1000 3300050495 nmdc:mga04h51_93603_c1 nmdc:mga04h51_93603_c1_260_865 201
1001 3300050496 nmdc:mga07m45_317639_c1 nmdc:mga07m45_317639_c1_290_895 201
1002 3300050507 nmdc:mga05p37_19_c2 nmdc:mga05p37_19_c2_43287_43916 201
1003 3300050507 nmdc:mga05p37_216354_c1 nmdc:mga05p37_216354_c1_1205_1810 201
1004 3300050508 nmdc:mga09592_2070_c1 nmdc:mga09592_2070_c1_8658_9350 201
1005 3300050508 nmdc:mga09592_238_c1 nmdc:mga09592_238_c1_155_784 201
1006 3300050508 nmdc:mga09592_96720_c1 nmdc:mga09592_96720_c1_1831_2460 201
1007 3300050509 nmdc:mga0qj67_259_c1 nmdc:mga0qj67_259_c1_24481_25110 201
1008 3300050510 nmdc:mga06r32_2023_c1 nmdc:mga06r32_2023_c1_12400_13029 201
1009 3300050510 nmdc:mga06r32_349_c1 nmdc:mga06r32_349_c1_26614_27306 201
1010 3300050510 nmdc:mga06r32_501245_c1 nmdc:mga06r32_501245_c1_460_1065 201
1011 3300050511 nmdc:mga08y16_123581_c1 nmdc:mga08y16_123581_c1_108_713 201
1012 3300050511 nmdc:mga08y16_222039_c1 nmdc:mga08y16_222039_c1_986_1639 201
1013 3300050511 nmdc:mga08y16_245149_c1 nmdc:mga08y16_245149_c1_831_1436 201
1014 3300050511 nmdc:mga08y16_2735_c1 nmdc:mga08y16_2735_c1_17170_17799 201
1015 3300050511 nmdc:mga08y16_325_c1 nmdc:mga08y16_325_c1_41606_42298 201
1016 3300050511 nmdc:mga08y16_444751_c1 nmdc:mga08y16_444751_c1_244_849 201
1017 3300050512 nmdc:mga0n895_120909_c1 nmdc:mga0n895_120909_c1_31_636 201
1018 3300050512 nmdc:mga0n895_1215831_c1 nmdc:mga0n895_1215831_c1_109_714 201
1019 3300050512 nmdc:mga0n895_281192_c1 nmdc:mga0n895_281192_c1_759_1364 201
1020 3300050512 nmdc:mga0n895_394_c1 nmdc:mga0n895_394_c1_6682_7311 201
1021 3300050512 nmdc:mga0n895_45970_c1 nmdc:mga0n895_45970_c1_956_1561 201
1022 3300050512 nmdc:mga0n895_506674_c1 nmdc:mga0n895_506674_c1_254_859 201
1023 3300050512 nmdc:mga0n895_563681_c1 nmdc:mga0n895_563681_c1_236_841 201
1024 3300050512 nmdc:mga0n895_9070_c1 nmdc:mga0n895_9070_c1_831_1436 201
1025 3300050513 nmdc:mga0rr50_13004_c1 nmdc:mga0rr50_13004_c1_3367_3972 201
1026 3300050513 nmdc:mga0rr50_522077_c1 nmdc:mga0rr50_522077_c1_102_707 201
1027 3300050513 nmdc:mga0rr50_748596_c1 nmdc:mga0rr50_748596_c1_149_754 201
1028 3300050513 nmdc:mga0rr50_785_c1 nmdc:mga0rr50_785_c1_1558_2187 201
1029 3300050514 nmdc:mga08x19_120826_c1 nmdc:mga08x19_120826_c1_942_1547 201
1030 3300050514 nmdc:mga08x19_207318_c1 nmdc:mga08x19_207318_c1_387_992 201
1031 3300050514 nmdc:mga08x19_52251_c1 nmdc:mga08x19_52251_c1_1866_2471 201
1032 3300050515 nmdc:mga0a205_10038_c1 nmdc:mga0a205_10038_c1_7025_7630 201
1033 3300050515 nmdc:mga0a205_14874_c1 nmdc:mga0a205_14874_c1_1084_1689 201
1034 3300050515 nmdc:mga0a205_249_c1 nmdc:mga0a205_249_c1_26711_27340 201
1035 3300050515 nmdc:mga0a205_337310_c1 nmdc:mga0a205_337310_c1_445_1050 201
1036 3300053077 Ga0495601_0000338 Ga0495601_0000338_10540_11145 201
1037 3300053077 Ga0495601_0001346 Ga0495601_0001346_2268_2873 201
1038 3300053077 Ga0495601_0022223 Ga0495601_0022223_2315_2920 201
1039 3300053078 Ga0495612_0000152 Ga0495612_0000152_19102_19707 201
1040 3300053078 Ga0495612_0058120 Ga0495612_0058120_246_851 201
1041 3300053083 Ga0495655_0009189 Ga0495655_0009189_220_825 201
1042 3300053084 Ga0495595_0022830 Ga0495595_0022830_951_1556 201
1043 3300053084 Ga0495595_0066508 Ga0495595_0066508_880_1485 201
1044 3300053085 Ga0495619_0000078 Ga0495619_0000078_58068_58673 201
1045 3300053085 Ga0495619_0001083 Ga0495619_0001083_7460_8065 201
1046 3300053085 Ga0495619_0018347 Ga0495619_0018347_1520_2125 201
1047 3300053085 Ga0495619_0117573 Ga0495619_0117573_186_791 201
1048 3300053085 Ga0495619_0257819 Ga0495619_0257819_155_760 201
1049 3300053090 Ga0500646_0007709 Ga0500646_0007709_274_879 201
1050 3300053104 Ga0500556_0102072 Ga0500556_0102072_30_635 201
1051 3300053119 Ga0500595_012962 Ga0500595_012962_2211_2816 201
1052 3300053130 Ga0500642_0091120 Ga0500642_0091120_776_1381 201
1053 3300053131 Ga0500652_000169 Ga0500652_000169_17173_17778 201
1054 3300053153 Ga0500616_0006713 Ga0500616_0006713_492_1097 201
1055 3300053158 Ga0500627_0030433 Ga0500627_0030433_282_887 201
1056 3300053177 Ga0500636_0006847 Ga0500636_0006847_3484_4089 201
1057 3300054114 Ga0501084_0014744 Ga0501084_0014744_2884_3540 201
1058 3300054114 Ga0501084_0074320 Ga0501084_0074320_1334_1939 201
1059 3300054114 Ga0501084_0103789 Ga0501084_0103789_122_727 201
1060 3300054114 Ga0501084_0400245 Ga0501084_0400245_394_999 201
1061 3300060353 Ga0501082_0005652 Ga0501082_0005652_537_1193 201
1062 3300060353 Ga0501082_0169098 Ga0501082_0169098_133_738 201
1063 3300060353 Ga0501082_0176866 Ga0501082_0176866_1161_1766 201
1064 3300061734 Ga0530510_0002354 Ga0530510_0002354_17_622 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

36

159

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.8584 1 175
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.8583 1 176
2hcu-assembly1.cif.gz_A crystal structure of smu.1381 (or leud) from streptococcus mutans 0.854 1 175
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.8536 1 175
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.8428 4 162
ID Description Score Start End Superfamily
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8802 1 178 3.20.19.10
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8613 1 178 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8584 1 175 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8566 2 175 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8536 1 175 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A2E3QQN6-F1-model_v4 3-isopropylmalate dehydratase 0.9805 102 200 GO:0009098
GO:0016829
AF-A0A7C1YE99-F1-model_v4 3-isopropylmalate dehydratase small subunit 0.9783 121 200
AF-A0A4S0LI89-F1-model_v4 deleted 0.9722 53 170
AF-A0A4S0LI89-F1-model_v4 deleted 0.9642 53 170
AF-A0A7S0FG31-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9621 76 200 GO:0003861
GO:0009098
GO:0009316

Feature Viewer

pLDDT pTM Quality
86.28 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map