F489353
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1064 | 457 | 2128 | 107 |
Family's Representative Sequence
| Representative Sequence | 3300030521|Ga0307511_10009506|Ga0307511_100095061 |
| Length | 111 |
| Sequence | MQLNVTGHHIEVTAALRGYVEKKLDRIARHFDQVIDVHCVLTVEQKLRHKAEATLHVSGNAIHADATEENMYAAIDLLVDKLDRCVKKHKEKKCDHHAAEAQRSARNIASL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 87 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300019188 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 117 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 120 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 124 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 125 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 126 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 127 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 184 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 185 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 186 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 190 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300030963 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 208 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 210 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 214 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 217 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 218 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 219 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 220 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 228 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 229 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 230 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 234 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 236 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 238 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 240 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 241 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 244 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 248 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 254 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 260 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 268 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 269 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 270 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 271 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 272 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 273 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 274 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 275 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 276 | 3300041916 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run | Metatranscriptome | Unclassified |
| 277 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 278 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 279 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 280 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 281 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 285 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 286 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 287 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 288 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 289 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 290 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 291 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 292 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 293 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 354 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 355 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 356 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 357 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 358 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 366 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 367 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 368 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 369 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 370 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 371 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 372 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 373 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 374 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 395 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 396 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 397 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 401 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 411 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 412 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 413 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 414 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 415 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 416 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 417 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 418 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 419 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 420 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 421 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 422 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 423 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 424 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 425 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 426 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 428 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 429 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 430 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 431 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 432 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 434 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 435 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 436 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 437 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 439 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 440 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 441 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 442 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 443 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 444 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 445 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 446 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 447 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 448 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 449 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 450 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 452 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 453 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 454 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 456 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 457 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.27 |
| Metatranscriptomes | 5.73 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.95 |
| Nodule | 0 |
| Rhizoplane | 4.51 |
| Rhizosphere | 84.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307511_10009506 | 3300030521 | Bacteria | 9688 |
| 2 | MBSR1b_contig_5278590 | 2162886012 | Bacteria | 886 |
| 3 | JGI24738J21930_10102457 | 3300002075 | Bacteria | 612 |
| 4 | rootH1_10034951 | 3300003316 | Unclassified | 1717 |
| 5 | rootH2_10117380 | 3300003320 | Unclassified | 1929 |
| 6 | Ga0058863_11624363 | 3300004799 | Bacteria | 1090 |
| 7 | Ga0058863_11892829 | 3300004799 | Bacteria | 545 |
| 8 | Ga0058861_10019602 | 3300004800 | Bacteria | 1955 |
| 9 | Ga0058861_11586382 | 3300004800 | Bacteria | 838 |
| 10 | Ga0058862_10122417 | 3300004803 | Bacteria | 712 |
| 11 | Ga0058862_12346480 | 3300004803 | Bacteria | 617 |
| 12 | Ga0058862_12810254 | 3300004803 | Bacteria | 1459 |
| 13 | Ga0065715_10291879 | 3300005293 | Bacteria | 1061 |
| 14 | Ga0065707_10091763 | 3300005295 | Bacteria | 3883 |
| 15 | Ga0065707_10328244 | 3300005295 | Bacteria | 954 |
| 16 | Ga0070658_10149337 | 3300005327 | Unclassified | 1956 |
| 17 | Ga0070658_10360626 | 3300005327 | Bacteria | 1245 |
| 18 | Ga0070676_10487428 | 3300005328 | Bacteria | 873 |
| 19 | Ga0070683_100068631 | 3300005329 | Bacteria | 3303 |
| 20 | Ga0070683_100659341 | 3300005329 | Bacteria | 1002 |
| 21 | Ga0070690_100008411 | 3300005330 | Bacteria | 5942 |
| 22 | Ga0070670_101803729 | 3300005331 | Bacteria | 563 |
| 23 | Ga0068869_100408038 | 3300005334 | Bacteria | 1119 |
| 24 | Ga0068869_100790914 | 3300005334 | Bacteria | 815 |
| 25 | Ga0070666_10000608 | 3300005335 | Bacteria | 21544 |
| 26 | Ga0070666_10197214 | 3300005335 | Bacteria | 1416 |
| 27 | Ga0070680_100012524 | 3300005336 | Bacteria | 6593 |
| 28 | Ga0070680_100046067 | 3300005336 | Bacteria | 3547 |
| 29 | Ga0070680_100203349 | 3300005336 | Bacteria | 1670 |
| 30 | Ga0070680_100352165 | 3300005336 | Bacteria | 1252 |
| 31 | Ga0070680_101037174 | 3300005336 | Bacteria | 708 |
| 32 | Ga0070682_100017708 | 3300005337 | Bacteria | 4156 |
| 33 | Ga0070682_100572798 | 3300005337 | Bacteria | 887 |
| 34 | Ga0070682_101190777 | 3300005337 | Bacteria | 642 |
| 35 | Ga0068868_100009699 | 3300005338 | Bacteria | 6946 |
| 36 | Ga0070660_100097247 | 3300005339 | Bacteria | 2329 |
| 37 | Ga0070661_100566924 | 3300005344 | Bacteria | 915 |
| 38 | Ga0070692_10249967 | 3300005345 | Unclassified | 1061 |
| 39 | Ga0070668_100100749 | 3300005347 | Bacteria | 2288 |
| 40 | Ga0070668_100900991 | 3300005347 | Bacteria | 791 |
| 41 | Ga0070669_100731023 | 3300005353 | Bacteria | 837 |
| 42 | Ga0070671_100001886 | 3300005355 | Bacteria | 16027 |
| 43 | Ga0070671_100057434 | 3300005355 | Bacteria | 3238 |
| 44 | Ga0070671_100341417 | 3300005355 | Bacteria | 1277 |
| 45 | Ga0070674_100337778 | 3300005356 | Bacteria | 1212 |
| 46 | Ga0070674_101838706 | 3300005356 | Bacteria | 550 |
| 47 | Ga0070673_100250912 | 3300005364 | Bacteria | 1542 |
| 48 | Ga0070673_100751965 | 3300005364 | Bacteria | 898 |
| 49 | Ga0070659_102097198 | 3300005366 | Bacteria | 508 |
| 50 | Ga0070667_100000184 | 3300005367 | Bacteria | 75408 |
| 51 | Ga0070667_100010475 | 3300005367 | Bacteria | 7656 |
| 52 | Ga0070667_100030679 | 3300005367 | Bacteria | 4483 |
| 53 | Ga0070667_100109447 | 3300005367 | Unclassified | 2394 |
| 54 | Ga0070667_101688937 | 3300005367 | Bacteria | 595 |
| 55 | Ga0070667_102220699 | 3300005367 | Bacteria | 517 |
| 56 | Ga0070667_102342154 | 3300005367 | Bacteria | 503 |
| 57 | Ga0070703_10301717 | 3300005406 | Bacteria | 668 |
| 58 | Ga0070709_10001974 | 3300005434 | Bacteria | 11180 |
| 59 | Ga0070709_10002738 | 3300005434 | Bacteria | 9535 |
| 60 | Ga0070709_10502642 | 3300005434 | Bacteria | 921 |
| 61 | Ga0070709_11342497 | 3300005434 | Bacteria | 578 |
| 62 | Ga0070714_100008567 | 3300005435 | Bacteria | 7997 |
| 63 | Ga0070714_100057500 | 3300005435 | Bacteria | 3330 |
| 64 | Ga0070714_100520474 | 3300005435 | Bacteria | 1136 |
| 65 | Ga0070714_100812115 | 3300005435 | Bacteria | 906 |
| 66 | Ga0070713_100031953 | 3300005436 | Bacteria | 4199 |
| 67 | Ga0070713_100039641 | 3300005436 | Bacteria | 3824 |
| 68 | Ga0070713_100040668 | 3300005436 | Bacteria | 3781 |
| 69 | Ga0070713_100101571 | 3300005436 | Bacteria | 2492 |
| 70 | Ga0070713_100155600 | 3300005436 | Bacteria | 2037 |
| 71 | Ga0070713_101833529 | 3300005436 | Unclassified | 589 |
| 72 | Ga0070713_102079312 | 3300005436 | Bacteria | 551 |
| 73 | Ga0070710_10009119 | 3300005437 | Bacteria | 4851 |
| 74 | Ga0070710_10231980 | 3300005437 | Bacteria | 1179 |
| 75 | Ga0070710_10253671 | 3300005437 | Bacteria | 1132 |
| 76 | Ga0070710_10820846 | 3300005437 | Bacteria | 666 |
| 77 | Ga0070711_100001448 | 3300005439 | Bacteria | 13051 |
| 78 | Ga0070711_100001690 | 3300005439 | Bacteria | 12227 |
| 79 | Ga0070711_100029325 | 3300005439 | Bacteria | 3630 |
| 80 | Ga0070711_100036734 | 3300005439 | Bacteria | 3283 |
| 81 | Ga0070711_101359918 | 3300005439 | Bacteria | 617 |
| 82 | Ga0070705_101265484 | 3300005440 | Bacteria | 610 |
| 83 | Ga0070700_100364937 | 3300005441 | Bacteria | 1075 |
| 84 | Ga0070694_101232044 | 3300005444 | Bacteria | 628 |
| 85 | Ga0070663_101974659 | 3300005455 | Bacteria | 525 |
| 86 | Ga0070678_100006219 | 3300005456 | Bacteria | 6983 |
| 87 | Ga0070681_10002406 | 3300005458 | Bacteria | 17107 |
| 88 | Ga0070681_10011014 | 3300005458 | Bacteria | 8938 |
| 89 | Ga0070681_10028327 | 3300005458 | Bacteria | 5631 |
| 90 | Ga0070681_10038707 | 3300005458 | Bacteria | 4780 |
| 91 | Ga0070681_10099145 | 3300005458 | Bacteria | 2860 |
| 92 | Ga0070681_10464530 | 3300005458 | Bacteria | 1178 |
| 93 | Ga0070681_10732764 | 3300005458 | Bacteria | 905 |
| 94 | Ga0070681_10930757 | 3300005458 | Bacteria | 788 |
| 95 | Ga0070685_10209980 | 3300005466 | Bacteria | 1270 |
| 96 | Ga0070706_100891019 | 3300005467 | Bacteria | 822 |
| 97 | Ga0070699_100050674 | 3300005518 | Bacteria | 3595 |
| 98 | Ga0070679_100008485 | 3300005530 | Bacteria | 9677 |
| 99 | Ga0070679_100026652 | 3300005530 | Bacteria | 5683 |
| 100 | Ga0070679_100045483 | 3300005530 | Bacteria | 4374 |
| 101 | Ga0070679_100103846 | 3300005530 | Bacteria | 2828 |
| 102 | Ga0070679_101157537 | 3300005530 | Bacteria | 718 |
| 103 | Ga0070679_101199944 | 3300005530 | Bacteria | 704 |
| 104 | Ga0070684_100215454 | 3300005535 | Unclassified | 1751 |
| 105 | Ga0068853_100067674 | 3300005539 | Unclassified | 3103 |
| 106 | Ga0068853_100808638 | 3300005539 | Unclassified | 898 |
| 107 | Ga0068853_102464071 | 3300005539 | Bacteria | 504 |
| 108 | Ga0070672_100111579 | 3300005543 | Bacteria | 2229 |
| 109 | Ga0070672_101112407 | 3300005543 | Bacteria | 702 |
| 110 | Ga0070686_100172414 | 3300005544 | Bacteria | 1531 |
| 111 | Ga0070695_100002291 | 3300005545 | Bacteria | 10967 |
| 112 | Ga0070696_100002201 | 3300005546 | Bacteria | 12856 |
| 113 | Ga0070696_101365837 | 3300005546 | Unclassified | 603 |
| 114 | Ga0070696_101488492 | 3300005546 | Bacteria | 579 |
| 115 | Ga0070696_101890571 | 3300005546 | Bacteria | 517 |
| 116 | Ga0070693_100031832 | 3300005547 | Bacteria | 2895 |
| 117 | Ga0070665_100007941 | 3300005548 | Bacteria | 10759 |
| 118 | Ga0070665_100011190 | 3300005548 | Bacteria | 9073 |
| 119 | Ga0070665_100018402 | 3300005548 | Bacteria | 7001 |
| 120 | Ga0070665_100057719 | 3300005548 | Unclassified | 3891 |
| 121 | Ga0070665_100073753 | 3300005548 | Bacteria | 3418 |
| 122 | Ga0070665_100083295 | 3300005548 | Bacteria | 3203 |
| 123 | Ga0070665_100204633 | 3300005548 | Bacteria | 1974 |
| 124 | Ga0070665_100442092 | 3300005548 | Bacteria | 1310 |
| 125 | Ga0070665_101137411 | 3300005548 | Bacteria | 792 |
| 126 | Ga0070704_100576501 | 3300005549 | Bacteria | 986 |
| 127 | Ga0068855_100000693 | 3300005563 | Bacteria | 41175 |
| 128 | Ga0068855_100007974 | 3300005563 | Bacteria | 12794 |
| 129 | Ga0068855_100012114 | 3300005563 | Bacteria | 10420 |
| 130 | Ga0068855_100029539 | 3300005563 | Bacteria | 6552 |
| 131 | Ga0068855_100071391 | 3300005563 | Bacteria | 4038 |
| 132 | Ga0068855_100589956 | 3300005563 | Bacteria | 1199 |
| 133 | Ga0068855_100745717 | 3300005563 | Bacteria | 1044 |
| 134 | Ga0068855_100958216 | 3300005563 | Bacteria | 901 |
| 135 | Ga0068855_101040434 | 3300005563 | Bacteria | 858 |
| 136 | Ga0068855_101178293 | 3300005563 | Bacteria | 798 |
| 137 | Ga0068855_101465488 | 3300005563 | Bacteria | 702 |
| 138 | Ga0068855_101754887 | 3300005563 | Bacteria | 632 |
| 139 | Ga0070664_100341648 | 3300005564 | Bacteria | 1360 |
| 140 | Ga0070664_100981290 | 3300005564 | Bacteria | 794 |
| 141 | Ga0068857_100160632 | 3300005577 | Bacteria | 2039 |
| 142 | Ga0068857_100567936 | 3300005577 | Bacteria | 1070 |
| 143 | Ga0068857_100603227 | 3300005577 | Bacteria | 1038 |
| 144 | Ga0068854_100063626 | 3300005578 | Bacteria | 2678 |
| 145 | Ga0068856_100002992 | 3300005614 | Bacteria | 17295 |
| 146 | Ga0068856_100029588 | 3300005614 | Bacteria | 5351 |
| 147 | Ga0068856_100257440 | 3300005614 | Bacteria | 1760 |
| 148 | Ga0068856_100502432 | 3300005614 | Bacteria | 1234 |
| 149 | Ga0068856_100698898 | 3300005614 | Bacteria | 1034 |
| 150 | Ga0068856_100746141 | 3300005614 | Bacteria | 999 |
| 151 | Ga0068856_102702220 | 3300005614 | Bacteria | 502 |
| 152 | Ga0068852_100326283 | 3300005616 | Bacteria | 1492 |
| 153 | Ga0068852_100489982 | 3300005616 | Bacteria | 1223 |
| 154 | Ga0068859_100001446 | 3300005617 | Bacteria | 24083 |
| 155 | Ga0068859_100022197 | 3300005617 | Bacteria | 6364 |
| 156 | Ga0068859_100563515 | 3300005617 | Bacteria | 1233 |
| 157 | Ga0068859_101130968 | 3300005617 | Bacteria | 862 |
| 158 | Ga0068859_101486445 | 3300005617 | Bacteria | 748 |
| 159 | Ga0068864_100183354 | 3300005618 | Bacteria | 1915 |
| 160 | Ga0068866_10061374 | 3300005718 | Bacteria | 1952 |
| 161 | Ga0068861_100195488 | 3300005719 | Unclassified | 1694 |
| 162 | Ga0068861_100339118 | 3300005719 | Bacteria | 1315 |
| 163 | Ga0068861_100616181 | 3300005719 | Bacteria | 998 |
| 164 | Ga0068861_101184369 | 3300005719 | Bacteria | 738 |
| 165 | Ga0068861_101897836 | 3300005719 | Bacteria | 592 |
| 166 | Ga0068851_10554496 | 3300005834 | Unclassified | 695 |
| 167 | Ga0068863_100003715 | 3300005841 | Bacteria | 15096 |
| 168 | Ga0068863_100036000 | 3300005841 | Bacteria | 4714 |
| 169 | Ga0068863_100092892 | 3300005841 | Bacteria | 2863 |
| 170 | Ga0068863_100309555 | 3300005841 | Bacteria | 1533 |
| 171 | Ga0068863_102670075 | 3300005841 | Bacteria | 508 |
| 172 | Ga0068858_100000923 | 3300005842 | Bacteria | 30501 |
| 173 | Ga0068858_100015855 | 3300005842 | Bacteria | 7083 |
| 174 | Ga0068858_100038907 | 3300005842 | Bacteria | 4411 |
| 175 | Ga0068860_100003837 | 3300005843 | Bacteria | 15454 |
| 176 | Ga0068860_100023810 | 3300005843 | Bacteria | 5919 |
| 177 | Ga0068860_100133543 | 3300005843 | Bacteria | 2383 |
| 178 | Ga0068860_101307843 | 3300005843 | Bacteria | 746 |
| 179 | Ga0068860_101338978 | 3300005843 | Bacteria | 737 |
| 180 | Ga0068860_101342709 | 3300005843 | Bacteria | 736 |
| 181 | Ga0068860_102646942 | 3300005843 | Bacteria | 520 |
| 182 | Ga0068862_100244899 | 3300005844 | Bacteria | 1632 |
| 183 | Ga0068862_100831763 | 3300005844 | Bacteria | 904 |
| 184 | Ga0068862_101536342 | 3300005844 | Bacteria | 672 |
| 185 | Ga0068862_101843357 | 3300005844 | Bacteria | 614 |
| 186 | Ga0068862_102603398 | 3300005844 | Bacteria | 518 |
| 187 | Ga0081455_10003109 | 3300005937 | Bacteria | 19318 |
| 188 | Ga0070717_10011989 | 3300006028 | Bacteria | 6599 |
| 189 | Ga0070717_10593276 | 3300006028 | Bacteria | 1005 |
| 190 | Ga0070715_10000812 | 3300006163 | Bacteria | 8521 |
| 191 | Ga0070715_10074778 | 3300006163 | Bacteria | 1522 |
| 192 | Ga0070715_10113784 | 3300006163 | Bacteria | 1280 |
| 193 | Ga0070715_10224001 | 3300006163 | Bacteria | 968 |
| 194 | Ga0070716_100008137 | 3300006173 | Bacteria | 5193 |
| 195 | Ga0070716_100035599 | 3300006173 | Bacteria | 2738 |
| 196 | Ga0070716_100047505 | 3300006173 | Bacteria | 2422 |
| 197 | Ga0070716_100179001 | 3300006173 | Bacteria | 1390 |
| 198 | Ga0070712_100003960 | 3300006175 | Bacteria | 9110 |
| 199 | Ga0070712_100028899 | 3300006175 | Bacteria | 3713 |
| 200 | Ga0070712_100031323 | 3300006175 | Bacteria | 3582 |
| 201 | Ga0070712_100172532 | 3300006175 | Bacteria | 1679 |
| 202 | Ga0075366_10724576 | 3300006195 | Bacteria | 618 |
| 203 | Ga0097621_100052692 | 3300006237 | Bacteria | 3315 |
| 204 | Ga0097621_100104519 | 3300006237 | Bacteria | 2387 |
| 205 | Ga0097621_100116484 | 3300006237 | Bacteria | 2263 |
| 206 | Ga0097621_100461564 | 3300006237 | Bacteria | 1146 |
| 207 | Ga0097621_100778179 | 3300006237 | Bacteria | 885 |
| 208 | Ga0068871_100008272 | 3300006358 | Bacteria | 7478 |
| 209 | Ga0068871_100038196 | 3300006358 | Bacteria | 3833 |
| 210 | Ga0068871_100160702 | 3300006358 | Bacteria | 1921 |
| 211 | Ga0068871_100226730 | 3300006358 | Bacteria | 1620 |
| 212 | Ga0068871_100246494 | 3300006358 | Unclassified | 1555 |
| 213 | Ga0068871_100401873 | 3300006358 | Bacteria | 1220 |
| 214 | Ga0068871_100853305 | 3300006358 | Bacteria | 842 |
| 215 | Ga0068871_100970698 | 3300006358 | Bacteria | 790 |
| 216 | Ga0075430_100377506 | 3300006846 | Bacteria | 1170 |
| 217 | Ga0075434_102507879 | 3300006871 | Bacteria | 517 |
| 218 | Ga0068865_100000707 | 3300006881 | Bacteria | 18739 |
| 219 | Ga0075436_100547754 | 3300006914 | Bacteria | 849 |
| 220 | Ga0097620_100001446 | 3300006931 | Bacteria | 24083 |
| 221 | Ga0097620_100022197 | 3300006931 | Bacteria | 6364 |
| 222 | Ga0097620_100563614 | 3300006931 | Bacteria | 1233 |
| 223 | Ga0097620_101130994 | 3300006931 | Bacteria | 862 |
| 224 | Ga0097620_101486373 | 3300006931 | Bacteria | 748 |
| 225 | Ga0075435_100103088 | 3300007076 | Bacteria | 2366 |
| 226 | Ga0075435_100964984 | 3300007076 | Bacteria | 744 |
| 227 | Ga0099794_10085781 | 3300007265 | Bacteria | 1558 |
| 228 | Ga0099794_10302753 | 3300007265 | Bacteria | 828 |
| 229 | Ga0099794_10767390 | 3300007265 | Unclassified | 515 |
| 230 | Ga0099795_10039241 | 3300007788 | Bacteria | 1675 |
| 231 | Ga0105251_10253712 | 3300009011 | Bacteria | 793 |
| 232 | Ga0105250_10000008 | 3300009092 | Bacteria | 343965 |
| 233 | Ga0105250_10014783 | 3300009092 | Bacteria | 3202 |
| 234 | Ga0105250_10025876 | 3300009092 | Bacteria | 2364 |
| 235 | Ga0105250_10128776 | 3300009092 | Bacteria | 1044 |
| 236 | Ga0105240_10004628 | 3300009093 | Bacteria | 20859 |
| 237 | Ga0105240_10010993 | 3300009093 | Bacteria | 12673 |
| 238 | Ga0105240_10024454 | 3300009093 | Bacteria | 7959 |
| 239 | Ga0105240_10028720 | 3300009093 | Bacteria | 7256 |
| 240 | Ga0105240_10028754 | 3300009093 | Bacteria | 7251 |
| 241 | Ga0105240_10043136 | 3300009093 | Bacteria | 5742 |
| 242 | Ga0105240_10116761 | 3300009093 | Bacteria | 3219 |
| 243 | Ga0105240_10147249 | 3300009093 | Bacteria | 2808 |
| 244 | Ga0105240_10154560 | 3300009093 | Unclassified | 2730 |
| 245 | Ga0105240_10164555 | 3300009093 | Bacteria | 2632 |
| 246 | Ga0105240_10281934 | 3300009093 | Bacteria | 1908 |
| 247 | Ga0105240_10938195 | 3300009093 | Unclassified | 929 |
| 248 | Ga0111539_10593362 | 3300009094 | Bacteria | 1290 |
| 249 | Ga0111539_12128562 | 3300009094 | Bacteria | 651 |
| 250 | Ga0105245_10004650 | 3300009098 | Bacteria | 12127 |
| 251 | Ga0105247_10001598 | 3300009101 | Bacteria | 16036 |
| 252 | Ga0105247_10002642 | 3300009101 | Bacteria | 12068 |
| 253 | Ga0105247_10030993 | 3300009101 | Bacteria | 3243 |
| 254 | Ga0105247_10057762 | 3300009101 | Bacteria | 2399 |
| 255 | Ga0105247_10274345 | 3300009101 | Bacteria | 1161 |
| 256 | Ga0105247_10909503 | 3300009101 | Bacteria | 680 |
| 257 | Ga0105247_11180482 | 3300009101 | Bacteria | 608 |
| 258 | Ga0105243_10280747 | 3300009148 | Bacteria | 1500 |
| 259 | Ga0105243_10663602 | 3300009148 | Bacteria | 1012 |
| 260 | Ga0105241_10009873 | 3300009174 | Bacteria | 7016 |
| 261 | Ga0105241_10209638 | 3300009174 | Bacteria | 1632 |
| 262 | Ga0105241_10275312 | 3300009174 | Unclassified | 1435 |
| 263 | Ga0105241_10617024 | 3300009174 | Bacteria | 981 |
| 264 | Ga0105241_10799583 | 3300009174 | Unclassified | 869 |
| 265 | Ga0105242_10003540 | 3300009176 | Bacteria | 12140 |
| 266 | Ga0105242_11704286 | 3300009176 | Bacteria | 666 |
| 267 | Ga0105242_12668513 | 3300009176 | Bacteria | 549 |
| 268 | Ga0105248_10039031 | 3300009177 | Bacteria | 5316 |
| 269 | Ga0105248_10068735 | 3300009177 | Unclassified | 3977 |
| 270 | Ga0105248_10195359 | 3300009177 | Bacteria | 2280 |
| 271 | Ga0105248_10547375 | 3300009177 | Bacteria | 1305 |
| 272 | Ga0105248_11165583 | 3300009177 | Bacteria | 871 |
| 273 | Ga0105248_11675985 | 3300009177 | Bacteria | 721 |
| 274 | Ga0105237_10010118 | 3300009545 | Bacteria | 10053 |
| 275 | Ga0105237_10054755 | 3300009545 | Bacteria | 3997 |
| 276 | Ga0105237_10093481 | 3300009545 | Unclassified | 2996 |
| 277 | Ga0105237_10323493 | 3300009545 | Bacteria | 1546 |
| 278 | Ga0105237_10764971 | 3300009545 | Bacteria | 972 |
| 279 | Ga0105237_11412801 | 3300009545 | Unclassified | 702 |
| 280 | Ga0105237_11477807 | 3300009545 | Bacteria | 686 |
| 281 | Ga0105237_11611060 | 3300009545 | Bacteria | 656 |
| 282 | Ga0105237_11631540 | 3300009545 | Bacteria | 652 |
| 283 | Ga0105237_12529716 | 3300009545 | Bacteria | 524 |
| 284 | Ga0105238_10007205 | 3300009551 | Bacteria | 11131 |
| 285 | Ga0105238_10026224 | 3300009551 | Bacteria | 5939 |
| 286 | Ga0105238_10027723 | 3300009551 | Bacteria | 5773 |
| 287 | Ga0105238_10032952 | 3300009551 | Bacteria | 5273 |
| 288 | Ga0105238_10088963 | 3300009551 | Bacteria | 3075 |
| 289 | Ga0105238_10535123 | 3300009551 | Bacteria | 1175 |
| 290 | Ga0105238_10655197 | 3300009551 | Bacteria | 1060 |
| 291 | Ga0105238_10663366 | 3300009551 | Unclassified | 1054 |
| 292 | Ga0105238_10793161 | 3300009551 | Unclassified | 962 |
| 293 | Ga0105238_11535852 | 3300009551 | Bacteria | 695 |
| 294 | Ga0105238_11646085 | 3300009551 | Bacteria | 672 |
| 295 | Ga0105238_11908095 | 3300009551 | Bacteria | 627 |
| 296 | Ga0105249_10009685 | 3300009553 | Bacteria | 8443 |
| 297 | Ga0105249_10058278 | 3300009553 | Bacteria | 3540 |
| 298 | Ga0105249_10091371 | 3300009553 | Unclassified | 2848 |
| 299 | Ga0105249_10112187 | 3300009553 | Unclassified | 2578 |
| 300 | Ga0105249_11261957 | 3300009553 | Bacteria | 810 |
| 301 | Ga0105249_12357706 | 3300009553 | Bacteria | 605 |
| 302 | Ga0099796_10006378 | 3300010159 | Bacteria | 3014 |
| 303 | Ga0099796_10128312 | 3300010159 | Unclassified | 981 |
| 304 | Ga0105239_10011733 | 3300010375 | Bacteria | 9779 |
| 305 | Ga0105239_10348829 | 3300010375 | Bacteria | 1671 |
| 306 | Ga0105239_10657457 | 3300010375 | Bacteria | 1197 |
| 307 | Ga0105239_10813070 | 3300010375 | Bacteria | 1071 |
| 308 | Ga0105239_11024879 | 3300010375 | Bacteria | 949 |
| 309 | Ga0105239_11554572 | 3300010375 | Bacteria | 765 |
| 310 | Ga0105246_10838915 | 3300011119 | Bacteria | 819 |
| 311 | Ga0157373_10270097 | 3300013100 | Bacteria | 1204 |
| 312 | Ga0157373_11307076 | 3300013100 | Bacteria | 549 |
| 313 | Ga0157371_10396531 | 3300013102 | Bacteria | 1009 |
| 314 | Ga0157370_10003622 | 3300013104 | Bacteria | 18073 |
| 315 | Ga0157370_10232090 | 3300013104 | Bacteria | 1708 |
| 316 | Ga0157370_10237802 | 3300013104 | Bacteria | 1685 |
| 317 | Ga0157370_10747375 | 3300013104 | Bacteria | 891 |
| 318 | Ga0157369_10021134 | 3300013105 | Bacteria | 7276 |
| 319 | Ga0157369_10024057 | 3300013105 | Bacteria | 6778 |
| 320 | Ga0157369_10176655 | 3300013105 | Bacteria | 2248 |
| 321 | Ga0157369_10684372 | 3300013105 | Bacteria | 1057 |
| 322 | Ga0157369_10854323 | 3300013105 | Bacteria | 934 |
| 323 | Ga0157369_10981187 | 3300013105 | Unclassified | 865 |
| 324 | Ga0157369_11259261 | 3300013105 | Bacteria | 754 |
| 325 | Ga0157374_10007407 | 3300013296 | Bacteria | 9360 |
| 326 | Ga0157374_10153396 | 3300013296 | Unclassified | 2241 |
| 327 | Ga0157374_10610603 | 3300013296 | Bacteria | 1101 |
| 328 | Ga0157374_11872227 | 3300013296 | Unclassified | 626 |
| 329 | Ga0157378_10002799 | 3300013297 | Bacteria | 15556 |
| 330 | Ga0163162_10055915 | 3300013306 | Bacteria | 3975 |
| 331 | Ga0163162_10200494 | 3300013306 | Unclassified | 2124 |
| 332 | Ga0157372_10094880 | 3300013307 | Unclassified | 3398 |
| 333 | Ga0157372_10273484 | 3300013307 | Bacteria | 1963 |
| 334 | Ga0157372_10616000 | 3300013307 | Bacteria | 1265 |
| 335 | Ga0157372_10789333 | 3300013307 | Bacteria | 1104 |
| 336 | Ga0157372_10792805 | 3300013307 | Bacteria | 1101 |
| 337 | Ga0157375_10085903 | 3300013308 | Bacteria | 3196 |
| 338 | Ga0157375_10560464 | 3300013308 | Bacteria | 1304 |
| 339 | Ga0157375_13010206 | 3300013308 | Bacteria | 563 |
| 340 | Ga0163163_10047476 | 3300014325 | Unclassified | 4221 |
| 341 | Ga0163163_10048922 | 3300014325 | Bacteria | 4160 |
| 342 | Ga0163163_10066336 | 3300014325 | Bacteria | 3584 |
| 343 | Ga0163163_10259988 | 3300014325 | Bacteria | 1787 |
| 344 | Ga0163163_10900232 | 3300014325 | Bacteria | 948 |
| 345 | Ga0163163_10968168 | 3300014325 | Bacteria | 914 |
| 346 | Ga0163163_12781601 | 3300014325 | Bacteria | 546 |
| 347 | Ga0157380_11485283 | 3300014326 | Bacteria | 730 |
| 348 | Ga0157379_10000026 | 3300014968 | Bacteria | 88552 |
| 349 | Ga0157379_10042016 | 3300014968 | Bacteria | 4080 |
| 350 | Ga0157379_10063343 | 3300014968 | Bacteria | 3306 |
| 351 | Ga0157379_10071652 | 3300014968 | Bacteria | 3100 |
| 352 | Ga0157379_10088028 | 3300014968 | Bacteria | 2784 |
| 353 | Ga0157379_10583642 | 3300014968 | Bacteria | 1042 |
| 354 | Ga0157379_10893066 | 3300014968 | Bacteria | 843 |
| 355 | Ga0157379_10980282 | 3300014968 | Unclassified | 805 |
| 356 | Ga0157379_10983286 | 3300014968 | Bacteria | 804 |
| 357 | Ga0157379_11007308 | 3300014968 | Bacteria | 794 |
| 358 | Ga0157379_11267599 | 3300014968 | Bacteria | 711 |
| 359 | Ga0157379_11397788 | 3300014968 | Bacteria | 678 |
| 360 | Ga0157376_10184913 | 3300014969 | Bacteria | 1907 |
| 361 | Ga0157376_10423570 | 3300014969 | Bacteria | 1292 |
| 362 | Ga0157376_10601122 | 3300014969 | Bacteria | 1095 |
| 363 | Ga0157376_12304100 | 3300014969 | Bacteria | 578 |
| 364 | Ga0157376_12435290 | 3300014969 | Bacteria | 563 |
| 365 | Ga0184599_114780 | 3300019188 | Bacteria | 600 |
| 366 | Ga0197907_10584797 | 3300020069 | Bacteria | 694 |
| 367 | Ga0197907_10647479 | 3300020069 | Bacteria | 1053 |
| 368 | Ga0197907_10794903 | 3300020069 | Bacteria | 631 |
| 369 | Ga0197907_10903739 | 3300020069 | Bacteria | 710 |
| 370 | Ga0206356_11095295 | 3300020070 | Bacteria | 545 |
| 371 | Ga0206356_11599040 | 3300020070 | Bacteria | 718 |
| 372 | Ga0206355_1163233 | 3300020076 | Bacteria | 803 |
| 373 | Ga0206355_1233070 | 3300020076 | Bacteria | 635 |
| 374 | Ga0206352_10016966 | 3300020078 | Unclassified | 504 |
| 375 | Ga0206352_10143364 | 3300020078 | Bacteria | 531 |
| 376 | Ga0206352_10222627 | 3300020078 | Bacteria | 716 |
| 377 | Ga0206352_10679191 | 3300020078 | Unclassified | 622 |
| 378 | Ga0206352_10825076 | 3300020078 | Bacteria | 637 |
| 379 | Ga0206352_10942844 | 3300020078 | Bacteria | 622 |
| 380 | Ga0206354_10069854 | 3300020081 | Bacteria | 591 |
| 381 | Ga0206354_10145166 | 3300020081 | Bacteria | 512 |
| 382 | Ga0206354_10320488 | 3300020081 | Bacteria | 1492 |
| 383 | Ga0206354_10439605 | 3300020081 | Bacteria | 1510 |
| 384 | Ga0206354_10868956 | 3300020081 | Bacteria | 680 |
| 385 | Ga0206353_10180188 | 3300020082 | Bacteria | 970 |
| 386 | Ga0206353_11146841 | 3300020082 | Bacteria | 1133 |
| 387 | Ga0206353_11388057 | 3300020082 | Bacteria | 554 |
| 388 | Ga0213873_10068300 | 3300021358 | Bacteria | 975 |
| 389 | Ga0213874_10014398 | 3300021377 | Bacteria | 2067 |
| 390 | Ga0213874_10017982 | 3300021377 | Bacteria | 1904 |
| 391 | Ga0213874_10250182 | 3300021377 | Bacteria | 653 |
| 392 | Ga0213876_10210978 | 3300021384 | Bacteria | 1032 |
| 393 | Ga0213876_10241696 | 3300021384 | Bacteria | 960 |
| 394 | Ga0213871_10176725 | 3300021441 | Bacteria | 659 |
| 395 | Ga0224712_10078000 | 3300022467 | Bacteria | 1361 |
| 396 | Ga0224712_10141161 | 3300022467 | Bacteria | 1060 |
| 397 | Ga0224712_10181636 | 3300022467 | Bacteria | 948 |
| 398 | Ga0224712_10556745 | 3300022467 | Unclassified | 558 |
| 399 | Ga0207656_10065789 | 3300025321 | Unclassified | 1601 |
| 400 | Ga0207696_1000119 | 3300025711 | Bacteria | 147213 |
| 401 | Ga0207696_1097847 | 3300025711 | Bacteria | 801 |
| 402 | Ga0207692_10006695 | 3300025898 | Bacteria | 4685 |
| 403 | Ga0207692_10018116 | 3300025898 | Bacteria | 3155 |
| 404 | Ga0207692_10038879 | 3300025898 | Bacteria | 2336 |
| 405 | Ga0207642_10443362 | 3300025899 | Bacteria | 785 |
| 406 | Ga0207710_10002602 | 3300025900 | Bacteria | 8325 |
| 407 | Ga0207710_10008629 | 3300025900 | Bacteria | 4297 |
| 408 | Ga0207710_10041882 | 3300025900 | Bacteria | 2032 |
| 409 | Ga0207710_10057432 | 3300025900 | Bacteria | 1758 |
| 410 | Ga0207710_10229023 | 3300025900 | Bacteria | 924 |
| 411 | Ga0207680_10022741 | 3300025903 | Bacteria | 3414 |
| 412 | Ga0207680_10119513 | 3300025903 | Bacteria | 1721 |
| 413 | Ga0207680_10162187 | 3300025903 | Bacteria | 1500 |
| 414 | Ga0207680_10481202 | 3300025903 | Bacteria | 883 |
| 415 | Ga0207647_10278386 | 3300025904 | Bacteria | 955 |
| 416 | Ga0207685_10013010 | 3300025905 | Bacteria | 2561 |
| 417 | Ga0207685_10028629 | 3300025905 | Bacteria | 1964 |
| 418 | Ga0207685_10540125 | 3300025905 | Bacteria | 619 |
| 419 | Ga0207685_10712275 | 3300025905 | Bacteria | 547 |
| 420 | Ga0207699_10001744 | 3300025906 | Bacteria | 10267 |
| 421 | Ga0207699_10028729 | 3300025906 | Bacteria | 3094 |
| 422 | Ga0207699_11021427 | 3300025906 | Unclassified | 611 |
| 423 | Ga0207684_11110691 | 3300025910 | Bacteria | 658 |
| 424 | Ga0207654_10202506 | 3300025911 | Unclassified | 1308 |
| 425 | Ga0207654_10210013 | 3300025911 | Bacteria | 1286 |
| 426 | Ga0207654_10470797 | 3300025911 | Bacteria | 884 |
| 427 | Ga0207654_10648261 | 3300025911 | Unclassified | 756 |
| 428 | Ga0207707_10000115 | 3300025912 | Bacteria | 81416 |
| 429 | Ga0207707_10000140 | 3300025912 | Bacteria | 74787 |
| 430 | Ga0207707_10000148 | 3300025912 | Bacteria | 73167 |
| 431 | Ga0207707_10002518 | 3300025912 | Bacteria | 16477 |
| 432 | Ga0207707_10026877 | 3300025912 | Bacteria | 5030 |
| 433 | Ga0207707_10050202 | 3300025912 | Bacteria | 3635 |
| 434 | Ga0207707_10052947 | 3300025912 | Bacteria | 3533 |
| 435 | Ga0207707_10163285 | 3300025912 | Bacteria | 1947 |
| 436 | Ga0207707_10183333 | 3300025912 | Bacteria | 1827 |
| 437 | Ga0207695_10019465 | 3300025913 | Bacteria | 7819 |
| 438 | Ga0207695_10029928 | 3300025913 | Bacteria | 6006 |
| 439 | Ga0207695_10030248 | 3300025913 | Bacteria | 5964 |
| 440 | Ga0207695_10069859 | 3300025913 | Unclassified | 3593 |
| 441 | Ga0207695_10076523 | 3300025913 | Bacteria | 3402 |
| 442 | Ga0207695_10117609 | 3300025913 | Bacteria | 2630 |
| 443 | Ga0207695_10130356 | 3300025913 | Bacteria | 2472 |
| 444 | Ga0207695_10248331 | 3300025913 | Bacteria | 1679 |
| 445 | Ga0207695_10285620 | 3300025913 | Bacteria | 1543 |
| 446 | Ga0207695_10300392 | 3300025913 | Bacteria | 1497 |
| 447 | Ga0207695_10334119 | 3300025913 | Bacteria | 1403 |
| 448 | Ga0207695_10611253 | 3300025913 | Unclassified | 971 |
| 449 | Ga0207671_10022423 | 3300025914 | Bacteria | 4776 |
| 450 | Ga0207671_10041438 | 3300025914 | Bacteria | 3408 |
| 451 | Ga0207671_10118150 | 3300025914 | Unclassified | 2025 |
| 452 | Ga0207671_10150913 | 3300025914 | Bacteria | 1795 |
| 453 | Ga0207671_10225516 | 3300025914 | Bacteria | 1469 |
| 454 | Ga0207671_10265496 | 3300025914 | Bacteria | 1351 |
| 455 | Ga0207671_10965459 | 3300025914 | Bacteria | 672 |
| 456 | Ga0207671_11234432 | 3300025914 | Bacteria | 584 |
| 457 | Ga0207671_11257285 | 3300025914 | Bacteria | 577 |
| 458 | Ga0207671_11534399 | 3300025914 | Bacteria | 514 |
| 459 | Ga0207693_10001073 | 3300025915 | Bacteria | 24508 |
| 460 | Ga0207693_10096674 | 3300025915 | Bacteria | 2315 |
| 461 | Ga0207693_10145556 | 3300025915 | Bacteria | 1863 |
| 462 | Ga0207663_10015727 | 3300025916 | Bacteria | 4182 |
| 463 | Ga0207663_10046213 | 3300025916 | Bacteria | 2681 |
| 464 | Ga0207663_10150811 | 3300025916 | Bacteria | 1631 |
| 465 | Ga0207663_11123699 | 3300025916 | Bacteria | 632 |
| 466 | Ga0207663_11204552 | 3300025916 | Bacteria | 610 |
| 467 | Ga0207660_10123735 | 3300025917 | Bacteria | 1962 |
| 468 | Ga0207660_10290489 | 3300025917 | Bacteria | 1300 |
| 469 | Ga0207660_10414623 | 3300025917 | Bacteria | 1086 |
| 470 | Ga0207660_11136872 | 3300025917 | Bacteria | 636 |
| 471 | Ga0207649_11684838 | 3300025920 | Bacteria | 502 |
| 472 | Ga0207652_10007347 | 3300025921 | Bacteria | 8882 |
| 473 | Ga0207652_10042736 | 3300025921 | Bacteria | 3859 |
| 474 | Ga0207652_10105104 | 3300025921 | Bacteria | 2498 |
| 475 | Ga0207652_10129069 | 3300025921 | Bacteria | 2254 |
| 476 | Ga0207652_10349665 | 3300025921 | Bacteria | 1334 |
| 477 | Ga0207694_10021741 | 3300025924 | Bacteria | 4861 |
| 478 | Ga0207694_10068598 | 3300025924 | Bacteria | 2769 |
| 479 | Ga0207694_10113623 | 3300025924 | Unclassified | 2156 |
| 480 | Ga0207694_10198560 | 3300025924 | Unclassified | 1631 |
| 481 | Ga0207694_10321892 | 3300025924 | Bacteria | 1276 |
| 482 | Ga0207694_10360260 | 3300025924 | Bacteria | 1205 |
| 483 | Ga0207694_10405768 | 3300025924 | Bacteria | 1133 |
| 484 | Ga0207694_10475932 | 3300025924 | Bacteria | 1044 |
| 485 | Ga0207694_11230806 | 3300025924 | Bacteria | 633 |
| 486 | Ga0207694_11324770 | 3300025924 | Bacteria | 609 |
| 487 | Ga0207694_11693444 | 3300025924 | Unclassified | 532 |
| 488 | Ga0207650_10121695 | 3300025925 | Unclassified | 2033 |
| 489 | Ga0207687_10359695 | 3300025927 | Bacteria | 1188 |
| 490 | Ga0207700_10043999 | 3300025928 | Bacteria | 3284 |
| 491 | Ga0207700_10105359 | 3300025928 | Bacteria | 2258 |
| 492 | Ga0207700_10129955 | 3300025928 | Bacteria | 2055 |
| 493 | Ga0207700_10272844 | 3300025928 | Bacteria | 1452 |
| 494 | Ga0207700_10313481 | 3300025928 | Bacteria | 1358 |
| 495 | Ga0207664_10002103 | 3300025929 | Bacteria | 13096 |
| 496 | Ga0207664_10043798 | 3300025929 | Bacteria | 3503 |
| 497 | Ga0207664_11236179 | 3300025929 | Bacteria | 665 |
| 498 | Ga0207644_10010743 | 3300025931 | Bacteria | 6038 |
| 499 | Ga0207644_10238995 | 3300025931 | Bacteria | 1445 |
| 500 | Ga0207644_11301653 | 3300025931 | Bacteria | 611 |
| 501 | Ga0207709_10111002 | 3300025935 | Bacteria | 1833 |
| 502 | Ga0207709_10974497 | 3300025935 | Bacteria | 692 |
| 503 | Ga0207669_11514255 | 3300025937 | Bacteria | 572 |
| 504 | Ga0207704_10178721 | 3300025938 | Bacteria | 1531 |
| 505 | Ga0207704_11120415 | 3300025938 | Bacteria | 669 |
| 506 | Ga0207665_10009900 | 3300025939 | Bacteria | 6255 |
| 507 | Ga0207665_10024297 | 3300025939 | Bacteria | 3995 |
| 508 | Ga0207665_10209974 | 3300025939 | Bacteria | 1422 |
| 509 | Ga0207665_11105230 | 3300025939 | Bacteria | 632 |
| 510 | Ga0207665_11303078 | 3300025939 | Bacteria | 579 |
| 511 | Ga0207691_10028917 | 3300025940 | Bacteria | 5187 |
| 512 | Ga0207691_10532919 | 3300025940 | Bacteria | 996 |
| 513 | Ga0207711_10009890 | 3300025941 | Bacteria | 7931 |
| 514 | Ga0207711_10392876 | 3300025941 | Bacteria | 1288 |
| 515 | Ga0207711_10451073 | 3300025941 | Unclassified | 1197 |
| 516 | Ga0207689_10257729 | 3300025942 | Bacteria | 1443 |
| 517 | Ga0207689_10367985 | 3300025942 | Bacteria | 1196 |
| 518 | Ga0207689_10714680 | 3300025942 | Bacteria | 845 |
| 519 | Ga0207689_11323870 | 3300025942 | Bacteria | 605 |
| 520 | Ga0207661_10085908 | 3300025944 | Bacteria | 2609 |
| 521 | Ga0207679_11498530 | 3300025945 | Bacteria | 619 |
| 522 | Ga0207667_10001288 | 3300025949 | Bacteria | 31396 |
| 523 | Ga0207667_10002087 | 3300025949 | Bacteria | 25043 |
| 524 | Ga0207667_10004284 | 3300025949 | Bacteria | 17483 |
| 525 | Ga0207667_10029032 | 3300025949 | Bacteria | 6002 |
| 526 | Ga0207667_10030638 | 3300025949 | Bacteria | 5817 |
| 527 | Ga0207667_10135711 | 3300025949 | Bacteria | 2534 |
| 528 | Ga0207667_10504949 | 3300025949 | Bacteria | 1226 |
| 529 | Ga0207667_10964254 | 3300025949 | Bacteria | 842 |
| 530 | Ga0207667_11159501 | 3300025949 | Bacteria | 754 |
| 531 | Ga0207651_10201044 | 3300025960 | Bacteria | 1597 |
| 532 | Ga0207712_10140632 | 3300025961 | Bacteria | 1852 |
| 533 | Ga0207712_10148369 | 3300025961 | Bacteria | 1809 |
| 534 | Ga0207712_10197477 | 3300025961 | Bacteria | 1592 |
| 535 | Ga0207712_10250731 | 3300025961 | Bacteria | 1431 |
| 536 | Ga0207712_10719414 | 3300025961 | Unclassified | 873 |
| 537 | Ga0207712_10984952 | 3300025961 | Bacteria | 748 |
| 538 | Ga0207712_11356770 | 3300025961 | Bacteria | 636 |
| 539 | Ga0207668_11011456 | 3300025972 | Bacteria | 743 |
| 540 | Ga0207640_11164909 | 3300025981 | Unclassified | 684 |
| 541 | Ga0207658_10000591 | 3300025986 | Bacteria | 32569 |
| 542 | Ga0207658_10010518 | 3300025986 | Bacteria | 6286 |
| 543 | Ga0207658_10597585 | 3300025986 | Bacteria | 991 |
| 544 | Ga0207658_11277168 | 3300025986 | Bacteria | 671 |
| 545 | Ga0207658_12070820 | 3300025986 | Bacteria | 517 |
| 546 | Ga0207677_10010510 | 3300026023 | Bacteria | 5242 |
| 547 | Ga0207703_10002339 | 3300026035 | Bacteria | 16532 |
| 548 | Ga0207703_10002459 | 3300026035 | Bacteria | 16067 |
| 549 | Ga0207703_10047903 | 3300026035 | Bacteria | 3447 |
| 550 | Ga0207639_10021354 | 3300026041 | Bacteria | 4650 |
| 551 | Ga0207639_10176300 | 3300026041 | Bacteria | 1815 |
| 552 | Ga0207639_10333425 | 3300026041 | Bacteria | 1351 |
| 553 | Ga0207639_10909001 | 3300026041 | Unclassified | 823 |
| 554 | Ga0207639_11469793 | 3300026041 | Bacteria | 640 |
| 555 | Ga0207678_10041356 | 3300026067 | Unclassified | 3997 |
| 556 | Ga0207678_10870975 | 3300026067 | Bacteria | 796 |
| 557 | Ga0207708_10810691 | 3300026075 | Bacteria | 806 |
| 558 | Ga0207702_10015793 | 3300026078 | Bacteria | 6252 |
| 559 | Ga0207702_10117519 | 3300026078 | Bacteria | 2374 |
| 560 | Ga0207702_10361455 | 3300026078 | Bacteria | 1391 |
| 561 | Ga0207702_11571241 | 3300026078 | Bacteria | 651 |
| 562 | Ga0207641_10003942 | 3300026088 | Bacteria | 12973 |
| 563 | Ga0207641_10103026 | 3300026088 | Bacteria | 2517 |
| 564 | Ga0207641_10134444 | 3300026088 | Unclassified | 2224 |
| 565 | Ga0207641_11052030 | 3300026088 | Bacteria | 812 |
| 566 | Ga0207641_11990089 | 3300026088 | Bacteria | 582 |
| 567 | Ga0207648_10056590 | 3300026089 | Bacteria | 3422 |
| 568 | Ga0207676_10089263 | 3300026095 | Unclassified | 2526 |
| 569 | Ga0207674_10196527 | 3300026116 | Bacteria | 1966 |
| 570 | Ga0207674_10312835 | 3300026116 | Bacteria | 1520 |
| 571 | Ga0207674_10675999 | 3300026116 | Bacteria | 997 |
| 572 | Ga0207674_10749017 | 3300026116 | Bacteria | 943 |
| 573 | Ga0207675_100091899 | 3300026118 | Bacteria | 2854 |
| 574 | Ga0207675_100114131 | 3300026118 | Bacteria | 2551 |
| 575 | Ga0207675_100343058 | 3300026118 | Bacteria | 1462 |
| 576 | Ga0207675_100649500 | 3300026118 | Unclassified | 1061 |
| 577 | Ga0207683_10013351 | 3300026121 | Bacteria | 7005 |
| 578 | Ga0207698_10199917 | 3300026142 | Bacteria | 1789 |
| 579 | Ga0207698_10300900 | 3300026142 | Bacteria | 1493 |
| 580 | Ga0209179_1000814 | 3300027512 | Bacteria | 3434 |
| 581 | Ga0209588_1253812 | 3300027671 | Unclassified | 537 |
| 582 | Ga0207428_11076127 | 3300027907 | Bacteria | 563 |
| 583 | Ga0265354_1000847 | 3300028016 | Bacteria | 4922 |
| 584 | Ga0265356_1002589 | 3300028017 | Bacteria | 2381 |
| 585 | Ga0268266_10000228 | 3300028379 | Bacteria | 97214 |
| 586 | Ga0268266_10033695 | 3300028379 | Bacteria | 4353 |
| 587 | Ga0268266_10036093 | 3300028379 | Unclassified | 4205 |
| 588 | Ga0268266_10088200 | 3300028379 | Bacteria | 2715 |
| 589 | Ga0268266_10112965 | 3300028379 | Bacteria | 2408 |
| 590 | Ga0268266_10284859 | 3300028379 | Unclassified | 1537 |
| 591 | Ga0268266_10303330 | 3300028379 | Bacteria | 1490 |
| 592 | Ga0268265_10231954 | 3300028380 | Bacteria | 1623 |
| 593 | Ga0268265_10465256 | 3300028380 | Bacteria | 1184 |
| 594 | Ga0268265_10522789 | 3300028380 | Bacteria | 1122 |
| 595 | Ga0268265_10785514 | 3300028380 | Bacteria | 927 |
| 596 | Ga0268264_10000415 | 3300028381 | Bacteria | 60291 |
| 597 | Ga0268264_10055146 | 3300028381 | Bacteria | 3321 |
| 598 | Ga0268264_10310376 | 3300028381 | Bacteria | 1488 |
| 599 | Ga0268264_10480672 | 3300028381 | Bacteria | 1208 |
| 600 | Ga0268264_10973854 | 3300028381 | Bacteria | 854 |
| 601 | Ga0268264_11503279 | 3300028381 | Bacteria | 684 |
| 602 | Ga0268264_11985495 | 3300028381 | Unclassified | 591 |
| 603 | Ga0265326_10006119 | 3300028558 | Bacteria | 3756 |
| 604 | Ga0265319_1003343 | 3300028563 | Bacteria | 8408 |
| 605 | Ga0265334_10000110 | 3300028573 | Bacteria | 54049 |
| 606 | Ga0265334_10116511 | 3300028573 | Bacteria | 957 |
| 607 | Ga0265318_10001420 | 3300028577 | Bacteria | 14164 |
| 608 | Ga0265322_10054530 | 3300028654 | Bacteria | 1134 |
| 609 | Ga0307515_10121469 | 3300028794 | Bacteria | 2955 |
| 610 | Ga0307515_10386611 | 3300028794 | Bacteria | 1030 |
| 611 | Ga0265338_10003886 | 3300028800 | Bacteria | 20664 |
| 612 | Ga0265338_10004595 | 3300028800 | Bacteria | 18576 |
| 613 | Ga0265338_10121167 | 3300028800 | Bacteria | 2085 |
| 614 | Ga0265338_10301988 | 3300028800 | Unclassified | 1163 |
| 615 | Ga0265338_11011668 | 3300028800 | Bacteria | 562 |
| 616 | Ga0307511_10000048 | 3300030521 | Bacteria | 98665 |
| 617 | Ga0307511_10444357 | 3300030521 | Bacteria | 515 |
| 618 | Ga0265763_1004567 | 3300030763 | Bacteria | 1139 |
| 619 | Ga0265763_1018299 | 3300030763 | Bacteria | 718 |
| 620 | Ga0265766_1018122 | 3300030863 | Bacteria | 563 |
| 621 | Ga0265770_1000921 | 3300030878 | Bacteria | 4081 |
| 622 | Ga0265765_1012333 | 3300030879 | Bacteria | 968 |
| 623 | Ga0265769_120132 | 3300030888 | Bacteria | 526 |
| 624 | Ga0265768_114525 | 3300030963 | Bacteria | 541 |
| 625 | Ga0265760_10019346 | 3300031090 | Bacteria | 1962 |
| 626 | Ga0265760_10019513 | 3300031090 | Bacteria | 1953 |
| 627 | Ga0265330_10001462 | 3300031235 | Bacteria | 13759 |
| 628 | Ga0265332_10003322 | 3300031238 | Bacteria | 7806 |
| 629 | Ga0265328_10002296 | 3300031239 | Bacteria | 8615 |
| 630 | Ga0265320_10006743 | 3300031240 | Bacteria | 7211 |
| 631 | Ga0265325_10021380 | 3300031241 | Bacteria | 3554 |
| 632 | Ga0265329_10005689 | 3300031242 | Bacteria | 5012 |
| 633 | Ga0265340_10017992 | 3300031247 | Bacteria | 3653 |
| 634 | Ga0265340_10055284 | 3300031247 | Bacteria | 1912 |
| 635 | Ga0265340_10437074 | 3300031247 | Bacteria | 577 |
| 636 | Ga0265339_10059451 | 3300031249 | Bacteria | 2061 |
| 637 | Ga0265339_10142669 | 3300031249 | Bacteria | 1217 |
| 638 | Ga0265331_10005200 | 3300031250 | Bacteria | 7901 |
| 639 | Ga0265331_10026337 | 3300031250 | Bacteria | 2924 |
| 640 | Ga0265316_10017615 | 3300031344 | Bacteria | 6164 |
| 641 | Ga0307513_10013479 | 3300031456 | Bacteria | 10027 |
| 642 | Ga0307513_10036178 | 3300031456 | Bacteria | 5513 |
| 643 | Ga0307513_10159768 | 3300031456 | Bacteria | 2148 |
| 644 | Ga0307509_10000017 | 3300031507 | Bacteria | 265012 |
| 645 | Ga0307509_10886932 | 3300031507 | Bacteria | 557 |
| 646 | Ga0307408_100660449 | 3300031548 | Bacteria | 936 |
| 647 | Ga0265313_10012355 | 3300031595 | Bacteria | 5222 |
| 648 | Ga0265313_10028992 | 3300031595 | Bacteria | 2869 |
| 649 | Ga0265313_10052342 | 3300031595 | Bacteria | 1949 |
| 650 | Ga0265313_10333670 | 3300031595 | Unclassified | 604 |
| 651 | Ga0307508_10181705 | 3300031616 | Bacteria | 1706 |
| 652 | Ga0316575_10031436 | 3300031665 | Bacteria | 2078 |
| 653 | Ga0265314_10021433 | 3300031711 | Bacteria | 4967 |
| 654 | Ga0265342_10027787 | 3300031712 | Bacteria | 3529 |
| 655 | Ga0316576_10468568 | 3300031727 | Bacteria | 929 |
| 656 | Ga0307516_10866194 | 3300031730 | Bacteria | 568 |
| 657 | Ga0316577_10224253 | 3300031733 | Bacteria | 1063 |
| 658 | Ga0307413_10626574 | 3300031824 | Bacteria | 884 |
| 659 | Ga0307406_11008326 | 3300031901 | Bacteria | 715 |
| 660 | Ga0307415_100434816 | 3300032126 | Bacteria | 1130 |
| 661 | Ga0307507_10262248 | 3300033179 | Bacteria | 1102 |
| 662 | Ga0307510_10000002 | 3300033180 | Bacteria | 801565 |
| 663 | Ga0307510_10049322 | 3300033180 | Unclassified | 4479 |
| 664 | Ga0307510_10184578 | 3300033180 | Bacteria | 1643 |
| 665 | Ga0316214_1018039 | 3300033545 | Bacteria | 981 |
| 666 | Ga0316212_1021990 | 3300033547 | Bacteria | 894 |
| 667 | Ga0373934_0432672 | 3300035086 | Bacteria | 551 |
| 668 | Ga0373934_0468921 | 3300035086 | Bacteria | 528 |
| 669 | Ga0373936_0437840 | 3300035113 | Bacteria | 603 |
| 670 | Ga0373945_0060478 | 3300035116 | Bacteria | 1413 |
| 671 | Ga0373953_0305187 | 3300035117 | Bacteria | 695 |
| 672 | Ga0373954_0032042 | 3300035118 | Bacteria | 2429 |
| 673 | Ga0373954_0045113 | 3300035118 | Bacteria | 2059 |
| 674 | Ga0373956_0142240 | 3300035119 | Bacteria | 1127 |
| 675 | Ga0373957_0080328 | 3300035120 | Bacteria | 1287 |
| 676 | Ga0373957_0474593 | 3300035120 | Unclassified | 543 |
| 677 | Ga0373943_0203329 | 3300035170 | Bacteria | 1097 |
| 678 | Ga0373955_0076292 | 3300035172 | Bacteria | 1885 |
| 679 | Ga0373955_0931179 | 3300035172 | Bacteria | 535 |
| 680 | Ga0373955_0964797 | 3300035172 | Bacteria | 525 |
| 681 | Ga0316574_0102368 | 3300035398 | Bacteria | 1833 |
| 682 | Ga0373924_0028157 | 3300035410 | Bacteria | 2238 |
| 683 | Ga0373924_0061737 | 3300035410 | Bacteria | 1569 |
| 684 | Ga0373924_0374255 | 3300035410 | Bacteria | 636 |
| 685 | Ga0373935_0293770 | 3300035692 | Bacteria | 1147 |
| 686 | Ga0373927_0116216 | 3300035695 | Bacteria | 1744 |
| 687 | Ga0373933_0090878 | 3300035724 | Bacteria | 1884 |
| 688 | Ga0373933_0526170 | 3300035724 | Bacteria | 775 |
| 689 | Ga0373933_0711584 | 3300035724 | Unclassified | 660 |
| 690 | Ga0373937_0023813 | 3300036401 | Bacteria | 5519 |
| 691 | Ga0373937_0382064 | 3300036401 | Bacteria | 1336 |
| 692 | Ga0373937_0535962 | 3300036401 | Bacteria | 1112 |
| 693 | Ga0373937_0710347 | 3300036401 | Bacteria | 952 |
| 694 | Ga0265778_046957 | 3300036457 | Bacteria | 585 |
| 695 | Ga0316584_0466911 | 3300036712 | Bacteria | 891 |
| 696 | Ga0316584_0879318 | 3300036712 | Unclassified | 604 |
| 697 | Ga0373925_0043471 | 3300037068 | Bacteria | 3335 |
| 698 | Ga0373925_0602867 | 3300037068 | Bacteria | 904 |
| 699 | Ga0395900_0063512 | 3300037418 | Bacteria | 3796 |
| 700 | Ga0395900_0205619 | 3300037418 | Bacteria | 1990 |
| 701 | Ga0395900_0600041 | 3300037418 | Bacteria | 1042 |
| 702 | Ga0395898_0026504 | 3300037466 | Bacteria | 5830 |
| 703 | Ga0395898_0032383 | 3300037466 | Bacteria | 5218 |
| 704 | Ga0316581_0244980 | 3300037588 | Bacteria | 551 |
| 705 | Ga0436364_0110092 | 3300037853 | Bacteria | 784 |
| 706 | Ga0436364_0174527 | 3300037853 | Bacteria | 825 |
| 707 | Ga0400483_256878 | 3300039062 | Bacteria | 1849 |
| 708 | Ga0400487_14166 | 3300039110 | Bacteria | 1288 |
| 709 | Ga0400487_27409 | 3300039110 | Bacteria | 2252 |
| 710 | Ga0436365_0237205 | 3300039437 | Bacteria | 1736 |
| 711 | Ga0436365_0611032 | 3300039437 | Bacteria | 697 |
| 712 | Ga0436365_0868934 | 3300039437 | Bacteria | 923 |
| 713 | Ga0436365_0874562 | 3300039437 | Bacteria | 7958 |
| 714 | Ga0436365_1206550 | 3300039437 | Bacteria | 1178 |
| 715 | Ga0436360_0028921 | 3300039438 | Bacteria | 1079 |
| 716 | Ga0436360_0180700 | 3300039438 | Bacteria | 4061 |
| 717 | Ga0436360_0239842 | 3300039438 | Bacteria | 1534 |
| 718 | Ga0436360_0970044 | 3300039438 | Bacteria | 1408 |
| 719 | Ga0436360_1090775 | 3300039438 | Bacteria | 1764 |
| 720 | Ga0436360_1183037 | 3300039438 | Bacteria | 13455 |
| 721 | Ga0436360_1364095 | 3300039438 | Bacteria | 702 |
| 722 | Ga0436361_0561964 | 3300039447 | Bacteria | 651 |
| 723 | Ga0436361_1160124 | 3300039447 | Bacteria | 734 |
| 724 | Ga0436363_0425036 | 3300039450 | Bacteria | 1241 |
| 725 | Ga0436363_0458954 | 3300039450 | Unclassified | 870 |
| 726 | Ga0436363_0913390 | 3300039450 | Bacteria | 8056 |
| 727 | Ga0436363_1075031 | 3300039450 | Bacteria | 1770 |
| 728 | Ga0436363_1444365 | 3300039450 | Bacteria | 839 |
| 729 | Ga0436363_1519240 | 3300039450 | Bacteria | 1427 |
| 730 | Ga0436363_1637866 | 3300039450 | Bacteria | 11126 |
| 731 | Ga0436362_0067735 | 3300039453 | Bacteria | 887 |
| 732 | Ga0436362_0691176 | 3300039453 | Bacteria | 2798 |
| 733 | Ga0436362_1011958 | 3300039453 | Bacteria | 685 |
| 734 | Ga0436362_1095678 | 3300039453 | Bacteria | 672 |
| 735 | Ga0436362_1234617 | 3300039453 | Bacteria | 2372 |
| 736 | Ga0436362_1273112 | 3300039453 | Bacteria | 669 |
| 737 | Ga0451789_1168205 | 3300041443 | Bacteria | 586 |
| 738 | Ga0451789_1366508 | 3300041443 | Bacteria | 1111 |
| 739 | Ga0451791_1538412 | 3300041451 | Bacteria | 1093 |
| 740 | Ga0451791_1541669 | 3300041451 | Bacteria | 4464 |
| 741 | Ga0451793_0858019 | 3300041452 | Bacteria | 511 |
| 742 | Ga0451798_0714897 | 3300041458 | Bacteria | 581 |
| 743 | Ga0451800_1140122 | 3300041459 | Bacteria | 545 |
| 744 | Ga0451802_1913729 | 3300041460 | Bacteria | 1610 |
| 745 | Ga0451804_0626684 | 3300041463 | Bacteria | 1105 |
| 746 | Ga0451807_1166408 | 3300041486 | Bacteria | 739 |
| 747 | Ga0451807_1517446 | 3300041486 | Bacteria | 2822 |
| 748 | Ga0451807_1763801 | 3300041486 | Bacteria | 970 |
| 749 | Ga0451833_1101685 | 3300041491 | Bacteria | 751 |
| 750 | Ga0451833_1400472 | 3300041491 | Bacteria | 902 |
| 751 | Ga0451835_0670032 | 3300041492 | Bacteria | 1183 |
| 752 | Ga0451845_0780617 | 3300041501 | Bacteria | 762 |
| 753 | Ga0451845_0858351 | 3300041501 | Bacteria | 1070 |
| 754 | Ga0451847_0404821 | 3300041503 | Bacteria | 1070 |
| 755 | Ga0451849_0366760 | 3300041505 | Bacteria | 1143 |
| 756 | Ga0451843_1077815 | 3300041509 | Bacteria | 591 |
| 757 | Ga0451855_0259858 | 3300041511 | Bacteria | 825 |
| 758 | Ga0451853_0012702 | 3300041512 | Bacteria | 3499 |
| 759 | Ga0451853_2312926 | 3300041512 | Bacteria | 859 |
| 760 | Ga0451853_2663512 | 3300041512 | Bacteria | 780 |
| 761 | Ga0452271_49259 | 3300041916 | Unclassified | 568 |
| 762 | Ga0439459_0109957 | 3300042438 | Bacteria | 684 |
| 763 | Ga0466969_0000701 | 3300044656 | Bacteria | 18154 |
| 764 | Ga0466972_0045402 | 3300044658 | Bacteria | 2130 |
| 765 | Ga0453683_0147982 | 3300044673 | Bacteria | 1483 |
| 766 | Ga0466965_0314380 | 3300044683 | Bacteria | 852 |
| 767 | Ga0466966_0001335 | 3300044684 | Bacteria | 15829 |
| 768 | Ga0466966_0559840 | 3300044684 | Bacteria | 688 |
| 769 | Ga0466961_0061745 | 3300044693 | Bacteria | 2381 |
| 770 | Ga0466961_0478165 | 3300044693 | Bacteria | 753 |
| 771 | Ga0466964_0000158 | 3300044706 | Bacteria | 18604 |
| 772 | Ga0453684_0039369 | 3300044712 | Bacteria | 6443 |
| 773 | Ga0453684_0634709 | 3300044712 | Unclassified | 1167 |
| 774 | Ga0466971_0000297 | 3300044719 | Bacteria | 19087 |
| 775 | Ga0466970_0009583 | 3300044765 | Bacteria | 4899 |
| 776 | Ga0466957_1101188 | 3300044842 | Bacteria | 573 |
| 777 | Ga0466957_1195853 | 3300044842 | Bacteria | 550 |
| 778 | Ga0466959_0000251 | 3300045049 | Bacteria | 33248 |
| 779 | Ga0466959_0073766 | 3300045049 | Bacteria | 2468 |
| 780 | Ga0451576_0036838 | 3300045051 | Bacteria | 5183 |
| 781 | Ga0451576_0087532 | 3300045051 | Bacteria | 3240 |
| 782 | Ga0466958_0027464 | 3300045836 | Bacteria | 3369 |
| 783 | Ga0466967_0853892 | 3300045976 | Bacteria | 905 |
| 784 | Ga0466967_2009656 | 3300045976 | Unclassified | 575 |
| 785 | Ga0495617_043937 | 3300046452 | Bacteria | 1492 |
| 786 | Ga0495592_0531389 | 3300046454 | Unclassified | 726 |
| 787 | Ga0495592_0532880 | 3300046454 | Bacteria | 724 |
| 788 | Ga0495603_0193990 | 3300046455 | Bacteria | 1174 |
| 789 | Ga0495590_0002104 | 3300046457 | Bacteria | 8340 |
| 790 | Ga0495591_017112 | 3300046458 | Bacteria | 2500 |
| 791 | Ga0495629_0164259 | 3300046459 | Bacteria | 1542 |
| 792 | Ga0495629_0863337 | 3300046459 | Unclassified | 595 |
| 793 | Ga0495638_0054799 | 3300046460 | Bacteria | 2478 |
| 794 | Ga0495638_0248445 | 3300046460 | Unclassified | 982 |
| 795 | Ga0495638_0347797 | 3300046460 | Bacteria | 784 |
| 796 | Ga0495638_0464488 | 3300046460 | Bacteria | 644 |
| 797 | Ga0495580_0010362 | 3300046472 | Bacteria | 7266 |
| 798 | Ga0495580_0058818 | 3300046472 | Bacteria | 2702 |
| 799 | Ga0495580_0059714 | 3300046472 | Bacteria | 2680 |
| 800 | Ga0495580_0659122 | 3300046472 | Bacteria | 688 |
| 801 | Ga0495582_0732913 | 3300046473 | Bacteria | 572 |
| 802 | Ga0495582_0822267 | 3300046473 | Unclassified | 537 |
| 803 | Ga0495639_0358586 | 3300046475 | Bacteria | 733 |
| 804 | Ga0495662_0187795 | 3300046476 | Bacteria | 1019 |
| 805 | Ga0495584_0053391 | 3300046491 | Bacteria | 2034 |
| 806 | Ga0495584_0240861 | 3300046491 | Bacteria | 920 |
| 807 | Ga0495583_0405575 | 3300046506 | Bacteria | 535 |
| 808 | Ga0495606_0035789 | 3300046507 | Unclassified | 3390 |
| 809 | Ga0495606_0218062 | 3300046507 | Bacteria | 1077 |
| 810 | Ga0495610_0268145 | 3300046512 | Bacteria | 670 |
| 811 | Ga0495618_0116902 | 3300046514 | Bacteria | 1708 |
| 812 | Ga0495620_0216152 | 3300046515 | Bacteria | 734 |
| 813 | Ga0495628_0104439 | 3300046516 | Bacteria | 2183 |
| 814 | Ga0495628_0152437 | 3300046516 | Bacteria | 1760 |
| 815 | Ga0495631_0219204 | 3300046518 | Bacteria | 812 |
| 816 | Ga0495632_0067205 | 3300046519 | Unclassified | 1729 |
| 817 | Ga0495632_0086312 | 3300046519 | Bacteria | 1493 |
| 818 | Ga0495632_0132088 | 3300046519 | Bacteria | 1161 |
| 819 | Ga0495644_0005529 | 3300046523 | Bacteria | 4934 |
| 820 | Ga0495663_0101732 | 3300046525 | Bacteria | 947 |
| 821 | Ga0495654_0108458 | 3300046530 | Bacteria | 1269 |
| 822 | Ga0495654_0300284 | 3300046530 | Bacteria | 656 |
| 823 | Ga0495665_0027815 | 3300046531 | Bacteria | 3035 |
| 824 | Ga0495640_0464200 | 3300046533 | Bacteria | 772 |
| 825 | Ga0495586_0041882 | 3300046535 | Bacteria | 2467 |
| 826 | Ga0495586_0738007 | 3300046535 | Unclassified | 568 |
| 827 | Ga0495586_0830976 | 3300046535 | Bacteria | 533 |
| 828 | Ga0495587_0070874 | 3300046536 | Bacteria | 2028 |
| 829 | Ga0495598_0074542 | 3300046537 | Bacteria | 1076 |
| 830 | Ga0495621_0000821 | 3300046539 | Bacteria | 7863 |
| 831 | Ga0495622_0293054 | 3300046557 | Bacteria | 710 |
| 832 | Ga0495622_0413045 | 3300046557 | Bacteria | 580 |
| 833 | Ga0495633_0223509 | 3300046558 | Bacteria | 862 |
| 834 | Ga0495633_0358579 | 3300046558 | Bacteria | 660 |
| 835 | Ga0495667_0961963 | 3300046559 | Bacteria | 522 |
| 836 | Ga0495656_0034044 | 3300046615 | Bacteria | 2083 |
| 837 | Ga0495668_0134528 | 3300046616 | Bacteria | 1353 |
| 838 | Ga0495668_0288790 | 3300046616 | Bacteria | 899 |
| 839 | Ga0495625_0092413 | 3300046660 | Unclassified | 2091 |
| 840 | Ga0495625_0113958 | 3300046660 | Bacteria | 1846 |
| 841 | Ga0495625_0150526 | 3300046660 | Bacteria | 1565 |
| 842 | Ga0495635_0144364 | 3300046663 | Bacteria | 1621 |
| 843 | Ga0495635_0349330 | 3300046663 | Bacteria | 987 |
| 844 | Ga0495599_0141261 | 3300046678 | Bacteria | 1494 |
| 845 | Ga0495647_0024714 | 3300046681 | Bacteria | 2189 |
| 846 | Ga0495647_0167630 | 3300046681 | Unclassified | 949 |
| 847 | Ga0495647_0222920 | 3300046681 | Bacteria | 833 |
| 848 | Ga0495658_0015584 | 3300046683 | Bacteria | 3901 |
| 849 | Ga0495658_0067565 | 3300046683 | Bacteria | 2067 |
| 850 | Ga0495669_0103873 | 3300046684 | Bacteria | 1322 |
| 851 | Ga0495669_0257972 | 3300046684 | Bacteria | 837 |
| 852 | Ga0495613_0823290 | 3300046689 | Bacteria | 605 |
| 853 | Ga0495613_0956358 | 3300046689 | Bacteria | 552 |
| 854 | Ga0495670_0409208 | 3300046691 | Bacteria | 733 |
| 855 | Ga0495670_0495021 | 3300046691 | Bacteria | 664 |
| 856 | Ga0495671_0124163 | 3300046692 | Bacteria | 1259 |
| 857 | Ga0495649_0058055 | 3300046694 | Unclassified | 2086 |
| 858 | Ga0495649_0195827 | 3300046694 | Bacteria | 1051 |
| 859 | Ga0495649_0252519 | 3300046694 | Bacteria | 905 |
| 860 | Ga0495660_0318379 | 3300046810 | Bacteria | 700 |
| 861 | Ga0495581_0165833 | 3300047315 | Bacteria | 1292 |
| 862 | Ga0495604_0202041 | 3300047317 | Bacteria | 1378 |
| 863 | Ga0495674_0021182 | 3300047319 | Bacteria | 6014 |
| 864 | Ga0495674_0929390 | 3300047319 | Bacteria | 670 |
| 865 | Ga0495676_0472109 | 3300047321 | Bacteria | 826 |
| 866 | Ga0495680_0301768 | 3300047322 | Bacteria | 1124 |
| 867 | Ga0495683_0396949 | 3300047323 | Bacteria | 574 |
| 868 | Ga0495687_027813 | 3300047443 | Bacteria | 2641 |
| 869 | Ga0495687_030505 | 3300047443 | Unclassified | 2482 |
| 870 | Ga0495673_0161680 | 3300047469 | Bacteria | 859 |
| 871 | Ga0495673_0278807 | 3300047469 | Bacteria | 604 |
| 872 | Ga0495681_0022734 | 3300047470 | Bacteria | 3348 |
| 873 | Ga0495681_0288024 | 3300047470 | Bacteria | 639 |
| 874 | Ga0495686_0082058 | 3300047472 | Bacteria | 1968 |
| 875 | Ga0495686_0275510 | 3300047472 | Bacteria | 937 |
| 876 | Ga0495686_0443843 | 3300047472 | Bacteria | 690 |
| 877 | Ga0495614_0317215 | 3300048089 | Unclassified | 722 |
| 878 | Ga0495615_0089778 | 3300048090 | Bacteria | 854 |
| 879 | Ga0496100_0005916 | 3300048903 | Bacteria | 6629 |
| 880 | Ga0496100_0461094 | 3300048903 | Bacteria | 975 |
| 881 | Ga0496100_0508140 | 3300048903 | Bacteria | 929 |
| 882 | Ga0496101_0003364 | 3300048904 | Bacteria | 9964 |
| 883 | Ga0496101_0171809 | 3300048904 | Bacteria | 1666 |
| 884 | Ga0496102_0016336 | 3300048905 | Bacteria | 6484 |
| 885 | Ga0496102_0050361 | 3300048905 | Unclassified | 3792 |
| 886 | Ga0496102_0154652 | 3300048905 | Bacteria | 2156 |
| 887 | Ga0496103_0079527 | 3300048906 | Bacteria | 2060 |
| 888 | Ga0496103_0454074 | 3300048906 | Bacteria | 822 |
| 889 | Ga0496103_0576207 | 3300048906 | Bacteria | 718 |
| 890 | Ga0496104_0028290 | 3300048907 | Bacteria | 5195 |
| 891 | Ga0496104_0085586 | 3300048907 | Bacteria | 3009 |
| 892 | Ga0496104_0240521 | 3300048907 | Bacteria | 1722 |
| 893 | Ga0496105_0017713 | 3300048908 | Bacteria | 5715 |
| 894 | Ga0496105_0036455 | 3300048908 | Bacteria | 4051 |
| 895 | Ga0496105_0148857 | 3300048908 | Unclassified | 1925 |
| 896 | Ga0496106_0087865 | 3300048909 | Bacteria | 2395 |
| 897 | Ga0496106_0164073 | 3300048909 | Bacteria | 1758 |
| 898 | Ga0496107_0002116 | 3300048910 | Bacteria | 12724 |
| 899 | Ga0496107_0249319 | 3300048910 | Bacteria | 1321 |
| 900 | Ga0496107_0641088 | 3300048910 | Bacteria | 783 |
| 901 | Ga0496107_0913515 | 3300048910 | Bacteria | 640 |
| 902 | Ga0496108_0328944 | 3300048911 | Bacteria | 1332 |
| 903 | Ga0496108_0408486 | 3300048911 | Bacteria | 1186 |
| 904 | Ga0496109_0059622 | 3300048912 | Bacteria | 3487 |
| 905 | Ga0496111_0018991 | 3300048914 | Bacteria | 4766 |
| 906 | Ga0496112_0030840 | 3300048915 | Bacteria | 5194 |
| 907 | Ga0496112_0031223 | 3300048915 | Bacteria | 5165 |
| 908 | Ga0496113_0172913 | 3300048916 | Bacteria | 1711 |
| 909 | Ga0496114_0004330 | 3300048917 | Bacteria | 10991 |
| 910 | Ga0496114_0019094 | 3300048917 | Bacteria | 5554 |
| 911 | Ga0496114_0279664 | 3300048917 | Bacteria | 1471 |
| 912 | Ga0496115_0001174 | 3300048918 | Bacteria | 18773 |
| 913 | Ga0496115_0247333 | 3300048918 | Bacteria | 1469 |
| 914 | Ga0496115_0567916 | 3300048918 | Bacteria | 905 |
| 915 | Ga0496116_0019290 | 3300048919 | Bacteria | 5224 |
| 916 | Ga0496117_0000135 | 3300048920 | Bacteria | 160708 |
| 917 | Ga0496118_0000098 | 3300048921 | Bacteria | 160610 |
| 918 | Ga0496118_0061479 | 3300048921 | Bacteria | 2781 |
| 919 | Ga0496119_0165103 | 3300048922 | Unclassified | 1173 |
| 920 | Ga0496119_0172631 | 3300048922 | Unclassified | 1140 |
| 921 | Ga0496120_0000543 | 3300048923 | Bacteria | 57596 |
| 922 | Ga0496120_0380612 | 3300048923 | Bacteria | 627 |
| 923 | Ga0496121_0001196 | 3300048924 | Bacteria | 45454 |
| 924 | Ga0496124_0008240 | 3300048927 | Bacteria | 10930 |
| 925 | Ga0496125_0000653 | 3300048928 | Bacteria | 57890 |
| 926 | Ga0496125_0010007 | 3300048928 | Bacteria | 9636 |
| 927 | Ga0496125_0120972 | 3300048928 | Bacteria | 1868 |
| 928 | Ga0496126_0140483 | 3300048929 | Bacteria | 2079 |
| 929 | Ga0496126_0334959 | 3300048929 | Bacteria | 1241 |
| 930 | Ga0496126_1205530 | 3300048929 | Bacteria | 556 |
| 931 | Ga0501031_0083119 | 3300049568 | Bacteria | 2087 |
| 932 | Ga0501031_0283721 | 3300049568 | Bacteria | 1074 |
| 933 | Ga0501031_0645037 | 3300049568 | Bacteria | 681 |
| 934 | Ga0501033_0054857 | 3300049570 | Bacteria | 2947 |
| 935 | Ga0501034_0186314 | 3300049571 | Bacteria | 2039 |
| 936 | Ga0501036_0015625 | 3300049572 | Bacteria | 6341 |
| 937 | Ga0501036_0043159 | 3300049572 | Bacteria | 3818 |
| 938 | Ga0501037_0055914 | 3300049573 | Bacteria | 2884 |
| 939 | Ga0501037_0206862 | 3300049573 | Bacteria | 1385 |
| 940 | Ga0501038_0093384 | 3300049574 | Bacteria | 2517 |
| 941 | Ga0501038_0104231 | 3300049574 | Bacteria | 2357 |
| 942 | Ga0501039_0028242 | 3300049575 | Bacteria | 4317 |
| 943 | Ga0501039_0044339 | 3300049575 | Bacteria | 3435 |
| 944 | Ga0501040_0009688 | 3300049576 | Bacteria | 6290 |
| 945 | Ga0501040_0034507 | 3300049576 | Bacteria | 3426 |
| 946 | Ga0501041_0005070 | 3300049577 | Bacteria | 7674 |
| 947 | Ga0501041_0006915 | 3300049577 | Bacteria | 6654 |
| 948 | Ga0501042_0000933 | 3300049578 | Bacteria | 16482 |
| 949 | Ga0501042_0005669 | 3300049578 | Bacteria | 8060 |
| 950 | Ga0501043_0047000 | 3300049579 | Bacteria | 3393 |
| 951 | Ga0501043_0239354 | 3300049579 | Bacteria | 1400 |
| 952 | Ga0501046_0073285 | 3300049580 | Bacteria | 2658 |
| 953 | Ga0501046_0118593 | 3300049580 | Bacteria | 2015 |
| 954 | Ga0501046_0621138 | 3300049580 | Bacteria | 766 |
| 955 | Ga0501047_0733751 | 3300049581 | Bacteria | 804 |
| 956 | Ga0501047_1122399 | 3300049581 | Bacteria | 599 |
| 957 | Ga0501048_0186797 | 3300049582 | Bacteria | 1469 |
| 958 | Ga0501048_0190912 | 3300049582 | Bacteria | 1451 |
| 959 | Ga0501048_0357668 | 3300049582 | Bacteria | 1041 |
| 960 | Ga0501068_0009560 | 3300049584 | Bacteria | 5430 |
| 961 | Ga0501068_0153845 | 3300049584 | Bacteria | 1447 |
| 962 | Ga0501068_0722982 | 3300049584 | Bacteria | 651 |
| 963 | Ga0501070_0932629 | 3300049586 | Bacteria | 676 |
| 964 | Ga0501071_0004416 | 3300049587 | Bacteria | 8924 |
| 965 | Ga0501071_0077720 | 3300049587 | Bacteria | 2424 |
| 966 | Ga0501071_1194068 | 3300049587 | Bacteria | 588 |
| 967 | Ga0501072_0001013 | 3300049588 | Bacteria | 20796 |
| 968 | Ga0501072_0003245 | 3300049588 | Bacteria | 12215 |
| 969 | Ga0501074_0059271 | 3300049590 | Bacteria | 2758 |
| 970 | Ga0501074_0065853 | 3300049590 | Bacteria | 2607 |
| 971 | Ga0501075_0001675 | 3300049591 | Bacteria | 14535 |
| 972 | Ga0501075_0113368 | 3300049591 | Bacteria | 2061 |
| 973 | Ga0501076_0002336 | 3300049592 | Bacteria | 12984 |
| 974 | Ga0501076_0231477 | 3300049592 | Bacteria | 1510 |
| 975 | Ga0501076_1159186 | 3300049592 | Bacteria | 636 |
| 976 | Ga0501077_0013647 | 3300049593 | Bacteria | 5092 |
| 977 | Ga0501077_0099855 | 3300049593 | Bacteria | 1839 |
| 978 | Ga0501257_119693 | 3300049686 | Bacteria | 704 |
| 979 | Ga0501079_0088661 | 3300049741 | Bacteria | 2395 |
| 980 | Ga0501079_0134816 | 3300049741 | Bacteria | 1922 |
| 981 | Ga0501079_1105069 | 3300049741 | Bacteria | 625 |
| 982 | Ga0501080_0025523 | 3300049742 | Bacteria | 5485 |
| 983 | Ga0501080_0057548 | 3300049742 | Bacteria | 3619 |
| 984 | Ga0501080_0673036 | 3300049742 | Bacteria | 914 |
| 985 | Ga0501081_0000553 | 3300049743 | Bacteria | 21246 |
| 986 | Ga0501083_0091901 | 3300049744 | Bacteria | 2003 |
| 987 | Ga0501083_0145558 | 3300049744 | Bacteria | 1551 |
| 988 | Ga0501035_0040058 | 3300049822 | Bacteria | 4236 |
| 989 | Ga0501035_0109178 | 3300049822 | Bacteria | 2425 |
| 990 | Ga0501035_0205160 | 3300049822 | Bacteria | 1689 |
| 991 | Ga0501044_0363376 | 3300049823 | Bacteria | 1365 |
| 992 | Ga0501045_0037405 | 3300049824 | Bacteria | 3527 |
| 993 | Ga0501045_0099346 | 3300049824 | Bacteria | 2153 |
| 994 | nmdc:mga08y16_445413_c1 | 3300050511 | Bacteria | 1321 |
| 995 | nmdc:mga0n895_2062079_c1 | 3300050512 | Bacteria | 527 |
| 996 | nmdc:mga0rr50_172788_c1 | 3300050513 | Bacteria | 1762 |
| 997 | nmdc:mga08x19_44840_c1 | 3300050514 | Bacteria | 2824 |
| 998 | nmdc:mga08x19_917492_c1 | 3300050514 | Bacteria | 622 |
| 999 | Ga0495601_0148183 | 3300053077 | Bacteria | 1532 |
| 1000 | Ga0495619_0195043 | 3300053085 | Bacteria | 1402 |
| 1001 | Ga0500646_0034846 | 3300053090 | Bacteria | 1397 |
| 1002 | Ga0500646_0332761 | 3300053090 | Unclassified | 550 |
| 1003 | Ga0500583_0055810 | 3300053092 | Bacteria | 1848 |
| 1004 | Ga0500583_0527407 | 3300053092 | Unclassified | 551 |
| 1005 | Ga0500641_0065908 | 3300053096 | Bacteria | 1516 |
| 1006 | Ga0500650_0479318 | 3300053098 | Bacteria | 531 |
| 1007 | Ga0500556_0000455 | 3300053104 | Bacteria | 28996 |
| 1008 | Ga0500556_0047640 | 3300053104 | Bacteria | 1538 |
| 1009 | Ga0500562_171457 | 3300053108 | Bacteria | 590 |
| 1010 | Ga0500572_023826 | 3300053111 | Bacteria | 1647 |
| 1011 | Ga0500591_071318 | 3300053115 | Unclassified | 1573 |
| 1012 | Ga0500594_0027809 | 3300053118 | Bacteria | 1467 |
| 1013 | Ga0500594_0055565 | 3300053118 | Bacteria | 1127 |
| 1014 | Ga0500597_253662 | 3300053120 | Bacteria | 719 |
| 1015 | Ga0500614_187643 | 3300053123 | Bacteria | 634 |
| 1016 | Ga0500617_026529 | 3300053124 | Bacteria | 2577 |
| 1017 | Ga0500628_031885 | 3300053129 | Bacteria | 1150 |
| 1018 | Ga0500642_0089533 | 3300053130 | Bacteria | 1421 |
| 1019 | Ga0500642_0185887 | 3300053130 | Bacteria | 971 |
| 1020 | Ga0500652_191390 | 3300053131 | Bacteria | 834 |
| 1021 | Ga0500655_104642 | 3300053133 | Bacteria | 595 |
| 1022 | Ga0500658_0013165 | 3300053134 | Bacteria | 3055 |
| 1023 | Ga0500568_0087049 | 3300053139 | Bacteria | 1181 |
| 1024 | Ga0500573_0383487 | 3300053140 | Bacteria | 671 |
| 1025 | Ga0500588_0019770 | 3300053146 | Bacteria | 1796 |
| 1026 | Ga0500590_286239 | 3300053148 | Bacteria | 629 |
| 1027 | Ga0500616_0000064 | 3300053153 | Bacteria | 243072 |
| 1028 | Ga0500619_084471 | 3300053154 | Unclassified | 1069 |
| 1029 | Ga0500622_0018720 | 3300053156 | Bacteria | 3679 |
| 1030 | Ga0500624_047593 | 3300053157 | Unclassified | 789 |
| 1031 | Ga0500627_0054137 | 3300053158 | Bacteria | 1755 |
| 1032 | Ga0500627_0344393 | 3300053158 | Bacteria | 644 |
| 1033 | Ga0500630_073726 | 3300053159 | Unclassified | 1610 |
| 1034 | Ga0500634_0297560 | 3300053161 | Bacteria | 642 |
| 1035 | Ga0500639_271748 | 3300053163 | Bacteria | 661 |
| 1036 | Ga0500636_0168372 | 3300053177 | Bacteria | 1187 |
| 1037 | Ga0500636_0350564 | 3300053177 | Bacteria | 705 |
| 1038 | Ga0500637_0013173 | 3300053178 | Bacteria | 4328 |
| 1039 | Ga0500637_0018818 | 3300053178 | Bacteria | 3715 |
| 1040 | Ga0500637_0251037 | 3300053178 | Unclassified | 987 |
| 1041 | Ga0500656_000697 | 3300053732 | Bacteria | 2610 |
| 1042 | Ga0501084_0020689 | 3300054114 | Bacteria | 5488 |
| 1043 | Ga0501084_0071085 | 3300054114 | Bacteria | 2913 |
| 1044 | Ga0587073_0226134 | 3300059492 | Bacteria | 574 |
| 1045 | Ga0587085_086850 | 3300059506 | Bacteria | 639 |
| 1046 | Ga0587085_157611 | 3300059506 | Bacteria | 528 |
| 1047 | Ga0587086_067049 | 3300059507 | Bacteria | 609 |
| 1048 | Ga0587088_157297 | 3300059508 | Bacteria | 554 |
| 1049 | Ga0587090_105364 | 3300059510 | Bacteria | 595 |
| 1050 | Ga0587091_239230 | 3300059511 | Bacteria | 504 |
| 1051 | Ga0587117_128790 | 3300059627 | Bacteria | 508 |
| 1052 | Ga0587128_145750 | 3300059630 | Bacteria | 535 |
| 1053 | Ga0587128_178304 | 3300059630 | Bacteria | 500 |
| 1054 | Ga0587072_155314 | 3300059643 | Bacteria | 555 |
| 1055 | Ga0587107_124680 | 3300059652 | Bacteria | 535 |
| 1056 | Ga0587110_056896 | 3300059654 | Bacteria | 534 |
| 1057 | Ga0587111_0223616 | 3300060346 | Bacteria | 545 |
| 1058 | Ga0587111_0230263 | 3300060346 | Bacteria | 539 |
| 1059 | Ga0587111_0249046 | 3300060346 | Unclassified | 525 |
| 1060 | Ga0501082_0009857 | 3300060353 | Bacteria | 8231 |
| 1061 | Ga0501082_0016530 | 3300060353 | Bacteria | 6351 |
| 1062 | Ga0466962_0000186 | 3300061719 | Bacteria | 25769 |
| 1063 | Ga0530510_0056263 | 3300061734 | Bacteria | 2841 |
| 1064 | Ga0530510_0922582 | 3300061734 | Bacteria | 667 |
| 1065 | Ga0307511_10009506 | |||
| 1066 | MBSR1b_contig_5278590 | |||
| 1067 | JGI24738J21930_10102457 | |||
| 1068 | rootH1_10034951 | |||
| 1069 | rootH2_10117380 | |||
| 1070 | Ga0058863_11624363 | |||
| 1071 | Ga0058863_11892829 | |||
| 1072 | Ga0058861_10019602 | |||
| 1073 | Ga0058861_11586382 | |||
| 1074 | Ga0058862_10122417 | |||
| 1075 | Ga0058862_12346480 | |||
| 1076 | Ga0058862_12810254 | |||
| 1077 | Ga0065715_10291879 | |||
| 1078 | Ga0065707_10091763 | |||
| 1079 | Ga0065707_10328244 | |||
| 1080 | Ga0070658_10149337 | |||
| 1081 | Ga0070658_10360626 | |||
| 1082 | Ga0070676_10487428 | |||
| 1083 | Ga0070683_100068631 | |||
| 1084 | Ga0070683_100659341 | |||
| 1085 | Ga0070690_100008411 | |||
| 1086 | Ga0070670_101803729 | |||
| 1087 | Ga0068869_100408038 | |||
| 1088 | Ga0068869_100790914 | |||
| 1089 | Ga0070666_10000608 | |||
| 1090 | Ga0070666_10197214 | |||
| 1091 | Ga0070680_100012524 | |||
| 1092 | Ga0070680_100046067 | |||
| 1093 | Ga0070680_100203349 | |||
| 1094 | Ga0070680_100352165 | |||
| 1095 | Ga0070680_101037174 | |||
| 1096 | Ga0070682_100017708 | |||
| 1097 | Ga0070682_100572798 | |||
| 1098 | Ga0070682_101190777 | |||
| 1099 | Ga0068868_100009699 | |||
| 1100 | Ga0070660_100097247 | |||
| 1101 | Ga0070661_100566924 | |||
| 1102 | Ga0070692_10249967 | |||
| 1103 | Ga0070668_100100749 | |||
| 1104 | Ga0070668_100900991 | |||
| 1105 | Ga0070669_100731023 | |||
| 1106 | Ga0070671_100001886 | |||
| 1107 | Ga0070671_100057434 | |||
| 1108 | Ga0070671_100341417 | |||
| 1109 | Ga0070674_100337778 | |||
| 1110 | Ga0070674_101838706 | |||
| 1111 | Ga0070673_100250912 | |||
| 1112 | Ga0070673_100751965 | |||
| 1113 | Ga0070659_102097198 | |||
| 1114 | Ga0070667_100000184 | |||
| 1115 | Ga0070667_100010475 | |||
| 1116 | Ga0070667_100030679 | |||
| 1117 | Ga0070667_100109447 | |||
| 1118 | Ga0070667_101688937 | |||
| 1119 | Ga0070667_102220699 | |||
| 1120 | Ga0070667_102342154 | |||
| 1121 | Ga0070703_10301717 | |||
| 1122 | Ga0070709_10001974 | |||
| 1123 | Ga0070709_10002738 | |||
| 1124 | Ga0070709_10502642 | |||
| 1125 | Ga0070709_11342497 | |||
| 1126 | Ga0070714_100008567 | |||
| 1127 | Ga0070714_100057500 | |||
| 1128 | Ga0070714_100520474 | |||
| 1129 | Ga0070714_100812115 | |||
| 1130 | Ga0070713_100031953 | |||
| 1131 | Ga0070713_100039641 | |||
| 1132 | Ga0070713_100040668 | |||
| 1133 | Ga0070713_100101571 | |||
| 1134 | Ga0070713_100155600 | |||
| 1135 | Ga0070713_101833529 | |||
| 1136 | Ga0070713_102079312 | |||
| 1137 | Ga0070710_10009119 | |||
| 1138 | Ga0070710_10231980 | |||
| 1139 | Ga0070710_10253671 | |||
| 1140 | Ga0070710_10820846 | |||
| 1141 | Ga0070711_100001448 | |||
| 1142 | Ga0070711_100001690 | |||
| 1143 | Ga0070711_100029325 | |||
| 1144 | Ga0070711_100036734 | |||
| 1145 | Ga0070711_101359918 | |||
| 1146 | Ga0070705_101265484 | |||
| 1147 | Ga0070700_100364937 | |||
| 1148 | Ga0070694_101232044 | |||
| 1149 | Ga0070663_101974659 | |||
| 1150 | Ga0070678_100006219 | |||
| 1151 | Ga0070681_10002406 | |||
| 1152 | Ga0070681_10011014 | |||
| 1153 | Ga0070681_10028327 | |||
| 1154 | Ga0070681_10038707 | |||
| 1155 | Ga0070681_10099145 | |||
| 1156 | Ga0070681_10464530 | |||
| 1157 | Ga0070681_10732764 | |||
| 1158 | Ga0070681_10930757 | |||
| 1159 | Ga0070685_10209980 | |||
| 1160 | Ga0070706_100891019 | |||
| 1161 | Ga0070699_100050674 | |||
| 1162 | Ga0070679_100008485 | |||
| 1163 | Ga0070679_100026652 | |||
| 1164 | Ga0070679_100045483 | |||
| 1165 | Ga0070679_100103846 | |||
| 1166 | Ga0070679_101157537 | |||
| 1167 | Ga0070679_101199944 | |||
| 1168 | Ga0070684_100215454 | |||
| 1169 | Ga0068853_100067674 | |||
| 1170 | Ga0068853_100808638 | |||
| 1171 | Ga0068853_102464071 | |||
| 1172 | Ga0070672_100111579 | |||
| 1173 | Ga0070672_101112407 | |||
| 1174 | Ga0070686_100172414 | |||
| 1175 | Ga0070695_100002291 | |||
| 1176 | Ga0070696_100002201 | |||
| 1177 | Ga0070696_101365837 | |||
| 1178 | Ga0070696_101488492 | |||
| 1179 | Ga0070696_101890571 | |||
| 1180 | Ga0070693_100031832 | |||
| 1181 | Ga0070665_100007941 | |||
| 1182 | Ga0070665_100011190 | |||
| 1183 | Ga0070665_100018402 | |||
| 1184 | Ga0070665_100057719 | |||
| 1185 | Ga0070665_100073753 | |||
| 1186 | Ga0070665_100083295 | |||
| 1187 | Ga0070665_100204633 | |||
| 1188 | Ga0070665_100442092 | |||
| 1189 | Ga0070665_101137411 | |||
| 1190 | Ga0070704_100576501 | |||
| 1191 | Ga0068855_100000693 | |||
| 1192 | Ga0068855_100007974 | |||
| 1193 | Ga0068855_100012114 | |||
| 1194 | Ga0068855_100029539 | |||
| 1195 | Ga0068855_100071391 | |||
| 1196 | Ga0068855_100589956 | |||
| 1197 | Ga0068855_100745717 | |||
| 1198 | Ga0068855_100958216 | |||
| 1199 | Ga0068855_101040434 | |||
| 1200 | Ga0068855_101178293 | |||
| 1201 | Ga0068855_101465488 | |||
| 1202 | Ga0068855_101754887 | |||
| 1203 | Ga0070664_100341648 | |||
| 1204 | Ga0070664_100981290 | |||
| 1205 | Ga0068857_100160632 | |||
| 1206 | Ga0068857_100567936 | |||
| 1207 | Ga0068857_100603227 | |||
| 1208 | Ga0068854_100063626 | |||
| 1209 | Ga0068856_100002992 | |||
| 1210 | Ga0068856_100029588 | |||
| 1211 | Ga0068856_100257440 | |||
| 1212 | Ga0068856_100502432 | |||
| 1213 | Ga0068856_100698898 | |||
| 1214 | Ga0068856_100746141 | |||
| 1215 | Ga0068856_102702220 | |||
| 1216 | Ga0068852_100326283 | |||
| 1217 | Ga0068852_100489982 | |||
| 1218 | Ga0068859_100001446 | |||
| 1219 | Ga0068859_100022197 | |||
| 1220 | Ga0068859_100563515 | |||
| 1221 | Ga0068859_101130968 | |||
| 1222 | Ga0068859_101486445 | |||
| 1223 | Ga0068864_100183354 | |||
| 1224 | Ga0068866_10061374 | |||
| 1225 | Ga0068861_100195488 | |||
| 1226 | Ga0068861_100339118 | |||
| 1227 | Ga0068861_100616181 | |||
| 1228 | Ga0068861_101184369 | |||
| 1229 | Ga0068861_101897836 | |||
| 1230 | Ga0068851_10554496 | |||
| 1231 | Ga0068863_100003715 | |||
| 1232 | Ga0068863_100036000 | |||
| 1233 | Ga0068863_100092892 | |||
| 1234 | Ga0068863_100309555 | |||
| 1235 | Ga0068863_102670075 | |||
| 1236 | Ga0068858_100000923 | |||
| 1237 | Ga0068858_100015855 | |||
| 1238 | Ga0068858_100038907 | |||
| 1239 | Ga0068860_100003837 | |||
| 1240 | Ga0068860_100023810 | |||
| 1241 | Ga0068860_100133543 | |||
| 1242 | Ga0068860_101307843 | |||
| 1243 | Ga0068860_101338978 | |||
| 1244 | Ga0068860_101342709 | |||
| 1245 | Ga0068860_102646942 | |||
| 1246 | Ga0068862_100244899 | |||
| 1247 | Ga0068862_100831763 | |||
| 1248 | Ga0068862_101536342 | |||
| 1249 | Ga0068862_101843357 | |||
| 1250 | Ga0068862_102603398 | |||
| 1251 | Ga0081455_10003109 | |||
| 1252 | Ga0070717_10011989 | |||
| 1253 | Ga0070717_10593276 | |||
| 1254 | Ga0070715_10000812 | |||
| 1255 | Ga0070715_10074778 | |||
| 1256 | Ga0070715_10113784 | |||
| 1257 | Ga0070715_10224001 | |||
| 1258 | Ga0070716_100008137 | |||
| 1259 | Ga0070716_100035599 | |||
| 1260 | Ga0070716_100047505 | |||
| 1261 | Ga0070716_100179001 | |||
| 1262 | Ga0070712_100003960 | |||
| 1263 | Ga0070712_100028899 | |||
| 1264 | Ga0070712_100031323 | |||
| 1265 | Ga0070712_100172532 | |||
| 1266 | Ga0075366_10724576 | |||
| 1267 | Ga0097621_100052692 | |||
| 1268 | Ga0097621_100104519 | |||
| 1269 | Ga0097621_100116484 | |||
| 1270 | Ga0097621_100461564 | |||
| 1271 | Ga0097621_100778179 | |||
| 1272 | Ga0068871_100008272 | |||
| 1273 | Ga0068871_100038196 | |||
| 1274 | Ga0068871_100160702 | |||
| 1275 | Ga0068871_100226730 | |||
| 1276 | Ga0068871_100246494 | |||
| 1277 | Ga0068871_100401873 | |||
| 1278 | Ga0068871_100853305 | |||
| 1279 | Ga0068871_100970698 | |||
| 1280 | Ga0075430_100377506 | |||
| 1281 | Ga0075434_102507879 | |||
| 1282 | Ga0068865_100000707 | |||
| 1283 | Ga0075436_100547754 | |||
| 1284 | Ga0097620_100001446 | |||
| 1285 | Ga0097620_100022197 | |||
| 1286 | Ga0097620_100563614 | |||
| 1287 | Ga0097620_101130994 | |||
| 1288 | Ga0097620_101486373 | |||
| 1289 | Ga0075435_100103088 | |||
| 1290 | Ga0075435_100964984 | |||
| 1291 | Ga0099794_10085781 | |||
| 1292 | Ga0099794_10302753 | |||
| 1293 | Ga0099794_10767390 | |||
| 1294 | Ga0099795_10039241 | |||
| 1295 | Ga0105251_10253712 | |||
| 1296 | Ga0105250_10000008 | |||
| 1297 | Ga0105250_10014783 | |||
| 1298 | Ga0105250_10025876 | |||
| 1299 | Ga0105250_10128776 | |||
| 1300 | Ga0105240_10004628 | |||
| 1301 | Ga0105240_10010993 | |||
| 1302 | Ga0105240_10024454 | |||
| 1303 | Ga0105240_10028720 | |||
| 1304 | Ga0105240_10028754 | |||
| 1305 | Ga0105240_10043136 | |||
| 1306 | Ga0105240_10116761 | |||
| 1307 | Ga0105240_10147249 | |||
| 1308 | Ga0105240_10154560 | |||
| 1309 | Ga0105240_10164555 | |||
| 1310 | Ga0105240_10281934 | |||
| 1311 | Ga0105240_10938195 | |||
| 1312 | Ga0111539_10593362 | |||
| 1313 | Ga0111539_12128562 | |||
| 1314 | Ga0105245_10004650 | |||
| 1315 | Ga0105247_10001598 | |||
| 1316 | Ga0105247_10002642 | |||
| 1317 | Ga0105247_10030993 | |||
| 1318 | Ga0105247_10057762 | |||
| 1319 | Ga0105247_10274345 | |||
| 1320 | Ga0105247_10909503 | |||
| 1321 | Ga0105247_11180482 | |||
| 1322 | Ga0105243_10280747 | |||
| 1323 | Ga0105243_10663602 | |||
| 1324 | Ga0105241_10009873 | |||
| 1325 | Ga0105241_10209638 | |||
| 1326 | Ga0105241_10275312 | |||
| 1327 | Ga0105241_10617024 | |||
| 1328 | Ga0105241_10799583 | |||
| 1329 | Ga0105242_10003540 | |||
| 1330 | Ga0105242_11704286 | |||
| 1331 | Ga0105242_12668513 | |||
| 1332 | Ga0105248_10039031 | |||
| 1333 | Ga0105248_10068735 | |||
| 1334 | Ga0105248_10195359 | |||
| 1335 | Ga0105248_10547375 | |||
| 1336 | Ga0105248_11165583 | |||
| 1337 | Ga0105248_11675985 | |||
| 1338 | Ga0105237_10010118 | |||
| 1339 | Ga0105237_10054755 | |||
| 1340 | Ga0105237_10093481 | |||
| 1341 | Ga0105237_10323493 | |||
| 1342 | Ga0105237_10764971 | |||
| 1343 | Ga0105237_11412801 | |||
| 1344 | Ga0105237_11477807 | |||
| 1345 | Ga0105237_11611060 | |||
| 1346 | Ga0105237_11631540 | |||
| 1347 | Ga0105237_12529716 | |||
| 1348 | Ga0105238_10007205 | |||
| 1349 | Ga0105238_10026224 | |||
| 1350 | Ga0105238_10027723 | |||
| 1351 | Ga0105238_10032952 | |||
| 1352 | Ga0105238_10088963 | |||
| 1353 | Ga0105238_10535123 | |||
| 1354 | Ga0105238_10655197 | |||
| 1355 | Ga0105238_10663366 | |||
| 1356 | Ga0105238_10793161 | |||
| 1357 | Ga0105238_11535852 | |||
| 1358 | Ga0105238_11646085 | |||
| 1359 | Ga0105238_11908095 | |||
| 1360 | Ga0105249_10009685 | |||
| 1361 | Ga0105249_10058278 | |||
| 1362 | Ga0105249_10091371 | |||
| 1363 | Ga0105249_10112187 | |||
| 1364 | Ga0105249_11261957 | |||
| 1365 | Ga0105249_12357706 | |||
| 1366 | Ga0099796_10006378 | |||
| 1367 | Ga0099796_10128312 | |||
| 1368 | Ga0105239_10011733 | |||
| 1369 | Ga0105239_10348829 | |||
| 1370 | Ga0105239_10657457 | |||
| 1371 | Ga0105239_10813070 | |||
| 1372 | Ga0105239_11024879 | |||
| 1373 | Ga0105239_11554572 | |||
| 1374 | Ga0105246_10838915 | |||
| 1375 | Ga0157373_10270097 | |||
| 1376 | Ga0157373_11307076 | |||
| 1377 | Ga0157371_10396531 | |||
| 1378 | Ga0157370_10003622 | |||
| 1379 | Ga0157370_10232090 | |||
| 1380 | Ga0157370_10237802 | |||
| 1381 | Ga0157370_10747375 | |||
| 1382 | Ga0157369_10021134 | |||
| 1383 | Ga0157369_10024057 | |||
| 1384 | Ga0157369_10176655 | |||
| 1385 | Ga0157369_10684372 | |||
| 1386 | Ga0157369_10854323 | |||
| 1387 | Ga0157369_10981187 | |||
| 1388 | Ga0157369_11259261 | |||
| 1389 | Ga0157374_10007407 | |||
| 1390 | Ga0157374_10153396 | |||
| 1391 | Ga0157374_10610603 | |||
| 1392 | Ga0157374_11872227 | |||
| 1393 | Ga0157378_10002799 | |||
| 1394 | Ga0163162_10055915 | |||
| 1395 | Ga0163162_10200494 | |||
| 1396 | Ga0157372_10094880 | |||
| 1397 | Ga0157372_10273484 | |||
| 1398 | Ga0157372_10616000 | |||
| 1399 | Ga0157372_10789333 | |||
| 1400 | Ga0157372_10792805 | |||
| 1401 | Ga0157375_10085903 | |||
| 1402 | Ga0157375_10560464 | |||
| 1403 | Ga0157375_13010206 | |||
| 1404 | Ga0163163_10047476 | |||
| 1405 | Ga0163163_10048922 | |||
| 1406 | Ga0163163_10066336 | |||
| 1407 | Ga0163163_10259988 | |||
| 1408 | Ga0163163_10900232 | |||
| 1409 | Ga0163163_10968168 | |||
| 1410 | Ga0163163_12781601 | |||
| 1411 | Ga0157380_11485283 | |||
| 1412 | Ga0157379_10000026 | |||
| 1413 | Ga0157379_10042016 | |||
| 1414 | Ga0157379_10063343 | |||
| 1415 | Ga0157379_10071652 | |||
| 1416 | Ga0157379_10088028 | |||
| 1417 | Ga0157379_10583642 | |||
| 1418 | Ga0157379_10893066 | |||
| 1419 | Ga0157379_10980282 | |||
| 1420 | Ga0157379_10983286 | |||
| 1421 | Ga0157379_11007308 | |||
| 1422 | Ga0157379_11267599 | |||
| 1423 | Ga0157379_11397788 | |||
| 1424 | Ga0157376_10184913 | |||
| 1425 | Ga0157376_10423570 | |||
| 1426 | Ga0157376_10601122 | |||
| 1427 | Ga0157376_12304100 | |||
| 1428 | Ga0157376_12435290 | |||
| 1429 | Ga0184599_114780 | |||
| 1430 | Ga0197907_10584797 | |||
| 1431 | Ga0197907_10647479 | |||
| 1432 | Ga0197907_10794903 | |||
| 1433 | Ga0197907_10903739 | |||
| 1434 | Ga0206356_11095295 | |||
| 1435 | Ga0206356_11599040 | |||
| 1436 | Ga0206355_1163233 | |||
| 1437 | Ga0206355_1233070 | |||
| 1438 | Ga0206352_10016966 | |||
| 1439 | Ga0206352_10143364 | |||
| 1440 | Ga0206352_10222627 | |||
| 1441 | Ga0206352_10679191 | |||
| 1442 | Ga0206352_10825076 | |||
| 1443 | Ga0206352_10942844 | |||
| 1444 | Ga0206354_10069854 | |||
| 1445 | Ga0206354_10145166 | |||
| 1446 | Ga0206354_10320488 | |||
| 1447 | Ga0206354_10439605 | |||
| 1448 | Ga0206354_10868956 | |||
| 1449 | Ga0206353_10180188 | |||
| 1450 | Ga0206353_11146841 | |||
| 1451 | Ga0206353_11388057 | |||
| 1452 | Ga0213873_10068300 | |||
| 1453 | Ga0213874_10014398 | |||
| 1454 | Ga0213874_10017982 | |||
| 1455 | Ga0213874_10250182 | |||
| 1456 | Ga0213876_10210978 | |||
| 1457 | Ga0213876_10241696 | |||
| 1458 | Ga0213871_10176725 | |||
| 1459 | Ga0224712_10078000 | |||
| 1460 | Ga0224712_10141161 | |||
| 1461 | Ga0224712_10181636 | |||
| 1462 | Ga0224712_10556745 | |||
| 1463 | Ga0207656_10065789 | |||
| 1464 | Ga0207696_1000119 | |||
| 1465 | Ga0207696_1097847 | |||
| 1466 | Ga0207692_10006695 | |||
| 1467 | Ga0207692_10018116 | |||
| 1468 | Ga0207692_10038879 | |||
| 1469 | Ga0207642_10443362 | |||
| 1470 | Ga0207710_10002602 | |||
| 1471 | Ga0207710_10008629 | |||
| 1472 | Ga0207710_10041882 | |||
| 1473 | Ga0207710_10057432 | |||
| 1474 | Ga0207710_10229023 | |||
| 1475 | Ga0207680_10022741 | |||
| 1476 | Ga0207680_10119513 | |||
| 1477 | Ga0207680_10162187 | |||
| 1478 | Ga0207680_10481202 | |||
| 1479 | Ga0207647_10278386 | |||
| 1480 | Ga0207685_10013010 | |||
| 1481 | Ga0207685_10028629 | |||
| 1482 | Ga0207685_10540125 | |||
| 1483 | Ga0207685_10712275 | |||
| 1484 | Ga0207699_10001744 | |||
| 1485 | Ga0207699_10028729 | |||
| 1486 | Ga0207699_11021427 | |||
| 1487 | Ga0207684_11110691 | |||
| 1488 | Ga0207654_10202506 | |||
| 1489 | Ga0207654_10210013 | |||
| 1490 | Ga0207654_10470797 | |||
| 1491 | Ga0207654_10648261 | |||
| 1492 | Ga0207707_10000115 | |||
| 1493 | Ga0207707_10000140 | |||
| 1494 | Ga0207707_10000148 | |||
| 1495 | Ga0207707_10002518 | |||
| 1496 | Ga0207707_10026877 | |||
| 1497 | Ga0207707_10050202 | |||
| 1498 | Ga0207707_10052947 | |||
| 1499 | Ga0207707_10163285 | |||
| 1500 | Ga0207707_10183333 | |||
| 1501 | Ga0207695_10019465 | |||
| 1502 | Ga0207695_10029928 | |||
| 1503 | Ga0207695_10030248 | |||
| 1504 | Ga0207695_10069859 | |||
| 1505 | Ga0207695_10076523 | |||
| 1506 | Ga0207695_10117609 | |||
| 1507 | Ga0207695_10130356 | |||
| 1508 | Ga0207695_10248331 | |||
| 1509 | Ga0207695_10285620 | |||
| 1510 | Ga0207695_10300392 | |||
| 1511 | Ga0207695_10334119 | |||
| 1512 | Ga0207695_10611253 | |||
| 1513 | Ga0207671_10022423 | |||
| 1514 | Ga0207671_10041438 | |||
| 1515 | Ga0207671_10118150 | |||
| 1516 | Ga0207671_10150913 | |||
| 1517 | Ga0207671_10225516 | |||
| 1518 | Ga0207671_10265496 | |||
| 1519 | Ga0207671_10965459 | |||
| 1520 | Ga0207671_11234432 | |||
| 1521 | Ga0207671_11257285 | |||
| 1522 | Ga0207671_11534399 | |||
| 1523 | Ga0207693_10001073 | |||
| 1524 | Ga0207693_10096674 | |||
| 1525 | Ga0207693_10145556 | |||
| 1526 | Ga0207663_10015727 | |||
| 1527 | Ga0207663_10046213 | |||
| 1528 | Ga0207663_10150811 | |||
| 1529 | Ga0207663_11123699 | |||
| 1530 | Ga0207663_11204552 | |||
| 1531 | Ga0207660_10123735 | |||
| 1532 | Ga0207660_10290489 | |||
| 1533 | Ga0207660_10414623 | |||
| 1534 | Ga0207660_11136872 | |||
| 1535 | Ga0207649_11684838 | |||
| 1536 | Ga0207652_10007347 | |||
| 1537 | Ga0207652_10042736 | |||
| 1538 | Ga0207652_10105104 | |||
| 1539 | Ga0207652_10129069 | |||
| 1540 | Ga0207652_10349665 | |||
| 1541 | Ga0207694_10021741 | |||
| 1542 | Ga0207694_10068598 | |||
| 1543 | Ga0207694_10113623 | |||
| 1544 | Ga0207694_10198560 | |||
| 1545 | Ga0207694_10321892 | |||
| 1546 | Ga0207694_10360260 | |||
| 1547 | Ga0207694_10405768 | |||
| 1548 | Ga0207694_10475932 | |||
| 1549 | Ga0207694_11230806 | |||
| 1550 | Ga0207694_11324770 | |||
| 1551 | Ga0207694_11693444 | |||
| 1552 | Ga0207650_10121695 | |||
| 1553 | Ga0207687_10359695 | |||
| 1554 | Ga0207700_10043999 | |||
| 1555 | Ga0207700_10105359 | |||
| 1556 | Ga0207700_10129955 | |||
| 1557 | Ga0207700_10272844 | |||
| 1558 | Ga0207700_10313481 | |||
| 1559 | Ga0207664_10002103 | |||
| 1560 | Ga0207664_10043798 | |||
| 1561 | Ga0207664_11236179 | |||
| 1562 | Ga0207644_10010743 | |||
| 1563 | Ga0207644_10238995 | |||
| 1564 | Ga0207644_11301653 | |||
| 1565 | Ga0207709_10111002 | |||
| 1566 | Ga0207709_10974497 | |||
| 1567 | Ga0207669_11514255 | |||
| 1568 | Ga0207704_10178721 | |||
| 1569 | Ga0207704_11120415 | |||
| 1570 | Ga0207665_10009900 | |||
| 1571 | Ga0207665_10024297 | |||
| 1572 | Ga0207665_10209974 | |||
| 1573 | Ga0207665_11105230 | |||
| 1574 | Ga0207665_11303078 | |||
| 1575 | Ga0207691_10028917 | |||
| 1576 | Ga0207691_10532919 | |||
| 1577 | Ga0207711_10009890 | |||
| 1578 | Ga0207711_10392876 | |||
| 1579 | Ga0207711_10451073 | |||
| 1580 | Ga0207689_10257729 | |||
| 1581 | Ga0207689_10367985 | |||
| 1582 | Ga0207689_10714680 | |||
| 1583 | Ga0207689_11323870 | |||
| 1584 | Ga0207661_10085908 | |||
| 1585 | Ga0207679_11498530 | |||
| 1586 | Ga0207667_10001288 | |||
| 1587 | Ga0207667_10002087 | |||
| 1588 | Ga0207667_10004284 | |||
| 1589 | Ga0207667_10029032 | |||
| 1590 | Ga0207667_10030638 | |||
| 1591 | Ga0207667_10135711 | |||
| 1592 | Ga0207667_10504949 | |||
| 1593 | Ga0207667_10964254 | |||
| 1594 | Ga0207667_11159501 | |||
| 1595 | Ga0207651_10201044 | |||
| 1596 | Ga0207712_10140632 | |||
| 1597 | Ga0207712_10148369 | |||
| 1598 | Ga0207712_10197477 | |||
| 1599 | Ga0207712_10250731 | |||
| 1600 | Ga0207712_10719414 | |||
| 1601 | Ga0207712_10984952 | |||
| 1602 | Ga0207712_11356770 | |||
| 1603 | Ga0207668_11011456 | |||
| 1604 | Ga0207640_11164909 | |||
| 1605 | Ga0207658_10000591 | |||
| 1606 | Ga0207658_10010518 | |||
| 1607 | Ga0207658_10597585 | |||
| 1608 | Ga0207658_11277168 | |||
| 1609 | Ga0207658_12070820 | |||
| 1610 | Ga0207677_10010510 | |||
| 1611 | Ga0207703_10002339 | |||
| 1612 | Ga0207703_10002459 | |||
| 1613 | Ga0207703_10047903 | |||
| 1614 | Ga0207639_10021354 | |||
| 1615 | Ga0207639_10176300 | |||
| 1616 | Ga0207639_10333425 | |||
| 1617 | Ga0207639_10909001 | |||
| 1618 | Ga0207639_11469793 | |||
| 1619 | Ga0207678_10041356 | |||
| 1620 | Ga0207678_10870975 | |||
| 1621 | Ga0207708_10810691 | |||
| 1622 | Ga0207702_10015793 | |||
| 1623 | Ga0207702_10117519 | |||
| 1624 | Ga0207702_10361455 | |||
| 1625 | Ga0207702_11571241 | |||
| 1626 | Ga0207641_10003942 | |||
| 1627 | Ga0207641_10103026 | |||
| 1628 | Ga0207641_10134444 | |||
| 1629 | Ga0207641_11052030 | |||
| 1630 | Ga0207641_11990089 | |||
| 1631 | Ga0207648_10056590 | |||
| 1632 | Ga0207676_10089263 | |||
| 1633 | Ga0207674_10196527 | |||
| 1634 | Ga0207674_10312835 | |||
| 1635 | Ga0207674_10675999 | |||
| 1636 | Ga0207674_10749017 | |||
| 1637 | Ga0207675_100091899 | |||
| 1638 | Ga0207675_100114131 | |||
| 1639 | Ga0207675_100343058 | |||
| 1640 | Ga0207675_100649500 | |||
| 1641 | Ga0207683_10013351 | |||
| 1642 | Ga0207698_10199917 | |||
| 1643 | Ga0207698_10300900 | |||
| 1644 | Ga0209179_1000814 | |||
| 1645 | Ga0209588_1253812 | |||
| 1646 | Ga0207428_11076127 | |||
| 1647 | Ga0265354_1000847 | |||
| 1648 | Ga0265356_1002589 | |||
| 1649 | Ga0268266_10000228 | |||
| 1650 | Ga0268266_10033695 | |||
| 1651 | Ga0268266_10036093 | |||
| 1652 | Ga0268266_10088200 | |||
| 1653 | Ga0268266_10112965 | |||
| 1654 | Ga0268266_10284859 | |||
| 1655 | Ga0268266_10303330 | |||
| 1656 | Ga0268265_10231954 | |||
| 1657 | Ga0268265_10465256 | |||
| 1658 | Ga0268265_10522789 | |||
| 1659 | Ga0268265_10785514 | |||
| 1660 | Ga0268264_10000415 | |||
| 1661 | Ga0268264_10055146 | |||
| 1662 | Ga0268264_10310376 | |||
| 1663 | Ga0268264_10480672 | |||
| 1664 | Ga0268264_10973854 | |||
| 1665 | Ga0268264_11503279 | |||
| 1666 | Ga0268264_11985495 | |||
| 1667 | Ga0265326_10006119 | |||
| 1668 | Ga0265319_1003343 | |||
| 1669 | Ga0265334_10000110 | |||
| 1670 | Ga0265334_10116511 | |||
| 1671 | Ga0265318_10001420 | |||
| 1672 | Ga0265322_10054530 | |||
| 1673 | Ga0307515_10121469 | |||
| 1674 | Ga0307515_10386611 | |||
| 1675 | Ga0265338_10003886 | |||
| 1676 | Ga0265338_10004595 | |||
| 1677 | Ga0265338_10121167 | |||
| 1678 | Ga0265338_10301988 | |||
| 1679 | Ga0265338_11011668 | |||
| 1680 | Ga0307511_10000048 | |||
| 1681 | Ga0307511_10444357 | |||
| 1682 | Ga0265763_1004567 | |||
| 1683 | Ga0265763_1018299 | |||
| 1684 | Ga0265766_1018122 | |||
| 1685 | Ga0265770_1000921 | |||
| 1686 | Ga0265765_1012333 | |||
| 1687 | Ga0265769_120132 | |||
| 1688 | Ga0265768_114525 | |||
| 1689 | Ga0265760_10019346 | |||
| 1690 | Ga0265760_10019513 | |||
| 1691 | Ga0265330_10001462 | |||
| 1692 | Ga0265332_10003322 | |||
| 1693 | Ga0265328_10002296 | |||
| 1694 | Ga0265320_10006743 | |||
| 1695 | Ga0265325_10021380 | |||
| 1696 | Ga0265329_10005689 | |||
| 1697 | Ga0265340_10017992 | |||
| 1698 | Ga0265340_10055284 | |||
| 1699 | Ga0265340_10437074 | |||
| 1700 | Ga0265339_10059451 | |||
| 1701 | Ga0265339_10142669 | |||
| 1702 | Ga0265331_10005200 | |||
| 1703 | Ga0265331_10026337 | |||
| 1704 | Ga0265316_10017615 | |||
| 1705 | Ga0307513_10013479 | |||
| 1706 | Ga0307513_10036178 | |||
| 1707 | Ga0307513_10159768 | |||
| 1708 | Ga0307509_10000017 | |||
| 1709 | Ga0307509_10886932 | |||
| 1710 | Ga0307408_100660449 | |||
| 1711 | Ga0265313_10012355 | |||
| 1712 | Ga0265313_10028992 | |||
| 1713 | Ga0265313_10052342 | |||
| 1714 | Ga0265313_10333670 | |||
| 1715 | Ga0307508_10181705 | |||
| 1716 | Ga0316575_10031436 | |||
| 1717 | Ga0265314_10021433 | |||
| 1718 | Ga0265342_10027787 | |||
| 1719 | Ga0316576_10468568 | |||
| 1720 | Ga0307516_10866194 | |||
| 1721 | Ga0316577_10224253 | |||
| 1722 | Ga0307413_10626574 | |||
| 1723 | Ga0307406_11008326 | |||
| 1724 | Ga0307415_100434816 | |||
| 1725 | Ga0307507_10262248 | |||
| 1726 | Ga0307510_10000002 | |||
| 1727 | Ga0307510_10049322 | |||
| 1728 | Ga0307510_10184578 | |||
| 1729 | Ga0316214_1018039 | |||
| 1730 | Ga0316212_1021990 | |||
| 1731 | Ga0373934_0432672 | |||
| 1732 | Ga0373934_0468921 | |||
| 1733 | Ga0373936_0437840 | |||
| 1734 | Ga0373945_0060478 | |||
| 1735 | Ga0373953_0305187 | |||
| 1736 | Ga0373954_0032042 | |||
| 1737 | Ga0373954_0045113 | |||
| 1738 | Ga0373956_0142240 | |||
| 1739 | Ga0373957_0080328 | |||
| 1740 | Ga0373957_0474593 | |||
| 1741 | Ga0373943_0203329 | |||
| 1742 | Ga0373955_0076292 | |||
| 1743 | Ga0373955_0931179 | |||
| 1744 | Ga0373955_0964797 | |||
| 1745 | Ga0316574_0102368 | |||
| 1746 | Ga0373924_0028157 | |||
| 1747 | Ga0373924_0061737 | |||
| 1748 | Ga0373924_0374255 | |||
| 1749 | Ga0373935_0293770 | |||
| 1750 | Ga0373927_0116216 | |||
| 1751 | Ga0373933_0090878 | |||
| 1752 | Ga0373933_0526170 | |||
| 1753 | Ga0373933_0711584 | |||
| 1754 | Ga0373937_0023813 | |||
| 1755 | Ga0373937_0382064 | |||
| 1756 | Ga0373937_0535962 | |||
| 1757 | Ga0373937_0710347 | |||
| 1758 | Ga0265778_046957 | |||
| 1759 | Ga0316584_0466911 | |||
| 1760 | Ga0316584_0879318 | |||
| 1761 | Ga0373925_0043471 | |||
| 1762 | Ga0373925_0602867 | |||
| 1763 | Ga0395900_0063512 | |||
| 1764 | Ga0395900_0205619 | |||
| 1765 | Ga0395900_0600041 | |||
| 1766 | Ga0395898_0026504 | |||
| 1767 | Ga0395898_0032383 | |||
| 1768 | Ga0316581_0244980 | |||
| 1769 | Ga0436364_0110092 | |||
| 1770 | Ga0436364_0174527 | |||
| 1771 | Ga0400483_256878 | |||
| 1772 | Ga0400487_14166 | |||
| 1773 | Ga0400487_27409 | |||
| 1774 | Ga0436365_0237205 | |||
| 1775 | Ga0436365_0611032 | |||
| 1776 | Ga0436365_0868934 | |||
| 1777 | Ga0436365_0874562 | |||
| 1778 | Ga0436365_1206550 | |||
| 1779 | Ga0436360_0028921 | |||
| 1780 | Ga0436360_0180700 | |||
| 1781 | Ga0436360_0239842 | |||
| 1782 | Ga0436360_0970044 | |||
| 1783 | Ga0436360_1090775 | |||
| 1784 | Ga0436360_1183037 | |||
| 1785 | Ga0436360_1364095 | |||
| 1786 | Ga0436361_0561964 | |||
| 1787 | Ga0436361_1160124 | |||
| 1788 | Ga0436363_0425036 | |||
| 1789 | Ga0436363_0458954 | |||
| 1790 | Ga0436363_0913390 | |||
| 1791 | Ga0436363_1075031 | |||
| 1792 | Ga0436363_1444365 | |||
| 1793 | Ga0436363_1519240 | |||
| 1794 | Ga0436363_1637866 | |||
| 1795 | Ga0436362_0067735 | |||
| 1796 | Ga0436362_0691176 | |||
| 1797 | Ga0436362_1011958 | |||
| 1798 | Ga0436362_1095678 | |||
| 1799 | Ga0436362_1234617 | |||
| 1800 | Ga0436362_1273112 | |||
| 1801 | Ga0451789_1168205 | |||
| 1802 | Ga0451789_1366508 | |||
| 1803 | Ga0451791_1538412 | |||
| 1804 | Ga0451791_1541669 | |||
| 1805 | Ga0451793_0858019 | |||
| 1806 | Ga0451798_0714897 | |||
| 1807 | Ga0451800_1140122 | |||
| 1808 | Ga0451802_1913729 | |||
| 1809 | Ga0451804_0626684 | |||
| 1810 | Ga0451807_1166408 | |||
| 1811 | Ga0451807_1517446 | |||
| 1812 | Ga0451807_1763801 | |||
| 1813 | Ga0451833_1101685 | |||
| 1814 | Ga0451833_1400472 | |||
| 1815 | Ga0451835_0670032 | |||
| 1816 | Ga0451845_0780617 | |||
| 1817 | Ga0451845_0858351 | |||
| 1818 | Ga0451847_0404821 | |||
| 1819 | Ga0451849_0366760 | |||
| 1820 | Ga0451843_1077815 | |||
| 1821 | Ga0451855_0259858 | |||
| 1822 | Ga0451853_0012702 | |||
| 1823 | Ga0451853_2312926 | |||
| 1824 | Ga0451853_2663512 | |||
| 1825 | Ga0452271_49259 | |||
| 1826 | Ga0439459_0109957 | |||
| 1827 | Ga0466969_0000701 | |||
| 1828 | Ga0466972_0045402 | |||
| 1829 | Ga0453683_0147982 | |||
| 1830 | Ga0466965_0314380 | |||
| 1831 | Ga0466966_0001335 | |||
| 1832 | Ga0466966_0559840 | |||
| 1833 | Ga0466961_0061745 | |||
| 1834 | Ga0466961_0478165 | |||
| 1835 | Ga0466964_0000158 | |||
| 1836 | Ga0453684_0039369 | |||
| 1837 | Ga0453684_0634709 | |||
| 1838 | Ga0466971_0000297 | |||
| 1839 | Ga0466970_0009583 | |||
| 1840 | Ga0466957_1101188 | |||
| 1841 | Ga0466957_1195853 | |||
| 1842 | Ga0466959_0000251 | |||
| 1843 | Ga0466959_0073766 | |||
| 1844 | Ga0451576_0036838 | |||
| 1845 | Ga0451576_0087532 | |||
| 1846 | Ga0466958_0027464 | |||
| 1847 | Ga0466967_0853892 | |||
| 1848 | Ga0466967_2009656 | |||
| 1849 | Ga0495617_043937 | |||
| 1850 | Ga0495592_0531389 | |||
| 1851 | Ga0495592_0532880 | |||
| 1852 | Ga0495603_0193990 | |||
| 1853 | Ga0495590_0002104 | |||
| 1854 | Ga0495591_017112 | |||
| 1855 | Ga0495629_0164259 | |||
| 1856 | Ga0495629_0863337 | |||
| 1857 | Ga0495638_0054799 | |||
| 1858 | Ga0495638_0248445 | |||
| 1859 | Ga0495638_0347797 | |||
| 1860 | Ga0495638_0464488 | |||
| 1861 | Ga0495580_0010362 | |||
| 1862 | Ga0495580_0058818 | |||
| 1863 | Ga0495580_0059714 | |||
| 1864 | Ga0495580_0659122 | |||
| 1865 | Ga0495582_0732913 | |||
| 1866 | Ga0495582_0822267 | |||
| 1867 | Ga0495639_0358586 | |||
| 1868 | Ga0495662_0187795 | |||
| 1869 | Ga0495584_0053391 | |||
| 1870 | Ga0495584_0240861 | |||
| 1871 | Ga0495583_0405575 | |||
| 1872 | Ga0495606_0035789 | |||
| 1873 | Ga0495606_0218062 | |||
| 1874 | Ga0495610_0268145 | |||
| 1875 | Ga0495618_0116902 | |||
| 1876 | Ga0495620_0216152 | |||
| 1877 | Ga0495628_0104439 | |||
| 1878 | Ga0495628_0152437 | |||
| 1879 | Ga0495631_0219204 | |||
| 1880 | Ga0495632_0067205 | |||
| 1881 | Ga0495632_0086312 | |||
| 1882 | Ga0495632_0132088 | |||
| 1883 | Ga0495644_0005529 | |||
| 1884 | Ga0495663_0101732 | |||
| 1885 | Ga0495654_0108458 | |||
| 1886 | Ga0495654_0300284 | |||
| 1887 | Ga0495665_0027815 | |||
| 1888 | Ga0495640_0464200 | |||
| 1889 | Ga0495586_0041882 | |||
| 1890 | Ga0495586_0738007 | |||
| 1891 | Ga0495586_0830976 | |||
| 1892 | Ga0495587_0070874 | |||
| 1893 | Ga0495598_0074542 | |||
| 1894 | Ga0495621_0000821 | |||
| 1895 | Ga0495622_0293054 | |||
| 1896 | Ga0495622_0413045 | |||
| 1897 | Ga0495633_0223509 | |||
| 1898 | Ga0495633_0358579 | |||
| 1899 | Ga0495667_0961963 | |||
| 1900 | Ga0495656_0034044 | |||
| 1901 | Ga0495668_0134528 | |||
| 1902 | Ga0495668_0288790 | |||
| 1903 | Ga0495625_0092413 | |||
| 1904 | Ga0495625_0113958 | |||
| 1905 | Ga0495625_0150526 | |||
| 1906 | Ga0495635_0144364 | |||
| 1907 | Ga0495635_0349330 | |||
| 1908 | Ga0495599_0141261 | |||
| 1909 | Ga0495647_0024714 | |||
| 1910 | Ga0495647_0167630 | |||
| 1911 | Ga0495647_0222920 | |||
| 1912 | Ga0495658_0015584 | |||
| 1913 | Ga0495658_0067565 | |||
| 1914 | Ga0495669_0103873 | |||
| 1915 | Ga0495669_0257972 | |||
| 1916 | Ga0495613_0823290 | |||
| 1917 | Ga0495613_0956358 | |||
| 1918 | Ga0495670_0409208 | |||
| 1919 | Ga0495670_0495021 | |||
| 1920 | Ga0495671_0124163 | |||
| 1921 | Ga0495649_0058055 | |||
| 1922 | Ga0495649_0195827 | |||
| 1923 | Ga0495649_0252519 | |||
| 1924 | Ga0495660_0318379 | |||
| 1925 | Ga0495581_0165833 | |||
| 1926 | Ga0495604_0202041 | |||
| 1927 | Ga0495674_0021182 | |||
| 1928 | Ga0495674_0929390 | |||
| 1929 | Ga0495676_0472109 | |||
| 1930 | Ga0495680_0301768 | |||
| 1931 | Ga0495683_0396949 | |||
| 1932 | Ga0495687_027813 | |||
| 1933 | Ga0495687_030505 | |||
| 1934 | Ga0495673_0161680 | |||
| 1935 | Ga0495673_0278807 | |||
| 1936 | Ga0495681_0022734 | |||
| 1937 | Ga0495681_0288024 | |||
| 1938 | Ga0495686_0082058 | |||
| 1939 | Ga0495686_0275510 | |||
| 1940 | Ga0495686_0443843 | |||
| 1941 | Ga0495614_0317215 | |||
| 1942 | Ga0495615_0089778 | |||
| 1943 | Ga0496100_0005916 | |||
| 1944 | Ga0496100_0461094 | |||
| 1945 | Ga0496100_0508140 | |||
| 1946 | Ga0496101_0003364 | |||
| 1947 | Ga0496101_0171809 | |||
| 1948 | Ga0496102_0016336 | |||
| 1949 | Ga0496102_0050361 | |||
| 1950 | Ga0496102_0154652 | |||
| 1951 | Ga0496103_0079527 | |||
| 1952 | Ga0496103_0454074 | |||
| 1953 | Ga0496103_0576207 | |||
| 1954 | Ga0496104_0028290 | |||
| 1955 | Ga0496104_0085586 | |||
| 1956 | Ga0496104_0240521 | |||
| 1957 | Ga0496105_0017713 | |||
| 1958 | Ga0496105_0036455 | |||
| 1959 | Ga0496105_0148857 | |||
| 1960 | Ga0496106_0087865 | |||
| 1961 | Ga0496106_0164073 | |||
| 1962 | Ga0496107_0002116 | |||
| 1963 | Ga0496107_0249319 | |||
| 1964 | Ga0496107_0641088 | |||
| 1965 | Ga0496107_0913515 | |||
| 1966 | Ga0496108_0328944 | |||
| 1967 | Ga0496108_0408486 | |||
| 1968 | Ga0496109_0059622 | |||
| 1969 | Ga0496111_0018991 | |||
| 1970 | Ga0496112_0030840 | |||
| 1971 | Ga0496112_0031223 | |||
| 1972 | Ga0496113_0172913 | |||
| 1973 | Ga0496114_0004330 | |||
| 1974 | Ga0496114_0019094 | |||
| 1975 | Ga0496114_0279664 | |||
| 1976 | Ga0496115_0001174 | |||
| 1977 | Ga0496115_0247333 | |||
| 1978 | Ga0496115_0567916 | |||
| 1979 | Ga0496116_0019290 | |||
| 1980 | Ga0496117_0000135 | |||
| 1981 | Ga0496118_0000098 | |||
| 1982 | Ga0496118_0061479 | |||
| 1983 | Ga0496119_0165103 | |||
| 1984 | Ga0496119_0172631 | |||
| 1985 | Ga0496120_0000543 | |||
| 1986 | Ga0496120_0380612 | |||
| 1987 | Ga0496121_0001196 | |||
| 1988 | Ga0496124_0008240 | |||
| 1989 | Ga0496125_0000653 | |||
| 1990 | Ga0496125_0010007 | |||
| 1991 | Ga0496125_0120972 | |||
| 1992 | Ga0496126_0140483 | |||
| 1993 | Ga0496126_0334959 | |||
| 1994 | Ga0496126_1205530 | |||
| 1995 | Ga0501031_0083119 | |||
| 1996 | Ga0501031_0283721 | |||
| 1997 | Ga0501031_0645037 | |||
| 1998 | Ga0501033_0054857 | |||
| 1999 | Ga0501034_0186314 | |||
| 2000 | Ga0501036_0015625 | |||
| 2001 | Ga0501036_0043159 | |||
| 2002 | Ga0501037_0055914 | |||
| 2003 | Ga0501037_0206862 | |||
| 2004 | Ga0501038_0093384 | |||
| 2005 | Ga0501038_0104231 | |||
| 2006 | Ga0501039_0028242 | |||
| 2007 | Ga0501039_0044339 | |||
| 2008 | Ga0501040_0009688 | |||
| 2009 | Ga0501040_0034507 | |||
| 2010 | Ga0501041_0005070 | |||
| 2011 | Ga0501041_0006915 | |||
| 2012 | Ga0501042_0000933 | |||
| 2013 | Ga0501042_0005669 | |||
| 2014 | Ga0501043_0047000 | |||
| 2015 | Ga0501043_0239354 | |||
| 2016 | Ga0501046_0073285 | |||
| 2017 | Ga0501046_0118593 | |||
| 2018 | Ga0501046_0621138 | |||
| 2019 | Ga0501047_0733751 | |||
| 2020 | Ga0501047_1122399 | |||
| 2021 | Ga0501048_0186797 | |||
| 2022 | Ga0501048_0190912 | |||
| 2023 | Ga0501048_0357668 | |||
| 2024 | Ga0501068_0009560 | |||
| 2025 | Ga0501068_0153845 | |||
| 2026 | Ga0501068_0722982 | |||
| 2027 | Ga0501070_0932629 | |||
| 2028 | Ga0501071_0004416 | |||
| 2029 | Ga0501071_0077720 | |||
| 2030 | Ga0501071_1194068 | |||
| 2031 | Ga0501072_0001013 | |||
| 2032 | Ga0501072_0003245 | |||
| 2033 | Ga0501074_0059271 | |||
| 2034 | Ga0501074_0065853 | |||
| 2035 | Ga0501075_0001675 | |||
| 2036 | Ga0501075_0113368 | |||
| 2037 | Ga0501076_0002336 | |||
| 2038 | Ga0501076_0231477 | |||
| 2039 | Ga0501076_1159186 | |||
| 2040 | Ga0501077_0013647 | |||
| 2041 | Ga0501077_0099855 | |||
| 2042 | Ga0501257_119693 | |||
| 2043 | Ga0501079_0088661 | |||
| 2044 | Ga0501079_0134816 | |||
| 2045 | Ga0501079_1105069 | |||
| 2046 | Ga0501080_0025523 | |||
| 2047 | Ga0501080_0057548 | |||
| 2048 | Ga0501080_0673036 | |||
| 2049 | Ga0501081_0000553 | |||
| 2050 | Ga0501083_0091901 | |||
| 2051 | Ga0501083_0145558 | |||
| 2052 | Ga0501035_0040058 | |||
| 2053 | Ga0501035_0109178 | |||
| 2054 | Ga0501035_0205160 | |||
| 2055 | Ga0501044_0363376 | |||
| 2056 | Ga0501045_0037405 | |||
| 2057 | Ga0501045_0099346 | |||
| 2058 | nmdc:mga08y16_445413_c1 | |||
| 2059 | nmdc:mga0n895_2062079_c1 | |||
| 2060 | nmdc:mga0rr50_172788_c1 | |||
| 2061 | nmdc:mga08x19_44840_c1 | |||
| 2062 | nmdc:mga08x19_917492_c1 | |||
| 2063 | Ga0495601_0148183 | |||
| 2064 | Ga0495619_0195043 | |||
| 2065 | Ga0500646_0034846 | |||
| 2066 | Ga0500646_0332761 | |||
| 2067 | Ga0500583_0055810 | |||
| 2068 | Ga0500583_0527407 | |||
| 2069 | Ga0500641_0065908 | |||
| 2070 | Ga0500650_0479318 | |||
| 2071 | Ga0500556_0000455 | |||
| 2072 | Ga0500556_0047640 | |||
| 2073 | Ga0500562_171457 | |||
| 2074 | Ga0500572_023826 | |||
| 2075 | Ga0500591_071318 | |||
| 2076 | Ga0500594_0027809 | |||
| 2077 | Ga0500594_0055565 | |||
| 2078 | Ga0500597_253662 | |||
| 2079 | Ga0500614_187643 | |||
| 2080 | Ga0500617_026529 | |||
| 2081 | Ga0500628_031885 | |||
| 2082 | Ga0500642_0089533 | |||
| 2083 | Ga0500642_0185887 | |||
| 2084 | Ga0500652_191390 | |||
| 2085 | Ga0500655_104642 | |||
| 2086 | Ga0500658_0013165 | |||
| 2087 | Ga0500568_0087049 | |||
| 2088 | Ga0500573_0383487 | |||
| 2089 | Ga0500588_0019770 | |||
| 2090 | Ga0500590_286239 | |||
| 2091 | Ga0500616_0000064 | |||
| 2092 | Ga0500619_084471 | |||
| 2093 | Ga0500622_0018720 | |||
| 2094 | Ga0500624_047593 | |||
| 2095 | Ga0500627_0054137 | |||
| 2096 | Ga0500627_0344393 | |||
| 2097 | Ga0500630_073726 | |||
| 2098 | Ga0500634_0297560 | |||
| 2099 | Ga0500639_271748 | |||
| 2100 | Ga0500636_0168372 | |||
| 2101 | Ga0500636_0350564 | |||
| 2102 | Ga0500637_0013173 | |||
| 2103 | Ga0500637_0018818 | |||
| 2104 | Ga0500637_0251037 | |||
| 2105 | Ga0500656_000697 | |||
| 2106 | Ga0501084_0020689 | |||
| 2107 | Ga0501084_0071085 | |||
| 2108 | Ga0587073_0226134 | |||
| 2109 | Ga0587085_086850 | |||
| 2110 | Ga0587085_157611 | |||
| 2111 | Ga0587086_067049 | |||
| 2112 | Ga0587088_157297 | |||
| 2113 | Ga0587090_105364 | |||
| 2114 | Ga0587091_239230 | |||
| 2115 | Ga0587117_128790 | |||
| 2116 | Ga0587128_145750 | |||
| 2117 | Ga0587128_178304 | |||
| 2118 | Ga0587072_155314 | |||
| 2119 | Ga0587107_124680 | |||
| 2120 | Ga0587110_056896 | |||
| 2121 | Ga0587111_0223616 | |||
| 2122 | Ga0587111_0230263 | |||
| 2123 | Ga0587111_0249046 | |||
| 2124 | Ga0501082_0009857 | |||
| 2125 | Ga0501082_0016530 | |||
| 2126 | Ga0466962_0000186 | |||
| 2127 | Ga0530510_0056263 | |||
| 2128 | Ga0530510_0922582 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hei-assembly1.cif.gz_A | 2a x-ray structure of hpf from vibrio cholerae | 0.9722 | 1 | 91 |
| 6h4n-assembly1.cif.gz_x | structure of a hibernating 100s ribosome reveals an inactive conformation of the ribosomal protein s1 - 70s hibernating e. coli ribosome | 0.9575 | 1 | 95 |
| 5zep-assembly1.cif.gz_x | m. smegmatis hibernating state 70s ribosome structure | 0.9523 | 1 | 89 |
| 4hei-assembly1.cif.gz_A | 2a x-ray structure of hpf from vibrio cholerae | 0.9518 | 1 | 91 |
| 4v8h-assembly2.cif.gz_CX | crystal structure of hpf bound to the 70s ribosome. | 0.9511 | 1 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3v26X00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like | 0.9559 | 1 | 95 | 3.30.160.100 |
| 3v26X00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like | 0.9463 | 1 | 95 | 3.30.160.100 |
| af_I1KB15_71_175_3.30.160.100 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like | 0.9462 | 2 | 95 | 3.30.160.100 |
| af_O05886_21_120_3.30.160.100 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like | 0.9383 | 4 | 92 | 3.30.160.100 |
| 2ywqA00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Ribosome hibernation promotion factor-like | 0.9108 | 4 | 88 | 3.30.160.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1E4GM68-F1-model_v4 | deleted | 0.9892 | 1 | 96 |
|
| AF-A0A1I0G1G5-F1-model_v4 | Ribosome hibernation promoting factor | 0.9887 | 1 | 96 |
GO:0022627
GO:0043024 GO:0045900 |
| AF-A0A8A6BD65-F1-model_v4 | deleted | 0.9874 | 1 | 96 |
|
| AF-A0A3M5BPR1-F1-model_v4 | deleted | 0.9862 | 1 | 94 |
|
| AF-A0A3M5W8G8-F1-model_v4 | Ribosome hibernation promoting factor (Hibernation factor HPF) | 0.9861 | 13 | 94 |
GO:0022627
GO:0043024 GO:0045900 |