F489170

General Info

Members Datasets Scaffolds Average Seq Length
1056 511 1017 238

Family's Representative Sequence

Representative Sequence 3300002705|JGI25156J39149_1001066|JGI25156J39149_100106611
Length 284
Sequence MRGIYAQVLGRDKDALAWNKGGVRRGKATLQSWETATMFKRLFAEFFGTFWLVLGGCGSAVLAAAFPNLGIGFAGVALAFGLTVVTMAYACAGISGAHFNPAVTVGLFFGGRFSGKDVVPYIVSQVIGAIVAAAVLYVIASGKPGFDATASGFASNGYAAHSPGGYSLQACVVCEFVLTAMFLIVIHGATDRRAPAGFGPLAIGLALTLIHLISIPVTNTSVNPARSTGVAIFQGTWALQQLWMFWLVPLLGGAAGGLIFRFLLGEDVAKPSVAAGAQAGMSNA

Samples

Sample ID Description Type Environment
1 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
2 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
6 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
7 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
8 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
9 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
10 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
11 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
12 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
13 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
14 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
15 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
16 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
17 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
18 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
19 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
20 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
21 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
22 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
23 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
24 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
25 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
26 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
27 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
28 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
29 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
30 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
31 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
32 2914759650 Rhizosphaericola mali Isolate Rhizosphere
33 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
34 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
35 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
36 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
37 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
38 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
39 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
40 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
41 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
42 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
43 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
44 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
45 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
46 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
47 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
48 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
49 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
50 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
51 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
52 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
53 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
54 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
55 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
56 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
57 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
58 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
59 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
60 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
63 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
64 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
65 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
66 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
67 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
68 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
69 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
70 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
71 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
72 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
73 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
74 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
75 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
76 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
77 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
78 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
79 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
80 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
81 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
82 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
83 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
84 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
85 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
86 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
87 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
90 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
95 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
96 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
97 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
104 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
105 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
106 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
107 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
108 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
109 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
110 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
111 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
112 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
113 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
114 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
115 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
116 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
117 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
118 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
119 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
120 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
121 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
122 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
123 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
124 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
125 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
126 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
127 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
130 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
131 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
132 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
133 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
136 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
137 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
140 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
146 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
148 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
155 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
156 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
157 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
158 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
159 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
160 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
161 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
162 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
163 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
164 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
165 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
166 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
167 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
168 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
169 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
170 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
171 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
172 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
175 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
182 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
183 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
185 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
186 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
194 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
259 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
262 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
263 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
267 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
268 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
269 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
270 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
272 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
273 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
274 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
275 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
276 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
277 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
278 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
279 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
280 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
281 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
282 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
283 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
284 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
285 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
286 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
287 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
288 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
289 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
290 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
291 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
292 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
293 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
294 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
295 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
296 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
297 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
298 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
299 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
300 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
301 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
302 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
303 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
304 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
305 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
306 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
307 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
308 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
309 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
310 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
311 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
312 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
313 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
314 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
315 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
316 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
317 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
318 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
319 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
320 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
321 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
322 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
323 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
324 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
325 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
326 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
327 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
328 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
329 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
330 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
331 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
332 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
333 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
334 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
335 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
336 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
337 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
338 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
339 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
340 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
341 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
342 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
343 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
344 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
345 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
346 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
347 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
348 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
349 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
350 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
351 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
352 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
353 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
354 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
355 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
356 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
357 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
358 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
359 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
360 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
361 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
362 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
363 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
364 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
365 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
366 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
367 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
368 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
369 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
370 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
371 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
372 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
373 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
374 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
375 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
376 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
377 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
378 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
379 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
380 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
381 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
382 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
383 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
384 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
385 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
386 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
387 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
388 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
389 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
390 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
391 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
392 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
393 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
394 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
395 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
396 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
397 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
398 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
399 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
400 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
401 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
402 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
403 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
404 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
405 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
406 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
407 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
408 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
409 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
410 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
411 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
412 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
413 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
414 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
415 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
416 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
417 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
418 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
419 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
420 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
421 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
422 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
423 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
424 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
425 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
426 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
427 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
428 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
429 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
430 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
431 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
432 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
433 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
434 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
435 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
436 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
437 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
438 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
439 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
440 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
441 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
442 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
443 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
444 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
445 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
446 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
447 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
448 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
449 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
450 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
451 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
452 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
453 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
454 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
458 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
459 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
460 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
461 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
462 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
463 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
468 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
469 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
470 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
471 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
472 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
473 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
474 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
475 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
476 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
477 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
478 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
479 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
480 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
481 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
482 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
483 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
484 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
485 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
486 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
487 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
488 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
489 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
490 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
491 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
492 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
493 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
494 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
495 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
496 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
497 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
498 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
499 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
500 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
501 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
502 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
503 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
504 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
505 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
506 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
507 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
508 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
509 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
510 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
511 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.21
Metatranscriptomes 0.09
Isolates 3.69

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 7.01
Nodule 0.47
Rhizoplane 1.52
Rhizosphere 83.52
Stem 0
Stem Tuber 0
Unclassified 7.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1001066 3300002705 Bacteria 12662
2 JGI25162J39368_1000995 3300002737 Bacteria 17881
3 JGI25162J39368_1001495 3300002737 Bacteria 12188
4 JGI25162J39368_1002049 3300002737 Bacteria 8790
5 JGI25154J39366_1002110 3300002738 Bacteria 5581
6 JGI25157J39369_1000342 3300002741 Bacteria 32979
7 JGI25157J39369_1001042 3300002741 Bacteria 12663
8 JGI25164J39214_1000078 3300002772 Bacteria 94809
9 JGI25164J39214_1000738 3300002772 Bacteria 12191
10 JGI25164J39214_1000760 3300002772 Bacteria 11831
11 JGI25165J46597_1000088 3300003214 Bacteria 169821
12 JGI25165J46597_1000245 3300003214 Bacteria 73709
13 JGI25165J46597_1001490 3300003214 Bacteria 12004
14 JGI25165J46597_1001854 3300003214 Bacteria 8739
15 rootH2_10009385 3300003320 Bacteria 8751
16 rootH2_10193234 3300003320 Bacteria 1314
17 rootL2_10155819 3300003322 Bacteria 7965
18 rootH1_10075165 3300003323 Bacteria 12585
19 Ga0055525_1000146 3300003759 Bacteria 97114
20 Ga0055527_1000074 3300003760 Bacteria 82742
21 Ga0055535_1000359 3300003761 Bacteria 44033
22 Ga0055535_1000372 3300003761 Bacteria 42891
23 Ga0055542_1000151 3300003762 Bacteria 87857
24 Ga0055542_1000168 3300003762 Bacteria 82742
25 Ga0055542_1000352 3300003762 Bacteria 48395
26 Ga0055529_1000163 3300003763 Bacteria 92012
27 Ga0055529_1000543 3300003763 Bacteria 32272
28 Ga0055526_1000232 3300003771 Bacteria 46733
29 Ga0055537_1000030 3300003773 Bacteria 100491
30 Ga0055524_1002681 3300003775 Bacteria 9017
31 Ga0055534_1000447 3300003784 Bacteria 24217
32 Ga0055528_1000439 3300003790 Bacteria 33348
33 Ga0065703_1018836 3300005272 Bacteria 6188
34 Ga0065704_10074548 3300005289 Bacteria 6194
35 Ga0065704_10332195 3300005289 Bacteria 834
36 Ga0065715_10003421 3300005293 Bacteria 4050
37 Ga0065715_10212795 3300005293 Bacteria 1306
38 Ga0070658_10504740 3300005327 Bacteria 1045
39 Ga0070676_10024163 3300005328 Bacteria 3421
40 Ga0070676_10173087 3300005328 Bacteria 1398
41 Ga0070676_10235689 3300005328 Bacteria 1215
42 Ga0070676_10368502 3300005328 Bacteria 992
43 Ga0070683_100007566 3300005329 Bacteria 9184
44 Ga0070683_100505607 3300005329 Bacteria 1154
45 Ga0070690_100006132 3300005330 Bacteria 6805
46 Ga0070690_100029833 3300005330 Bacteria 3386
47 Ga0070690_100482899 3300005330 Bacteria 924
48 Ga0070677_10020372 3300005333 Bacteria 2415
49 Ga0070677_10042635 3300005333 Bacteria 1798
50 Ga0068869_100015418 3300005334 Bacteria 5126
51 Ga0070666_10007588 3300005335 Bacteria 6692
52 Ga0070666_10051454 3300005335 Bacteria 2774
53 Ga0070666_10067052 3300005335 Bacteria 2436
54 Ga0070680_100553621 3300005336 Bacteria 986
55 Ga0070682_100000474 3300005337 Bacteria 25301
56 Ga0068868_100003208 3300005338 Bacteria 11384
57 Ga0068868_100016571 3300005338 Bacteria 5477
58 Ga0070660_100266428 3300005339 Bacteria 1400
59 Ga0070660_100650995 3300005339 Bacteria 882
60 Ga0070689_100091651 3300005340 Bacteria 2396
61 Ga0070687_100059708 3300005343 Bacteria 2009
62 Ga0070668_100031835 3300005347 Bacteria 4013
63 Ga0070669_100164277 3300005353 Bacteria 1727
64 Ga0070675_100000208 3300005354 Bacteria 37508
65 Ga0070675_100009783 3300005354 Bacteria 7469
66 Ga0070675_100234616 3300005354 Bacteria 1601
67 Ga0070675_100864699 3300005354 Bacteria 828
68 Ga0070671_100001433 3300005355 Bacteria 17805
69 Ga0070671_100341699 3300005355 Bacteria 1277
70 Ga0070671_100545243 3300005355 Bacteria 1000
71 Ga0070674_100020413 3300005356 Bacteria 4233
72 Ga0070673_100000523 3300005364 Bacteria 20606
73 Ga0070688_100065452 3300005365 Bacteria 2310
74 Ga0070688_100121598 3300005365 Bacteria 1750
75 Ga0070659_100714914 3300005366 Bacteria 867
76 Ga0070667_100001902 3300005367 Bacteria 18530
77 Ga0070667_100112715 3300005367 Bacteria 2359
78 Ga0070703_10000113 3300005406 Bacteria 41936
79 Ga0070714_100056798 3300005435 Bacteria 3349
80 Ga0070714_100117931 3300005435 Bacteria 2358
81 Ga0070713_100032163 3300005436 Bacteria 4187
82 Ga0070713_100162298 3300005436 Bacteria 1996
83 Ga0070713_100228091 3300005436 Bacteria 1692
84 Ga0070701_10011600 3300005438 Bacteria 3948
85 Ga0070711_100126251 3300005439 Bacteria 1899
86 Ga0070711_100188716 3300005439 Bacteria 1582
87 Ga0070711_100211362 3300005439 Bacteria 1503
88 Ga0070705_100296412 3300005440 Bacteria 1157
89 Ga0070700_100009956 3300005441 Bacteria 5232
90 Ga0070700_100048201 3300005441 Bacteria 2640
91 Ga0070700_100367358 3300005441 Bacteria 1072
92 Ga0070694_100005129 3300005444 Bacteria 7897
93 Ga0070708_100084056 3300005445 Bacteria 2887
94 Ga0070708_100370732 3300005445 Bacteria 1350
95 Ga0070708_100373407 3300005445 Bacteria 1344
96 Ga0070678_100000227 3300005456 Bacteria 25438
97 Ga0070678_100023593 3300005456 Bacteria 4102
98 Ga0070678_100103126 3300005456 Bacteria 2215
99 Ga0070678_100380653 3300005456 Bacteria 1221
100 Ga0070662_100030296 3300005457 Bacteria 3784
101 Ga0070662_100135810 3300005457 Bacteria 1901
102 Ga0070662_100277722 3300005457 Bacteria 1355
103 Ga0068867_100025872 3300005459 Bacteria 4210
104 Ga0068867_100051158 3300005459 Bacteria 3046
105 Ga0068867_100615026 3300005459 Bacteria 949
106 Ga0070685_10053945 3300005466 Bacteria 2331
107 Ga0070685_10238652 3300005466 Bacteria 1199
108 Ga0070707_100057853 3300005468 Bacteria 3719
109 Ga0070707_100176789 3300005468 Bacteria 2081
110 Ga0070698_100014238 3300005471 Bacteria 8408
111 Ga0070698_100246073 3300005471 Bacteria 1721
112 Ga0070699_100015650 3300005518 Bacteria 6515
113 Ga0070699_100323386 3300005518 Bacteria 1387
114 Ga0070699_100405362 3300005518 Bacteria 1233
115 Ga0070679_100017929 3300005530 Bacteria 6859
116 Ga0070679_100196955 3300005530 Bacteria 1982
117 Ga0070684_100007379 3300005535 Bacteria 8548
118 Ga0070697_100032621 3300005536 Bacteria 4192
119 Ga0070697_100837722 3300005536 Bacteria 815
120 Ga0068853_100238057 3300005539 Bacteria 1667
121 Ga0068853_100447454 3300005539 Bacteria 1215
122 Ga0070686_100026997 3300005544 Bacteria 3471
123 Ga0070686_100478906 3300005544 Bacteria 962
124 Ga0070665_100041910 3300005548 Bacteria 4601
125 Ga0070665_100046639 3300005548 Bacteria 4352
126 Ga0070665_100082250 3300005548 Bacteria 3225
127 Ga0070665_100117248 3300005548 Bacteria 2665
128 Ga0070665_100180269 3300005548 Bacteria 2113
129 Ga0070665_100310869 3300005548 Bacteria 1579
130 Ga0070665_100754776 3300005548 Bacteria 986
131 Ga0070704_100005894 3300005549 Bacteria 7180
132 Ga0070704_100161035 3300005549 Bacteria 1775
133 Ga0068855_100001240 3300005563 Bacteria 31649
134 Ga0068855_100002346 3300005563 Bacteria 23375
135 Ga0068855_100013263 3300005563 Bacteria 9939
136 Ga0068855_100634742 3300005563 Bacteria 1149
137 Ga0070664_100012064 3300005564 Bacteria 7021
138 Ga0070664_100145424 3300005564 Bacteria 2090
139 Ga0070664_100148006 3300005564 Bacteria 2072
140 Ga0070664_100534515 3300005564 Bacteria 1083
141 Ga0068857_100207217 3300005577 Bacteria 1788
142 Ga0068856_100010356 3300005614 Bacteria 9057
143 Ga0068856_100235107 3300005614 Bacteria 1848
144 Ga0068856_100724484 3300005614 Bacteria 1015
145 Ga0070702_100111863 3300005615 Bacteria 1694
146 Ga0070702_100242822 3300005615 Bacteria 1216
147 Ga0068852_100031895 3300005616 Bacteria 4356
148 Ga0068852_100064778 3300005616 Bacteria 3187
149 Ga0068859_100000008 3300005617 Bacteria 383750
150 Ga0068859_100004743 3300005617 Bacteria 13816
151 Ga0068859_100021239 3300005617 Bacteria 6515
152 Ga0068859_100197930 3300005617 Bacteria 2094
153 Ga0068859_100393256 3300005617 Bacteria 1482
154 Ga0068859_100468269 3300005617 Bacteria 1356
155 Ga0068864_100000101 3300005618 Bacteria 84095
156 Ga0068864_100085017 3300005618 Unclassified 2781
157 Ga0068864_100316511 3300005618 Bacteria 1465
158 Ga0068864_100504502 3300005618 Bacteria 1164
159 Ga0068866_10011077 3300005718 Bacteria 3887
160 Ga0068861_100023859 3300005719 Bacteria 4417
161 Ga0068861_100304831 3300005719 Bacteria 1381
162 Ga0068861_100436788 3300005719 Bacteria 1170
163 Ga0068851_10097345 3300005834 Bacteria 1557
164 Ga0068870_10485655 3300005840 Bacteria 821
165 Ga0068863_100012306 3300005841 Bacteria 8261
166 Ga0068863_100081804 3300005841 Bacteria 3059
167 Ga0068863_100107301 3300005841 Bacteria 2657
168 Ga0068863_100153171 3300005841 Bacteria 2206
169 Ga0068863_100409320 3300005841 Bacteria 1327
170 Ga0068858_100003390 3300005842 Bacteria 15860
171 Ga0068858_100003419 3300005842 Bacteria 15788
172 Ga0068858_100015795 3300005842 Bacteria 7101
173 Ga0068858_100096380 3300005842 Bacteria 2756
174 Ga0068858_100723917 3300005842 Bacteria 969
175 Ga0068860_100043493 3300005843 Bacteria 4285
176 Ga0068862_100059701 3300005844 Bacteria 3275
177 Ga0068862_100385881 3300005844 Bacteria 1307
178 Ga0081539_10026051 3300005985 Bacteria 3745
179 Ga0070717_10001018 3300006028 Bacteria 18799
180 Ga0070717_10076438 3300006028 Bacteria 2803
181 Ga0070717_10293105 3300006028 Bacteria 1445
182 Ga0070716_100075027 3300006173 Bacteria 2000
183 Ga0070712_100003184 3300006175 Bacteria 10109
184 Ga0070712_100235479 3300006175 Bacteria 1456
185 Ga0075362_10062829 3300006177 Bacteria 1683
186 Ga0075366_10002575 3300006195 Bacteria 9323
187 Ga0075366_10011548 3300006195 Bacteria 4988
188 Ga0097621_100026816 3300006237 Bacteria 4524
189 Ga0097621_100043240 3300006237 Bacteria 3631
190 Ga0097621_100206674 3300006237 Bacteria 1706
191 Ga0068871_100005768 3300006358 Bacteria 8697
192 Ga0068871_100019124 3300006358 Bacteria 5225
193 Ga0075428_100388793 3300006844 Bacteria 1495
194 Ga0075428_100514917 3300006844 Bacteria 1280
195 Ga0075430_100105710 3300006846 Bacteria 2349
196 Ga0075433_10027568 3300006852 Bacteria 4819
197 Ga0075434_100659378 3300006871 Bacteria 1064
198 Ga0075429_100048420 3300006880 Bacteria 3696
199 Ga0075429_100334186 3300006880 Bacteria 1326
200 Ga0075429_100507462 3300006880 Bacteria 1057
201 Ga0068865_100047398 3300006881 Bacteria 2953
202 Ga0068865_100152844 3300006881 Bacteria 1753
203 Ga0075436_100136428 3300006914 Bacteria 1723
204 Ga0075436_100175287 3300006914 Bacteria 1514
205 Ga0097620_100000008 3300006931 Bacteria 383750
206 Ga0097620_100004743 3300006931 Bacteria 13816
207 Ga0097620_100021236 3300006931 Bacteria 6515
208 Ga0097620_100197924 3300006931 Bacteria 2094
209 Ga0097620_100393241 3300006931 Bacteria 1482
210 Ga0097620_100468260 3300006931 Bacteria 1356
211 Ga0079104_1000700 3300006946 Bacteria 30527
212 Ga0079104_1003404 3300006946 Bacteria 7433
213 Ga0075435_100167749 3300007076 Bacteria 1851
214 Ga0105251_10000073 3300009011 Bacteria 97270
215 Ga0105251_10000267 3300009011 Bacteria 52069
216 Ga0105251_10000582 3300009011 Bacteria 33639
217 Ga0105244_10000001 3300009036 Bacteria 1034899
218 Ga0105244_10000315 3300009036 Bacteria 46626
219 Ga0105244_10108177 3300009036 Bacteria 1355
220 Ga0105250_10080334 3300009092 Bacteria 1322
221 Ga0105240_10003716 3300009093 Bacteria 23574
222 Ga0105240_10005607 3300009093 Bacteria 18634
223 Ga0105240_10005746 3300009093 Bacteria 18400
224 Ga0105240_10006293 3300009093 Bacteria 17469
225 Ga0105240_10061165 3300009093 Bacteria 4693
226 Ga0105240_10074105 3300009093 Bacteria 4203
227 Ga0105240_10661509 3300009093 Bacteria 1144
228 Ga0111539_10006397 3300009094 Bacteria 15195
229 Ga0111539_10066977 3300009094 Bacteria 4242
230 Ga0111539_10189811 3300009094 Bacteria 2398
231 Ga0111539_10209250 3300009094 Bacteria 2273
232 Ga0111539_11009104 3300009094 Bacteria 967
233 Ga0105245_10086433 3300009098 Bacteria 2876
234 Ga0105247_10000187 3300009101 Bacteria 60332
235 Ga0105247_10012875 3300009101 Bacteria 5020
236 Ga0105247_10208835 3300009101 Bacteria 1316
237 Ga0114129_10198151 3300009147 Bacteria 2722
238 Ga0105243_10000056 3300009148 Bacteria 133442
239 Ga0105243_10000471 3300009148 Bacteria 41457
240 Ga0105241_10000004 3300009174 Bacteria 803007
241 Ga0105241_10348406 3300009174 Bacteria 1285
242 Ga0105242_10000015 3300009176 Bacteria 124678
243 Ga0105242_10058655 3300009176 Bacteria 3157
244 Ga0105248_10035689 3300009177 Bacteria 5561
245 Ga0105248_10036354 3300009177 Bacteria 5507
246 Ga0105248_10039410 3300009177 Bacteria 5291
247 Ga0105248_10064863 3300009177 Bacteria 4100
248 Ga0105248_10135207 3300009177 Bacteria 2781
249 Ga0105237_10006745 3300009545 Bacteria 12679
250 Ga0105237_10115769 3300009545 Bacteria 2674
251 Ga0105237_10194727 3300009545 Bacteria 2026
252 Ga0105237_10229381 3300009545 Bacteria 1858
253 Ga0105238_10053835 3300009551 Bacteria 4044
254 Ga0105238_10074565 3300009551 Bacteria 3385
255 Ga0105239_10044969 3300010375 Bacteria 4840
256 Ga0105239_10051580 3300010375 Bacteria 4510
257 Ga0105239_10105428 3300010375 Bacteria 3122
258 Ga0105239_10110765 3300010375 Bacteria 3043
259 Ga0105239_10116732 3300010375 Bacteria 2962
260 Ga0105239_10617904 3300010375 Bacteria 1236
261 Ga0157316_1003325 3300012510 Bacteria 1153
262 Ga0157373_10003158 3300013100 Bacteria 12444
263 Ga0157373_10092599 3300013100 Bacteria 2129
264 Ga0157373_10193437 3300013100 Bacteria 1433
265 Ga0157370_10013507 3300013104 Bacteria 8408
266 Ga0157370_10136510 3300013104 Bacteria 2286
267 Ga0157369_10005191 3300013105 Bacteria 15223
268 Ga0157369_10255028 3300013105 Bacteria 1830
269 Ga0157369_10487808 3300013105 Bacteria 1275
270 Ga0157374_10003724 3300013296 Bacteria 12812
271 Ga0157374_10003991 3300013296 Bacteria 12401
272 Ga0157374_10029467 3300013296 Bacteria 4971
273 Ga0157374_10044152 3300013296 Bacteria 4120
274 Ga0157374_10074693 3300013296 Bacteria 3202
275 Ga0157374_10157142 3300013296 Bacteria 2214
276 Ga0157374_10378805 3300013296 Bacteria 1409
277 Ga0157378_10046120 3300013297 Bacteria 3874
278 Ga0157378_10107682 3300013297 Bacteria 2551
279 Ga0157378_10153853 3300013297 Bacteria 2145
280 Ga0163162_10001589 3300013306 Bacteria 21243
281 Ga0163162_10037600 3300013306 Bacteria 4830
282 Ga0163162_10055019 3300013306 Bacteria 4005
283 Ga0163162_10215867 3300013306 Bacteria 2048
284 Ga0163162_11239320 3300013306 Bacteria 847
285 Ga0157372_10010066 3300013307 Bacteria 10052
286 Ga0157372_10519451 3300013307 Bacteria 1388
287 Ga0157372_10799439 3300013307 Bacteria 1096
288 Ga0157372_11410881 3300013307 Bacteria 803
289 Ga0157375_10001221 3300013308 Bacteria 22177
290 Ga0157375_10081196 3300013308 Bacteria 3282
291 Ga0157375_11307461 3300013308 Bacteria 853
292 Ga0163163_10001383 3300014325 Bacteria 20485
293 Ga0163163_10006926 3300014325 Bacteria 9955
294 Ga0163163_10406796 3300014325 Bacteria 1419
295 Ga0157380_10049239 3300014326 Bacteria 3322
296 Ga0157380_10307547 3300014326 Bacteria 1463
297 Ga0157380_10769736 3300014326 Bacteria 976
298 Ga0182008_10001860 3300014497 Bacteria 13719
299 Ga0182008_10015435 3300014497 Bacteria 3985
300 Ga0157377_10234961 3300014745 Bacteria 1181
301 Ga0157377_10509041 3300014745 Bacteria 843
302 Ga0157379_10015278 3300014968 Bacteria 6733
303 Ga0157379_10069552 3300014968 Bacteria 3149
304 Ga0157379_10533521 3300014968 Bacteria 1090
305 Ga0157376_10006392 3300014969 Bacteria 8324
306 Ga0157376_10268440 3300014969 Bacteria 1602
307 Ga0157376_10430607 3300014969 Bacteria 1282
308 Ga0157376_10477482 3300014969 Bacteria 1221
309 Ga0157376_10708376 3300014969 Bacteria 1012
310 Ga0182006_1000003 3300015261 Bacteria 826681
311 Ga0182006_1000049 3300015261 Bacteria 184514
312 Ga0182006_1000097 3300015261 Bacteria 102186
313 Ga0182007_10000095 3300015262 Bacteria 63829
314 Ga0182007_10002958 3300015262 Bacteria 8239
315 Ga0182007_10015404 3300015262 Bacteria 2853
316 Ga0182005_1000038 3300015265 Bacteria 160030
317 Ga0182005_1020469 3300015265 Bacteria 1820
318 Ga0182005_1020510 3300015265 Bacteria 1818
319 Ga0163161_10000004 3300017792 Bacteria 333149
320 Ga0163161_10062869 3300017792 Bacteria 2705
321 Ga0163161_10531271 3300017792 Bacteria 962
322 Ga0213872_10001170 3300021361 Bacteria 17827
323 Ga0213872_10021407 3300021361 Bacteria 2977
324 Ga0213872_10045192 3300021361 Bacteria 2004
325 Ga0213872_10083172 3300021361 Bacteria 1437
326 Ga0213871_10001458 3300021441 Bacteria 3980
327 Ga0209674_100598 3300025226 Bacteria 13799
328 Ga0209672_100007 3300025228 Bacteria 959482
329 Ga0209672_100095 3300025228 Bacteria 113474
330 Ga0209672_101868 3300025228 Bacteria 6230
331 Ga0209563_100131 3300025230 Bacteria 97465
332 Ga0207427_100021 3300025231 Bacteria 494115
333 Ga0207427_100105 3300025231 Bacteria 118241
334 Ga0207427_100107 3300025231 Bacteria 116422
335 Ga0209437_100039 3300025233 Bacteria 448321
336 Ga0209437_100087 3300025233 Bacteria 253432
337 Ga0209437_100129 3300025233 Bacteria 184661
338 Ga0209258_100017 3300025242 Bacteria 590785
339 Ga0209258_100206 3300025242 Bacteria 119449
340 Ga0209258_100272 3300025242 Bacteria 88382
341 Ga0209646_1000246 3300025246 Bacteria 55219
342 Ga0209646_1000485 3300025246 Bacteria 19518
343 Ga0209026_1000051 3300025250 Bacteria 250792
344 Ga0209026_1000878 3300025250 Bacteria 15653
345 Ga0209148_1000044 3300025254 Bacteria 458417
346 Ga0209148_1000176 3300025254 Bacteria 128357
347 Ga0209148_1000185 3300025254 Bacteria 118117
348 Ga0209759_1000145 3300025256 Bacteria 121772
349 Ga0209233_1000023 3300025261 Bacteria 738870
350 Ga0209233_1000224 3300025261 Bacteria 103605
351 Ga0209233_1000447 3300025261 Bacteria 27425
352 Ga0209565_1000017 3300025263 Bacteria 462438
353 Ga0207666_1007773 3300025271 Bacteria 1420
354 Ga0209455_1000010 3300025272 Bacteria 959482
355 Ga0209455_1000081 3300025272 Bacteria 263674
356 Ga0209673_1000007 3300025273 Bacteria 634477
357 Ga0209675_1000009 3300025291 Bacteria 562872
358 Ga0209675_1000077 3300025291 Bacteria 156212
359 Ga0209564_1000055 3300025295 Bacteria 343782
360 Ga0209564_1000230 3300025295 Bacteria 123814
361 Ga0209256_1000559 3300025299 Bacteria 53325
362 Ga0207426_1026348 3300025302 Bacteria 1948
363 Ga0209051_1003306 3300025303 Bacteria 10681
364 Ga0207697_10014064 3300025315 Bacteria 3331
365 Ga0207697_10021800 3300025315 Bacteria 2624
366 Ga0207696_1000033 3300025711 Bacteria 360689
367 Ga0207655_1000011 3300025728 Bacteria 643321
368 Ga0207655_1000013 3300025728 Bacteria 637510
369 Ga0207713_1000065 3300025735 Bacteria 196128
370 Ga0207713_1000108 3300025735 Bacteria 137268
371 Ga0207713_1001983 3300025735 Bacteria 15397
372 Ga0207653_10000011 3300025885 Bacteria 160949
373 Ga0207682_10002230 3300025893 Bacteria 8744
374 Ga0207642_10022924 3300025899 Bacteria 2485
375 Ga0207710_10000016 3300025900 Bacteria 388568
376 Ga0207710_10044398 3300025900 Bacteria 1979
377 Ga0207710_10172342 3300025900 Bacteria 1058
378 Ga0207688_10005672 3300025901 Bacteria 6788
379 Ga0207680_10001266 3300025903 Bacteria 11962
380 Ga0207680_10023747 3300025903 Bacteria 3353
381 Ga0207680_10052911 3300025903 Bacteria 2435
382 Ga0207699_10442958 3300025906 Bacteria 931
383 Ga0207645_10010412 3300025907 Bacteria 6381
384 Ga0207645_10199600 3300025907 Bacteria 1316
385 Ga0207645_10311642 3300025907 Bacteria 1049
386 Ga0207643_10085564 3300025908 Bacteria 1831
387 Ga0207643_10108622 3300025908 Bacteria 1632
388 Ga0207643_10158000 3300025908 Bacteria 1363
389 Ga0207705_10002381 3300025909 Bacteria 14531
390 Ga0207684_10113737 3300025910 Bacteria 2317
391 Ga0207654_10000006 3300025911 Bacteria 815027
392 Ga0207707_10185830 3300025912 Bacteria 1814
393 Ga0207695_10006958 3300025913 Bacteria 14520
394 Ga0207695_10014188 3300025913 Bacteria 9453
395 Ga0207695_10020911 3300025913 Bacteria 7479
396 Ga0207695_10069147 3300025913 Bacteria 3615
397 Ga0207695_10109815 3300025913 Bacteria 2739
398 Ga0207695_10283680 3300025913 Bacteria 1549
399 Ga0207671_10021594 3300025914 Bacteria 4879
400 Ga0207671_10073666 3300025914 Bacteria 2551
401 Ga0207671_10167782 3300025914 Bacteria 1703
402 Ga0207693_10024754 3300025915 Bacteria 4760
403 Ga0207693_10053702 3300025915 Bacteria 3161
404 Ga0207663_10084177 3300025916 Bacteria 2091
405 Ga0207663_10226086 3300025916 Bacteria 1364
406 Ga0207660_10083820 3300025917 Bacteria 2348
407 Ga0207662_10021647 3300025918 Bacteria 3679
408 Ga0207657_10053741 3300025919 Bacteria 3488
409 Ga0207649_10084596 3300025920 Bacteria 2062
410 Ga0207649_10180123 3300025920 Bacteria 1478
411 Ga0207652_10250881 3300025921 Bacteria 1596
412 Ga0207652_10309266 3300025921 Bacteria 1426
413 Ga0207646_10042178 3300025922 Bacteria 4100
414 Ga0207646_10670195 3300025922 Bacteria 928
415 Ga0207681_10133978 3300025923 Bacteria 1835
416 Ga0207681_10355577 3300025923 Bacteria 1173
417 Ga0207694_10539477 3300025924 Bacteria 978
418 Ga0207650_10008966 3300025925 Bacteria 6838
419 Ga0207650_10066083 3300025925 Bacteria 2711
420 Ga0207650_10277875 3300025925 Bacteria 1363
421 Ga0207659_10000588 3300025926 Bacteria 21759
422 Ga0207659_10029176 3300025926 Bacteria 3757
423 Ga0207700_10051406 3300025928 Bacteria 3075
424 Ga0207700_10272437 3300025928 Bacteria 1453
425 Ga0207664_10069324 3300025929 Bacteria 2835
426 Ga0207664_10164548 3300025929 Bacteria 1894
427 Ga0207644_10002078 3300025931 Bacteria 12952
428 Ga0207644_10004826 3300025931 Bacteria 8780
429 Ga0207644_10032885 3300025931 Bacteria 3621
430 Ga0207644_10102077 3300025931 Bacteria 2156
431 Ga0207644_10421341 3300025931 Bacteria 1094
432 Ga0207690_10022251 3300025932 Bacteria 3941
433 Ga0207690_10273457 3300025932 Bacteria 1313
434 Ga0207690_10648375 3300025932 Bacteria 865
435 Ga0207706_10002872 3300025933 Bacteria 16701
436 Ga0207706_10082095 3300025933 Bacteria 2833
437 Ga0207706_10305056 3300025933 Bacteria 1387
438 Ga0207686_10000007 3300025934 Bacteria 249199
439 Ga0207686_10040916 3300025934 Bacteria 2822
440 Ga0207686_10093174 3300025934 Bacteria 1994
441 Ga0207709_10000101 3300025935 Bacteria 133425
442 Ga0207709_10000161 3300025935 Bacteria 91314
443 Ga0207709_10237979 3300025935 Bacteria 1323
444 Ga0207670_10014040 3300025936 Bacteria 4742
445 Ga0207670_10031541 3300025936 Bacteria 3398
446 Ga0207670_10225360 3300025936 Bacteria 1437
447 Ga0207670_10234084 3300025936 Bacteria 1412
448 Ga0207669_10174886 3300025937 Bacteria 1532
449 Ga0207704_10024325 3300025938 Bacteria 3282
450 Ga0207704_10039218 3300025938 Bacteria 2756
451 Ga0207704_10157544 3300025938 Bacteria 1611
452 Ga0207665_10160044 3300025939 Bacteria 1619
453 Ga0207691_10036906 3300025940 Bacteria 4527
454 Ga0207691_10081108 3300025940 Bacteria 2917
455 Ga0207691_10159650 3300025940 Bacteria 1979
456 Ga0207711_10005419 3300025941 Bacteria 10791
457 Ga0207711_10029539 3300025941 Bacteria 4625
458 Ga0207711_10064678 3300025941 Bacteria 3160
459 Ga0207711_10080900 3300025941 Bacteria 2838
460 Ga0207689_10024667 3300025942 Bacteria 5042
461 Ga0207689_10104860 3300025942 Bacteria 2323
462 Ga0207689_10323356 3300025942 Bacteria 1280
463 Ga0207661_10001327 3300025944 Bacteria 16569
464 Ga0207661_10151832 3300025944 Bacteria 2003
465 Ga0207679_10100194 3300025945 Bacteria 2264
466 Ga0207679_10178036 3300025945 Bacteria 1757
467 Ga0207679_10293684 3300025945 Bacteria 1398
468 Ga0207667_10001671 3300025949 Bacteria 27944
469 Ga0207667_10002349 3300025949 Bacteria 23706
470 Ga0207667_10008952 3300025949 Bacteria 11839
471 Ga0207667_10169277 3300025949 Bacteria 2245
472 Ga0207667_10571675 3300025949 Bacteria 1142
473 Ga0207651_10000179 3300025960 Bacteria 27573
474 Ga0207651_10016407 3300025960 Bacteria 4337
475 Ga0207651_10548597 3300025960 Bacteria 1005
476 Ga0207712_10008695 3300025961 Bacteria 6422
477 Ga0207712_10081944 3300025961 Bacteria 2351
478 Ga0207712_10521389 3300025961 Bacteria 1018
479 Ga0207712_10535290 3300025961 Bacteria 1006
480 Ga0207668_10066865 3300025972 Bacteria 2549
481 Ga0207658_10001572 3300025986 Bacteria 17671
482 Ga0207677_10004081 3300026023 Bacteria 7807
483 Ga0207677_10082448 3300026023 Bacteria 2311
484 Ga0207703_10005653 3300026035 Bacteria 10039
485 Ga0207703_10017041 3300026035 Bacteria 5665
486 Ga0207703_10120128 3300026035 Bacteria 2255
487 Ga0207703_10182196 3300026035 Bacteria 1854
488 Ga0207703_10385639 3300026035 Bacteria 1297
489 Ga0207639_10022786 3300026041 Bacteria 4515
490 Ga0207639_10027657 3300026041 Bacteria 4134
491 Ga0207639_10034078 3300026041 Bacteria 3761
492 Ga0207639_10233772 3300026041 Bacteria 1595
493 Ga0207708_10019637 3300026075 Bacteria 5096
494 Ga0207708_10095035 3300026075 Bacteria 2302
495 Ga0207708_10370931 3300026075 Bacteria 1178
496 Ga0207641_10009505 3300026088 Bacteria 8016
497 Ga0207641_10010646 3300026088 Bacteria 7547
498 Ga0207641_10126045 3300026088 Bacteria 2292
499 Ga0207641_10181212 3300026088 Bacteria 1929
500 Ga0207641_10592141 3300026088 Bacteria 1085
501 Ga0207641_10927352 3300026088 Bacteria 865
502 Ga0207648_10007551 3300026089 Bacteria 10670
503 Ga0207648_10009747 3300026089 Bacteria 9180
504 Ga0207648_10468805 3300026089 Bacteria 1149
505 Ga0207648_10484125 3300026089 Bacteria 1130
506 Ga0207676_10002099 3300026095 Bacteria 14425
507 Ga0207676_10067892 3300026095 Bacteria 2849
508 Ga0207676_10100058 3300026095 Unclassified 2401
509 Ga0207676_10303498 3300026095 Bacteria 1458
510 Ga0207674_10088512 3300026116 Bacteria 3090
511 Ga0207674_10151829 3300026116 Bacteria 2273
512 Ga0207674_10277185 3300026116 Bacteria 1625
513 Ga0207674_10344350 3300026116 Bacteria 1441
514 Ga0207674_10701524 3300026116 Bacteria 977
515 Ga0207675_100039681 3300026118 Bacteria 4394
516 Ga0207675_100099700 3300026118 Bacteria 2736
517 Ga0207675_100227299 3300026118 Bacteria 1799
518 Ga0207675_100240210 3300026118 Bacteria 1750
519 Ga0207675_101002749 3300026118 Bacteria 853
520 Ga0207683_10001598 3300026121 Bacteria 20368
521 Ga0207683_10146798 3300026121 Bacteria 2127
522 Ga0207683_10184790 3300026121 Bacteria 1891
523 Ga0207683_10364682 3300026121 Bacteria 1327
524 Ga0207683_10407446 3300026121 Bacteria 1251
525 Ga0207698_10067524 3300026142 Bacteria 2820
526 Ga0207698_10132170 3300026142 Bacteria 2135
527 Ga0209281_1000008 3300027111 Bacteria 867470
528 Ga0209281_1004171 3300027111 Bacteria 4411
529 Ga0209371_1002176 3300027312 Bacteria 11460
530 Ga0209588_1073225 3300027671 Bacteria 1107
531 Ga0207428_10038931 3300027907 Bacteria 3862
532 Ga0265356_1000177 3300028017 Bacteria 11904
533 Ga0268266_10000420 3300028379 Bacteria 64525
534 Ga0268266_10024463 3300028379 Bacteria 5135
535 Ga0268266_10033124 3300028379 Bacteria 4393
536 Ga0268266_10065765 3300028379 Bacteria 3134
537 Ga0268266_10072942 3300028379 Bacteria 2978
538 Ga0268266_10093764 3300028379 Bacteria 2634
539 Ga0268266_10096267 3300028379 Bacteria 2601
540 Ga0268266_10231525 3300028379 Bacteria 1702
541 Ga0268266_10413924 3300028379 Bacteria 1276
542 Ga0268266_10579678 3300028379 Bacteria 1076
543 Ga0268266_10821167 3300028379 Bacteria 898
544 Ga0268265_10036989 3300028380 Bacteria 3579
545 Ga0268265_10126671 3300028380 Bacteria 2114
546 Ga0268264_10054629 3300028381 Bacteria 3336
547 Ga0268264_10061722 3300028381 Bacteria 3145
548 Ga0268264_10369170 3300028381 Bacteria 1371
549 Ga0265326_10051178 3300028558 Bacteria 1170
550 Ga0265318_10071790 3300028577 Bacteria 1283
551 Ga0265338_10092476 3300028800 Bacteria 2494
552 Ga0268256_1001097 3300030500 Bacteria 17670
553 Ga0265760_10002206 3300031090 Bacteria 5694
554 Ga0265332_10065200 3300031238 Bacteria 1555
555 Ga0265328_10116024 3300031239 Bacteria 997
556 Ga0265325_10000127 3300031241 Bacteria 52109
557 Ga0265339_10000827 3300031249 Bacteria 23830
558 Ga0265339_10067611 3300031249 Bacteria 1911
559 Ga0265331_10029577 3300031250 Bacteria 2732
560 Ga0265331_10060128 3300031250 Bacteria 1795
561 Ga0265331_10249713 3300031250 Bacteria 796
562 Ga0265327_10158451 3300031251 Bacteria 1047
563 Ga0265316_10018261 3300031344 Bacteria 6032
564 Ga0265316_10052944 3300031344 Bacteria 3182
565 Ga0265316_10093487 3300031344 Bacteria 2291
566 Ga0307513_10103235 3300031456 Bacteria 2868
567 Ga0265313_10000907 3300031595 Bacteria 29634
568 Ga0265313_10147932 3300031595 Bacteria 1006
569 Ga0307514_10001950 3300031649 Bacteria 22540
570 Ga0265314_10008385 3300031711 Bacteria 8856
571 Ga0316576_10203972 3300031727 Bacteria 1489
572 Ga0316578_10087120 3300031728 Bacteria 1862
573 Ga0316577_10079932 3300031733 Bacteria 1827
574 Ga0307406_10210179 3300031901 Bacteria 1439
575 Ga0307412_10000096 3300031911 Bacteria 74069
576 Ga0307412_10001339 3300031911 Bacteria 13744
577 Ga0307409_100270971 3300031995 Bacteria 1563
578 Ga0307416_100000017 3300032002 Bacteria 201722
579 Ga0307414_10010449 3300032004 Bacteria 5386
580 Ga0307411_10612860 3300032005 Bacteria 937
581 Ga0307415_100615369 3300032126 Bacteria 969
582 Ga0307415_100847747 3300032126 Bacteria 838
583 Ga0307415_100977160 3300032126 Bacteria 785
584 Ga0316585_10051322 3300032137 Bacteria 1325
585 Ga0307510_10377122 3300033180 Bacteria 864
586 Ga0373959_0025113 3300034820 Bacteria 1169
587 Ga0373926_0219815 3300035083 Bacteria 733
588 Ga0373934_0000391 3300035086 Bacteria 15305
589 Ga0373934_0012247 3300035086 Bacteria 3238
590 Ga0373934_0086340 3300035086 Bacteria 1263
591 Ga0373923_0003108 3300035111 Bacteria 5265
592 Ga0373923_0225851 3300035111 Bacteria 871
593 Ga0373936_0004500 3300035113 Bacteria 5275
594 Ga0373936_0057196 3300035113 Bacteria 1586
595 Ga0373945_0019882 3300035116 Bacteria 2295
596 Ga0373953_0003575 3300035117 Bacteria 4863
597 Ga0373953_0029245 3300035117 Bacteria 2130
598 Ga0373954_0003733 3300035118 Bacteria 6490
599 Ga0373954_0031178 3300035118 Bacteria 2460
600 Ga0373954_0035743 3300035118 Bacteria 2305
601 Ga0373954_0071008 3300035118 Bacteria 1655
602 Ga0373954_0187956 3300035118 Bacteria 1014
603 Ga0373943_0033981 3300035170 Bacteria 2432
604 Ga0373946_0023130 3300035171 Bacteria 2426
605 Ga0373946_0146142 3300035171 Bacteria 1100
606 Ga0373955_0001902 3300035172 Bacteria 9009
607 Ga0373955_0021943 3300035172 Bacteria 3230
608 Ga0373955_0108442 3300035172 Bacteria 1603
609 Ga0373961_0082419 3300035241 Bacteria 1014
610 Ga0373924_0002259 3300035410 Bacteria 6465
611 Ga0373924_0170859 3300035410 Bacteria 955
612 Ga0373931_0014564 3300035691 Bacteria 3846
613 Ga0373935_0008762 3300035692 Bacteria 6061
614 Ga0373935_0107250 3300035692 Bacteria 1849
615 Ga0373927_0002239 3300035695 Bacteria 14208
616 Ga0373927_0007084 3300035695 Bacteria 7605
617 Ga0373933_0010447 3300035724 Bacteria 5090
618 Ga0373933_0044563 3300035724 Bacteria 2628
619 Ga0373933_0177682 3300035724 Bacteria 1357
620 Ga0373933_0210819 3300035724 Bacteria 1245
621 Ga0373947_0374787 3300035725 Bacteria 957
622 Ga0373937_0001034 3300036401 Bacteria 23525
623 Ga0373937_0008262 3300036401 Bacteria 9037
624 Ga0373937_0032473 3300036401 Bacteria 4735
625 Ga0373937_0107999 3300036401 Bacteria 2587
626 Ga0373937_0211881 3300036401 Bacteria 1823
627 Ga0316584_0315286 3300036712 Bacteria 1129
628 Ga0373925_0000715 3300037068 Bacteria 30997
629 Ga0373925_0025553 3300037068 Bacteria 4316
630 Ga0373925_0090209 3300037068 Bacteria 2343
631 Ga0373925_0299408 3300037068 Bacteria 1298
632 Ga0373925_0304909 3300037068 Bacteria 1286
633 Ga0395899_0019318 3300037312 Bacteria 5177
634 Ga0395899_0042250 3300037312 Bacteria 3404
635 Ga0395898_0001110 3300037466 Bacteria 41435
636 Ga0395905_0417365 3300037471 Bacteria 1238
637 Ga0436364_0089220 3300037853 Bacteria 9810
638 Ga0436365_0001623 3300039437 Bacteria 1711
639 Ga0436360_0137000 3300039438 Bacteria 4047
640 Ga0436360_0386428 3300039438 Bacteria 2037
641 Ga0436360_0469655 3300039438 Bacteria 3935
642 Ga0436360_0708149 3300039438 Bacteria 1590
643 Ga0436360_0824430 3300039438 Bacteria 2369
644 Ga0436360_1098059 3300039438 Bacteria 2114
645 Ga0436361_0041018 3300039447 Bacteria 1992
646 Ga0436361_0133351 3300039447 Bacteria 1570
647 Ga0436361_0191634 3300039447 Bacteria 3050
648 Ga0436361_0282869 3300039447 Bacteria 2878
649 Ga0436361_0300897 3300039447 Bacteria 77372
650 Ga0436361_0508014 3300039447 Bacteria 3250
651 Ga0436361_0785765 3300039447 Bacteria 815
652 Ga0436361_1030428 3300039447 Bacteria 2354
653 Ga0436363_0387766 3300039450 Bacteria 1390
654 Ga0436363_0588950 3300039450 Bacteria 1024
655 Ga0436363_1671843 3300039450 Bacteria 1027
656 Ga0439438_002259 3300041405 Bacteria 8262
657 Ga0439447_001305 3300041407 Bacteria 9066
658 Ga0439466_0083079 3300041411 Bacteria 1009
659 Ga0439445_0000288 3300042004 Bacteria 9789
660 Ga0439432_023496 3300042006 Bacteria 2031
661 Ga0439432_036474 3300042006 Bacteria 1573
662 Ga0451577_0000101 3300042876 Bacteria 190854
663 Ga0451577_0208072 3300042876 Bacteria 1767
664 Ga0466969_0009932 3300044656 Bacteria 5045
665 Ga0466969_0090988 3300044656 Bacteria 1446
666 Ga0466972_0123062 3300044658 Bacteria 1223
667 Ga0466989_0074246 3300044663 Bacteria 2093
668 Ga0466965_0017505 3300044683 Bacteria 3426
669 Ga0466965_0084935 3300044683 Bacteria 1604
670 Ga0466966_0007469 3300044684 Bacteria 7247
671 Ga0466961_0000412 3300044693 Bacteria 27244
672 Ga0466961_0001299 3300044693 Bacteria 15419
673 Ga0466961_0001373 3300044693 Bacteria 15036
674 Ga0466961_0022862 3300044693 Bacteria 4021
675 Ga0466963_0051014 3300044694 Bacteria 2741
676 Ga0466963_0238926 3300044694 Bacteria 1274
677 Ga0466964_0111020 3300044706 Bacteria 1223
678 Ga0453684_0000679 3300044712 Bacteria 121950
679 Ga0453684_0070521 3300044712 Bacteria 4425
680 Ga0453684_0361100 3300044712 Bacteria 1635
681 Ga0466971_0019617 3300044719 Bacteria 3004
682 Ga0466971_0027166 3300044719 Bacteria 2562
683 Ga0466968_0180669 3300044735 Bacteria 981
684 Ga0466957_0006003 3300044842 Bacteria 6849
685 Ga0466957_0404160 3300044842 Bacteria 934
686 Ga0466959_0029127 3300045049 Bacteria 4091
687 Ga0451576_0000260 3300045051 Bacteria 129222
688 Ga0466958_0063430 3300045836 Bacteria 2253
689 Ga0466958_0070861 3300045836 Bacteria 2134
690 Ga0466958_0190423 3300045836 Bacteria 1304
691 Ga0466967_0161576 3300045976 Bacteria 2103
692 Ga0466967_0324205 3300045976 Bacteria 1486
693 Ga0466967_0625270 3300045976 Bacteria 1064
694 Ga0495617_000304 3300046452 Bacteria 27738
695 Ga0495627_000141 3300046453 Bacteria 85993
696 Ga0495627_004584 3300046453 Bacteria 5743
697 Ga0495592_0004704 3300046454 Bacteria 10015
698 Ga0495592_0020234 3300046454 Bacteria 5063
699 Ga0495592_0062411 3300046454 Bacteria 2736
700 Ga0495590_0000020 3300046457 Bacteria 212352
701 Ga0495591_001616 3300046458 Bacteria 13611
702 Ga0495638_0000328 3300046460 Bacteria 60200
703 Ga0495638_0000493 3300046460 Bacteria 47046
704 Ga0495638_0000543 3300046460 Bacteria 43505
705 Ga0495638_0104420 3300046460 Bacteria 1690
706 Ga0495641_0001105 3300046461 Bacteria 23196
707 Ga0495651_0009753 3300046462 Bacteria 7385
708 Ga0495653_0017178 3300046463 Bacteria 5884
709 Ga0495653_0196397 3300046463 Bacteria 1373
710 Ga0495650_0001929 3300046471 Bacteria 18373
711 Ga0495650_0003366 3300046471 Bacteria 11722
712 Ga0495580_0021288 3300046472 Bacteria 4785
713 Ga0495580_0128834 3300046472 Bacteria 1756
714 Ga0495580_0244249 3300046472 Bacteria 1230
715 Ga0495582_0089280 3300046473 Bacteria 1717
716 Ga0495582_0094989 3300046473 Bacteria 1665
717 Ga0495582_0314016 3300046473 Bacteria 902
718 Ga0495605_0000394 3300046474 Bacteria 40242
719 Ga0495605_0025478 3300046474 Bacteria 3081
720 Ga0495639_0003744 3300046475 Bacteria 6541
721 Ga0495639_0008665 3300046475 Bacteria 4360
722 Ga0495662_0016160 3300046476 Bacteria 3619
723 Ga0495664_0003219 3300046477 Bacteria 8860
724 Ga0495664_0009587 3300046477 Bacteria 5419
725 Ga0495584_0003609 3300046491 Bacteria 8444
726 Ga0495585_0000001 3300046492 Bacteria 609804
727 Ga0495594_0009332 3300046499 Bacteria 5068
728 Ga0495596_0006258 3300046500 Bacteria 5508
729 Ga0495607_0000967 3300046501 Bacteria 26576
730 Ga0495607_0004270 3300046501 Bacteria 10576
731 Ga0495607_0006847 3300046501 Bacteria 7953
732 Ga0495607_0217499 3300046501 Bacteria 936
733 Ga0495583_0000310 3300046506 Bacteria 77200
734 Ga0495583_0000626 3300046506 Bacteria 47506
735 Ga0495583_0084943 3300046506 Bacteria 1370
736 Ga0495606_0000326 3300046507 Bacteria 82103
737 Ga0495606_0000660 3300046507 Bacteria 54210
738 Ga0495606_0001121 3300046507 Bacteria 38297
739 Ga0495608_0011280 3300046511 Bacteria 6222
740 Ga0495608_0023435 3300046511 Bacteria 4230
741 Ga0495610_0000006 3300046512 Bacteria 856822
742 Ga0495616_0014232 3300046513 Bacteria 4461
743 Ga0495628_0006322 3300046516 Bacteria 10348
744 Ga0495628_0052427 3300046516 Bacteria 3222
745 Ga0495628_0218511 3300046516 Bacteria 1432
746 Ga0495628_0579662 3300046516 Bacteria 803
747 Ga0495630_0001974 3300046517 Bacteria 14279
748 Ga0495631_0000078 3300046518 Bacteria 63148
749 Ga0495632_0000601 3300046519 Bacteria 33346
750 Ga0495643_0000519 3300046522 Bacteria 48062
751 Ga0495644_0000799 3300046523 Bacteria 12983
752 Ga0495644_0002833 3300046523 Bacteria 6874
753 Ga0495648_0000206 3300046524 Bacteria 68670
754 Ga0495648_0000990 3300046524 Bacteria 29242
755 Ga0495648_0003241 3300046524 Bacteria 14432
756 Ga0495648_0023475 3300046524 Bacteria 4222
757 Ga0495666_0006403 3300046526 Bacteria 5931
758 Ga0495642_0013982 3300046528 Bacteria 3109
759 Ga0495652_0037267 3300046529 Bacteria 4219
760 Ga0495652_0202263 3300046529 Bacteria 1506
761 Ga0495652_0347124 3300046529 Bacteria 1064
762 Ga0495654_0000006 3300046530 Bacteria 451432
763 Ga0495654_0000353 3300046530 Bacteria 39769
764 Ga0495654_0002624 3300046530 Bacteria 11452
765 Ga0495654_0018562 3300046530 Bacteria 3643
766 Ga0495640_0006143 3300046533 Bacteria 9520
767 Ga0495586_0005085 3300046535 Bacteria 7039
768 Ga0495587_0015431 3300046536 Bacteria 4770
769 Ga0495587_0024960 3300046536 Bacteria 3658
770 Ga0495587_0027599 3300046536 Bacteria 3457
771 Ga0495587_0045421 3300046536 Bacteria 2611
772 Ga0495587_0322659 3300046536 Bacteria 862
773 Ga0495609_0005147 3300046538 Bacteria 6965
774 Ga0495609_0010929 3300046538 Bacteria 4337
775 Ga0495609_0107445 3300046538 Bacteria 1206
776 Ga0495621_0006587 3300046539 Bacteria 3399
777 Ga0495621_0104197 3300046539 Bacteria 1082
778 Ga0495597_0000262 3300046542 Bacteria 48054
779 Ga0495645_0000483 3300046543 Bacteria 27603
780 Ga0495645_0027047 3300046543 Bacteria 4166
781 Ga0495645_0334436 3300046543 Bacteria 980
782 Ga0495622_0000077 3300046557 Bacteria 86561
783 Ga0495622_0113110 3300046557 Bacteria 1242
784 Ga0495633_0000149 3300046558 Bacteria 92890
785 Ga0495633_0002549 3300046558 Bacteria 12789
786 Ga0495633_0007833 3300046558 Bacteria 6097
787 Ga0495667_0005516 3300046559 Bacteria 8551
788 Ga0495667_0014488 3300046559 Bacteria 5327
789 Ga0495667_0015374 3300046559 Bacteria 5171
790 Ga0495668_0000888 3300046616 Bacteria 33684
791 Ga0495668_0034425 3300046616 Bacteria 2841
792 Ga0495634_0008248 3300046642 Bacteria 7769
793 Ga0495611_0000001 3300046648 Bacteria 2628469
794 Ga0495625_0000001 3300046660 Bacteria 1641829
795 Ga0495625_0000199 3300046660 Bacteria 95454
796 Ga0495625_0001048 3300046660 Bacteria 36295
797 Ga0495625_0062950 3300046660 Bacteria 2620
798 Ga0495635_0312077 3300046663 Bacteria 1053
799 Ga0495659_0002117 3300046664 Bacteria 6475
800 Ga0495661_0000104 3300046665 Bacteria 101211
801 Ga0495661_0043077 3300046665 Bacteria 2777
802 Ga0495588_0048265 3300046674 Bacteria 2187
803 Ga0495657_0003049 3300046675 Bacteria 13865
804 Ga0495657_0017206 3300046675 Bacteria 5253
805 Ga0495599_0001707 3300046678 Bacteria 12704
806 Ga0495599_0001790 3300046678 Bacteria 12465
807 Ga0495646_0026014 3300046680 Bacteria 3675
808 Ga0495647_0001510 3300046681 Bacteria 7201
809 Ga0495658_0335019 3300046683 Bacteria 960
810 Ga0495658_0466913 3300046683 Bacteria 807
811 Ga0495669_0125883 3300046684 Bacteria 1204
812 Ga0495613_0180728 3300046689 Bacteria 1494
813 Ga0495624_0023178 3300046690 Bacteria 4095
814 Ga0495670_0176018 3300046691 Bacteria 1128
815 Ga0495671_0000175 3300046692 Bacteria 57098
816 Ga0495671_0001021 3300046692 Bacteria 19478
817 Ga0495671_0004751 3300046692 Bacteria 8026
818 Ga0495589_0000006 3300046794 Bacteria 303635
819 Ga0495589_0000999 3300046794 Bacteria 17183
820 Ga0495600_0002178 3300046809 Bacteria 11118
821 Ga0495600_0070414 3300046809 Bacteria 2285
822 Ga0495660_0000008 3300046810 Bacteria 435769
823 Ga0495660_0000009 3300046810 Bacteria 427395
824 Ga0495660_0000019 3300046810 Bacteria 311047
825 Ga0495660_0109464 3300046810 Bacteria 1411
826 Ga0495660_0186080 3300046810 Bacteria 1001
827 Ga0495581_0146557 3300047315 Bacteria 1378
828 Ga0495604_0010199 3300047317 Bacteria 7442
829 Ga0495604_0012321 3300047317 Bacteria 6797
830 Ga0495636_0001345 3300047318 Bacteria 9340
831 Ga0495674_0000463 3300047319 Bacteria 36736
832 Ga0495674_0052188 3300047319 Bacteria 3600
833 Ga0495674_0354855 3300047319 Bacteria 1190
834 Ga0495672_0000003 3300047320 Bacteria 728845
835 Ga0495672_0001917 3300047320 Bacteria 19721
836 Ga0495680_0016578 3300047322 Bacteria 6324
837 Ga0495680_0082993 3300047322 Bacteria 2417
838 Ga0495680_0102926 3300047322 Bacteria 2126
839 Ga0495683_0000472 3300047323 Bacteria 31230
840 Ga0495687_000370 3300047443 Bacteria 56035
841 Ga0495675_0035274 3300047444 Bacteria 3195
842 Ga0495677_0009318 3300047445 Bacteria 3627
843 Ga0495679_000001 3300047446 Bacteria 1607568
844 Ga0495679_057429 3300047446 Bacteria 1151
845 Ga0495685_000091 3300047447 Bacteria 32792
846 Ga0495673_0000001 3300047469 Bacteria 1630730
847 Ga0495673_0000011 3300047469 Bacteria 674140
848 Ga0495673_0000089 3300047469 Bacteria 188744
849 Ga0495673_0004212 3300047469 Bacteria 9073
850 Ga0495684_0001586 3300047471 Bacteria 18214
851 Ga0495684_0047674 3300047471 Bacteria 3277
852 Ga0495686_0003986 3300047472 Bacteria 12361
853 Ga0495686_0124293 3300047472 Bacteria 1535
854 Ga0495602_0000196 3300048088 Bacteria 57045
855 Ga0496100_0021624 3300048903 Bacteria 3879
856 Ga0496101_0436596 3300048904 Bacteria 1033
857 Ga0496102_0778275 3300048905 Bacteria 879
858 Ga0496104_0004551 3300048907 Bacteria 12082
859 Ga0496105_0007863 3300048908 Bacteria 8277
860 Ga0496105_0477587 3300048908 Bacteria 981
861 Ga0496106_0186734 3300048909 Bacteria 1647
862 Ga0496106_0389667 3300048909 Bacteria 1120
863 Ga0496107_0158962 3300048910 Bacteria 1674
864 Ga0496108_0030955 3300048911 Bacteria 4435
865 Ga0496108_0081698 3300048911 Bacteria 2739
866 Ga0496109_0135358 3300048912 Bacteria 2302
867 Ga0496109_0251756 3300048912 Bacteria 1663
868 Ga0496111_0218620 3300048914 Bacteria 1415
869 Ga0496114_0129947 3300048917 Bacteria 2174
870 Ga0496115_0014454 3300048918 Bacteria 5975
871 Ga0496116_0000006 3300048919 Bacteria 811937
872 Ga0496116_0000031 3300048919 Bacteria 420043
873 Ga0496116_0066661 3300048919 Bacteria 2303
874 Ga0496117_0000027 3300048920 Bacteria 412234
875 Ga0496117_0000132 3300048920 Bacteria 162117
876 Ga0496117_0019969 3300048920 Bacteria 5480
877 Ga0496118_0000099 3300048921 Bacteria 160412
878 Ga0496118_0000141 3300048921 Bacteria 126552
879 Ga0496118_0085794 3300048921 Bacteria 2190
880 Ga0496119_0000006 3300048922 Bacteria 505999
881 Ga0496119_0000258 3300048922 Bacteria 75132
882 Ga0496119_0000280 3300048922 Bacteria 71494
883 Ga0496119_0014218 3300048922 Bacteria 6252
884 Ga0496119_0115941 3300048922 Bacteria 1479
885 Ga0496120_0000228 3300048923 Bacteria 96403
886 Ga0496120_0000255 3300048923 Bacteria 89200
887 Ga0496120_0040527 3300048923 Bacteria 2736
888 Ga0496120_0083671 3300048923 Bacteria 1722
889 Ga0496121_0000368 3300048924 Bacteria 92730
890 Ga0496121_0032337 3300048924 Bacteria 4757
891 Ga0496122_0000229 3300048925 Bacteria 125600
892 Ga0496122_0000397 3300048925 Bacteria 92511
893 Ga0496122_0001702 3300048925 Bacteria 34087
894 Ga0496122_0002499 3300048925 Bacteria 25974
895 Ga0496122_0004429 3300048925 Bacteria 17454
896 Ga0496122_0023172 3300048925 Bacteria 5485
897 Ga0496122_0074132 3300048925 Bacteria 2409
898 Ga0496123_0003689 3300048926 Bacteria 16868
899 Ga0496123_0005655 3300048926 Bacteria 12483
900 Ga0496123_0021618 3300048926 Bacteria 4995
901 Ga0496123_0023894 3300048926 Bacteria 4666
902 Ga0496124_0000122 3300048927 Bacteria 161741
903 Ga0496124_0005070 3300048927 Bacteria 15021
904 Ga0496124_0186194 3300048927 Bacteria 1593
905 Ga0496125_0001071 3300048928 Bacteria 42210
906 Ga0496125_0003176 3300048928 Bacteria 20363
907 Ga0496125_0054020 3300048928 Bacteria 3287
908 Ga0496126_0001395 3300048929 Bacteria 38244
909 Ga0496126_0016309 3300048929 Bacteria 7433
910 Ga0496126_0067076 3300048929 Bacteria 3207
911 Ga0496126_0105264 3300048929 Bacteria 2464
912 Ga0496126_0110835 3300048929 Bacteria 2390
913 Ga0496126_0138838 3300048929 Bacteria 2094
914 Ga0496126_0152582 3300048929 Bacteria 1979
915 Ga0496126_0281066 3300048929 Bacteria 1379
916 Ga0496126_0641876 3300048929 Bacteria 832
917 Ga0495678_000023 3300049459 Bacteria 233463
918 Ga0495678_016990 3300049459 Bacteria 3309
919 Ga0495682_0000106 3300049460 Bacteria 74069
920 Ga0495682_0000836 3300049460 Bacteria 19308
921 Ga0495682_0001080 3300049460 Bacteria 16037
922 Ga0495682_0003245 3300049460 Bacteria 7292
923 Ga0501031_0300797 3300049568 Bacteria 1040
924 Ga0501033_0052608 3300049570 Bacteria 3018
925 Ga0501033_0207987 3300049570 Bacteria 1396
926 Ga0501034_0253758 3300049571 Bacteria 1703
927 Ga0501036_0171871 3300049572 Bacteria 1826
928 Ga0501036_0185232 3300049572 Bacteria 1752
929 Ga0501037_0219025 3300049573 Bacteria 1340
930 Ga0501037_0375071 3300049573 Bacteria 978
931 Ga0501038_0011020 3300049574 Bacteria 8254
932 Ga0501039_0002684 3300049575 Bacteria 13279
933 Ga0501039_0221456 3300049575 Bacteria 1488
934 Ga0501039_0689972 3300049575 Bacteria 799
935 Ga0501040_0002660 3300049576 Bacteria 11526
936 Ga0501041_0189193 3300049577 Bacteria 1289
937 Ga0501043_0025691 3300049579 Bacteria 4621
938 Ga0501043_0039241 3300049579 Bacteria 3722
939 Ga0501043_0043785 3300049579 Bacteria 3519
940 Ga0501046_0109734 3300049580 Bacteria 2109
941 Ga0501046_0131278 3300049580 Bacteria 1900
942 Ga0501046_0255728 3300049580 Bacteria 1288
943 Ga0501047_0065745 3300049581 Bacteria 3495
944 Ga0501047_0130481 3300049581 Bacteria 2394
945 Ga0501047_0144310 3300049581 Bacteria 2258
946 Ga0501047_0423529 3300049581 Bacteria 1162
947 Ga0501048_0009927 3300049582 Bacteria 7130
948 Ga0501068_0028004 3300049584 Bacteria 3329
949 Ga0501068_0104582 3300049584 Bacteria 1757
950 Ga0501070_0052346 3300049586 Bacteria 3389
951 Ga0501070_0721142 3300049586 Bacteria 787
952 Ga0501071_0011773 3300049587 Bacteria 5903
953 Ga0501071_0339466 3300049587 Bacteria 1142
954 Ga0501072_0008811 3300049588 Bacteria 7662
955 Ga0501072_0245166 3300049588 Bacteria 1427
956 Ga0501073_0036993 3300049589 Bacteria 3467
957 Ga0501073_0124613 3300049589 Bacteria 1786
958 Ga0501073_0186704 3300049589 Bacteria 1435
959 Ga0501074_0080946 3300049590 Bacteria 2329
960 Ga0501074_0433317 3300049590 Bacteria 932
961 Ga0501075_0000572 3300049591 Bacteria 22432
962 Ga0501076_0007550 3300049592 Bacteria 7915
963 Ga0501077_0000982 3300049593 Bacteria 17195
964 Ga0501079_0000502 3300049741 Bacteria 25497
965 Ga0501079_0111438 3300049741 Bacteria 2126
966 Ga0501080_0005351 3300049742 Bacteria 11439
967 Ga0501080_0154465 3300049742 Bacteria 2120
968 Ga0501080_0399862 3300049742 Bacteria 1236
969 Ga0501081_0000092 3300049743 Bacteria 36705
970 Ga0501081_0141157 3300049743 Bacteria 1726
971 Ga0501083_0010764 3300049744 Bacteria 6432
972 Ga0501241_000003 3300049758 Bacteria 178857
973 Ga0501269_000050 3300049766 Bacteria 37244
974 Ga0501044_0459709 3300049823 Bacteria 1178
975 Ga0501045_0000513 3300049824 Bacteria 24139
976 nmdc:mga0k408_2569_c1 3300050493 Bacteria 9634
977 nmdc:mga0k408_3418_c1 3300050493 Bacteria 8405
978 nmdc:mga05p37_125234_c1 3300050507 Bacteria 3156
979 nmdc:mga05p37_221805_c1 3300050507 Bacteria 2281
980 nmdc:mga09592_235446_c1 3300050508 Bacteria 1586
981 nmdc:mga09592_308647_c1 3300050508 Bacteria 1371
982 nmdc:mga09592_37007_c1 3300050508 Bacteria 4090
983 nmdc:mga09592_465938_c1 3300050508 Bacteria 1089
984 nmdc:mga0qj67_244258_c1 3300050509 Bacteria 1456
985 nmdc:mga0qj67_94824_c1 3300050509 Bacteria 2401
986 nmdc:mga06r32_741098_c1 3300050510 Bacteria 946
987 nmdc:mga08y16_123766_c1 3300050511 Bacteria 2691
988 nmdc:mga08y16_43526_c1 3300050511 Bacteria 4706
989 nmdc:mga08y16_860711_c1 3300050511 Bacteria 895
990 Ga0495601_0002906 3300053077 Bacteria 9748
991 Ga0495601_0017419 3300053077 Bacteria 4361
992 Ga0495601_0026240 3300053077 Bacteria 3596
993 Ga0495601_0096987 3300053077 Bacteria 1902
994 Ga0495612_0000301 3300053078 Bacteria 20083
995 Ga0495595_0053071 3300053084 Bacteria 1882
996 Ga0495619_0000944 3300053085 Bacteria 19038
997 Ga0495619_0022615 3300053085 Bacteria 4026
998 Ga0495619_0047926 3300053085 Bacteria 2815
999 Ga0495619_0129937 3300053085 Bacteria 1730
1000 Ga0500643_000002 3300053087 Bacteria 1277657
1001 Ga0500651_0000723 3300053093 Bacteria 16223
1002 Ga0500555_000242 3300053103 Bacteria 24278
1003 Ga0500555_009159 3300053103 Bacteria 2830
1004 Ga0500562_000130 3300053108 Bacteria 23570
1005 Ga0500592_000252 3300053116 Bacteria 9612
1006 Ga0500642_0077572 3300053130 Bacteria 1521
1007 Ga0500568_0034536 3300053139 Bacteria 2069
1008 Ga0500573_0021147 3300053140 Bacteria 3727
1009 Ga0500616_0000019 3300053153 Bacteria 549964
1010 Ga0500619_000037 3300053154 Bacteria 41109
1011 Ga0500637_0251453 3300053178 Bacteria 986
1012 Ga0500645_001224 3300053730 Bacteria 13535
1013 Ga0500645_012815 3300053730 Bacteria 2705
1014 Ga0501084_0001064 3300054114 Bacteria 21323
1015 Ga0501082_0067389 3300060353 Bacteria 3082
1016 Ga0466962_0036085 3300061719 Bacteria 2365
1017 Ga0530510_0008078 3300061734 Bacteria 7339

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035083 Ga0373926_0219815 Ga0373926_0219815_90_710 205
2 3300003320 rootH2_10009385 rootH2_100093858 217
3 3300046473 Ga0495582_0314016 Ga0495582_0314016_22_717 219
4 3300005435 Ga0070714_100117931 Ga0070714_1001179313 223
5 3300005436 Ga0070713_100162298 Ga0070713_1001622982 223
6 3300005614 Ga0068856_100235107 Ga0068856_1002351072 223
7 3300025915 Ga0207693_10024754 Ga0207693_100247543 223
8 3300025928 Ga0207700_10051406 Ga0207700_100514063 223
9 3300025929 Ga0207664_10069324 Ga0207664_100693242 223
10 3300035118 Ga0373954_0187956 Ga0373954_0187956_42_758 223
11 3300013100 Ga0157373_10003158 Ga0157373_100031582 224
12 3300032126 Ga0307415_100615369 Ga0307415_1006153691 224
13 3300005439 Ga0070711_100211362 Ga0070711_1002113622 225
14 3300037068 Ga0373925_0090209 Ga0373925_0090209_74_775 225
15 3300046692 Ga0495671_0001021 Ga0495671_0001021_14867_15613 225
16 3300005328 Ga0070676_10368502 Ga0070676_103685022 227
17 3300005615 Ga0070702_100242822 Ga0070702_1002428222 227
18 3300005618 Ga0068864_100085017 Ga0068864_1000850173 227
19 3300025907 Ga0207645_10311642 Ga0207645_103116422 227
20 3300026095 Ga0207676_10100058 Ga0207676_101000582 227
21 3300049575 Ga0501039_0689972 Ga0501039_0689972_95_781 227
22 iso_pu_bacteria 8036736890 8036739605 227
23 3300005328 Ga0070676_10173087 Ga0070676_101730872 228
24 3300005330 Ga0070690_100006132 Ga0070690_1000061325 228
25 3300005333 Ga0070677_10042635 Ga0070677_100426352 228
26 3300005335 Ga0070666_10007588 Ga0070666_100075882 228
27 3300005338 Ga0068868_100003208 Ga0068868_1000032085 228
28 3300005354 Ga0070675_100000208 Ga0070675_10000020815 228
29 3300005355 Ga0070671_100001433 Ga0070671_10000143316 228
30 3300005364 Ga0070673_100000523 Ga0070673_10000052313 228
31 3300005365 Ga0070688_100065452 Ga0070688_1000654523 228
32 3300005456 Ga0070678_100000227 Ga0070678_10000022725 228
33 3300005459 Ga0068867_100025872 Ga0068867_1000258723 228
34 3300005466 Ga0070685_10238652 Ga0070685_102386522 228
35 3300005471 Ga0070698_100246073 Ga0070698_1002460731 228
36 3300005539 Ga0068853_100238057 Ga0068853_1002380572 228
37 3300005544 Ga0070686_100478906 Ga0070686_1004789062 228
38 3300005564 Ga0070664_100534515 Ga0070664_1005345151 228
39 3300005616 Ga0068852_100031895 Ga0068852_1000318952 228
40 3300005617 Ga0068859_100004743 Ga0068859_1000047433 228
41 3300005618 Ga0068864_100000101 Ga0068864_10000010114 228
42 3300005719 Ga0068861_100304831 Ga0068861_1003048312 228
43 3300005834 Ga0068851_10097345 Ga0068851_100973452 228
44 3300005841 Ga0068863_100012306 Ga0068863_1000123063 228
45 3300005842 Ga0068858_100003419 Ga0068858_1000034195 228
46 3300006237 Ga0097621_100206674 Ga0097621_1002066742 228
47 3300006358 Ga0068871_100019124 Ga0068871_1000191242 228
48 3300006931 Ga0097620_100004743 Ga0097620_1000047438 228
49 3300009177 Ga0105248_10039410 Ga0105248_100394101 228
50 3300013296 Ga0157374_10029467 Ga0157374_100294671 228
51 3300013297 Ga0157378_10153853 Ga0157378_101538533 228
52 3300013306 Ga0163162_10001589 Ga0163162_1000158916 228
53 3300013306 Ga0163162_10037600 Ga0163162_100376002 228
54 3300013308 Ga0157375_10001221 Ga0157375_100012217 228
55 3300014325 Ga0163163_10001383 Ga0163163_1000138314 228
56 3300014968 Ga0157379_10069552 Ga0157379_100695522 228
57 3300014969 Ga0157376_10268440 Ga0157376_102684402 228
58 3300017792 Ga0163161_10062869 Ga0163161_100628693 228
59 3300021361 Ga0213872_10001170 Ga0213872_100011701 228
60 3300025903 Ga0207680_10001266 Ga0207680_100012665 228
61 3300025907 Ga0207645_10199600 Ga0207645_101996001 228
62 3300025926 Ga0207659_10000588 Ga0207659_100005886 228
63 3300025931 Ga0207644_10004826 Ga0207644_100048263 228
64 3300025936 Ga0207670_10014040 Ga0207670_100140404 228
65 3300025940 Ga0207691_10081108 Ga0207691_100811082 228
66 3300025941 Ga0207711_10029539 Ga0207711_100295395 228
67 3300025960 Ga0207651_10000179 Ga0207651_1000017920 228
68 3300026023 Ga0207677_10004081 Ga0207677_100040814 228
69 3300026035 Ga0207703_10005653 Ga0207703_100056533 228
70 3300026041 Ga0207639_10233772 Ga0207639_102337722 228
71 3300026088 Ga0207641_10009505 Ga0207641_100095053 228
72 3300026088 Ga0207641_10181212 Ga0207641_101812122 228
73 3300026089 Ga0207648_10007551 Ga0207648_100075512 228
74 3300026095 Ga0207676_10002099 Ga0207676_1000209915 228
75 3300026118 Ga0207675_100240210 Ga0207675_1002402101 228
76 3300026121 Ga0207683_10001598 Ga0207683_1000159820 228
77 3300026121 Ga0207683_10364682 Ga0207683_103646822 228
78 3300026142 Ga0207698_10132170 Ga0207698_101321702 228
79 3300031239 Ga0265328_10116024 Ga0265328_101160242 228
80 3300039447 Ga0436361_0508014 Ga0436361_0508014_228_914 228
81 3300047320 Ga0495672_0001917 Ga0495672_0001917_10001_10747 228
82 3300048909 Ga0496106_0186734 Ga0496106_0186734_486_1172 228
83 3300048911 Ga0496108_0081698 Ga0496108_0081698_332_1018 228
84 3300048912 Ga0496109_0135358 Ga0496109_0135358_1399_2085 228
85 iso_pu_bacteria 2914759650 2914763196 228
86 3300003320 rootH2_10193234 rootH2_101932342 229
87 3300005293 Ga0065715_10212795 Ga0065715_102127952 229
88 3300005328 Ga0070676_10024163 Ga0070676_100241631 229
89 3300005330 Ga0070690_100029833 Ga0070690_1000298333 229
90 3300005333 Ga0070677_10020372 Ga0070677_100203723 229
91 3300005335 Ga0070666_10051454 Ga0070666_100514543 229
92 3300005338 Ga0068868_100016571 Ga0068868_1000165711 229
93 3300005343 Ga0070687_100059708 Ga0070687_1000597083 229
94 3300005347 Ga0070668_100031835 Ga0070668_1000318352 229
95 3300005353 Ga0070669_100164277 Ga0070669_1001642772 229
96 3300005354 Ga0070675_100234616 Ga0070675_1002346162 229
97 3300005356 Ga0070674_100020413 Ga0070674_1000204133 229
98 3300005365 Ga0070688_100121598 Ga0070688_1001215982 229
99 3300005367 Ga0070667_100001902 Ga0070667_1000019027 229
100 3300005367 Ga0070667_100112715 Ga0070667_1001127152 229
101 3300005406 Ga0070703_10000113 Ga0070703_1000011319 229
102 3300005438 Ga0070701_10011600 Ga0070701_100116003 229
103 3300005440 Ga0070705_100296412 Ga0070705_1002964121 229
104 3300005441 Ga0070700_100009956 Ga0070700_1000099562 229
105 3300005441 Ga0070700_100048201 Ga0070700_1000482012 229
106 3300005441 Ga0070700_100367358 Ga0070700_1003673581 229
107 3300005444 Ga0070694_100005129 Ga0070694_1000051295 229
108 3300005445 Ga0070708_100084056 Ga0070708_1000840563 229
109 3300005456 Ga0070678_100023593 Ga0070678_1000235932 229
110 3300005457 Ga0070662_100030296 Ga0070662_1000302962 229
111 3300005459 Ga0068867_100051158 Ga0068867_1000511581 229
112 3300005466 Ga0070685_10053945 Ga0070685_100539452 229
113 3300005518 Ga0070699_100405362 Ga0070699_1004053622 229
114 3300005544 Ga0070686_100026997 Ga0070686_1000269973 229
115 3300005548 Ga0070665_100046639 Ga0070665_1000466393 229
116 3300005564 Ga0070664_100148006 Ga0070664_1001480062 229
117 3300005577 Ga0068857_100207217 Ga0068857_1002072172 229
118 3300005617 Ga0068859_100197930 Ga0068859_1001979302 229
119 3300005618 Ga0068864_100316511 Ga0068864_1003165112 229
120 3300005718 Ga0068866_10011077 Ga0068866_100110774 229
121 3300005719 Ga0068861_100023859 Ga0068861_1000238593 229
122 3300005841 Ga0068863_100107301 Ga0068863_1001073013 229
123 3300005841 Ga0068863_100409320 Ga0068863_1004093201 229
124 3300005842 Ga0068858_100096380 Ga0068858_1000963803 229
125 3300005842 Ga0068858_100723917 Ga0068858_1007239172 229
126 3300005844 Ga0068862_100059701 Ga0068862_1000597013 229
127 3300006028 Ga0070717_10076438 Ga0070717_100764382 229
128 3300006028 Ga0070717_10293105 Ga0070717_102931051 229
129 3300006173 Ga0070716_100075027 Ga0070716_1000750271 229
130 3300006195 Ga0075366_10002575 Ga0075366_100025755 229
131 3300006237 Ga0097621_100026816 Ga0097621_1000268162 229
132 3300006237 Ga0097621_100043240 Ga0097621_1000432404 229
133 3300006358 Ga0068871_100005768 Ga0068871_10000576810 229
134 3300006844 Ga0075428_100514917 Ga0075428_1005149171 229
135 3300006846 Ga0075430_100105710 Ga0075430_1001057102 229
136 3300006880 Ga0075429_100334186 Ga0075429_1003341861 229
137 3300006881 Ga0068865_100047398 Ga0068865_1000473982 229
138 3300006881 Ga0068865_100152844 Ga0068865_1001528442 229
139 3300006931 Ga0097620_100197924 Ga0097620_1001979242 229
140 3300009148 Ga0105243_10000056 Ga0105243_10000056104 229
141 3300009176 Ga0105242_10000015 Ga0105242_1000001597 229
142 3300009176 Ga0105242_10058655 Ga0105242_100586555 229
143 3300009177 Ga0105248_10035689 Ga0105248_100356897 229
144 3300009177 Ga0105248_10135207 Ga0105248_101352072 229
145 3300013296 Ga0157374_10003991 Ga0157374_100039913 229
146 3300013297 Ga0157378_10107682 Ga0157378_101076823 229
147 3300013306 Ga0163162_10055019 Ga0163162_100550192 229
148 3300013306 Ga0163162_11239320 Ga0163162_112393201 229
149 3300013308 Ga0157375_11307461 Ga0157375_113074611 229
150 3300014497 Ga0182008_10015435 Ga0182008_100154353 229
151 3300014969 Ga0157376_10006392 Ga0157376_100063928 229
152 3300015261 Ga0182006_1000097 Ga0182006_100009787 229
153 3300015262 Ga0182007_10000095 Ga0182007_1000009555 229
154 3300015265 Ga0182005_1000038 Ga0182005_100003885 229
155 3300017792 Ga0163161_10531271 Ga0163161_105312711 229
156 3300025271 Ga0207666_1007773 Ga0207666_10077732 229
157 3300025315 Ga0207697_10014064 Ga0207697_100140642 229
158 3300025885 Ga0207653_10000011 Ga0207653_1000001142 229
159 3300025893 Ga0207682_10002230 Ga0207682_100022304 229
160 3300025899 Ga0207642_10022924 Ga0207642_100229243 229
161 3300025901 Ga0207688_10005672 Ga0207688_100056726 229
162 3300025903 Ga0207680_10023747 Ga0207680_100237473 229
163 3300025907 Ga0207645_10010412 Ga0207645_100104122 229
164 3300025908 Ga0207643_10085564 Ga0207643_100855642 229
165 3300025908 Ga0207643_10158000 Ga0207643_101580002 229
166 3300025918 Ga0207662_10021647 Ga0207662_100216472 229
167 3300025922 Ga0207646_10670195 Ga0207646_106701951 229
168 3300025923 Ga0207681_10133978 Ga0207681_101339782 229
169 3300025925 Ga0207650_10066083 Ga0207650_100660833 229
170 3300025926 Ga0207659_10029176 Ga0207659_100291765 229
171 3300025931 Ga0207644_10032885 Ga0207644_100328853 229
172 3300025931 Ga0207644_10102077 Ga0207644_101020774 229
173 3300025933 Ga0207706_10082095 Ga0207706_100820953 229
174 3300025934 Ga0207686_10000007 Ga0207686_10000007109 229
175 3300025934 Ga0207686_10040916 Ga0207686_100409163 229
176 3300025934 Ga0207686_10093174 Ga0207686_100931743 229
177 3300025935 Ga0207709_10000101 Ga0207709_100001018 229
178 3300025935 Ga0207709_10237979 Ga0207709_102379791 229
179 3300025936 Ga0207670_10225360 Ga0207670_102253601 229
180 3300025937 Ga0207669_10174886 Ga0207669_101748862 229
181 3300025938 Ga0207704_10024325 Ga0207704_100243252 229
182 3300025938 Ga0207704_10157544 Ga0207704_101575441 229
183 3300025940 Ga0207691_10036906 Ga0207691_100369062 229
184 3300025941 Ga0207711_10080900 Ga0207711_100809003 229
185 3300025942 Ga0207689_10024667 Ga0207689_100246673 229
186 3300025942 Ga0207689_10323356 Ga0207689_103233562 229
187 3300025945 Ga0207679_10293684 Ga0207679_102936842 229
188 3300025961 Ga0207712_10521389 Ga0207712_105213892 229
189 3300025961 Ga0207712_10535290 Ga0207712_105352901 229
190 3300025972 Ga0207668_10066865 Ga0207668_100668653 229
191 3300025986 Ga0207658_10001572 Ga0207658_1000157212 229
192 3300026023 Ga0207677_10082448 Ga0207677_100824482 229
193 3300026035 Ga0207703_10182196 Ga0207703_101821962 229
194 3300026035 Ga0207703_10385639 Ga0207703_103856392 229
195 3300026075 Ga0207708_10019637 Ga0207708_100196373 229
196 3300026075 Ga0207708_10095035 Ga0207708_100950352 229
197 3300026075 Ga0207708_10370931 Ga0207708_103709311 229
198 3300026088 Ga0207641_10927352 Ga0207641_109273521 229
199 3300026089 Ga0207648_10009747 Ga0207648_100097476 229
200 3300026095 Ga0207676_10067892 Ga0207676_100678923 229
201 3300026116 Ga0207674_10151829 Ga0207674_101518292 229
202 3300026118 Ga0207675_100039681 Ga0207675_1000396813 229
203 3300028379 Ga0268266_10096267 Ga0268266_100962673 229
204 3300028380 Ga0268265_10126671 Ga0268265_101266712 229
205 3300028381 Ga0268264_10061722 Ga0268264_100617221 229
206 3300028558 Ga0265326_10051178 Ga0265326_100511782 229
207 3300028577 Ga0265318_10071790 Ga0265318_100717901 229
208 3300031250 Ga0265331_10060128 Ga0265331_100601281 229
209 3300031250 Ga0265331_10249713 Ga0265331_102497131 229
210 3300031251 Ga0265327_10158451 Ga0265327_101584511 229
211 3300031344 Ga0265316_10052944 Ga0265316_100529442 229
212 3300031456 Ga0307513_10103235 Ga0307513_101032352 229
213 3300031649 Ga0307514_10001950 Ga0307514_1000195015 229
214 3300031727 Ga0316576_10203972 Ga0316576_102039721 229
215 3300031728 Ga0316578_10087120 Ga0316578_100871202 229
216 3300031733 Ga0316577_10079932 Ga0316577_100799321 229
217 3300032137 Ga0316585_10051322 Ga0316585_100513221 229
218 3300035171 Ga0373946_0146142 Ga0373946_0146142_381_1070 229
219 3300036401 Ga0373937_0032473 Ga0373937_0032473_3660_4349 229
220 3300036712 Ga0316584_0315286 Ga0316584_0315286_195_884 229
221 3300042876 Ga0451577_0000101 Ga0451577_0000101_133552_134241 229
222 3300044712 Ga0453684_0000679 Ga0453684_0000679_39551_40240 229
223 3300044712 Ga0453684_0361100 Ga0453684_0361100_330_1019 229
224 3300048919 Ga0496116_0066661 Ga0496116_0066661_806_1495 229
225 3300048920 Ga0496117_0000132 Ga0496117_0000132_87244_87933 229
226 3300048921 Ga0496118_0000099 Ga0496118_0000099_87244_87933 229
227 3300048924 Ga0496121_0032337 Ga0496121_0032337_2766_3455 229
228 3300048925 Ga0496122_0004429 Ga0496122_0004429_2700_3389 229
229 3300048926 Ga0496123_0005655 Ga0496123_0005655_8675_9364 229
230 3300048928 Ga0496125_0054020 Ga0496125_0054020_896_1585 229
231 3300048929 Ga0496126_0641876 Ga0496126_0641876_53_742 229
232 3300049568 Ga0501031_0300797 Ga0501031_0300797_292_981 229
233 3300049574 Ga0501038_0011020 Ga0501038_0011020_4256_4945 229
234 3300049575 Ga0501039_0002684 Ga0501039_0002684_12334_13023 229
235 3300049576 Ga0501040_0002660 Ga0501040_0002660_6889_7578 229
236 3300049579 Ga0501043_0043785 Ga0501043_0043785_180_869 229
237 3300049580 Ga0501046_0131278 Ga0501046_0131278_1161_1850 229
238 3300049582 Ga0501048_0009927 Ga0501048_0009927_4255_4944 229
239 3300049584 Ga0501068_0028004 Ga0501068_0028004_1706_2395 229
240 3300049586 Ga0501070_0052346 Ga0501070_0052346_2539_3228 229
241 3300049588 Ga0501072_0008811 Ga0501072_0008811_2195_2884 229
242 3300049589 Ga0501073_0186704 Ga0501073_0186704_642_1331 229
243 3300049590 Ga0501074_0080946 Ga0501074_0080946_748_1437 229
244 3300049591 Ga0501075_0000572 Ga0501075_0000572_11246_11935 229
245 3300049592 Ga0501076_0007550 Ga0501076_0007550_4904_5593 229
246 3300049593 Ga0501077_0000982 Ga0501077_0000982_8677_9366 229
247 3300049741 Ga0501079_0000502 Ga0501079_0000502_13931_14620 229
248 3300049742 Ga0501080_0005351 Ga0501080_0005351_102_791 229
249 3300049743 Ga0501081_0000092 Ga0501081_0000092_24157_24846 229
250 3300049744 Ga0501083_0010764 Ga0501083_0010764_4942_5631 229
251 3300049824 Ga0501045_0000513 Ga0501045_0000513_1002_1691 229
252 3300050493 nmdc:mga0k408_2569_c1 nmdc:mga0k408_2569_c1_5792_6481 229
253 3300050509 nmdc:mga0qj67_94824_c1 nmdc:mga0qj67_94824_c1_1269_1958 229
254 3300053093 Ga0500651_0000723 Ga0500651_0000723_5247_5936 229
255 3300053154 Ga0500619_000037 Ga0500619_000037_39217_39906 229
256 3300054114 Ga0501084_0001064 Ga0501084_0001064_9997_10686 229
257 3300061734 Ga0530510_0008078 Ga0530510_0008078_1551_2240 229
258 iso_pu_bacteria 2890737413 2890740132 229
259 3300002738 JGI25154J39366_1002110 JGI25154J39366_10021105 230
260 3300003771 Ga0055526_1000232 Ga0055526_100023221 230
261 3300005468 Ga0070707_100057853 Ga0070707_1000578537 230
262 3300005471 Ga0070698_100014238 Ga0070698_1000142382 230
263 3300005518 Ga0070699_100015650 Ga0070699_1000156509 230
264 3300005536 Ga0070697_100032621 Ga0070697_1000326214 230
265 3300005549 Ga0070704_100005894 Ga0070704_1000058949 230
266 3300005617 Ga0068859_100000008 Ga0068859_100000008197 230
267 3300006871 Ga0075434_100659378 Ga0075434_1006593781 230
268 3300006914 Ga0075436_100136428 Ga0075436_1001364282 230
269 3300006931 Ga0097620_100000008 Ga0097620_100000008197 230
270 3300009147 Ga0114129_10198151 Ga0114129_101981513 230
271 3300009177 Ga0105248_10036354 Ga0105248_100363549 230
272 3300014325 Ga0163163_10406796 Ga0163163_104067961 230
273 3300025246 Ga0209646_1000246 Ga0209646_100024613 230
274 3300025295 Ga0209564_1000230 Ga0209564_100023072 230
275 3300025910 Ga0207684_10113737 Ga0207684_101137371 230
276 3300025922 Ga0207646_10042178 Ga0207646_100421782 230
277 3300025960 Ga0207651_10548597 Ga0207651_105485972 230
278 3300027312 Ga0209371_1002176 Ga0209371_10021763 230
279 3300028379 Ga0268266_10821167 Ga0268266_108211671 230
280 3300028800 Ga0265338_10092476 Ga0265338_100924762 230
281 3300030500 Ga0268256_1001097 Ga0268256_10010978 230
282 3300031241 Ga0265325_10000127 Ga0265325_1000012714 230
283 3300031249 Ga0265339_10000827 Ga0265339_1000082731 230
284 3300031344 Ga0265316_10018261 Ga0265316_100182612 230
285 3300031595 Ga0265313_10000907 Ga0265313_100009078 230
286 3300035118 Ga0373954_0071008 Ga0373954_0071008_183_878 230
287 3300035410 Ga0373924_0170859 Ga0373924_0170859_32_727 230
288 3300035724 Ga0373933_0177682 Ga0373933_0177682_132_824 230
289 3300035725 Ga0373947_0374787 Ga0373947_0374787_146_841 230
290 3300037068 Ga0373925_0299408 Ga0373925_0299408_86_781 230
291 3300039450 Ga0436363_0588950 Ga0436363_0588950_69_794 230
292 3300045836 Ga0466958_0190423 Ga0466958_0190423_299_1012 230
293 3300045976 Ga0466967_0324205 Ga0466967_0324205_751_1464 230
294 3300045976 Ga0466967_0625270 Ga0466967_0625270_122_853 230
295 3300046460 Ga0495638_0000493 Ga0495638_0000493_32403_33095 230
296 3300046471 Ga0495650_0001929 Ga0495650_0001929_3682_4374 230
297 3300046472 Ga0495580_0244249 Ga0495580_0244249_309_1001 230
298 3300046475 Ga0495639_0008665 Ga0495639_0008665_1670_2362 230
299 3300046501 Ga0495607_0004270 Ga0495607_0004270_193_885 230
300 3300046506 Ga0495583_0000626 Ga0495583_0000626_33111_33803 230
301 3300046507 Ga0495606_0000660 Ga0495606_0000660_46960_47652 230
302 3300046524 Ga0495648_0000206 Ga0495648_0000206_32626_33318 230
303 3300046528 Ga0495642_0013982 Ga0495642_0013982_64_756 230
304 3300046557 Ga0495622_0000077 Ga0495622_0000077_32538_33230 230
305 3300046558 Ga0495633_0000149 Ga0495633_0000149_53106_53798 230
306 3300046660 Ga0495625_0000199 Ga0495625_0000199_34120_34812 230
307 3300050507 nmdc:mga05p37_221805_c1 nmdc:mga05p37_221805_c1_790_1482 230
308 3300053108 Ga0500562_000130 Ga0500562_000130_22233_22925 230
309 iso_pu_bacteria 2721755763 2723878444 230
310 3300005272 Ga0065703_1018836 Ga0065703_10188367 231
311 3300005439 Ga0070711_100126251 Ga0070711_1001262512 231
312 3300005549 Ga0070704_100161035 Ga0070704_1001610351 231
313 3300005615 Ga0070702_100111863 Ga0070702_1001118632 231
314 3300006946 Ga0079104_1000700 Ga0079104_100070018 231
315 3300006946 Ga0079104_1003404 Ga0079104_10034048 231
316 3300009011 Ga0105251_10000073 Ga0105251_1000007358 231
317 3300009011 Ga0105251_10000267 Ga0105251_1000026719 231
318 3300009036 Ga0105244_10000315 Ga0105244_1000031533 231
319 3300009036 Ga0105244_10108177 Ga0105244_101081772 231
320 3300009092 Ga0105250_10080334 Ga0105250_100803342 231
321 3300009094 Ga0111539_10209250 Ga0111539_102092502 231
322 3300009098 Ga0105245_10086433 Ga0105245_100864331 231
323 3300009174 Ga0105241_10000004 Ga0105241_10000004108 231
324 3300013296 Ga0157374_10074693 Ga0157374_100746934 231
325 3300013306 Ga0163162_10215867 Ga0163162_102158671 231
326 3300014326 Ga0157380_10049239 Ga0157380_100492393 231
327 3300014326 Ga0157380_10769736 Ga0157380_107697361 231
328 3300014497 Ga0182008_10001860 Ga0182008_100018604 231
329 3300014745 Ga0157377_10234961 Ga0157377_102349612 231
330 3300014968 Ga0157379_10015278 Ga0157379_100152784 231
331 3300014969 Ga0157376_10477482 Ga0157376_104774821 231
332 3300017792 Ga0163161_10000004 Ga0163161_10000004281 231
333 3300021361 Ga0213872_10021407 Ga0213872_100214072 231
334 3300025263 Ga0209565_1000017 Ga0209565_100001726 231
335 3300025273 Ga0209673_1000007 Ga0209673_1000007403 231
336 3300025291 Ga0209675_1000009 Ga0209675_1000009115 231
337 3300025295 Ga0209564_1000055 Ga0209564_100005550 231
338 3300025299 Ga0209256_1000559 Ga0209256_100055930 231
339 3300025711 Ga0207696_1000033 Ga0207696_1000033240 231
340 3300025728 Ga0207655_1000011 Ga0207655_100001131 231
341 3300025735 Ga0207713_1000065 Ga0207713_1000065123 231
342 3300025735 Ga0207713_1000108 Ga0207713_100010870 231
343 3300025735 Ga0207713_1001983 Ga0207713_100198312 231
344 3300025900 Ga0207710_10000016 Ga0207710_10000016130 231
345 3300025911 Ga0207654_10000006 Ga0207654_10000006124 231
346 3300026121 Ga0207683_10407446 Ga0207683_104074462 231
347 3300027111 Ga0209281_1000008 Ga0209281_1000008746 231
348 3300027111 Ga0209281_1004171 Ga0209281_10041711 231
349 3300035086 Ga0373934_0000391 Ga0373934_0000391_6969_7664 231
350 3300035111 Ga0373923_0003108 Ga0373923_0003108_677_1372 231
351 3300035113 Ga0373936_0004500 Ga0373936_0004500_3563_4258 231
352 3300035116 Ga0373945_0019882 Ga0373945_0019882_1187_1882 231
353 3300035117 Ga0373953_0003575 Ga0373953_0003575_3483_4178 231
354 3300035118 Ga0373954_0003733 Ga0373954_0003733_5287_5982 231
355 3300035118 Ga0373954_0035743 Ga0373954_0035743_598_1293 231
356 3300035171 Ga0373946_0023130 Ga0373946_0023130_1214_1909 231
357 3300035172 Ga0373955_0001902 Ga0373955_0001902_7250_7945 231
358 3300035172 Ga0373955_0021943 Ga0373955_0021943_264_959 231
359 3300035692 Ga0373935_0008762 Ga0373935_0008762_1392_2087 231
360 3300035695 Ga0373927_0007084 Ga0373927_0007084_5106_5801 231
361 3300036401 Ga0373937_0107999 Ga0373937_0107999_935_1630 231
362 3300037068 Ga0373925_0025553 Ga0373925_0025553_1629_2324 231
363 3300039447 Ga0436361_0191634 Ga0436361_0191634_754_1449 231
364 3300039447 Ga0436361_0282869 Ga0436361_0282869_122_817 231
365 3300039447 Ga0436361_0300897 Ga0436361_0300897_55274_55969 231
366 3300041411 Ga0439466_0083079 Ga0439466_0083079_111_806 231
367 3300042006 Ga0439432_023496 Ga0439432_023496_681_1376 231
368 3300046454 Ga0495592_0020234 Ga0495592_0020234_3860_4555 231
369 3300046461 Ga0495641_0001105 Ga0495641_0001105_4300_4995 231
370 3300046462 Ga0495651_0009753 Ga0495651_0009753_6059_6754 231
371 3300046463 Ga0495653_0017178 Ga0495653_0017178_1135_1830 231
372 3300046472 Ga0495580_0021288 Ga0495580_0021288_3994_4689 231
373 3300046473 Ga0495582_0089280 Ga0495582_0089280_396_1091 231
374 3300046475 Ga0495639_0003744 Ga0495639_0003744_2394_3089 231
375 3300046476 Ga0495662_0016160 Ga0495662_0016160_1592_2287 231
376 3300046477 Ga0495664_0009587 Ga0495664_0009587_3894_4589 231
377 3300046499 Ga0495594_0009332 Ga0495594_0009332_2705_3400 231
378 3300046511 Ga0495608_0023435 Ga0495608_0023435_3454_4149 231
379 3300046516 Ga0495628_0052427 Ga0495628_0052427_2151_2846 231
380 3300046517 Ga0495630_0001974 Ga0495630_0001974_1376_2071 231
381 3300046526 Ga0495666_0006403 Ga0495666_0006403_4843_5538 231
382 3300046529 Ga0495652_0202263 Ga0495652_0202263_115_810 231
383 3300046530 Ga0495654_0000353 Ga0495654_0000353_5128_5823 231
384 3300046533 Ga0495640_0006143 Ga0495640_0006143_8359_9054 231
385 3300046535 Ga0495586_0005085 Ga0495586_0005085_441_1136 231
386 3300046536 Ga0495587_0015431 Ga0495587_0015431_3436_4131 231
387 3300046539 Ga0495621_0104197 Ga0495621_0104197_23_727 231
388 3300046557 Ga0495622_0113110 Ga0495622_0113110_471_1166 231
389 3300046559 Ga0495667_0005516 Ga0495667_0005516_686_1381 231
390 3300046642 Ga0495634_0008248 Ga0495634_0008248_6395_7090 231
391 3300046675 Ga0495657_0003049 Ga0495657_0003049_4815_5510 231
392 3300046678 Ga0495599_0001790 Ga0495599_0001790_6467_7162 231
393 3300046681 Ga0495647_0001510 Ga0495647_0001510_496_1191 231
394 3300046683 Ga0495658_0335019 Ga0495658_0335019_181_882 231
395 3300046684 Ga0495669_0125883 Ga0495669_0125883_486_1190 231
396 3300046690 Ga0495624_0023178 Ga0495624_0023178_1133_1828 231
397 3300046794 Ga0495589_0000006 Ga0495589_0000006_127109_127804 231
398 3300046809 Ga0495600_0002178 Ga0495600_0002178_8754_9449 231
399 3300047315 Ga0495581_0146557 Ga0495581_0146557_309_1004 231
400 3300047317 Ga0495604_0012321 Ga0495604_0012321_3239_3934 231
401 3300047319 Ga0495674_0000463 Ga0495674_0000463_7039_7734 231
402 3300047322 Ga0495680_0016578 Ga0495680_0016578_3975_4670 231
403 3300047444 Ga0495675_0035274 Ga0495675_0035274_2112_2807 231
404 3300047471 Ga0495684_0001586 Ga0495684_0001586_17016_17711 231
405 3300048922 Ga0496119_0000258 Ga0496119_0000258_40453_41148 231
406 3300048922 Ga0496119_0000280 Ga0496119_0000280_33968_34663 231
407 3300048923 Ga0496120_0000228 Ga0496120_0000228_53045_53740 231
408 3300048923 Ga0496120_0000255 Ga0496120_0000255_42003_42698 231
409 3300048927 Ga0496124_0000122 Ga0496124_0000122_76688_77383 231
410 3300049587 Ga0501071_0339466 Ga0501071_0339466_372_1067 231
411 3300049588 Ga0501072_0245166 Ga0501072_0245166_546_1241 231
412 3300050508 nmdc:mga09592_308647_c1 nmdc:mga09592_308647_c1_174_878 231
413 3300050511 nmdc:mga08y16_123766_c1 nmdc:mga08y16_123766_c1_1377_2081 231
414 3300053084 Ga0495595_0053071 Ga0495595_0053071_676_1371 231
415 3300053085 Ga0495619_0000944 Ga0495619_0000944_5927_6622 231
416 iso_pu_bacteria 2738541273 2738699871 231
417 iso_pu_bacteria 2738543014 2739253620 231
418 iso_pu_bacteria 2984572630 2984573195 231
419 iso_pu_bacteria 2984606641 2984610647 231
420 3300005289 Ga0065704_10332195 Ga0065704_103321951 232
421 3300005336 Ga0070680_100553621 Ga0070680_1005536211 232
422 3300005719 Ga0068861_100436788 Ga0068861_1004367882 232
423 3300025906 Ga0207699_10442958 Ga0207699_104429582 232
424 3300026118 Ga0207675_100227299 Ga0207675_1002272992 232
425 3300026118 Ga0207675_101002749 Ga0207675_1010027491 232
426 3300028017 Ga0265356_1000177 Ga0265356_10001775 232
427 3300031090 Ga0265760_10002206 Ga0265760_100022062 232
428 3300042876 Ga0451577_0208072 Ga0451577_0208072_289_996 232
429 3300044683 Ga0466965_0017505 Ga0466965_0017505_1868_2611 232
430 3300044693 Ga0466961_0001373 Ga0466961_0001373_6443_7186 232
431 3300044719 Ga0466971_0019617 Ga0466971_0019617_66_809 232
432 3300044842 Ga0466957_0006003 Ga0466957_0006003_3378_4121 232
433 3300045051 Ga0451576_0000260 Ga0451576_0000260_74088_74795 232
434 3300045836 Ga0466958_0063430 Ga0466958_0063430_60_803 232
435 3300046473 Ga0495582_0094989 Ga0495582_0094989_416_1120 232
436 3300046539 Ga0495621_0006587 Ga0495621_0006587_1684_2382 232
437 3300053103 Ga0500555_009159 Ga0500555_009159_64_762 232
438 3300061719 Ga0466962_0036085 Ga0466962_0036085_1437_2180 232
439 iso_pu_bacteria 2511231000 2511231668 232
440 iso_pu_bacteria 2582581278 2585145033 232
441 iso_pu_bacteria 2582581281 2585156106 232
442 iso_pu_bacteria 2582581282 2585160315 232
443 iso_pu_bacteria 2585428045 2587678591 232
444 iso_pu_bacteria 2585428182 2588210351 232
445 iso_pu_bacteria 2585428183 2588214405 232
446 iso_pu_bacteria 2585428184 2588217631 232
447 iso_pu_bacteria 2585428185 2588223148 232
448 iso_pu_bacteria 2588254255 2590601608 232
449 iso_pu_bacteria 2728369107 2729200139 232
450 iso_pu_bacteria 2739367874 2740059118 232
451 iso_pu_bacteria 2751185877 2753673169 232
452 iso_pu_bacteria 2765235839 2765574262 232
453 iso_pu_bacteria 2772190705 2772604781 232
454 iso_pu_bacteria 2816332188 2816874473 232
455 iso_pu_bacteria 2842083920 2842085836 232
456 iso_pu_bacteria 2871720351 2871724158 232
457 iso_pu_bacteria 2889290771 2889295208 232
458 iso_pu_bacteria 2898713307 2898713989 232
459 iso_pu_bacteria 2905999023 2906000103 232
460 iso_pu_bacteria 2919399522 2919403791 232
461 iso_pu_bacteria 2946019816 2946022745 232
462 3300005457 Ga0070662_100277722 Ga0070662_1002777222 233
463 3300005539 Ga0068853_100447454 Ga0068853_1004474542 233
464 3300009011 Ga0105251_10000582 Ga0105251_1000058212 233
465 3300009101 Ga0105247_10000187 Ga0105247_1000018755 233
466 3300013100 Ga0157373_10092599 Ga0157373_100925992 233
467 3300013307 Ga0157372_10519451 Ga0157372_105194512 233
468 3300025919 Ga0207657_10053741 Ga0207657_100537413 233
469 3300025932 Ga0207690_10022251 Ga0207690_100222513 233
470 3300025932 Ga0207690_10273457 Ga0207690_102734572 233
471 3300026041 Ga0207639_10027657 Ga0207639_100276572 233
472 3300026118 Ga0207675_100099700 Ga0207675_1000997002 233
473 3300046453 Ga0495627_000141 Ga0495627_000141_19128_19832 233
474 3300048919 Ga0496116_0000031 Ga0496116_0000031_124395_125099 233
475 3300048920 Ga0496117_0019969 Ga0496117_0019969_3531_4235 233
476 3300048921 Ga0496118_0085794 Ga0496118_0085794_427_1131 233
477 3300048922 Ga0496119_0014218 Ga0496119_0014218_3505_4209 233
478 3300048929 Ga0496126_0281066 Ga0496126_0281066_276_995 233
479 iso_pu_bacteria 2585428060 2587746246 233
480 iso_pu_bacteria 2585428187 2588232868 233
481 iso_pu_bacteria 2588253712 2588443990 233
482 iso_pu_bacteria 2588254257 2590609243 233
483 iso_pu_bacteria 2775506739 2775671904 233
484 iso_pu_bacteria 2919097161 2919098657 233
485 3300002737 JGI25162J39368_1001495 JGI25162J39368_10014957 234
486 3300002737 JGI25162J39368_1002049 JGI25162J39368_10020492 234
487 3300002741 JGI25157J39369_1000342 JGI25157J39369_100034210 234
488 3300002772 JGI25164J39214_1000738 JGI25164J39214_10007385 234
489 3300002772 JGI25164J39214_1000760 JGI25164J39214_10007607 234
490 3300003214 JGI25165J46597_1001490 JGI25165J46597_10014904 234
491 3300003214 JGI25165J46597_1001854 JGI25165J46597_10018544 234
492 3300005435 Ga0070714_100056798 Ga0070714_1000567982 234
493 3300005436 Ga0070713_100228091 Ga0070713_1002280912 234
494 3300005617 Ga0068859_100021239 Ga0068859_1000212393 234
495 3300005617 Ga0068859_100393256 Ga0068859_1003932561 234
496 3300005843 Ga0068860_100043493 Ga0068860_1000434932 234
497 3300005844 Ga0068862_100385881 Ga0068862_1003858812 234
498 3300006175 Ga0070712_100235479 Ga0070712_1002354791 234
499 3300006880 Ga0075429_100048420 Ga0075429_1000484202 234
500 3300006931 Ga0097620_100021236 Ga0097620_1000212363 234
501 3300006931 Ga0097620_100393241 Ga0097620_1003932411 234
502 3300007076 Ga0075435_100167749 Ga0075435_1001677493 234
503 3300009094 Ga0111539_10006397 Ga0111539_1000639711 234
504 3300013105 Ga0157369_10487808 Ga0157369_104878082 234
505 3300015262 Ga0182007_10002958 Ga0182007_100029587 234
506 3300025226 Ga0209674_100598 Ga0209674_1005984 234
507 3300025231 Ga0207427_100105 Ga0207427_10010510 234
508 3300025231 Ga0207427_100107 Ga0207427_1001075 234
509 3300025233 Ga0209437_100039 Ga0209437_100039108 234
510 3300025233 Ga0209437_100129 Ga0209437_10012974 234
511 3300025250 Ga0209026_1000051 Ga0209026_1000051123 234
512 3300025261 Ga0209233_1000224 Ga0209233_100022487 234
513 3300025261 Ga0209233_1000447 Ga0209233_100044710 234
514 3300025915 Ga0207693_10053702 Ga0207693_100537023 234
515 3300025928 Ga0207700_10272437 Ga0207700_102724372 234
516 3300025929 Ga0207664_10164548 Ga0207664_101645482 234
517 3300025961 Ga0207712_10081944 Ga0207712_100819442 234
518 3300026116 Ga0207674_10701524 Ga0207674_107015241 234
519 3300027907 Ga0207428_10038931 Ga0207428_100389313 234
520 3300028380 Ga0268265_10036989 Ga0268265_100369892 234
521 3300028381 Ga0268264_10054629 Ga0268264_100546292 234
522 3300031344 Ga0265316_10093487 Ga0265316_100934873 234
523 3300046674 Ga0495588_0048265 Ga0495588_0048265_820_1524 234
524 3300050508 nmdc:mga09592_37007_c1 nmdc:mga09592_37007_c1_2657_3361 234
525 3300050509 nmdc:mga0qj67_244258_c1 nmdc:mga0qj67_244258_c1_157_861 234
526 3300050511 nmdc:mga08y16_43526_c1 nmdc:mga08y16_43526_c1_2800_3504 234
527 3300053139 Ga0500568_0034536 Ga0500568_0034536_28_732 234
528 3300053153 Ga0500616_0000019 Ga0500616_0000019_431507_432211 234
529 3300005329 Ga0070683_100007566 Ga0070683_1000075667 235
530 3300005535 Ga0070684_100007379 Ga0070684_1000073797 235
531 3300005548 Ga0070665_100180269 Ga0070665_1001802692 235
532 3300025944 Ga0207661_10001327 Ga0207661_100013276 235
533 3300028379 Ga0268266_10093764 Ga0268266_100937642 235
534 3300031911 Ga0307412_10001339 Ga0307412_1000133911 235
535 3300035118 Ga0373954_0031178 Ga0373954_0031178_1231_1947 235
536 3300042004 Ga0439445_0000288 Ga0439445_0000288_847_1578 235
537 3300046454 Ga0495592_0004704 Ga0495592_0004704_6946_7662 235
538 3300046460 Ga0495638_0000328 Ga0495638_0000328_35054_35782 235
539 3300046474 Ga0495605_0000394 Ga0495605_0000394_14706_15434 235
540 3300046501 Ga0495607_0217499 Ga0495607_0217499_49_777 235
541 3300046506 Ga0495583_0000310 Ga0495583_0000310_39884_40612 235
542 3300046516 Ga0495628_0006322 Ga0495628_0006322_1480_2196 235
543 3300046516 Ga0495628_0579662 Ga0495628_0579662_19_735 235
544 3300046523 Ga0495644_0000799 Ga0495644_0000799_10755_11483 235
545 3300046524 Ga0495648_0023475 Ga0495648_0023475_2321_3049 235
546 3300046529 Ga0495652_0037267 Ga0495652_0037267_2038_2754 235
547 3300046536 Ga0495587_0045421 Ga0495587_0045421_43_759 235
548 3300046538 Ga0495609_0005147 Ga0495609_0005147_6189_6917 235
549 3300046543 Ga0495645_0027047 Ga0495645_0027047_1622_2338 235
550 3300046660 Ga0495625_0062950 Ga0495625_0062950_489_1217 235
551 3300046664 Ga0495659_0002117 Ga0495659_0002117_3959_4687 235
552 3300046665 Ga0495661_0043077 Ga0495661_0043077_274_1002 235
553 3300046678 Ga0495599_0001707 Ga0495599_0001707_10706_11422 235
554 3300047318 Ga0495636_0001345 Ga0495636_0001345_3947_4675 235
555 3300047323 Ga0495683_0000472 Ga0495683_0000472_21941_22669 235
556 3300047443 Ga0495687_000370 Ga0495687_000370_36583_37311 235
557 3300047445 Ga0495677_0009318 Ga0495677_0009318_1500_2228 235
558 3300047446 Ga0495679_057429 Ga0495679_057429_222_950 235
559 3300047447 Ga0495685_000091 Ga0495685_000091_27892_28620 235
560 3300047469 Ga0495673_0004212 Ga0495673_0004212_3125_3853 235
561 3300047472 Ga0495686_0124293 Ga0495686_0124293_608_1336 235
562 3300049459 Ga0495678_016990 Ga0495678_016990_303_1031 235
563 3300049460 Ga0495682_0000836 Ga0495682_0000836_5742_6470 235
564 3300053077 Ga0495601_0026240 Ga0495601_0026240_1932_2648 235
565 3300003322 rootL2_10155819 rootL2_101558195 236
566 3300003323 rootH1_10075165 rootH1_1007516511 236
567 3300005289 Ga0065704_10074548 Ga0065704_100745486 236
568 3300005337 Ga0070682_100000474 Ga0070682_10000047423 236
569 3300005339 Ga0070660_100650995 Ga0070660_1006509951 236
570 3300009036 Ga0105244_10000001 Ga0105244_10000001449 236
571 3300009148 Ga0105243_10000471 Ga0105243_1000047120 236
572 3300013104 Ga0157370_10013507 Ga0157370_1001350711 236
573 3300015261 Ga0182006_1000003 Ga0182006_1000003386 236
574 3300025291 Ga0209675_1000077 Ga0209675_1000077136 236
575 3300025728 Ga0207655_1000013 Ga0207655_1000013575 236
576 3300025935 Ga0207709_10000161 Ga0207709_1000016161 236
577 3300031911 Ga0307412_10000096 Ga0307412_1000009644 236
578 3300032002 Ga0307416_100000017 Ga0307416_10000001717 236
579 3300032004 Ga0307414_10010449 Ga0307414_100104495 236
580 3300046500 Ga0495596_0006258 Ga0495596_0006258_3119_3838 236
581 3300046512 Ga0495610_0000006 Ga0495610_0000006_478011_478730 236
582 3300048905 Ga0496102_0778275 Ga0496102_0778275_68_787 236
583 3300048908 Ga0496105_0477587 Ga0496105_0477587_42_761 236
584 3300048919 Ga0496116_0000006 Ga0496116_0000006_15328_16047 236
585 3300048920 Ga0496117_0000027 Ga0496117_0000027_340294_341013 236
586 3300048921 Ga0496118_0000141 Ga0496118_0000141_23366_24085 236
587 3300048922 Ga0496119_0000006 Ga0496119_0000006_249081_249800 236
588 3300048923 Ga0496120_0083671 Ga0496120_0083671_538_1257 236
589 3300048925 Ga0496122_0001702 Ga0496122_0001702_18532_19251 236
590 3300048925 Ga0496122_0002499 Ga0496122_0002499_20595_21314 236
591 3300048926 Ga0496123_0003689 Ga0496123_0003689_11896_12615 236
592 3300048926 Ga0496123_0021618 Ga0496123_0021618_1155_1874 236
593 3300048927 Ga0496124_0005070 Ga0496124_0005070_13722_14441 236
594 3300048928 Ga0496125_0001071 Ga0496125_0001071_38362_39081 236
595 3300048928 Ga0496125_0003176 Ga0496125_0003176_3137_3856 236
596 3300048929 Ga0496126_0001395 Ga0496126_0001395_24498_25217 236
597 3300048929 Ga0496126_0152582 Ga0496126_0152582_190_909 236
598 3300050508 nmdc:mga09592_465938_c1 nmdc:mga09592_465938_c1_14_724 236
599 3300050510 nmdc:mga06r32_741098_c1 nmdc:mga06r32_741098_c1_220_930 236
600 3300005530 Ga0070679_100017929 Ga0070679_1000179297 237
601 3300005840 Ga0068870_10485655 Ga0068870_104856551 237
602 3300006844 Ga0075428_100388793 Ga0075428_1003887932 237
603 3300009094 Ga0111539_10066977 Ga0111539_100669771 237
604 3300013308 Ga0157375_10081196 Ga0157375_100811962 237
605 3300039438 Ga0436360_1098059 Ga0436360_1098059_1096_1833 237
606 3300046453 Ga0495627_004584 Ga0495627_004584_766_1503 237
607 3300046460 Ga0495638_0104420 Ga0495638_0104420_65_802 237
608 3300046474 Ga0495605_0025478 Ga0495605_0025478_1442_2203 237
609 3300046491 Ga0495584_0003609 Ga0495584_0003609_5372_6133 237
610 3300046501 Ga0495607_0006847 Ga0495607_0006847_3602_4363 237
611 3300046519 Ga0495632_0000601 Ga0495632_0000601_16732_17469 237
612 3300046524 Ga0495648_0003241 Ga0495648_0003241_1344_2105 237
613 3300046530 Ga0495654_0000006 Ga0495654_0000006_27863_28600 237
614 3300046530 Ga0495654_0002624 Ga0495654_0002624_7336_8097 237
615 3300046558 Ga0495633_0002549 Ga0495633_0002549_11878_12615 237
616 3300046660 Ga0495625_0001048 Ga0495625_0001048_17689_18426 237
617 3300046810 Ga0495660_0186080 Ga0495660_0186080_179_916 237
618 3300047320 Ga0495672_0000003 Ga0495672_0000003_61713_62474 237
619 3300047472 Ga0495686_0003986 Ga0495686_0003986_11435_12172 237
620 3300048927 Ga0496124_0186194 Ga0496124_0186194_173_910 237
621 3300049758 Ga0501241_000003 Ga0501241_000003_135696_136433 237
622 3300049766 Ga0501269_000050 Ga0501269_000050_13485_14222 237
623 3300005329 Ga0070683_100505607 Ga0070683_1005056072 238
624 3300005334 Ga0068869_100015418 Ga0068869_1000154184 238
625 3300005355 Ga0070671_100341699 Ga0070671_1003416992 238
626 3300005530 Ga0070679_100196955 Ga0070679_1001969553 238
627 3300005548 Ga0070665_100041910 Ga0070665_1000419104 238
628 3300005548 Ga0070665_100082250 Ga0070665_1000822503 238
629 3300005548 Ga0070665_100117248 Ga0070665_1001172484 238
630 3300005548 Ga0070665_100754776 Ga0070665_1007547762 238
631 3300005563 Ga0068855_100013263 Ga0068855_10001326310 238
632 3300005563 Ga0068855_100634742 Ga0068855_1006347422 238
633 3300005841 Ga0068863_100081804 Ga0068863_1000818045 238
634 3300005842 Ga0068858_100015795 Ga0068858_1000157959 238
635 3300009093 Ga0105240_10003716 Ga0105240_1000371617 238
636 3300009093 Ga0105240_10005607 Ga0105240_100056071 238
637 3300009093 Ga0105240_10006293 Ga0105240_100062934 238
638 3300009093 Ga0105240_10061165 Ga0105240_100611658 238
639 3300009093 Ga0105240_10074105 Ga0105240_100741055 238
640 3300009177 Ga0105248_10064863 Ga0105248_100648634 238
641 3300009545 Ga0105237_10115769 Ga0105237_101157693 238
642 3300009545 Ga0105237_10229381 Ga0105237_102293812 238
643 3300009551 Ga0105238_10053835 Ga0105238_100538353 238
644 3300009551 Ga0105238_10074565 Ga0105238_100745652 238
645 3300010375 Ga0105239_10051580 Ga0105239_100515805 238
646 3300010375 Ga0105239_10105428 Ga0105239_101054284 238
647 3300010375 Ga0105239_10110765 Ga0105239_101107652 238
648 3300010375 Ga0105239_10116732 Ga0105239_101167323 238
649 3300010375 Ga0105239_10617904 Ga0105239_106179042 238
650 3300013105 Ga0157369_10255028 Ga0157369_102550283 238
651 3300013296 Ga0157374_10378805 Ga0157374_103788052 238
652 3300013307 Ga0157372_10799439 Ga0157372_107994392 238
653 3300013307 Ga0157372_11410881 Ga0157372_114108811 238
654 3300014969 Ga0157376_10430607 Ga0157376_104306071 238
655 3300025912 Ga0207707_10185830 Ga0207707_101858303 238
656 3300025913 Ga0207695_10006958 Ga0207695_100069588 238
657 3300025913 Ga0207695_10014188 Ga0207695_100141885 238
658 3300025913 Ga0207695_10069147 Ga0207695_100691474 238
659 3300025913 Ga0207695_10109815 Ga0207695_101098152 238
660 3300025914 Ga0207671_10073666 Ga0207671_100736662 238
661 3300025914 Ga0207671_10167782 Ga0207671_101677822 238
662 3300025917 Ga0207660_10083820 Ga0207660_100838204 238
663 3300025921 Ga0207652_10250881 Ga0207652_102508811 238
664 3300025921 Ga0207652_10309266 Ga0207652_103092662 238
665 3300025924 Ga0207694_10539477 Ga0207694_105394772 238
666 3300025938 Ga0207704_10039218 Ga0207704_100392182 238
667 3300025941 Ga0207711_10064678 Ga0207711_100646785 238
668 3300025942 Ga0207689_10104860 Ga0207689_101048602 238
669 3300025944 Ga0207661_10151832 Ga0207661_101518322 238
670 3300025949 Ga0207667_10001671 Ga0207667_1000167118 238
671 3300025949 Ga0207667_10169277 Ga0207667_101692772 238
672 3300025949 Ga0207667_10571675 Ga0207667_105716752 238
673 3300025961 Ga0207712_10008695 Ga0207712_100086954 238
674 3300026035 Ga0207703_10120128 Ga0207703_101201282 238
675 3300026041 Ga0207639_10022786 Ga0207639_100227865 238
676 3300026088 Ga0207641_10126045 Ga0207641_101260452 238
677 3300026089 Ga0207648_10468805 Ga0207648_104688051 238
678 3300026116 Ga0207674_10088512 Ga0207674_100885123 238
679 3300026116 Ga0207674_10277185 Ga0207674_102771852 238
680 3300026116 Ga0207674_10344350 Ga0207674_103443503 238
681 3300028379 Ga0268266_10033124 Ga0268266_100331243 238
682 3300028379 Ga0268266_10065765 Ga0268266_100657655 238
683 3300028379 Ga0268266_10072942 Ga0268266_100729423 238
684 3300028379 Ga0268266_10413924 Ga0268266_104139242 238
685 3300028381 Ga0268264_10369170 Ga0268264_103691702 238
686 3300031238 Ga0265332_10065200 Ga0265332_100652002 238
687 3300031249 Ga0265339_10067611 Ga0265339_100676113 238
688 3300031250 Ga0265331_10029577 Ga0265331_100295774 238
689 3300031595 Ga0265313_10147932 Ga0265313_101479321 238
690 3300031711 Ga0265314_10008385 Ga0265314_100083858 238
691 3300033180 Ga0307510_10377122 Ga0307510_103771221 238
692 3300035086 Ga0373934_0086340 Ga0373934_0086340_147_872 238
693 3300035111 Ga0373923_0225851 Ga0373923_0225851_21_782 238
694 3300035113 Ga0373936_0057196 Ga0373936_0057196_307_1068 238
695 3300035170 Ga0373943_0033981 Ga0373943_0033981_675_1436 238
696 3300035172 Ga0373955_0108442 Ga0373955_0108442_758_1519 238
697 3300035410 Ga0373924_0002259 Ga0373924_0002259_5105_5866 238
698 3300035692 Ga0373935_0107250 Ga0373935_0107250_154_915 238
699 3300035724 Ga0373933_0010447 Ga0373933_0010447_1466_2227 238
700 3300036401 Ga0373937_0001034 Ga0373937_0001034_18857_19618 238
701 3300036401 Ga0373937_0211881 Ga0373937_0211881_93_848 238
702 3300037068 Ga0373925_0304909 Ga0373925_0304909_239_1000 238
703 3300037312 Ga0395899_0042250 Ga0395899_0042250_1045_1761 238
704 3300046454 Ga0495592_0062411 Ga0495592_0062411_620_1381 238
705 3300046463 Ga0495653_0196397 Ga0495653_0196397_524_1285 238
706 3300046511 Ga0495608_0011280 Ga0495608_0011280_2205_2966 238
707 3300046529 Ga0495652_0347124 Ga0495652_0347124_28_789 238
708 3300046536 Ga0495587_0027599 Ga0495587_0027599_488_1249 238
709 3300046536 Ga0495587_0322659 Ga0495587_0322659_40_756 238
710 3300046538 Ga0495609_0107445 Ga0495609_0107445_313_1029 238
711 3300046559 Ga0495667_0014488 Ga0495667_0014488_2074_2835 238
712 3300047319 Ga0495674_0354855 Ga0495674_0354855_242_958 238
713 3300047322 Ga0495680_0082993 Ga0495680_0082993_839_1600 238
714 3300048925 Ga0496122_0023172 Ga0496122_0023172_3540_4280 238
715 3300048929 Ga0496126_0138838 Ga0496126_0138838_65_781 238
716 3300049570 Ga0501033_0052608 Ga0501033_0052608_427_1143 238
717 3300049570 Ga0501033_0207987 Ga0501033_0207987_338_1054 238
718 3300049571 Ga0501034_0253758 Ga0501034_0253758_795_1511 238
719 3300049572 Ga0501036_0171871 Ga0501036_0171871_853_1569 238
720 3300049572 Ga0501036_0185232 Ga0501036_0185232_778_1494 238
721 3300049573 Ga0501037_0219025 Ga0501037_0219025_123_839 238
722 3300049573 Ga0501037_0375071 Ga0501037_0375071_157_873 238
723 3300049575 Ga0501039_0221456 Ga0501039_0221456_327_1043 238
724 3300049577 Ga0501041_0189193 Ga0501041_0189193_146_889 238
725 3300049579 Ga0501043_0025691 Ga0501043_0025691_367_1083 238
726 3300049579 Ga0501043_0039241 Ga0501043_0039241_1886_2602 238
727 3300049580 Ga0501046_0255728 Ga0501046_0255728_462_1205 238
728 3300049581 Ga0501047_0130481 Ga0501047_0130481_1350_2066 238
729 3300049581 Ga0501047_0144310 Ga0501047_0144310_1219_1935 238
730 3300049581 Ga0501047_0423529 Ga0501047_0423529_103_819 238
731 3300049584 Ga0501068_0104582 Ga0501068_0104582_761_1504 238
732 3300049586 Ga0501070_0721142 Ga0501070_0721142_28_744 238
733 3300049587 Ga0501071_0011773 Ga0501071_0011773_5157_5882 238
734 3300049589 Ga0501073_0036993 Ga0501073_0036993_712_1428 238
735 3300049589 Ga0501073_0124613 Ga0501073_0124613_502_1218 238
736 3300049590 Ga0501074_0433317 Ga0501074_0433317_94_810 238
737 3300049741 Ga0501079_0111438 Ga0501079_0111438_664_1407 238
738 3300049742 Ga0501080_0154465 Ga0501080_0154465_381_1097 238
739 3300049742 Ga0501080_0399862 Ga0501080_0399862_261_977 238
740 3300049743 Ga0501081_0141157 Ga0501081_0141157_15_758 238
741 3300049823 Ga0501044_0459709 Ga0501044_0459709_283_999 238
742 3300053077 Ga0495601_0096987 Ga0495601_0096987_607_1368 238
743 3300053085 Ga0495619_0022615 Ga0495619_0022615_1665_2426 238
744 3300053130 Ga0500642_0077572 Ga0500642_0077572_555_1271 238
745 3300053730 Ga0500645_012815 Ga0500645_012815_584_1300 238
746 3300060353 Ga0501082_0067389 Ga0501082_0067389_1116_1859 238
747 3300005339 Ga0070660_100266428 Ga0070660_1002664281 239
748 3300005445 Ga0070708_100373407 Ga0070708_1003734072 239
749 3300005468 Ga0070707_100176789 Ga0070707_1001767892 239
750 3300005518 Ga0070699_100323386 Ga0070699_1003233862 239
751 3300006177 Ga0075362_10062829 Ga0075362_100628292 239
752 3300006195 Ga0075366_10011548 Ga0075366_100115484 239
753 3300006852 Ga0075433_10027568 Ga0075433_100275685 239
754 3300014745 Ga0157377_10509041 Ga0157377_105090411 239
755 3300025315 Ga0207697_10021800 Ga0207697_100218002 239
756 3300025939 Ga0207665_10160044 Ga0207665_101600441 239
757 3300005327 Ga0070658_10504740 Ga0070658_105047402 240
758 3300005330 Ga0070690_100482899 Ga0070690_1004828991 240
759 3300005335 Ga0070666_10067052 Ga0070666_100670521 240
760 3300005354 Ga0070675_100009783 Ga0070675_1000097832 240
761 3300005366 Ga0070659_100714914 Ga0070659_1007149141 240
762 3300005456 Ga0070678_100103126 Ga0070678_1001031262 240
763 3300005457 Ga0070662_100135810 Ga0070662_1001358102 240
764 3300005459 Ga0068867_100615026 Ga0068867_1006150261 240
765 3300005564 Ga0070664_100012064 Ga0070664_1000120645 240
766 3300005616 Ga0068852_100064778 Ga0068852_1000647782 240
767 3300005618 Ga0068864_100504502 Ga0068864_1005045022 240
768 3300005841 Ga0068863_100153171 Ga0068863_1001531714 240
769 3300005842 Ga0068858_100003390 Ga0068858_10000339012 240
770 3300013296 Ga0157374_10003724 Ga0157374_1000372412 240
771 3300013297 Ga0157378_10046120 Ga0157378_100461203 240
772 3300014325 Ga0163163_10006926 Ga0163163_100069265 240
773 3300025903 Ga0207680_10052911 Ga0207680_100529112 240
774 3300025920 Ga0207649_10084596 Ga0207649_100845962 240
775 3300025925 Ga0207650_10008966 Ga0207650_100089663 240
776 3300025931 Ga0207644_10002078 Ga0207644_1000207812 240
777 3300025932 Ga0207690_10648375 Ga0207690_106483751 240
778 3300025933 Ga0207706_10002872 Ga0207706_100028727 240
779 3300025941 Ga0207711_10005419 Ga0207711_100054193 240
780 3300025945 Ga0207679_10178036 Ga0207679_101780362 240
781 3300025960 Ga0207651_10016407 Ga0207651_100164073 240
782 3300026035 Ga0207703_10017041 Ga0207703_100170412 240
783 3300026088 Ga0207641_10010646 Ga0207641_100106465 240
784 3300026088 Ga0207641_10592141 Ga0207641_105921411 240
785 3300026089 Ga0207648_10484125 Ga0207648_104841251 240
786 3300026095 Ga0207676_10303498 Ga0207676_103034981 240
787 3300026121 Ga0207683_10184790 Ga0207683_101847902 240
788 3300026142 Ga0207698_10067524 Ga0207698_100675242 240
789 3300028379 Ga0268266_10231525 Ga0268266_102315252 240
790 3300046530 Ga0495654_0018562 Ga0495654_0018562_551_1303 240
791 3300046558 Ga0495633_0007833 Ga0495633_0007833_5150_5902 240
792 3300046683 Ga0495658_0466913 Ga0495658_0466913_59_784 240
793 3300048911 Ga0496108_0030955 Ga0496108_0030955_3091_3813 240
794 3300048912 Ga0496109_0251756 Ga0496109_0251756_926_1648 240
795 3300048914 Ga0496111_0218620 Ga0496111_0218620_665_1387 240
796 iso_pu_bacteria 8057101203 8057102843 240
797 3300005293 Ga0065715_10003421 Ga0065715_100034211 241
798 3300005355 Ga0070671_100545243 Ga0070671_1005452431 241
799 3300006880 Ga0075429_100507462 Ga0075429_1005074621 241
800 3300006914 Ga0075436_100175287 Ga0075436_1001752872 241
801 3300009094 Ga0111539_10189811 Ga0111539_101898111 241
802 3300012510 Ga0157316_1003325 Ga0157316_10033251 241
803 3300013296 Ga0157374_10157142 Ga0157374_101571423 241
804 3300025302 Ga0207426_1026348 Ga0207426_10263483 241
805 3300025931 Ga0207644_10421341 Ga0207644_104213411 241
806 3300025936 Ga0207670_10234084 Ga0207670_102340842 241
807 3300039437 Ga0436365_0001623 Ga0436365_0001623_865_1590 241
808 3300039438 Ga0436360_0137000 Ga0436360_0137000_1785_2516 241
809 3300039447 Ga0436361_1030428 Ga0436361_1030428_289_1014 241
810 3300044658 Ga0466972_0123062 Ga0466972_0123062_333_1079 241
811 3300044693 Ga0466961_0000412 Ga0466961_0000412_5419_6165 241
812 3300044694 Ga0466963_0051014 Ga0466963_0051014_920_1648 241
813 3300044706 Ga0466964_0111020 Ga0466964_0111020_53_799 241
814 3300046457 Ga0495590_0000020 Ga0495590_0000020_43392_44117 241
815 3300046458 Ga0495591_001616 Ga0495591_001616_6185_6964 241
816 3300046471 Ga0495650_0003366 Ga0495650_0003366_2626_3405 241
817 3300046507 Ga0495606_0001121 Ga0495606_0001121_17075_17854 241
818 3300046522 Ga0495643_0000519 Ga0495643_0000519_37807_38532 241
819 3300046523 Ga0495644_0002833 Ga0495644_0002833_2569_3348 241
820 3300046542 Ga0495597_0000262 Ga0495597_0000262_37800_38525 241
821 3300046616 Ga0495668_0000888 Ga0495668_0000888_30747_31472 241
822 3300046691 Ga0495670_0176018 Ga0495670_0176018_98_823 241
823 3300046692 Ga0495671_0004751 Ga0495671_0004751_3263_4042 241
824 3300046810 Ga0495660_0000019 Ga0495660_0000019_249092_249871 241
825 3300046810 Ga0495660_0109464 Ga0495660_0109464_668_1393 241
826 3300047469 Ga0495673_0000011 Ga0495673_0000011_611505_612284 241
827 3300048904 Ga0496101_0436596 Ga0496101_0436596_154_909 241
828 3300048909 Ga0496106_0389667 Ga0496106_0389667_324_1079 241
829 3300049460 Ga0495682_0003245 Ga0495682_0003245_4545_5321 241
830 3300050493 nmdc:mga0k408_3418_c1 nmdc:mga0k408_3418_c1_4441_5235 241
831 3300005328 Ga0070676_10235689 Ga0070676_102356892 242
832 3300005340 Ga0070689_100091651 Ga0070689_1000916511 242
833 3300005354 Ga0070675_100864699 Ga0070675_1008646991 242
834 3300005456 Ga0070678_100380653 Ga0070678_1003806531 242
835 3300005548 Ga0070665_100310869 Ga0070665_1003108692 242
836 3300005617 Ga0068859_100468269 Ga0068859_1004682691 242
837 3300005985 Ga0081539_10026051 Ga0081539_100260513 242
838 3300006931 Ga0097620_100468260 Ga0097620_1004682602 242
839 3300009093 Ga0105240_10661509 Ga0105240_106615091 242
840 3300009545 Ga0105237_10194727 Ga0105237_101947273 242
841 3300021361 Ga0213872_10045192 Ga0213872_100451922 242
842 3300021441 Ga0213871_10001458 Ga0213871_100014582 242
843 3300025908 Ga0207643_10108622 Ga0207643_101086222 242
844 3300025925 Ga0207650_10277875 Ga0207650_102778752 242
845 3300025936 Ga0207670_10031541 Ga0207670_100315411 242
846 3300025940 Ga0207691_10159650 Ga0207691_101596502 242
847 3300026121 Ga0207683_10146798 Ga0207683_101467983 242
848 3300028379 Ga0268266_10579678 Ga0268266_105796781 242
849 3300031901 Ga0307406_10210179 Ga0307406_102101792 242
850 3300031995 Ga0307409_100270971 Ga0307409_1002709713 242
851 3300032005 Ga0307411_10612860 Ga0307411_106128601 242
852 3300032126 Ga0307415_100977160 Ga0307415_1009771601 242
853 3300035117 Ga0373953_0029245 Ga0373953_0029245_11_784 242
854 3300039438 Ga0436360_0386428 Ga0436360_0386428_249_977 242
855 3300039447 Ga0436361_0041018 Ga0436361_0041018_1035_1763 242
856 3300046507 Ga0495606_0000326 Ga0495606_0000326_27377_28129 242
857 3300046543 Ga0495645_0334436 Ga0495645_0334436_231_968 242
858 3300048922 Ga0496119_0115941 Ga0496119_0115941_250_1002 242
859 3300048923 Ga0496120_0040527 Ga0496120_0040527_1671_2423 242
860 3300048925 Ga0496122_0000229 Ga0496122_0000229_55469_56215 242
861 3300048925 Ga0496122_0000397 Ga0496122_0000397_63270_64016 242
862 3300048925 Ga0496122_0074132 Ga0496122_0074132_306_1058 242
863 3300048926 Ga0496123_0023894 Ga0496123_0023894_856_1608 242
864 3300049580 Ga0501046_0109734 Ga0501046_0109734_299_1027 242
865 3300049581 Ga0501047_0065745 Ga0501047_0065745_1849_2577 242
866 3300053077 Ga0495601_0017419 Ga0495601_0017419_3343_4080 242
867 iso_pu_bacteria 2881412998 2881418509 242
868 3300009094 Ga0111539_11009104 Ga0111539_110091041 243
869 3300014969 Ga0157376_10708376 Ga0157376_107083761 243
870 3300021361 Ga0213872_10083172 Ga0213872_100831721 243
871 3300025303 Ga0209051_1003306 Ga0209051_10033061 243
872 3300035241 Ga0373961_0082419 Ga0373961_0082419_67_798 243
873 3300035724 Ga0373933_0210819 Ga0373933_0210819_63_794 243
874 3300039438 Ga0436360_0708149 Ga0436360_0708149_49_780 243
875 3300039438 Ga0436360_0824430 Ga0436360_0824430_180_911 243
876 3300039447 Ga0436361_0785765 Ga0436361_0785765_34_765 243
877 3300050507 nmdc:mga05p37_125234_c1 nmdc:mga05p37_125234_c1_2014_2784 243
878 3300050508 nmdc:mga09592_235446_c1 nmdc:mga09592_235446_c1_267_1037 243
879 3300050511 nmdc:mga08y16_860711_c1 nmdc:mga08y16_860711_c1_150_884 243
880 3300053116 Ga0500592_000252 Ga0500592_000252_3803_4534 243
881 3300005445 Ga0070708_100370732 Ga0070708_1003707321 244
882 3300005563 Ga0068855_100002346 Ga0068855_10000234610 244
883 3300005564 Ga0070664_100145424 Ga0070664_1001454243 244
884 3300005614 Ga0068856_100010356 Ga0068856_1000103562 244
885 3300009093 Ga0105240_10005746 Ga0105240_1000574612 244
886 3300009174 Ga0105241_10348406 Ga0105241_103484062 244
887 3300009545 Ga0105237_10006745 Ga0105237_100067458 244
888 3300013105 Ga0157369_10005191 Ga0157369_1000519113 244
889 3300013296 Ga0157374_10044152 Ga0157374_100441524 244
890 3300014326 Ga0157380_10307547 Ga0157380_103075473 244
891 3300025916 Ga0207663_10226086 Ga0207663_102260861 244
892 3300025920 Ga0207649_10180123 Ga0207649_101801232 244
893 3300025923 Ga0207681_10355577 Ga0207681_103555771 244
894 3300025933 Ga0207706_10305056 Ga0207706_103050562 244
895 3300025945 Ga0207679_10100194 Ga0207679_101001943 244
896 3300025949 Ga0207667_10008952 Ga0207667_100089524 244
897 3300026041 Ga0207639_10034078 Ga0207639_100340782 244
898 3300027671 Ga0209588_1073225 Ga0209588_10732252 244
899 3300037471 Ga0395905_0417365 Ga0395905_0417365_324_1058 244
900 3300039438 Ga0436360_0469655 Ga0436360_0469655_3013_3750 244
901 3300039450 Ga0436363_0387766 Ga0436363_0387766_254_991 244
902 3300039450 Ga0436363_1671843 Ga0436363_1671843_135_872 244
903 3300046675 Ga0495657_0017206 Ga0495657_0017206_3576_4319 244
904 3300047322 Ga0495680_0102926 Ga0495680_0102926_906_1649 244
905 3300048903 Ga0496100_0021624 Ga0496100_0021624_2157_2891 244
906 3300048907 Ga0496104_0004551 Ga0496104_0004551_425_1159 244
907 3300048908 Ga0496105_0007863 Ga0496105_0007863_6735_7469 244
908 3300048910 Ga0496107_0158962 Ga0496107_0158962_29_763 244
909 3300048917 Ga0496114_0129947 Ga0496114_0129947_447_1181 244
910 3300048918 Ga0496115_0014454 Ga0496115_0014454_1807_2541 244
911 3300053085 Ga0495619_0047926 Ga0495619_0047926_243_986 244
912 3300003759 Ga0055525_1000146 Ga0055525_10001467 245
913 3300003760 Ga0055527_1000074 Ga0055527_100007430 245
914 3300003761 Ga0055535_1000372 Ga0055535_10003724 245
915 3300003762 Ga0055542_1000168 Ga0055542_100016830 245
916 3300003763 Ga0055529_1000543 Ga0055529_10005432 245
917 3300005436 Ga0070713_100032163 Ga0070713_1000321633 245
918 3300005439 Ga0070711_100188716 Ga0070711_1001887161 245
919 3300005614 Ga0068856_100724484 Ga0068856_1007244841 245
920 3300006028 Ga0070717_10001018 Ga0070717_100010187 245
921 3300006175 Ga0070712_100003184 Ga0070712_10000318411 245
922 3300009101 Ga0105247_10208835 Ga0105247_102088351 245
923 3300010375 Ga0105239_10044969 Ga0105239_100449692 245
924 3300014968 Ga0157379_10533521 Ga0157379_105335212 245
925 3300025228 Ga0209672_100007 Ga0209672_100007642 245
926 3300025230 Ga0209563_100131 Ga0209563_10013179 245
927 3300025242 Ga0209258_100017 Ga0209258_100017178 245
928 3300025254 Ga0209148_1000044 Ga0209148_1000044180 245
929 3300025272 Ga0209455_1000010 Ga0209455_1000010642 245
930 3300025900 Ga0207710_10172342 Ga0207710_101723422 245
931 3300025909 Ga0207705_10002381 Ga0207705_1000238110 245
932 3300025913 Ga0207695_10283680 Ga0207695_102836802 245
933 3300025916 Ga0207663_10084177 Ga0207663_100841772 245
934 3300028379 Ga0268266_10000420 Ga0268266_1000042022 245
935 3300037853 Ga0436364_0089220 Ga0436364_0089220_145_885 245
936 3300046472 Ga0495580_0128834 Ga0495580_0128834_608_1360 245
937 3300046492 Ga0495585_0000001 Ga0495585_0000001_205824_206561 245
938 3300046516 Ga0495628_0218511 Ga0495628_0218511_41_793 245
939 3300046518 Ga0495631_0000078 Ga0495631_0000078_4570_5307 245
940 3300046524 Ga0495648_0000990 Ga0495648_0000990_18275_19012 245
941 3300046665 Ga0495661_0000104 Ga0495661_0000104_12363_13100 245
942 3300046689 Ga0495613_0180728 Ga0495613_0180728_15_767 245
943 3300047471 Ga0495684_0047674 Ga0495684_0047674_473_1225 245
944 3300048929 Ga0496126_0067076 Ga0496126_0067076_851_1588 245
945 3300048929 Ga0496126_0110835 Ga0496126_0110835_925_1662 245
946 3300049460 Ga0495682_0000106 Ga0495682_0000106_565_1302 245
947 3300053085 Ga0495619_0129937 Ga0495619_0129937_450_1202 245
948 3300053140 Ga0500573_0021147 Ga0500573_0021147_32_787 245
949 3300053178 Ga0500637_0251453 Ga0500637_0251453_87_824 245
950 3300053730 Ga0500645_001224 Ga0500645_001224_975_1712 245
951 3300009101 Ga0105247_10012875 Ga0105247_100128753 246
952 3300013104 Ga0157370_10136510 Ga0157370_101365102 246
953 3300015261 Ga0182006_1000049 Ga0182006_100004943 246
954 3300015262 Ga0182007_10015404 Ga0182007_100154043 246
955 3300015265 Ga0182005_1020469 Ga0182005_10204692 246
956 3300015265 Ga0182005_1020510 Ga0182005_10205102 246
957 3300025900 Ga0207710_10044398 Ga0207710_100443982 246
958 3300044656 Ga0466969_0090988 Ga0466969_0090988_577_1320 246
959 3300044683 Ga0466965_0084935 Ga0466965_0084935_392_1135 246
960 3300044735 Ga0466968_0180669 Ga0466968_0180669_16_759 246
961 3300044842 Ga0466957_0404160 Ga0466957_0404160_13_756 246
962 3300046452 Ga0495617_000304 Ga0495617_000304_16014_16760 246
963 3300046460 Ga0495638_0000543 Ga0495638_0000543_38659_39405 246
964 3300046501 Ga0495607_0000967 Ga0495607_0000967_11843_12589 246
965 3300046506 Ga0495583_0084943 Ga0495583_0084943_571_1317 246
966 3300046513 Ga0495616_0014232 Ga0495616_0014232_2193_2939 246
967 3300046538 Ga0495609_0010929 Ga0495609_0010929_370_1116 246
968 3300046616 Ga0495668_0034425 Ga0495668_0034425_1390_2136 246
969 3300046648 Ga0495611_0000001 Ga0495611_0000001_1042546_1043292 246
970 3300046660 Ga0495625_0000001 Ga0495625_0000001_872746_873492 246
971 3300046692 Ga0495671_0000175 Ga0495671_0000175_25676_26422 246
972 3300046794 Ga0495589_0000999 Ga0495589_0000999_1527_2273 246
973 3300046810 Ga0495660_0000008 Ga0495660_0000008_237943_238689 246
974 3300046810 Ga0495660_0000009 Ga0495660_0000009_98868_99614 246
975 3300047446 Ga0495679_000001 Ga0495679_000001_543664_544410 246
976 3300047469 Ga0495673_0000001 Ga0495673_0000001_921088_921834 246
977 3300047469 Ga0495673_0000089 Ga0495673_0000089_149315_150061 246
978 3300048924 Ga0496121_0000368 Ga0496121_0000368_5951_6697 246
979 3300048929 Ga0496126_0016309 Ga0496126_0016309_3256_3996 246
980 3300048929 Ga0496126_0105264 Ga0496126_0105264_1644_2390 246
981 3300049459 Ga0495678_000023 Ga0495678_000023_209264_210010 246
982 3300049460 Ga0495682_0001080 Ga0495682_0001080_2272_3018 246
983 3300053087 Ga0500643_000002 Ga0500643_000002_752885_753631 246
984 3300053103 Ga0500555_000242 Ga0500555_000242_5191_5937 246
985 3300002741 JGI25157J39369_1001042 JGI25157J39369_10010424 247
986 3300003214 JGI25165J46597_1000245 JGI25165J46597_100024555 247
987 3300003762 Ga0055542_1000151 Ga0055542_100015126 247
988 3300003763 Ga0055529_1000163 Ga0055529_100016321 247
989 3300005536 Ga0070697_100837722 Ga0070697_1008377221 247
990 3300005563 Ga0068855_100001240 Ga0068855_10000124022 247
991 3300025228 Ga0209672_100095 Ga0209672_10009571 247
992 3300025228 Ga0209672_101868 Ga0209672_1018686 247
993 3300025231 Ga0207427_100021 Ga0207427_100021183 247
994 3300025233 Ga0209437_100087 Ga0209437_100087183 247
995 3300025242 Ga0209258_100206 Ga0209258_10020656 247
996 3300025242 Ga0209258_100272 Ga0209258_10027254 247
997 3300025246 Ga0209646_1000485 Ga0209646_100048519 247
998 3300025250 Ga0209026_1000878 Ga0209026_100087814 247
999 3300025254 Ga0209148_1000176 Ga0209148_100017665 247
1000 3300025254 Ga0209148_1000185 Ga0209148_100018554 247
1001 3300025256 Ga0209759_1000145 Ga0209759_100014547 247
1002 3300025261 Ga0209233_1000023 Ga0209233_1000023440 247
1003 3300025272 Ga0209455_1000081 Ga0209455_1000081177 247
1004 3300025913 Ga0207695_10020911 Ga0207695_100209115 247
1005 3300025914 Ga0207671_10021594 Ga0207671_100215944 247
1006 3300025949 Ga0207667_10002349 Ga0207667_100023492 247
1007 3300028379 Ga0268266_10024463 Ga0268266_100244637 247
1008 3300032126 Ga0307415_100847747 Ga0307415_1008477471 247
1009 3300044656 Ga0466969_0009932 Ga0466969_0009932_2466_3209 247
1010 3300044663 Ga0466989_0074246 Ga0466989_0074246_588_1331 247
1011 3300044684 Ga0466966_0007469 Ga0466966_0007469_2250_2993 247
1012 3300044693 Ga0466961_0022862 Ga0466961_0022862_461_1204 247
1013 3300044694 Ga0466963_0238926 Ga0466963_0238926_300_1043 247
1014 3300044719 Ga0466971_0027166 Ga0466971_0027166_14_757 247
1015 3300045049 Ga0466959_0029127 Ga0466959_0029127_2815_3558 247
1016 3300044693 Ga0466961_0001299 Ga0466961_0001299_1218_1964 248
1017 3300039447 Ga0436361_0133351 Ga0436361_0133351_225_977 249
1018 3300045976 Ga0466967_0161576 Ga0466967_0161576_1340_2089 249
1019 3300035086 Ga0373934_0012247 Ga0373934_0012247_1995_2807 250
1020 3300035724 Ga0373933_0044563 Ga0373933_0044563_1545_2357 250
1021 3300036401 Ga0373937_0008262 Ga0373937_0008262_1425_2237 250
1022 3300046477 Ga0495664_0003219 Ga0495664_0003219_2083_2895 250
1023 3300046536 Ga0495587_0024960 Ga0495587_0024960_1525_2337 250
1024 3300046543 Ga0495645_0000483 Ga0495645_0000483_5412_6224 250
1025 3300046559 Ga0495667_0015374 Ga0495667_0015374_1322_2134 250
1026 3300046663 Ga0495635_0312077 Ga0495635_0312077_201_1013 250
1027 3300046680 Ga0495646_0026014 Ga0495646_0026014_2044_2856 250
1028 3300046809 Ga0495600_0070414 Ga0495600_0070414_73_885 250
1029 3300047317 Ga0495604_0010199 Ga0495604_0010199_5126_5938 250
1030 3300047319 Ga0495674_0052188 Ga0495674_0052188_1417_2229 250
1031 3300048088 Ga0495602_0000196 Ga0495602_0000196_32060_32872 250
1032 3300053077 Ga0495601_0002906 Ga0495601_0002906_1300_2112 250
1033 3300053078 Ga0495612_0000301 Ga0495612_0000301_9084_9896 250
1034 3300003773 Ga0055537_1000030 Ga0055537_100003080 251
1035 3300003775 Ga0055524_1002681 Ga0055524_10026818 251
1036 3300003784 Ga0055534_1000447 Ga0055534_10004478 251
1037 3300003790 Ga0055528_1000439 Ga0055528_100043911 251
1038 3300013100 Ga0157373_10193437 Ga0157373_101934371 254
1039 3300013307 Ga0157372_10010066 Ga0157372_100100664 254
1040 3300041405 Ga0439438_002259 Ga0439438_002259_4582_5406 254
1041 3300041407 Ga0439447_001305 Ga0439447_001305_257_1081 254
1042 3300042006 Ga0439432_036474 Ga0439432_036474_422_1246 254
1043 3300037312 Ga0395899_0019318 Ga0395899_0019318_3225_4004 259
1044 3300037466 Ga0395898_0001110 Ga0395898_0001110_30953_31732 259
1045 3300045836 Ga0466958_0070861 Ga0466958_0070861_386_1174 259
1046 3300034820 Ga0373959_0025113 Ga0373959_0025113_307_1125 261
1047 3300035691 Ga0373931_0014564 Ga0373931_0014564_1143_1961 261
1048 3300035695 Ga0373927_0002239 Ga0373927_0002239_10913_11731 261
1049 3300037068 Ga0373925_0000715 Ga0373925_0000715_6678_7496 261
1050 3300044712 Ga0453684_0070521 Ga0453684_0070521_2579_3445 263
1051 3300002705 JGI25156J39149_1001066 JGI25156J39149_100106611 284
1052 3300002737 JGI25162J39368_1000995 JGI25162J39368_10009955 284
1053 3300002772 JGI25164J39214_1000078 JGI25164J39214_100007815 284
1054 3300003214 JGI25165J46597_1000088 JGI25165J46597_10000884 284
1055 3300003761 Ga0055535_1000359 Ga0055535_100035921 284
1056 3300003762 Ga0055542_1000352 Ga0055542_100035221 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00230

MIP

Major intrinsic protein

32

260

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o9e-assembly1.cif.gz_A crystal structure of aqpz mutant t183c complexed with mercury 0.9973 38 267
2abm-assembly1.cif.gz_A crystal structure of aquaporin z tetramer reveals both open and closed water-conducting channels 0.9973 39 264
2o9g-assembly1.cif.gz_A crystal structure of aqpz mutant l170c complexed with mercury. 0.9969 38 267
3nk5-assembly2.cif.gz_B crystal structure of aqpz mutant f43w 0.9969 38 267
2o9d-assembly2.cif.gz_B crystal structure of aqpz mutant t183c. 0.9969 38 267
ID Description Score Start End Superfamily
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.992 38 266 1.20.1080.10
3llqB00 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9625 38 266 1.20.1080.10
af_Q7Z138_18_164_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9341 38 137 1.20.1080.10
af_Q9V5Z7_14_242_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9332 34 267 1.20.1080.10
af_Q0JPT5_51_289_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.9289 38 263 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A485CCH7-F1-model_v4 Aquaporin Z 1.001 39 266 GO:0005886
GO:0015250
AF-A0A1C6Z0X6-F1-model_v4 Aquaporin Z 1.001 39 220 GO:0005886
GO:0015250
AF-A0A2J4YQS4-F1-model_v4 Aquaporin Z 1.001 85 266 GO:0005886
GO:0015250
AF-A0A4U9HQ78-F1-model_v4 Bacterial nodulin-like intrinsic protein 1.001 39 204 GO:0005886
GO:0015250
AF-A0A0A2VTY1-F1-model_v4 Uncharacterized protein ybjE 1.001 88 247 GO:0005886
GO:0015267
GO:0015661

Feature Viewer

pLDDT pTM Quality
86.88 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map