F489166

General Info

Members Datasets Scaffolds Average Seq Length
1055 349 1051 232

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0676784|Ga0501080_0676784_35_703
Length 222
Sequence MDFGKEFEKYAVKHRGISSNTIHGYKQHSITNLTPYIIEERPLNVASMDVFSRLMMDRIIFLGEPVDDYVANIVTAQLLFLDSTDRTRDIQMYINSPGGSVYTMQFVSPDVSTICTGIAASMAAILMCAGVKGKRSALKHSRIMLHQPFGSIGGQATDIEITAKEIRKIKHELYSIIAHHTEKDIEKVEADCDRDFWMNADESKAYGVVDEVLITNPRKDKK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2818991444 Filimonas endophytica 3197 Isolate Unclassified
5 2914759650 Rhizosphaericola mali Isolate Rhizosphere
6 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
187 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
188 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
189 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
190 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
208 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
209 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
210 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
211 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
212 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
217 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
255 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
256 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
257 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
258 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
259 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
278 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
281 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
282 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
283 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
284 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
285 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
286 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
287 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
288 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
289 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
290 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
291 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
292 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
293 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
294 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
295 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
296 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
297 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
298 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
299 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
300 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
301 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
302 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
303 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
304 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
305 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
306 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
307 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
308 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
313 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
314 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
315 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
316 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
317 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
318 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
322 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
323 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
331 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
332 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
333 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
334 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
335 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
336 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
337 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
338 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
339 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
343 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
344 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
345 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
346 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
347 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
348 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 1.33
Isolates 0.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 0.95
Rhizosphere 93.74
Stem 0
Stem Tuber 0
Unclassified 1.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_8282875 2162886011 Unclassified 932
2 MBSR1b_contig_807238 2162886012 Unclassified 1712
3 JGI24744J21845_10019960 3300002077 Bacteria 1324
4 JGI24033J26618_1007474 3300002155 Unclassified 1242
5 JGI24751J29686_10000409 3300002459 Bacteria 13652
6 JGI25406J46586_10000143 3300003203 Bacteria 31027
7 JGI25406J46586_10048452 3300003203 Bacteria 1440
8 rootH1_10024197 3300003316 Bacteria 5578
9 rootH2_10100492 3300003320 Bacteria 10831
10 rootL2_10216868 3300003322 Bacteria 2894
11 rootL2_10230147 3300003322 Bacteria 1702
12 rootH1_10014938 3300003323 Bacteria 2580
13 rootH1_10073697 3300003323 Bacteria 2436
14 rootH1_10104989 3300003323 Bacteria 1054
15 JGI25160J50197_1001273 3300003354 Bacteria 12786
16 Ga0065714_10090598 3300005288 Bacteria 1938
17 Ga0065704_10091559 3300005289 Bacteria 2703
18 Ga0065704_10149944 3300005289 Unclassified 1438
19 Ga0065712_10114193 3300005290 Unclassified 1750
20 Ga0065715_10008112 3300005293 Bacteria 3225
21 Ga0065715_10189048 3300005293 Unclassified 1426
22 Ga0065715_10381257 3300005293 Bacteria 907
23 Ga0070658_10117258 3300005327 Bacteria 2210
24 Ga0070658_10145098 3300005327 Bacteria 1984
25 Ga0070676_10000238 3300005328 Bacteria 23718
26 Ga0070676_10155426 3300005328 Bacteria 1468
27 Ga0070676_10173976 3300005328 Bacteria 1395
28 Ga0070676_10293962 3300005328 Unclassified 1099
29 Ga0070676_10341912 3300005328 Bacteria 1026
30 Ga0070683_100008594 3300005329 Bacteria 8678
31 Ga0070683_100243220 3300005329 Bacteria 1712
32 Ga0070683_100469055 3300005329 Bacteria 1202
33 Ga0070690_100018274 3300005330 Bacteria 4232
34 Ga0070690_100019279 3300005330 Bacteria 4136
35 Ga0070690_100206683 3300005330 Unclassified 1369
36 Ga0070670_100021331 3300005331 Bacteria 5572
37 Ga0070670_100042070 3300005331 Bacteria 3927
38 Ga0070670_100066171 3300005331 Unclassified 3100
39 Ga0070670_100088043 3300005331 Bacteria 2669
40 Ga0070670_100092922 3300005331 Unclassified 2594
41 Ga0070670_100257530 3300005331 Bacteria 1521
42 Ga0070670_100541003 3300005331 Bacteria 1038
43 Ga0070670_100633829 3300005331 Bacteria 958
44 Ga0070677_10011093 3300005333 Bacteria 3098
45 Ga0070677_10076810 3300005333 Bacteria 1419
46 Ga0068869_100005951 3300005334 Bacteria 7710
47 Ga0068869_100010616 3300005334 Bacteria 6012
48 Ga0068869_100011228 3300005334 Bacteria 5868
49 Ga0068869_100011620 3300005334 Bacteria 5782
50 Ga0068869_100017491 3300005334 Bacteria 4861
51 Ga0068869_100029659 3300005334 Bacteria 3835
52 Ga0068869_100081983 3300005334 Bacteria 2410
53 Ga0068869_100158273 3300005334 Bacteria 1762
54 Ga0068869_100318764 3300005334 Unclassified 1260
55 Ga0070666_10000019 3300005335 Bacteria 185877
56 Ga0070666_10000966 3300005335 Bacteria 17531
57 Ga0070666_10004456 3300005335 Bacteria 8528
58 Ga0070666_10103137 3300005335 Bacteria 1968
59 Ga0070666_10173240 3300005335 Bacteria 1512
60 Ga0070666_10232849 3300005335 Bacteria 1301
61 Ga0070680_100000930 3300005336 Bacteria 20720
62 Ga0070680_100034567 3300005336 Bacteria 4075
63 Ga0070680_100127533 3300005336 Bacteria 2126
64 Ga0070682_100000423 3300005337 Bacteria 27350
65 Ga0070682_100001176 3300005337 Bacteria 14932
66 Ga0070682_100079043 3300005337 Bacteria 2123
67 Ga0070682_100091788 3300005337 Bacteria 1988
68 Ga0070682_100259407 3300005337 Unclassified 1257
69 Ga0068868_100002525 3300005338 Bacteria 12711
70 Ga0068868_100004277 3300005338 Bacteria 9996
71 Ga0068868_100004975 3300005338 Bacteria 9332
72 Ga0068868_100019194 3300005338 Bacteria 5122
73 Ga0068868_100042310 3300005338 Bacteria 3555
74 Ga0068868_100062700 3300005338 Bacteria 2947
75 Ga0068868_100063169 3300005338 Bacteria 2937
76 Ga0068868_100144041 3300005338 Bacteria 1958
77 Ga0070660_100046558 3300005339 Bacteria 3324
78 Ga0070660_100122274 3300005339 Unclassified 2078
79 Ga0070660_100331338 3300005339 Bacteria 1252
80 Ga0070660_100533699 3300005339 Bacteria 978
81 Ga0070689_100023578 3300005340 Bacteria 4607
82 Ga0070689_100141821 3300005340 Bacteria 1933
83 Ga0070689_100188755 3300005340 Bacteria 1677
84 Ga0070687_100013338 3300005343 Bacteria 3660
85 Ga0070687_100080022 3300005343 Bacteria 1780
86 Ga0070661_100026648 3300005344 Bacteria 4158
87 Ga0070661_100596269 3300005344 Bacteria 893
88 Ga0070692_10255945 3300005345 Bacteria 1050
89 Ga0070668_100000981 3300005347 Bacteria 19999
90 Ga0070668_100016663 3300005347 Bacteria 5493
91 Ga0070668_100037453 3300005347 Bacteria 3704
92 Ga0070668_100140486 3300005347 Bacteria 1946
93 Ga0070668_100159587 3300005347 Unclassified 1829
94 Ga0070668_100235022 3300005347 Bacteria 1517
95 Ga0070668_100294963 3300005347 Bacteria 1358
96 Ga0070669_100000826 3300005353 Bacteria 22540
97 Ga0070669_100023785 3300005353 Bacteria 4390
98 Ga0070669_100096692 3300005353 Unclassified 2222
99 Ga0070669_100206721 3300005353 Unclassified 1547
100 Ga0070675_100011529 3300005354 Bacteria 6924
101 Ga0070675_100012707 3300005354 Bacteria 6603
102 Ga0070675_100069637 3300005354 Bacteria 2915
103 Ga0070675_100076970 3300005354 Bacteria 2776
104 Ga0070675_100281514 3300005354 Bacteria 1461
105 Ga0070675_100560982 3300005354 Bacteria 1033
106 Ga0070671_100032220 3300005355 Bacteria 4334
107 Ga0070671_100054717 3300005355 Bacteria 3318
108 Ga0070671_100224205 3300005355 Bacteria 1595
109 Ga0070671_100267854 3300005355 Unclassified 1452
110 Ga0070671_100641687 3300005355 Bacteria 919
111 Ga0070674_100136372 3300005356 Bacteria 1836
112 Ga0070674_100477639 3300005356 Bacteria 1034
113 Ga0070673_100001854 3300005364 Bacteria 12646
114 Ga0070673_100008764 3300005364 Bacteria 6751
115 Ga0070673_100012202 3300005364 Bacteria 5891
116 Ga0070673_100036038 3300005364 Bacteria 3757
117 Ga0070673_100079878 3300005364 Bacteria 2649
118 Ga0070673_100112347 3300005364 Bacteria 2261
119 Ga0070673_100130947 3300005364 Bacteria 2104
120 Ga0070673_100138587 3300005364 Bacteria 2050
121 Ga0070673_100219197 3300005364 Unclassified 1646
122 Ga0070673_100770808 3300005364 Bacteria 887
123 Ga0070688_100001299 3300005365 Bacteria 12452
124 Ga0070688_100002166 3300005365 Bacteria 9903
125 Ga0070688_100073887 3300005365 Bacteria 2188
126 Ga0070688_100253364 3300005365 Unclassified 1254
127 Ga0070659_100032456 3300005366 Bacteria 4050
128 Ga0070667_100001589 3300005367 Bacteria 20342
129 Ga0070667_100011530 3300005367 Bacteria 7307
130 Ga0070667_100012973 3300005367 Bacteria 6892
131 Ga0070667_100014864 3300005367 Bacteria 6430
132 Ga0070667_100022490 3300005367 Bacteria 5228
133 Ga0070667_100226056 3300005367 Bacteria 1667
134 Ga0070667_100242036 3300005367 Bacteria 1611
135 Ga0070667_100257172 3300005367 Bacteria 1562
136 Ga0070667_100355701 3300005367 Bacteria 1326
137 Ga0070667_100406789 3300005367 Unclassified 1239
138 Ga0070700_100148522 3300005441 Bacteria 1601
139 Ga0070694_100512318 3300005444 Bacteria 956
140 Ga0070663_100138358 3300005455 Bacteria 1856
141 Ga0070663_100263995 3300005455 Unclassified 1366
142 Ga0070663_100452975 3300005455 Unclassified 1058
143 Ga0070678_100003466 3300005456 Bacteria 8795
144 Ga0070678_100325856 3300005456 Bacteria 1313
145 Ga0070678_100478616 3300005456 Bacteria 1095
146 Ga0070662_100001906 3300005457 Bacteria 12809
147 Ga0070662_100002104 3300005457 Bacteria 12210
148 Ga0070662_100038623 3300005457 Bacteria 3392
149 Ga0070662_100237271 3300005457 Bacteria 1461
150 Ga0070662_100993694 3300005457 Bacteria 718
151 Ga0070681_10033798 3300005458 Bacteria 5133
152 Ga0070681_10078658 3300005458 Bacteria 3254
153 Ga0070681_10247465 3300005458 Bacteria 1696
154 Ga0070681_10389345 3300005458 Bacteria 1305
155 Ga0068867_100004334 3300005459 Bacteria 9990
156 Ga0068867_100011177 3300005459 Bacteria 6334
157 Ga0068867_100015145 3300005459 Bacteria 5468
158 Ga0068867_100028178 3300005459 Bacteria 4042
159 Ga0068867_100028654 3300005459 Bacteria 4010
160 Ga0068867_100054313 3300005459 Bacteria 2959
161 Ga0068867_100064586 3300005459 Bacteria 2722
162 Ga0068867_100108848 3300005459 Bacteria 2126
163 Ga0068867_100114652 3300005459 Bacteria 2075
164 Ga0068867_100117163 3300005459 Bacteria 2054
165 Ga0068867_100258067 3300005459 Unclassified 1420
166 Ga0068867_100338431 3300005459 Bacteria 1252
167 Ga0068867_100725156 3300005459 Bacteria 879
168 Ga0070685_10031812 3300005466 Bacteria 2950
169 Ga0070685_10128264 3300005466 Bacteria 1583
170 Ga0070706_100444877 3300005467 Bacteria 1206
171 Ga0070707_100148980 3300005468 Bacteria 2278
172 Ga0070698_100001267 3300005471 Bacteria 28207
173 Ga0070698_100019395 3300005471 Bacteria 7140
174 Ga0070698_100054424 3300005471 Bacteria 4062
175 Ga0070698_100066940 3300005471 Bacteria 3613
176 Ga0070698_100664676 3300005471 Unclassified 983
177 Ga0070699_100055087 3300005518 Unclassified 3444
178 Ga0070679_100054082 3300005530 Bacteria 3996
179 Ga0070679_100062849 3300005530 Bacteria 3701
180 Ga0070679_100104850 3300005530 Bacteria 2813
181 Ga0070684_100005645 3300005535 Bacteria 9611
182 Ga0070697_100334894 3300005536 Bacteria 1305
183 Ga0068853_100009326 3300005539 Bacteria 7912
184 Ga0068853_100085771 3300005539 Bacteria 2761
185 Ga0068853_100089920 3300005539 Bacteria 2698
186 Ga0068853_100165384 3300005539 Bacteria 1999
187 Ga0068853_100176568 3300005539 Bacteria 1935
188 Ga0068853_100346450 3300005539 Bacteria 1381
189 Ga0068853_100494491 3300005539 Bacteria 1154
190 Ga0070672_100001555 3300005543 Bacteria 14218
191 Ga0070672_100011979 3300005543 Bacteria 6064
192 Ga0070672_100058606 3300005543 Bacteria 3027
193 Ga0070672_100112553 3300005543 Bacteria 2220
194 Ga0070672_100238544 3300005543 Bacteria 1529
195 Ga0070672_100388203 3300005543 Bacteria 1195
196 Ga0070672_100539695 3300005543 Bacteria 1012
197 Ga0070686_100017757 3300005544 Bacteria 4163
198 Ga0070686_100145797 3300005544 Bacteria 1653
199 Ga0070686_100213621 3300005544 Unclassified 1390
200 Ga0070686_100475980 3300005544 Unclassified 965
201 Ga0070686_100477280 3300005544 Bacteria 963
202 Ga0070693_100071864 3300005547 Bacteria 2040
203 Ga0070693_100092842 3300005547 Bacteria 1823
204 Ga0070665_100002381 3300005548 Bacteria 20760
205 Ga0070665_100018175 3300005548 Bacteria 7052
206 Ga0070665_100418798 3300005548 Bacteria 1348
207 Ga0070665_100687807 3300005548 Bacteria 1036
208 Ga0068855_100005983 3300005563 Bacteria 14842
209 Ga0068855_100039366 3300005563 Bacteria 5612
210 Ga0068855_100083430 3300005563 Bacteria 3702
211 Ga0068855_100253182 3300005563 Bacteria 1964
212 Ga0070664_100061322 3300005564 Bacteria 3205
213 Ga0070664_100064495 3300005564 Bacteria 3124
214 Ga0070664_100074517 3300005564 Bacteria 2913
215 Ga0070664_100109408 3300005564 Bacteria 2410
216 Ga0070664_100533505 3300005564 Unclassified 1084
217 Ga0070664_100573254 3300005564 Bacteria 1045
218 Ga0070664_100651503 3300005564 Bacteria 979
219 Ga0068857_100023123 3300005577 Bacteria 5467
220 Ga0068857_100174400 3300005577 Bacteria 1955
221 Ga0068857_100597673 3300005577 Bacteria 1043
222 Ga0068857_100653403 3300005577 Bacteria 997
223 Ga0068854_100037680 3300005578 Bacteria 3395
224 Ga0068854_100189763 3300005578 Bacteria 1610
225 Ga0068854_100611099 3300005578 Unclassified 932
226 Ga0068856_100007851 3300005614 Bacteria 10420
227 Ga0070702_100066427 3300005615 Bacteria 2115
228 Ga0070702_100113874 3300005615 Bacteria 1682
229 Ga0068852_100031375 3300005616 Bacteria 4384
230 Ga0068852_100053358 3300005616 Bacteria 3480
231 Ga0068852_100102496 3300005616 Unclassified 2586
232 Ga0068852_100135178 3300005616 Bacteria 2276
233 Ga0068859_100000013 3300005617 Bacteria 291126
234 Ga0068859_100010041 3300005617 Bacteria 9549
235 Ga0068859_100019858 3300005617 Bacteria 6745
236 Ga0068859_100019894 3300005617 Bacteria 6738
237 Ga0068859_100029635 3300005617 Bacteria 5492
238 Ga0068859_100029925 3300005617 Bacteria 5462
239 Ga0068859_100038541 3300005617 Bacteria 4794
240 Ga0068859_100054597 3300005617 Bacteria 4018
241 Ga0068859_100058980 3300005617 Bacteria 3867
242 Ga0068859_100090332 3300005617 Bacteria 3114
243 Ga0068859_100131419 3300005617 Bacteria 2575
244 Ga0068859_100139162 3300005617 Bacteria 2501
245 Ga0068859_100284061 3300005617 Bacteria 1748
246 Ga0068859_100382405 3300005617 Bacteria 1503
247 Ga0068859_100632298 3300005617 Bacteria 1163
248 Ga0068864_100000357 3300005618 Bacteria 40219
249 Ga0068864_100001339 3300005618 Bacteria 20471
250 Ga0068864_100011141 3300005618 Bacteria 7432
251 Ga0068864_100029348 3300005618 Bacteria 4657
252 Ga0068864_100045286 3300005618 Bacteria 3774
253 Ga0068864_100450642 3300005618 Bacteria 1230
254 Ga0068864_100498590 3300005618 Bacteria 1171
255 Ga0068866_10003544 3300005718 Bacteria 6393
256 Ga0068866_10079890 3300005718 Bacteria 1753
257 Ga0068866_10217405 3300005718 Bacteria 1151
258 Ga0068861_100009344 3300005719 Bacteria 6767
259 Ga0068861_100014355 3300005719 Bacteria 5558
260 Ga0068861_100045063 3300005719 Bacteria 3319
261 Ga0068861_100110453 3300005719 Unclassified 2202
262 Ga0068861_100141357 3300005719 Bacteria 1965
263 Ga0068861_100279769 3300005719 Bacteria 1436
264 Ga0068861_100361218 3300005719 Bacteria 1277
265 Ga0068861_100372015 3300005719 Bacteria 1260
266 Ga0068851_10000433 3300005834 Bacteria 18684
267 Ga0068851_10025715 3300005834 Bacteria 2889
268 Ga0068851_10252166 3300005834 Bacteria 1001
269 Ga0068851_10255719 3300005834 Bacteria 995
270 Ga0068870_10001616 3300005840 Bacteria 9177
271 Ga0068870_10088732 3300005840 Bacteria 1724
272 Ga0068870_10436643 3300005840 Bacteria 860
273 Ga0068863_100001616 3300005841 Bacteria 22269
274 Ga0068863_100002217 3300005841 Bacteria 19295
275 Ga0068863_100026605 3300005841 Bacteria 5517
276 Ga0068863_100067788 3300005841 Bacteria 3375
277 Ga0068863_100110030 3300005841 Bacteria 2623
278 Ga0068863_100275815 3300005841 Bacteria 1628
279 Ga0068863_100299336 3300005841 Bacteria 1560
280 Ga0068863_100312215 3300005841 Bacteria 1526
281 Ga0068863_100352403 3300005841 Bacteria 1433
282 Ga0068863_100626159 3300005841 Bacteria 1066
283 Ga0068863_100931683 3300005841 Bacteria 870
284 Ga0068858_100006851 3300005842 Bacteria 11076
285 Ga0068858_100013114 3300005842 Bacteria 7815
286 Ga0068858_100102257 3300005842 Bacteria 2673
287 Ga0068858_100122844 3300005842 Bacteria 2430
288 Ga0068858_100126686 3300005842 Bacteria 2392
289 Ga0068858_100789562 3300005842 Unclassified 926
290 Ga0068860_100000948 3300005843 Bacteria 32094
291 Ga0068860_100002928 3300005843 Bacteria 17676
292 Ga0068860_100008208 3300005843 Bacteria 10394
293 Ga0068860_100011092 3300005843 Bacteria 8885
294 Ga0068860_100012904 3300005843 Bacteria 8209
295 Ga0068860_100019036 3300005843 Bacteria 6668
296 Ga0068860_100037012 3300005843 Bacteria 4672
297 Ga0068860_100151572 3300005843 Bacteria 2233
298 Ga0068860_100163293 3300005843 Bacteria 2149
299 Ga0068860_100174243 3300005843 Bacteria 2079
300 Ga0068860_100188881 3300005843 Bacteria 1993
301 Ga0068860_100283172 3300005843 Bacteria 1621
302 Ga0068860_100582336 3300005843 Unclassified 1123
303 Ga0068860_100616993 3300005843 Unclassified 1091
304 Ga0068862_100005077 3300005844 Bacteria 11082
305 Ga0068862_100040502 3300005844 Bacteria 3960
306 Ga0068862_100110877 3300005844 Bacteria 2408
307 Ga0068862_100111578 3300005844 Bacteria 2401
308 Ga0068862_100167921 3300005844 Unclassified 1963
309 Ga0068862_100452332 3300005844 Bacteria 1211
310 Ga0068862_100920125 3300005844 Bacteria 861
311 Ga0081539_10000402 3300005985 Bacteria 92866
312 Ga0081539_10026620 3300005985 Bacteria 3684
313 Ga0075366_10005580 3300006195 Bacteria 6821
314 Ga0075366_10010004 3300006195 Bacteria 5313
315 Ga0075366_10083828 3300006195 Bacteria 1905
316 Ga0075366_10244292 3300006195 Bacteria 1094
317 Ga0075366_10264951 3300006195 Bacteria 1049
318 Ga0097621_100000960 3300006237 Bacteria 20226
319 Ga0097621_100003944 3300006237 Bacteria 10276
320 Ga0097621_100017259 3300006237 Bacteria 5477
321 Ga0097621_100040578 3300006237 Bacteria 3742
322 Ga0097621_100104803 3300006237 Bacteria 2383
323 Ga0097621_100110271 3300006237 Bacteria 2325
324 Ga0075370_10147888 3300006353 Bacteria 1376
325 Ga0075370_10204252 3300006353 Bacteria 1166
326 Ga0068871_100000582 3300006358 Bacteria 25067
327 Ga0068871_100001510 3300006358 Bacteria 15596
328 Ga0068871_100001981 3300006358 Bacteria 13880
329 Ga0068871_100076476 3300006358 Bacteria 2765
330 Ga0068871_100116632 3300006358 Bacteria 2251
331 Ga0068871_100348634 3300006358 Unclassified 1309
332 Ga0068871_100353048 3300006358 Bacteria 1301
333 Ga0068871_100439543 3300006358 Bacteria 1168
334 Ga0068871_100564957 3300006358 Bacteria 1032
335 Ga0068871_100649722 3300006358 Bacteria 963
336 Ga0075428_100041147 3300006844 Bacteria 5083
337 Ga0075430_100005897 3300006846 Bacteria 10344
338 Ga0075431_100020982 3300006847 Bacteria 6676
339 Ga0075431_100317946 3300006847 Bacteria 1570
340 Ga0075429_100030293 3300006880 Bacteria 4700
341 Ga0075429_100157104 3300006880 Bacteria 1991
342 Ga0068865_100005767 3300006881 Bacteria 7527
343 Ga0068865_100018860 3300006881 Bacteria 4459
344 Ga0068865_100162117 3300006881 Bacteria 1707
345 Ga0097620_100000013 3300006931 Bacteria 291126
346 Ga0097620_100010041 3300006931 Bacteria 9549
347 Ga0097620_100019858 3300006931 Bacteria 6745
348 Ga0097620_100019895 3300006931 Bacteria 6738
349 Ga0097620_100029634 3300006931 Bacteria 5492
350 Ga0097620_100029926 3300006931 Bacteria 5462
351 Ga0097620_100038543 3300006931 Bacteria 4794
352 Ga0097620_100054597 3300006931 Bacteria 4018
353 Ga0097620_100058980 3300006931 Bacteria 3867
354 Ga0097620_100090336 3300006931 Bacteria 3114
355 Ga0097620_100131425 3300006931 Bacteria 2575
356 Ga0097620_100139165 3300006931 Bacteria 2501
357 Ga0097620_100284040 3300006931 Bacteria 1748
358 Ga0097620_100382392 3300006931 Bacteria 1503
359 Ga0097620_100632282 3300006931 Bacteria 1163
360 Ga0105240_10001908 3300009093 Bacteria 34614
361 Ga0111539_10028550 3300009094 Bacteria 6805
362 Ga0111539_10047620 3300009094 Bacteria 5123
363 Ga0111539_10114039 3300009094 Bacteria 3170
364 Ga0111539_10129092 3300009094 Bacteria 2960
365 Ga0111539_11278505 3300009094 Unclassified 852
366 Ga0105245_10051281 3300009098 Bacteria 3699
367 Ga0105245_10068267 3300009098 Bacteria 3221
368 Ga0105247_10000906 3300009101 Bacteria 22300
369 Ga0105247_10011607 3300009101 Bacteria 5307
370 Ga0114129_10033187 3300009147 Bacteria 7295
371 Ga0105243_10070257 3300009148 Bacteria 2827
372 Ga0105243_10073565 3300009148 Bacteria 2769
373 Ga0105241_10000858 3300009174 Bacteria 23051
374 Ga0105241_10005708 3300009174 Bacteria 9185
375 Ga0105241_10008625 3300009174 Bacteria 7491
376 Ga0105241_10097998 3300009174 Bacteria 2326
377 Ga0105241_10200902 3300009174 Bacteria 1665
378 Ga0105241_10323049 3300009174 Bacteria 1332
379 Ga0105241_10437512 3300009174 Bacteria 1154
380 Ga0105241_10619090 3300009174 Bacteria 980
381 Ga0105242_10010225 3300009176 Bacteria 7194
382 Ga0105242_10029115 3300009176 Bacteria 4402
383 Ga0105242_10042800 3300009176 Bacteria 3660
384 Ga0105242_10066209 3300009176 Bacteria 2983
385 Ga0105242_10164073 3300009176 Bacteria 1947
386 Ga0105242_10276328 3300009176 Bacteria 1524
387 Ga0105242_10331238 3300009176 Bacteria 1400
388 Ga0105242_10419863 3300009176 Bacteria 1253
389 Ga0105242_10537505 3300009176 Bacteria 1118
390 Ga0105242_10835750 3300009176 Unclassified 915
391 Ga0105248_10074758 3300009177 Bacteria 3808
392 Ga0105248_10085106 3300009177 Bacteria 3558
393 Ga0105237_10012709 3300009545 Bacteria 8858
394 Ga0105237_10026673 3300009545 Bacteria 5904
395 Ga0105237_10038845 3300009545 Bacteria 4807
396 Ga0105249_10000349 3300009553 Bacteria 46353
397 Ga0105249_10001507 3300009553 Bacteria 20425
398 Ga0105249_10001918 3300009553 Bacteria 18040
399 Ga0105249_10006005 3300009553 Bacteria 10522
400 Ga0105249_10011132 3300009553 Bacteria 7902
401 Ga0105249_10032555 3300009553 Bacteria 4717
402 Ga0105249_10052361 3300009553 Bacteria 3727
403 Ga0105249_10077670 3300009553 Bacteria 3079
404 Ga0105249_10109955 3300009553 Bacteria 2604
405 Ga0105249_10228135 3300009553 Bacteria 1836
406 Ga0105249_10240861 3300009553 Unclassified 1788
407 Ga0105239_10001102 3300010375 Bacteria 37330
408 Ga0105239_10049269 3300010375 Bacteria 4619
409 Ga0105239_10582044 3300010375 Bacteria 1276
410 Ga0105239_10726381 3300010375 Bacteria 1136
411 Ga0105246_10012996 3300011119 Bacteria 5210
412 Ga0105246_10204976 3300011119 Bacteria 1536
413 Ga0157373_10082601 3300013100 Bacteria 2265
414 Ga0157373_10190016 3300013100 Bacteria 1447
415 Ga0157371_10028376 3300013102 Bacteria 4053
416 Ga0157371_10049104 3300013102 Bacteria 2998
417 Ga0157371_10677130 3300013102 Bacteria 771
418 Ga0157370_10001507 3300013104 Bacteria 28750
419 Ga0157370_10004859 3300013104 Bacteria 15261
420 Ga0157370_10294963 3300013104 Bacteria 1497
421 Ga0157369_10040230 3300013105 Bacteria 5104
422 Ga0157374_10002251 3300013296 Bacteria 16254
423 Ga0157374_10002286 3300013296 Bacteria 16120
424 Ga0157374_10031984 3300013296 Bacteria 4787
425 Ga0157374_10053553 3300013296 Bacteria 3762
426 Ga0157374_10141538 3300013296 Bacteria 2335
427 Ga0157374_10249292 3300013296 Bacteria 1747
428 Ga0157374_10705627 3300013296 Unclassified 1022
429 Ga0157374_10983454 3300013296 Bacteria 863
430 Ga0157378_10011546 3300013297 Bacteria 7734
431 Ga0157378_10013523 3300013297 Bacteria 7138
432 Ga0157378_10015823 3300013297 Bacteria 6605
433 Ga0157378_10017243 3300013297 Bacteria 6333
434 Ga0157378_10018450 3300013297 Bacteria 6128
435 Ga0157378_10020057 3300013297 Bacteria 5879
436 Ga0157378_10029140 3300013297 Bacteria 4873
437 Ga0157378_10051030 3300013297 Bacteria 3681
438 Ga0157378_10073011 3300013297 Bacteria 3084
439 Ga0157378_10594185 3300013297 Unclassified 1117
440 Ga0157378_10670193 3300013297 Bacteria 1054
441 Ga0157378_10763422 3300013297 Bacteria 990
442 Ga0157378_10872330 3300013297 Bacteria 929
443 Ga0163162_10001002 3300013306 Bacteria 26238
444 Ga0163162_10001863 3300013306 Bacteria 19846
445 Ga0163162_10012341 3300013306 Bacteria 8343
446 Ga0163162_10026158 3300013306 Bacteria 5767
447 Ga0163162_10054538 3300013306 Bacteria 4021
448 Ga0163162_10153151 3300013306 Unclassified 2424
449 Ga0163162_10172942 3300013306 Bacteria 2285
450 Ga0163162_10359976 3300013306 Bacteria 1588
451 Ga0163162_10368078 3300013306 Bacteria 1570
452 Ga0157372_10053387 3300013307 Bacteria 4505
453 Ga0157372_10107240 3300013307 Bacteria 3196
454 Ga0157372_10130502 3300013307 Unclassified 2891
455 Ga0157372_10156597 3300013307 Bacteria 2632
456 Ga0157372_11165304 3300013307 Bacteria 891
457 Ga0157372_11372333 3300013307 Bacteria 815
458 Ga0157375_10000186 3300013308 Bacteria 58217
459 Ga0157375_10000827 3300013308 Bacteria 27101
460 Ga0157375_10035495 3300013308 Bacteria 4760
461 Ga0157375_10051538 3300013308 Bacteria 4042
462 Ga0157375_10133808 3300013308 Bacteria 2601
463 Ga0157375_10152272 3300013308 Bacteria 2449
464 Ga0157375_10211732 3300013308 Unclassified 2096
465 Ga0157375_10227395 3300013308 Bacteria 2024
466 Ga0157375_10282570 3300013308 Bacteria 1823
467 Ga0157375_10403786 3300013308 Bacteria 1533
468 Ga0157375_10503547 3300013308 Bacteria 1375
469 Ga0157375_10624499 3300013308 Bacteria 1235
470 Ga0163163_10001753 3300014325 Bacteria 18282
471 Ga0163163_10066412 3300014325 Bacteria 3583
472 Ga0163163_10140861 3300014325 Unclassified 2454
473 Ga0163163_10276699 3300014325 Bacteria 1730
474 Ga0163163_10352991 3300014325 Bacteria 1527
475 Ga0163163_10621308 3300014325 Bacteria 1144
476 Ga0157380_10000650 3300014326 Bacteria 21489
477 Ga0157380_10003052 3300014326 Bacteria 11413
478 Ga0157380_10025482 3300014326 Bacteria 4485
479 Ga0157380_10371768 3300014326 Bacteria 1346
480 Ga0157380_10444385 3300014326 Bacteria 1243
481 Ga0157380_10521547 3300014326 Bacteria 1159
482 Ga0157377_10000426 3300014745 Bacteria 18260
483 Ga0157377_10021575 3300014745 Bacteria 3389
484 Ga0157377_10026874 3300014745 Bacteria 3084
485 Ga0157377_10066059 3300014745 Unclassified 2079
486 Ga0157377_10083855 3300014745 Bacteria 1868
487 Ga0157379_10000976 3300014968 Bacteria 23195
488 Ga0157379_10015986 3300014968 Bacteria 6597
489 Ga0157379_10016659 3300014968 Bacteria 6464
490 Ga0157379_10037296 3300014968 Bacteria 4334
491 Ga0157379_10180962 3300014968 Bacteria 1904
492 Ga0157379_10429861 3300014968 Unclassified 1217
493 Ga0157376_10000650 3300014969 Bacteria 22495
494 Ga0157376_10008988 3300014969 Bacteria 7235
495 Ga0157376_10061038 3300014969 Bacteria 3168
496 Ga0157376_10124854 3300014969 Unclassified 2287
497 Ga0157376_10206340 3300014969 Unclassified 1811
498 Ga0157376_10543233 3300014969 Bacteria 1149
499 Ga0163161_10004470 3300017792 Bacteria 9736
500 Ga0163161_10025267 3300017792 Bacteria 4203
501 Ga0163161_10031410 3300017792 Bacteria 3784
502 Ga0163161_10039345 3300017792 Bacteria 3394
503 Ga0163161_10044628 3300017792 Bacteria 3194
504 Ga0163161_10409513 3300017792 Unclassified 1089
505 Ga0213876_10012974 3300021384 Bacteria 4429
506 Ga0207426_1000230 3300025302 Bacteria 128357
507 Ga0207697_10114295 3300025315 Bacteria 1157
508 Ga0207656_10001978 3300025321 Bacteria 6827
509 Ga0207656_10011320 3300025321 Bacteria 3368
510 Ga0207656_10034210 3300025321 Bacteria 2121
511 Ga0207656_10261089 3300025321 Bacteria 851
512 Ga0207682_10021187 3300025893 Bacteria 2556
513 Ga0207682_10025688 3300025893 Bacteria 2336
514 Ga0207682_10031701 3300025893 Unclassified 2123
515 Ga0207642_10006779 3300025899 Bacteria 3830
516 Ga0207710_10000417 3300025900 Bacteria 28186
517 Ga0207710_10103541 3300025900 Bacteria 1345
518 Ga0207688_10120088 3300025901 Bacteria 1533
519 Ga0207680_10000673 3300025903 Bacteria 16133
520 Ga0207680_10105322 3300025903 Bacteria 1819
521 Ga0207680_10204976 3300025903 Bacteria 1346
522 Ga0207680_10233803 3300025903 Bacteria 1264
523 Ga0207680_10234123 3300025903 Bacteria 1263
524 Ga0207680_10536183 3300025903 Bacteria 835
525 Ga0207647_10041916 3300025904 Bacteria 2874
526 Ga0207685_10128385 3300025905 Bacteria 1122
527 Ga0207645_10000684 3300025907 Bacteria 28112
528 Ga0207645_10001198 3300025907 Bacteria 21394
529 Ga0207645_10015549 3300025907 Bacteria 5054
530 Ga0207645_10046954 3300025907 Bacteria 2758
531 Ga0207645_10065076 3300025907 Bacteria 2330
532 Ga0207645_10082001 3300025907 Bacteria 2068
533 Ga0207645_10103782 3300025907 Bacteria 1836
534 Ga0207645_10157573 3300025907 Bacteria 1484
535 Ga0207645_10307144 3300025907 Bacteria 1057
536 Ga0207643_10010782 3300025908 Bacteria 4928
537 Ga0207643_10021449 3300025908 Bacteria 3549
538 Ga0207643_10304794 3300025908 Unclassified 992
539 Ga0207705_10010195 3300025909 Bacteria 6835
540 Ga0207654_10000569 3300025911 Bacteria 20920
541 Ga0207654_10002605 3300025911 Bacteria 9148
542 Ga0207654_10224234 3300025911 Bacteria 1248
543 Ga0207654_10304868 3300025911 Bacteria 1084
544 Ga0207654_10315026 3300025911 Bacteria 1068
545 Ga0207707_10000299 3300025912 Bacteria 52083
546 Ga0207707_10385436 3300025912 Bacteria 1204
547 Ga0207707_10386624 3300025912 Bacteria 1202
548 Ga0207707_10477052 3300025912 Bacteria 1066
549 Ga0207695_10014544 3300025913 Bacteria 9312
550 Ga0207671_10007851 3300025914 Bacteria 9169
551 Ga0207671_10018917 3300025914 Bacteria 5277
552 Ga0207671_10020567 3300025914 Bacteria 5022
553 Ga0207660_10004975 3300025917 Bacteria 8664
554 Ga0207660_10021310 3300025917 Bacteria 4358
555 Ga0207662_10000535 3300025918 Bacteria 16868
556 Ga0207657_10028682 3300025919 Bacteria 5073
557 Ga0207657_10088416 3300025919 Unclassified 2590
558 Ga0207657_10113696 3300025919 Unclassified 2233
559 Ga0207657_10419254 3300025919 Unclassified 1052
560 Ga0207649_10087229 3300025920 Bacteria 2035
561 Ga0207652_10013799 3300025921 Bacteria 6535
562 Ga0207652_10033484 3300025921 Bacteria 4327
563 Ga0207652_10222080 3300025921 Bacteria 1702
564 Ga0207646_10798337 3300025922 Bacteria 841
565 Ga0207681_10085979 3300025923 Unclassified 2233
566 Ga0207681_10097085 3300025923 Bacteria 2117
567 Ga0207681_10129501 3300025923 Unclassified 1863
568 Ga0207681_10225019 3300025923 Bacteria 1453
569 Ga0207681_10270733 3300025923 Unclassified 1333
570 Ga0207681_10355544 3300025923 Bacteria 1173
571 Ga0207650_10086314 3300025925 Bacteria 2389
572 Ga0207650_10095012 3300025925 Unclassified 2285
573 Ga0207650_10099351 3300025925 Unclassified 2237
574 Ga0207650_10114342 3300025925 Bacteria 2093
575 Ga0207650_10150942 3300025925 Bacteria 1834
576 Ga0207650_10271446 3300025925 Bacteria 1378
577 Ga0207650_10413451 3300025925 Bacteria 1118
578 Ga0207659_10009317 3300025926 Bacteria 6130
579 Ga0207659_10014000 3300025926 Bacteria 5161
580 Ga0207659_10014978 3300025926 Bacteria 5014
581 Ga0207659_10050875 3300025926 Bacteria 2945
582 Ga0207659_10055643 3300025926 Bacteria 2831
583 Ga0207659_10193585 3300025926 Unclassified 1619
584 Ga0207687_10283307 3300025927 Bacteria 1329
585 Ga0207644_10033752 3300025931 Bacteria 3579
586 Ga0207644_10198384 3300025931 Unclassified 1582
587 Ga0207644_10208113 3300025931 Bacteria 1546
588 Ga0207644_10548283 3300025931 Bacteria 957
589 Ga0207644_10614149 3300025931 Bacteria 903
590 Ga0207644_10782563 3300025931 Bacteria 798
591 Ga0207690_10000343 3300025932 Bacteria 31195
592 Ga0207690_10017765 3300025932 Bacteria 4351
593 Ga0207690_10084309 3300025932 Bacteria 2227
594 Ga0207690_10256772 3300025932 Unclassified 1352
595 Ga0207706_10005121 3300025933 Bacteria 12232
596 Ga0207706_10008686 3300025933 Bacteria 9357
597 Ga0207706_10027788 3300025933 Bacteria 5056
598 Ga0207706_10028286 3300025933 Bacteria 5007
599 Ga0207706_10111430 3300025933 Bacteria 2407
600 Ga0207706_10340490 3300025933 Bacteria 1305
601 Ga0207706_10817573 3300025933 Bacteria 791
602 Ga0207686_10001802 3300025934 Bacteria 11908
603 Ga0207686_10045206 3300025934 Bacteria 2708
604 Ga0207686_10147386 3300025934 Bacteria 1634
605 Ga0207686_10705821 3300025934 Bacteria 802
606 Ga0207709_10061250 3300025935 Bacteria 2351
607 Ga0207670_10136932 3300025936 Bacteria 1801
608 Ga0207670_10713195 3300025936 Bacteria 831
609 Ga0207669_10055077 3300025937 Bacteria 2406
610 Ga0207669_10093896 3300025937 Unclassified 1961
611 Ga0207669_10385712 3300025937 Bacteria 1093
612 Ga0207704_10037101 3300025938 Bacteria 2812
613 Ga0207704_10037235 3300025938 Bacteria 2809
614 Ga0207704_10093507 3300025938 Bacteria 1982
615 Ga0207704_10280838 3300025938 Bacteria 1266
616 Ga0207704_10620461 3300025938 Unclassified 887
617 Ga0207665_10454282 3300025939 Bacteria 984
618 Ga0207691_10000076 3300025940 Bacteria 83005
619 Ga0207691_10003310 3300025940 Bacteria 15699
620 Ga0207691_10026563 3300025940 Bacteria 5432
621 Ga0207691_10040327 3300025940 Bacteria 4315
622 Ga0207691_10072636 3300025940 Bacteria 3103
623 Ga0207691_10079309 3300025940 Bacteria 2955
624 Ga0207691_10089212 3300025940 Bacteria 2765
625 Ga0207691_10099507 3300025940 Bacteria 2596
626 Ga0207691_10669181 3300025940 Bacteria 876
627 Ga0207711_10109221 3300025941 Bacteria 2458
628 Ga0207711_10255166 3300025941 Unclassified 1611
629 Ga0207689_10001148 3300025942 Bacteria 25510
630 Ga0207689_10002202 3300025942 Bacteria 18273
631 Ga0207689_10004010 3300025942 Bacteria 13393
632 Ga0207689_10015942 3300025942 Bacteria 6361
633 Ga0207689_10017269 3300025942 Bacteria 6108
634 Ga0207689_10035934 3300025942 Bacteria 4113
635 Ga0207689_10156204 3300025942 Bacteria 1880
636 Ga0207689_10161836 3300025942 Bacteria 1844
637 Ga0207689_10167365 3300025942 Bacteria 1811
638 Ga0207689_10192959 3300025942 Bacteria 1681
639 Ga0207689_10196534 3300025942 Unclassified 1665
640 Ga0207689_10393235 3300025942 Bacteria 1155
641 Ga0207661_10373642 3300025944 Bacteria 1289
642 Ga0207661_10478636 3300025944 Bacteria 1136
643 Ga0207661_10806530 3300025944 Unclassified 864
644 Ga0207679_10002585 3300025945 Bacteria 11158
645 Ga0207679_10117752 3300025945 Bacteria 2109
646 Ga0207679_10557287 3300025945 Bacteria 1029
647 Ga0207679_10626190 3300025945 Bacteria 971
648 Ga0207679_10792209 3300025945 Bacteria 864
649 Ga0207667_10075896 3300025949 Bacteria 3489
650 Ga0207667_10086421 3300025949 Bacteria 3245
651 Ga0207667_10108676 3300025949 Bacteria 2861
652 Ga0207667_10147491 3300025949 Bacteria 2422
653 Ga0207651_10001378 3300025960 Bacteria 11009
654 Ga0207651_10032539 3300025960 Bacteria 3351
655 Ga0207651_10109564 3300025960 Bacteria 2069
656 Ga0207651_10122701 3300025960 Bacteria 1973
657 Ga0207651_10131231 3300025960 Unclassified 1918
658 Ga0207651_10172666 3300025960 Bacteria 1706
659 Ga0207651_10205281 3300025960 Bacteria 1582
660 Ga0207651_10232658 3300025960 Bacteria 1497
661 Ga0207651_10302024 3300025960 Bacteria 1331
662 Ga0207712_10003179 3300025961 Bacteria 10455
663 Ga0207712_10004545 3300025961 Bacteria 8758
664 Ga0207712_10008002 3300025961 Bacteria 6684
665 Ga0207712_10011029 3300025961 Bacteria 5754
666 Ga0207712_10063039 3300025961 Bacteria 2637
667 Ga0207712_10067357 3300025961 Bacteria 2562
668 Ga0207712_10205388 3300025961 Bacteria 1565
669 Ga0207668_10009407 3300025972 Bacteria 5856
670 Ga0207668_10290495 3300025972 Bacteria 1345
671 Ga0207668_10396971 3300025972 Bacteria 1165
672 Ga0207668_10522606 3300025972 Bacteria 1024
673 Ga0207640_10043487 3300025981 Bacteria 2872
674 Ga0207658_10003801 3300025986 Bacteria 10632
675 Ga0207658_10017334 3300025986 Bacteria 4961
676 Ga0207658_10025533 3300025986 Bacteria 4137
677 Ga0207658_10028133 3300025986 Bacteria 3957
678 Ga0207658_10058676 3300025986 Bacteria 2865
679 Ga0207658_10211973 3300025986 Unclassified 1624
680 Ga0207658_10543960 3300025986 Unclassified 1038
681 Ga0207677_10002528 3300026023 Bacteria 9587
682 Ga0207677_10044505 3300026023 Bacteria 2958
683 Ga0207677_10054223 3300026023 Bacteria 2734
684 Ga0207677_10100519 3300026023 Bacteria 2127
685 Ga0207677_10125779 3300026023 Bacteria 1937
686 Ga0207677_10173022 3300026023 Bacteria 1691
687 Ga0207677_10279216 3300026023 Bacteria 1370
688 Ga0207703_10002545 3300026035 Bacteria 15745
689 Ga0207703_10003606 3300026035 Bacteria 12919
690 Ga0207703_10339693 3300026035 Unclassified 1380
691 Ga0207639_10002738 3300026041 Bacteria 11827
692 Ga0207639_10009982 3300026041 Bacteria 6563
693 Ga0207639_10065405 3300026041 Bacteria 2823
694 Ga0207639_10086953 3300026041 Bacteria 2490
695 Ga0207639_10608182 3300026041 Bacteria 1008
696 Ga0207678_10063575 3300026067 Bacteria 3172
697 Ga0207678_10170807 3300026067 Bacteria 1856
698 Ga0207708_10016926 3300026075 Bacteria 5489
699 Ga0207708_10077631 3300026075 Bacteria 2549
700 Ga0207708_10517588 3300026075 Unclassified 1002
701 Ga0207708_10527723 3300026075 Bacteria 993
702 Ga0207641_10000184 3300026088 Bacteria 86994
703 Ga0207641_10003089 3300026088 Bacteria 14998
704 Ga0207641_10004182 3300026088 Bacteria 12574
705 Ga0207641_10046443 3300026088 Bacteria 3660
706 Ga0207641_10073835 3300026088 Bacteria 2940
707 Ga0207641_10311829 3300026088 Bacteria 1489
708 Ga0207641_10368053 3300026088 Bacteria 1374
709 Ga0207641_10519400 3300026088 Bacteria 1158
710 Ga0207648_10000488 3300026089 Bacteria 44152
711 Ga0207648_10006518 3300026089 Bacteria 11585
712 Ga0207648_10016043 3300026089 Bacteria 6862
713 Ga0207648_10024406 3300026089 Bacteria 5398
714 Ga0207648_10030559 3300026089 Bacteria 4768
715 Ga0207648_10034010 3300026089 Bacteria 4495
716 Ga0207648_10046889 3300026089 Bacteria 3788
717 Ga0207648_10079248 3300026089 Bacteria 2865
718 Ga0207648_10087305 3300026089 Bacteria 2722
719 Ga0207648_10830143 3300026089 Unclassified 861
720 Ga0207676_10003388 3300026095 Bacteria 11264
721 Ga0207676_10011316 3300026095 Bacteria 6377
722 Ga0207676_10030308 3300026095 Bacteria 4059
723 Ga0207676_10049366 3300026095 Bacteria 3273
724 Ga0207676_10069682 3300026095 Bacteria 2817
725 Ga0207676_10436645 3300026095 Bacteria 1231
726 Ga0207676_10549461 3300026095 Unclassified 1103
727 Ga0207674_10008650 3300026116 Bacteria 11727
728 Ga0207674_10027729 3300026116 Bacteria 5986
729 Ga0207674_10036746 3300026116 Bacteria 5099
730 Ga0207674_10076348 3300026116 Bacteria 3358
731 Ga0207674_10105672 3300026116 Unclassified 2793
732 Ga0207674_10277979 3300026116 Unclassified 1622
733 Ga0207674_10456867 3300026116 Bacteria 1234
734 Ga0207674_10555679 3300026116 Bacteria 1109
735 Ga0207674_10901502 3300026116 Bacteria 852
736 Ga0207675_100003643 3300026118 Bacteria 15015
737 Ga0207675_100007531 3300026118 Bacteria 10285
738 Ga0207675_100060176 3300026118 Bacteria 3546
739 Ga0207675_100063971 3300026118 Bacteria 3437
740 Ga0207675_100097749 3300026118 Bacteria 2765
741 Ga0207675_100238776 3300026118 Bacteria 1756
742 Ga0207675_100243594 3300026118 Bacteria 1738
743 Ga0207675_100330999 3300026118 Bacteria 1489
744 Ga0207675_100596880 3300026118 Bacteria 1107
745 Ga0207675_100607235 3300026118 Bacteria 1097
746 Ga0207683_10002620 3300026121 Bacteria 15710
747 Ga0207683_10026193 3300026121 Bacteria 5033
748 Ga0207683_10026625 3300026121 Bacteria 4993
749 Ga0207683_10047263 3300026121 Bacteria 3769
750 Ga0207683_10085974 3300026121 Bacteria 2796
751 Ga0207683_10093250 3300026121 Bacteria 2683
752 Ga0207683_10278135 3300026121 Bacteria 1530
753 Ga0207698_10097916 3300026142 Bacteria 2422
754 Ga0207698_10404643 3300026142 Bacteria 1305
755 Ga0207698_10422490 3300026142 Bacteria 1279
756 Ga0207698_10423485 3300026142 Bacteria 1278
757 Ga0207698_10762707 3300026142 Unclassified 967
758 Ga0207698_10769692 3300026142 Bacteria 963
759 Ga0207428_10013560 3300027907 Bacteria 7113
760 Ga0207428_10044663 3300027907 Bacteria 3573
761 Ga0268266_10003446 3300028379 Bacteria 15772
762 Ga0268266_10545767 3300028379 Bacteria 1110
763 Ga0268265_10019847 3300028380 Bacteria 4681
764 Ga0268265_10046626 3300028380 Bacteria 3241
765 Ga0268265_10095069 3300028380 Bacteria 2392
766 Ga0268265_10096767 3300028380 Bacteria 2373
767 Ga0268265_10266513 3300028380 Unclassified 1526
768 Ga0268265_10332197 3300028380 Bacteria 1381
769 Ga0268264_10002907 3300028381 Bacteria 14884
770 Ga0268264_10007740 3300028381 Bacteria 8946
771 Ga0268264_10012563 3300028381 Bacteria 6974
772 Ga0268264_10023693 3300028381 Bacteria 5005
773 Ga0268264_10025491 3300028381 Bacteria 4831
774 Ga0268264_10046502 3300028381 Bacteria 3604
775 Ga0268264_10068267 3300028381 Bacteria 3004
776 Ga0268264_10097640 3300028381 Bacteria 2547
777 Ga0268264_10113047 3300028381 Bacteria 2382
778 Ga0268264_10139237 3300028381 Bacteria 2162
779 Ga0268264_10171535 3300028381 Bacteria 1962
780 Ga0268264_10301685 3300028381 Bacteria 1508
781 Ga0268264_10491116 3300028381 Bacteria 1196
782 Ga0307515_10000455 3300028794 Bacteria 97670
783 Ga0316177_1064545 3300030731 Bacteria 1232
784 Ga0265327_10000013 3300031251 Bacteria 519549
785 Ga0265327_10000254 3300031251 Bacteria 106076
786 Ga0265327_10032002 3300031251 Bacteria 2950
787 Ga0265327_10062068 3300031251 Bacteria 1904
788 Ga0307513_10124861 3300031456 Bacteria 2532
789 Ga0307513_10463790 3300031456 Bacteria 989
790 Ga0307509_10043969 3300031507 Bacteria 4828
791 Ga0307509_10535933 3300031507 Bacteria 850
792 Ga0265313_10029162 3300031595 Bacteria 2858
793 Ga0307508_10000603 3300031616 Bacteria 43051
794 Ga0307406_10013998 3300031901 Bacteria 4607
795 Ga0307416_100157791 3300032002 Bacteria 2092
796 Ga0307416_100467654 3300032002 Bacteria 1318
797 Ga0307414_10150774 3300032004 Bacteria 1834
798 Ga0307414_10427274 3300032004 Bacteria 1157
799 Ga0307415_100129468 3300032126 Bacteria 1908
800 Ga0307415_100182501 3300032126 Bacteria 1648
801 Ga0373933_0013556 3300035724 Bacteria 4520
802 Ga0373933_0057220 3300035724 Unclassified 2343
803 Ga0373937_0000626 3300036401 Bacteria 31047
804 Ga0373937_0034742 3300036401 Bacteria 4585
805 Ga0373937_0154718 3300036401 Bacteria 2149
806 Ga0395899_0015685 3300037312 Bacteria 5777
807 Ga0395900_0047839 3300037418 Bacteria 4405
808 Ga0395900_0125735 3300037418 Bacteria 2630
809 Ga0395898_0015536 3300037466 Bacteria 7807
810 Ga0395901_0003272 3300038443 Bacteria 16313
811 Ga0436365_0298838 3300039437 Bacteria 7530
812 Ga0436365_1778757 3300039437 Bacteria 6021
813 Ga0436365_1889540 3300039437 Bacteria 1650
814 Ga0439436_0000413 3300041404 Bacteria 10744
815 Ga0451807_2402910 3300041486 Bacteria 1021
816 Ga0439441_014677 3300042001 Unclassified 1377
817 Ga0439449_0016026 3300042007 Bacteria 2818
818 Ga0439449_0017796 3300042007 Bacteria 2668
819 Ga0439457_003832 3300042014 Bacteria 4030
820 Ga0439457_014419 3300042014 Bacteria 1769
821 Ga0439462_0042841 3300042015 Bacteria 1209
822 Ga0450897_007222 3300042128 Bacteria 1010
823 Ga0450897_007938 3300042128 Bacteria 978
824 Ga0450894_014063 3300042131 Bacteria 1054
825 Ga0450898_030723 3300042134 Bacteria 985
826 Ga0450899_009011 3300042135 Bacteria 1096
827 Ga0439446_0024266 3300042156 Bacteria 1730
828 Ga0450893_0021987 3300042532 Bacteria 1103
829 Ga0451577_0020044 3300042876 Bacteria 6141
830 Ga0451577_0302370 3300042876 Bacteria 1450
831 Ga0451577_0538842 3300042876 Unclassified 1060
832 Ga0466969_0004123 3300044656 Bacteria 7712
833 Ga0466972_0000016 3300044658 Bacteria 208802
834 Ga0466972_0000104 3300044658 Bacteria 73886
835 Ga0466965_0189992 3300044683 Bacteria 1086
836 Ga0466966_0000193 3300044684 Bacteria 40730
837 Ga0466961_0211192 3300044693 Bacteria 1198
838 Ga0453684_0021387 3300044712 Bacteria 9667
839 Ga0453684_0038554 3300044712 Bacteria 6529
840 Ga0453684_0148150 3300044712 Bacteria 2793
841 Ga0453684_0734438 3300044712 Bacteria 1070
842 Ga0453684_0748184 3300044712 Bacteria 1058
843 Ga0466968_0010449 3300044735 Bacteria 3600
844 Ga0466970_0043550 3300044765 Bacteria 2388
845 Ga0466957_0001943 3300044842 Bacteria 10977
846 Ga0466957_0110513 3300044842 Bacteria 1742
847 Ga0466960_0054762 3300044901 Bacteria 1938
848 Ga0466959_0002486 3300045049 Bacteria 11803
849 Ga0451576_0133276 3300045051 Bacteria 2590
850 Ga0495592_0041592 3300046454 Bacteria 3445
851 Ga0495603_0170933 3300046455 Bacteria 1259
852 Ga0495638_0023753 3300046460 Bacteria 4005
853 Ga0495650_0029888 3300046471 Bacteria 2476
854 Ga0495618_0121311 3300046514 Bacteria 1674
855 Ga0495628_0032333 3300046516 Bacteria 4224
856 Ga0495630_0018495 3300046517 Bacteria 5119
857 Ga0495668_0000242 3300046616 Bacteria 78022
858 Ga0495668_0006585 3300046616 Bacteria 7580
859 Ga0495634_0131032 3300046642 Bacteria 1598
860 Ga0495635_0042972 3300046663 Bacteria 3120
861 Ga0495670_0010331 3300046691 Bacteria 4586
862 Ga0495674_0188469 3300047319 Unclassified 1715
863 Ga0495672_0005013 3300047320 Bacteria 10598
864 Ga0495672_0020050 3300047320 Bacteria 4392
865 Ga0495680_0128059 3300047322 Bacteria 1868
866 Ga0495684_0291467 3300047471 Bacteria 1174
867 Ga0495686_0011185 3300047472 Bacteria 6332
868 Ga0496100_0693337 3300048903 Bacteria 795
869 Ga0496101_0224250 3300048904 Unclassified 1459
870 Ga0496104_0339198 3300048907 Unclassified 1416
871 Ga0496105_0207097 3300048908 Bacteria 1600
872 Ga0496109_0014633 3300048912 Bacteria 6826
873 Ga0496109_0288820 3300048912 Bacteria 1546
874 Ga0496110_0065694 3300048913 Bacteria 3208
875 Ga0496110_0231067 3300048913 Bacteria 1682
876 Ga0496112_0328164 3300048915 Bacteria 1474
877 Ga0501306_016337 3300049127 Bacteria 996
878 Ga0501306_031780 3300049127 Bacteria 788
879 Ga0501306_033411 3300049127 Bacteria 773
880 Ga0501308_001539 3300049128 Bacteria 1869
881 Ga0501308_012590 3300049128 Bacteria 968
882 Ga0501305_030069 3300049161 Bacteria 843
883 Ga0501290_002235 3300049513 Bacteria 2515
884 Ga0501292_000995 3300049515 Bacteria 3442
885 Ga0501298_000530 3300049521 Bacteria 5175
886 Ga0501299_001303 3300049522 Bacteria 3168
887 Ga0501303_015565 3300049526 Bacteria 762
888 Ga0501312_002971 3300049528 Bacteria 1881
889 Ga0501312_024910 3300049528 Bacteria 909
890 Ga0501312_036890 3300049528 Bacteria 786
891 Ga0501314_009319 3300049530 Bacteria 899
892 Ga0501316_024174 3300049532 Bacteria 784
893 Ga0501324_016328 3300049540 Bacteria 728
894 Ga0501337_006885 3300049553 Bacteria 784
895 Ga0501031_0328658 3300049568 Bacteria 990
896 Ga0501031_0363715 3300049568 Bacteria 936
897 Ga0501032_0004313 3300049569 Bacteria 10742
898 Ga0501032_0045286 3300049569 Bacteria 2976
899 Ga0501032_0098945 3300049569 Bacteria 1932
900 Ga0501032_0201334 3300049569 Unclassified 1299
901 Ga0501033_0006858 3300049570 Bacteria 8892
902 Ga0501033_0094311 3300049570 Bacteria 2189
903 Ga0501033_0214437 3300049570 Bacteria 1372
904 Ga0501034_0000002 3300049571 Bacteria 565510
905 Ga0501034_0008447 3300049571 Bacteria 10876
906 Ga0501034_0012890 3300049571 Bacteria 8623
907 Ga0501034_0022986 3300049571 Bacteria 6353
908 Ga0501034_0031289 3300049571 Bacteria 5405
909 Ga0501034_0039862 3300049571 Bacteria 4757
910 Ga0501034_0097671 3300049571 Bacteria 2933
911 Ga0501034_0098127 3300049571 Bacteria 2925
912 Ga0501034_0106927 3300049571 Bacteria 2790
913 Ga0501036_0041557 3300049572 Bacteria 3889
914 Ga0501037_0020352 3300049573 Bacteria 4899
915 Ga0501037_0036949 3300049573 Bacteria 3599
916 Ga0501037_0042976 3300049573 Bacteria 3321
917 Ga0501037_0175444 3300049573 Unclassified 1522
918 Ga0501038_0005400 3300049574 Bacteria 11880
919 Ga0501038_0039893 3300049574 Bacteria 4104
920 Ga0501038_0062216 3300049574 Bacteria 3189
921 Ga0501038_0100211 3300049574 Bacteria 2414
922 Ga0501038_0478766 3300049574 Bacteria 954
923 Ga0501039_0008583 3300049575 Bacteria 7792
924 Ga0501039_0039599 3300049575 Bacteria 3640
925 Ga0501043_0004656 3300049579 Bacteria 11119
926 Ga0501043_0013445 3300049579 Bacteria 6401
927 Ga0501043_0059217 3300049579 Bacteria 3006
928 Ga0501043_0160558 3300049579 Bacteria 1756
929 Ga0501046_0003336 3300049580 Bacteria 14755
930 Ga0501046_0026201 3300049580 Bacteria 4763
931 Ga0501047_0002513 3300049581 Bacteria 17487
932 Ga0501047_0088741 3300049581 Bacteria 2969
933 Ga0501047_0160319 3300049581 Bacteria 2121
934 Ga0501047_0167032 3300049581 Bacteria 2071
935 Ga0501047_0199458 3300049581 Bacteria 1862
936 Ga0501048_0390018 3300049582 Bacteria 995
937 Ga0501069_0080213 3300049585 Bacteria 1838
938 Ga0501070_0006730 3300049586 Bacteria 9787
939 Ga0501070_0103596 3300049586 Bacteria 2353
940 Ga0501070_0396254 3300049586 Unclassified 1117
941 Ga0501072_0013863 3300049588 Bacteria 6176
942 Ga0501072_0526879 3300049588 Bacteria 934
943 Ga0501073_0001665 3300049589 Bacteria 16470
944 Ga0501073_0093194 3300049589 Bacteria 2093
945 Ga0501074_0102143 3300049590 Bacteria 2052
946 Ga0501198_000711 3300049649 Bacteria 4137
947 Ga0501198_011403 3300049649 Bacteria 1326
948 Ga0501201_000337 3300049651 Bacteria 4292
949 Ga0501202_005557 3300049652 Bacteria 2233
950 Ga0501206_007100 3300049653 Bacteria 1465
951 Ga0501207_001019 3300049654 Bacteria 3409
952 Ga0501216_001931 3300049660 Bacteria 2876
953 Ga0501217_000623 3300049661 Bacteria 5967
954 Ga0501217_008287 3300049661 Bacteria 2242
955 Ga0501222_009960 3300049662 Bacteria 1255
956 Ga0501223_000612 3300049663 Bacteria 8570
957 Ga0501227_013552 3300049665 Bacteria 1798
958 Ga0501228_005443 3300049666 Bacteria 1129
959 Ga0501233_036779 3300049668 Bacteria 1134
960 Ga0501235_001816 3300049669 Bacteria 4582
961 Ga0501235_023363 3300049669 Bacteria 1378
962 Ga0501236_008339 3300049670 Bacteria 1315
963 Ga0501240_000563 3300049673 Bacteria 3098
964 Ga0501242_002993 3300049674 Bacteria 1805
965 Ga0501242_009611 3300049674 Bacteria 1146
966 Ga0501243_000175 3300049675 Bacteria 7506
967 Ga0501251_001086 3300049681 Bacteria 2501
968 Ga0501252_000056 3300049682 Bacteria 5790
969 Ga0501253_004251 3300049683 Bacteria 1792
970 Ga0501257_030121 3300049686 Bacteria 1305
971 Ga0501259_000471 3300049688 Bacteria 6427
972 Ga0501259_004572 3300049688 Bacteria 2199
973 Ga0501261_000479 3300049690 Bacteria 5113
974 Ga0501219_000944 3300049703 Bacteria 3507
975 Ga0501221_000519 3300049704 Bacteria 6099
976 Ga0501225_0001014 3300049705 Bacteria 8815
977 Ga0501225_0002100 3300049705 Bacteria 6196
978 Ga0501225_0111651 3300049705 Bacteria 806
979 Ga0501234_000632 3300049707 Bacteria 5424
980 Ga0501234_007549 3300049707 Bacteria 1701
981 Ga0501245_010223 3300049708 Bacteria 1354
982 Ga0501079_0064510 3300049741 Bacteria 2825
983 Ga0501079_0191309 3300049741 Bacteria 1597
984 Ga0501080_0077292 3300049742 Bacteria 3095
985 Ga0501080_0314414 3300049742 Bacteria 1419
986 Ga0501080_0676784 3300049742 Bacteria 911
987 Ga0501083_0086403 3300049744 Bacteria 2074
988 Ga0501083_0148600 3300049744 Bacteria 1534
989 Ga0501241_018032 3300049758 Bacteria 1292
990 Ga0501264_004095 3300049761 Bacteria 1321
991 Ga0501266_013482 3300049763 Bacteria 1064
992 Ga0501267_002942 3300049764 Bacteria 1529
993 Ga0501268_006384 3300049765 Bacteria 1728
994 Ga0501279_009957 3300049775 Bacteria 1277
995 Ga0501282_005688 3300049778 Bacteria 1335
996 Ga0501035_0001789 3300049822 Bacteria 21715
997 Ga0501035_0019698 3300049822 Bacteria 6200
998 Ga0501035_0065820 3300049822 Bacteria 3217
999 Ga0501035_0075123 3300049822 Bacteria 2989
1000 Ga0501035_0531458 3300049822 Unclassified 965
1001 Ga0501044_0004121 3300049823 Bacteria 16310
1002 Ga0501044_0012046 3300049823 Bacteria 9365
1003 Ga0501044_0026210 3300049823 Bacteria 6174
1004 Ga0501044_0039575 3300049823 Bacteria 4917
1005 Ga0501044_0273289 3300049823 Bacteria 1625
1006 Ga0501044_0369310 3300049823 Bacteria 1351
1007 Ga0501204_004697 3300049850 Bacteria 1478
1008 Ga0501212_004479 3300049851 Bacteria 1806
1009 Ga0501284_00006 3300050005 Bacteria 153628
1010 nmdc:mga0k408_101998_c1 3300050493 Bacteria 1692
1011 nmdc:mga0k408_105792_c1 3300050493 Bacteria 1662
1012 nmdc:mga0k408_176430_c1 3300050493 Bacteria 1274
1013 nmdc:mga0k408_18195_c1 3300050493 Bacteria 3921
1014 nmdc:mga0k408_3671_c2 3300050493 Bacteria 1797
1015 nmdc:mga0k408_54565_c2 3300050493 Bacteria 1079
1016 nmdc:mga05p37_48940_c1 3300050507 Bacteria 5198
1017 nmdc:mga05p37_53739_c1 3300050507 Bacteria 4954
1018 nmdc:mga0qj67_84982_c1 3300050509 Bacteria 2538
1019 nmdc:mga06r32_131083_c1 3300050510 Bacteria 2479
1020 nmdc:mga06r32_23249_c1 3300050510 Bacteria 5733
1021 nmdc:mga08y16_39378_c1 3300050511 Bacteria 4960
1022 nmdc:mga08y16_423395_c1 3300050511 Unclassified 1361
1023 nmdc:mga08y16_470754_c1 3300050511 Bacteria 1279
1024 nmdc:mga08y16_820311_c1 3300050511 Bacteria 922
1025 nmdc:mga08y16_880207_c1 3300050511 Bacteria 883
1026 Ga0495619_0044008 3300053085 Bacteria 2929
1027 Ga0500578_0011031 3300053086 Bacteria 5839
1028 Ga0500583_0000009 3300053092 Bacteria 160749
1029 Ga0500583_0000258 3300053092 Bacteria 18965
1030 Ga0500651_0000232 3300053093 Bacteria 34617
1031 Ga0500641_0091345 3300053096 Unclassified 1300
1032 Ga0500555_024159 3300053103 Bacteria 1742
1033 Ga0500642_0043895 3300053130 Bacteria 1944
1034 Ga0500642_0135173 3300053130 Bacteria 1156
1035 Ga0500652_018206 3300053131 Bacteria 2589
1036 Ga0500652_086308 3300053131 Bacteria 1309
1037 Ga0500559_0024426 3300053136 Bacteria 2572
1038 Ga0500568_0000895 3300053139 Bacteria 20694
1039 Ga0500589_001419 3300053147 Bacteria 7110
1040 Ga0500604_0010575 3300053151 Bacteria 2470
1041 Ga0500616_0176839 3300053153 Bacteria 964
1042 Ga0500622_0000615 3300053156 Bacteria 32225
1043 Ga0500622_0058994 3300053156 Bacteria 1960
1044 Ga0500639_037414 3300053163 Bacteria 2557
1045 Ga0500611_000005 3300053727 Bacteria 228837
1046 Ga0500645_034780 3300053730 Bacteria 1504
1047 Ga0501084_0018691 3300054114 Bacteria 5770
1048 Ga0501084_0183587 3300054114 Bacteria 1766
1049 Ga0500661_001332 3300055283 Bacteria 4609
1050 Ga0587068_011416 3300059641 Bacteria 1340
1051 Ga0501082_0070209 3300060353 Bacteria 3016

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0339198 Ga0496104_0339198_43_804 208
2 3300005564 Ga0070664_100651503 Ga0070664_1006515032 217
3 3300005577 Ga0068857_100653403 Ga0068857_1006534031 217
4 3300026116 Ga0207674_10555679 Ga0207674_105556792 217
5 3300003323 rootH1_10104989 rootH1_101049892 219
6 3300005844 Ga0068862_100111578 Ga0068862_1001115782 219
7 3300028380 Ga0268265_10332197 Ga0268265_103321971 219
8 3300053093 Ga0500651_0000232 Ga0500651_0000232_14084_14761 219
9 3300005335 Ga0070666_10103137 Ga0070666_101031372 220
10 3300005344 Ga0070661_100596269 Ga0070661_1005962691 220
11 3300005365 Ga0070688_100073887 Ga0070688_1000738871 220
12 3300005457 Ga0070662_100038623 Ga0070662_1000386234 220
13 3300005544 Ga0070686_100145797 Ga0070686_1001457972 220
14 3300005617 Ga0068859_100131419 Ga0068859_1001314192 220
15 3300005842 Ga0068858_100122844 Ga0068858_1001228442 220
16 3300005843 Ga0068860_100151572 Ga0068860_1001515722 220
17 3300006931 Ga0097620_100131425 Ga0097620_1001314252 220
18 3300013296 Ga0157374_10249292 Ga0157374_102492922 220
19 3300013306 Ga0163162_10026158 Ga0163162_100261583 220
20 3300014325 Ga0163163_10352991 Ga0163163_103529912 220
21 3300014968 Ga0157379_10015986 Ga0157379_100159864 220
22 3300025903 Ga0207680_10234123 Ga0207680_102341231 220
23 3300025933 Ga0207706_10111430 Ga0207706_101114302 220
24 3300025944 Ga0207661_10373642 Ga0207661_103736421 220
25 3300025945 Ga0207679_10626190 Ga0207679_106261902 220
26 3300026023 Ga0207677_10173022 Ga0207677_101730222 220
27 3300026142 Ga0207698_10423485 Ga0207698_104234852 220
28 3300028381 Ga0268264_10097640 Ga0268264_100976403 220
29 3300048913 Ga0496110_0231067 Ga0496110_0231067_857_1576 220
30 3300048915 Ga0496112_0328164 Ga0496112_0328164_518_1237 220
31 3300014969 Ga0157376_10206340 Ga0157376_102063402 222
32 3300035724 Ga0373933_0013556 Ga0373933_0013556_1636_2352 222
33 3300036401 Ga0373937_0000626 Ga0373937_0000626_3107_3823 222
34 3300036401 Ga0373937_0034742 Ga0373937_0034742_2219_2914 222
35 3300046454 Ga0495592_0041592 Ga0495592_0041592_340_1056 222
36 3300046514 Ga0495618_0121311 Ga0495618_0121311_640_1356 222
37 3300046516 Ga0495628_0032333 Ga0495628_0032333_37_753 222
38 3300046517 Ga0495630_0018495 Ga0495630_0018495_2168_2884 222
39 3300046642 Ga0495634_0131032 Ga0495634_0131032_710_1426 222
40 3300046691 Ga0495670_0010331 Ga0495670_0010331_3020_3715 222
41 3300047319 Ga0495674_0188469 Ga0495674_0188469_658_1374 222
42 3300047322 Ga0495680_0128059 Ga0495680_0128059_173_889 222
43 3300047471 Ga0495684_0291467 Ga0495684_0291467_20_736 222
44 3300048908 Ga0496105_0207097 Ga0496105_0207097_555_1250 222
45 3300049742 Ga0501080_0676784 Ga0501080_0676784_35_703 222
46 3300053085 Ga0495619_0044008 Ga0495619_0044008_1007_1723 222
47 3300036401 Ga0373937_0154718 Ga0373937_0154718_1059_1751 223
48 3300025932 Ga0207690_10000343 Ga0207690_1000034328 224
49 3300042876 Ga0451577_0302370 Ga0451577_0302370_324_1001 224
50 3300044712 Ga0453684_0734438 Ga0453684_0734438_192_878 224
51 iso_pu_bacteria 2914759650 2914759804 224
52 3300025939 Ga0207665_10454282 Ga0207665_104542821 225
53 iso_pu_bacteria 2818991444 2819590467 225
54 iso_pu_bacteria 2929154850 2929158632 225
55 3300005466 Ga0070685_10031812 Ga0070685_100318122 226
56 3300005564 Ga0070664_100109408 Ga0070664_1001094082 226
57 3300013308 Ga0157375_10282570 Ga0157375_102825702 226
58 iso_pu_bacteria 2738541278 2738725990 226
59 3300003354 JGI25160J50197_1001273 JGI25160J50197_100127311 227
60 3300005841 Ga0068863_100312215 Ga0068863_1003122151 227
61 3300005843 Ga0068860_100582336 Ga0068860_1005823361 227
62 3300006195 Ga0075366_10264951 Ga0075366_102649511 227
63 3300009545 Ga0105237_10012709 Ga0105237_100127096 227
64 3300010375 Ga0105239_10049269 Ga0105239_100492695 227
65 3300013307 Ga0157372_10130502 Ga0157372_101305023 227
66 3300025302 Ga0207426_1000230 Ga0207426_1000230105 227
67 3300025914 Ga0207671_10020567 Ga0207671_100205671 227
68 3300050493 nmdc:mga0k408_176430_c1 nmdc:mga0k408_176430_c1_446_1129 227
69 3300059641 Ga0587068_011416 Ga0587068_011416_633_1319 227
70 3300005329 Ga0070683_100243220 Ga0070683_1002432202 228
71 3300005330 Ga0070690_100019279 Ga0070690_1000192792 228
72 3300005333 Ga0070677_10076810 Ga0070677_100768102 228
73 3300005335 Ga0070666_10004456 Ga0070666_100044567 228
74 3300005338 Ga0068868_100004277 Ga0068868_1000042774 228
75 3300005367 Ga0070667_100022490 Ga0070667_1000224905 228
76 3300005457 Ga0070662_100001906 Ga0070662_1000019063 228
77 3300005544 Ga0070686_100017757 Ga0070686_1000177573 228
78 3300005718 Ga0068866_10079890 Ga0068866_100798902 228
79 3300005844 Ga0068862_100920125 Ga0068862_1009201251 228
80 3300006237 Ga0097621_100104803 Ga0097621_1001048032 228
81 3300009174 Ga0105241_10323049 Ga0105241_103230492 228
82 3300009176 Ga0105242_10537505 Ga0105242_105375052 228
83 3300010375 Ga0105239_10726381 Ga0105239_107263812 228
84 3300013296 Ga0157374_10002286 Ga0157374_1000228616 228
85 3300013308 Ga0157375_10051538 Ga0157375_100515385 228
86 3300017792 Ga0163161_10031410 Ga0163161_100314102 228
87 3300025903 Ga0207680_10536183 Ga0207680_105361831 228
88 3300025931 Ga0207644_10614149 Ga0207644_106141491 228
89 3300025933 Ga0207706_10008686 Ga0207706_100086865 228
90 3300025960 Ga0207651_10232658 Ga0207651_102326581 228
91 3300025961 Ga0207712_10205388 Ga0207712_102053881 228
92 3300025986 Ga0207658_10028133 Ga0207658_100281335 228
93 3300026121 Ga0207683_10047263 Ga0207683_100472632 228
94 3300032002 Ga0307416_100157791 Ga0307416_1001577912 228
95 3300042876 Ga0451577_0538842 Ga0451577_0538842_153_839 228
96 3300044712 Ga0453684_0148150 Ga0453684_0148150_1757_2443 228
97 3300044712 Ga0453684_0748184 Ga0453684_0748184_320_1006 228
98 3300048903 Ga0496100_0693337 Ga0496100_0693337_19_735 228
99 3300002459 JGI24751J29686_10000409 JGI24751J29686_100004099 229
100 3300003320 rootH2_10100492 rootH2_101004923 229
101 3300003323 rootH1_10014938 rootH1_100149383 229
102 3300005327 Ga0070658_10117258 Ga0070658_101172583 229
103 3300005327 Ga0070658_10145098 Ga0070658_101450982 229
104 3300005328 Ga0070676_10155426 Ga0070676_101554262 229
105 3300005328 Ga0070676_10293962 Ga0070676_102939622 229
106 3300005329 Ga0070683_100008594 Ga0070683_1000085942 229
107 3300005329 Ga0070683_100469055 Ga0070683_1004690551 229
108 3300005330 Ga0070690_100206683 Ga0070690_1002066832 229
109 3300005331 Ga0070670_100042070 Ga0070670_1000420702 229
110 3300005331 Ga0070670_100633829 Ga0070670_1006338291 229
111 3300005334 Ga0068869_100011228 Ga0068869_1000112285 229
112 3300005336 Ga0070680_100034567 Ga0070680_1000345673 229
113 3300005336 Ga0070680_100127533 Ga0070680_1001275332 229
114 3300005338 Ga0068868_100042310 Ga0068868_1000423102 229
115 3300005338 Ga0068868_100062700 Ga0068868_1000627002 229
116 3300005339 Ga0070660_100046558 Ga0070660_1000465582 229
117 3300005339 Ga0070660_100331338 Ga0070660_1003313382 229
118 3300005340 Ga0070689_100141821 Ga0070689_1001418212 229
119 3300005344 Ga0070661_100026648 Ga0070661_1000266484 229
120 3300005345 Ga0070692_10255945 Ga0070692_102559451 229
121 3300005347 Ga0070668_100294963 Ga0070668_1002949631 229
122 3300005354 Ga0070675_100076970 Ga0070675_1000769702 229
123 3300005355 Ga0070671_100267854 Ga0070671_1002678542 229
124 3300005356 Ga0070674_100477639 Ga0070674_1004776391 229
125 3300005364 Ga0070673_100770808 Ga0070673_1007708081 229
126 3300005365 Ga0070688_100002166 Ga0070688_1000021666 229
127 3300005366 Ga0070659_100032456 Ga0070659_1000324564 229
128 3300005367 Ga0070667_100355701 Ga0070667_1003557012 229
129 3300005444 Ga0070694_100512318 Ga0070694_1005123181 229
130 3300005455 Ga0070663_100138358 Ga0070663_1001383582 229
131 3300005455 Ga0070663_100263995 Ga0070663_1002639952 229
132 3300005457 Ga0070662_100993694 Ga0070662_1009936941 229
133 3300005458 Ga0070681_10033798 Ga0070681_100337983 229
134 3300005458 Ga0070681_10247465 Ga0070681_102474652 229
135 3300005458 Ga0070681_10389345 Ga0070681_103893452 229
136 3300005459 Ga0068867_100114652 Ga0068867_1001146522 229
137 3300005459 Ga0068867_100258067 Ga0068867_1002580672 229
138 3300005459 Ga0068867_100338431 Ga0068867_1003384311 229
139 3300005530 Ga0070679_100054082 Ga0070679_1000540824 229
140 3300005530 Ga0070679_100104850 Ga0070679_1001048502 229
141 3300005535 Ga0070684_100005645 Ga0070684_1000056455 229
142 3300005539 Ga0068853_100089920 Ga0068853_1000899202 229
143 3300005539 Ga0068853_100494491 Ga0068853_1004944912 229
144 3300005543 Ga0070672_100238544 Ga0070672_1002385442 229
145 3300005548 Ga0070665_100418798 Ga0070665_1004187981 229
146 3300005563 Ga0068855_100039366 Ga0068855_1000393664 229
147 3300005564 Ga0070664_100074517 Ga0070664_1000745174 229
148 3300005577 Ga0068857_100174400 Ga0068857_1001744002 229
149 3300005578 Ga0068854_100611099 Ga0068854_1006110992 229
150 3300005616 Ga0068852_100053358 Ga0068852_1000533582 229
151 3300005617 Ga0068859_100019894 Ga0068859_1000198944 229
152 3300005617 Ga0068859_100029635 Ga0068859_1000296355 229
153 3300005618 Ga0068864_100011141 Ga0068864_1000111411 229
154 3300005618 Ga0068864_100029348 Ga0068864_1000293481 229
155 3300005618 Ga0068864_100045286 Ga0068864_1000452863 229
156 3300005719 Ga0068861_100110453 Ga0068861_1001104531 229
157 3300005834 Ga0068851_10255719 Ga0068851_102557192 229
158 3300005841 Ga0068863_100931683 Ga0068863_1009316831 229
159 3300005843 Ga0068860_100012904 Ga0068860_1000129048 229
160 3300005843 Ga0068860_100283172 Ga0068860_1002831721 229
161 3300005843 Ga0068860_100616993 Ga0068860_1006169932 229
162 3300005844 Ga0068862_100005077 Ga0068862_1000050776 229
163 3300006358 Ga0068871_100439543 Ga0068871_1004395432 229
164 3300006931 Ga0097620_100019895 Ga0097620_1000198954 229
165 3300006931 Ga0097620_100029634 Ga0097620_1000296343 229
166 3300009553 Ga0105249_10000349 Ga0105249_1000034929 229
167 3300009553 Ga0105249_10228135 Ga0105249_102281352 229
168 3300013100 Ga0157373_10082601 Ga0157373_100826012 229
169 3300013100 Ga0157373_10190016 Ga0157373_101900163 229
170 3300013102 Ga0157371_10028376 Ga0157371_100283764 229
171 3300013102 Ga0157371_10049104 Ga0157371_100491043 229
172 3300013102 Ga0157371_10677130 Ga0157371_106771301 229
173 3300013104 Ga0157370_10004859 Ga0157370_100048597 229
174 3300013105 Ga0157369_10040230 Ga0157369_100402306 229
175 3300013296 Ga0157374_10031984 Ga0157374_100319843 229
176 3300013296 Ga0157374_10053553 Ga0157374_100535534 229
177 3300013297 Ga0157378_10018450 Ga0157378_100184503 229
178 3300013297 Ga0157378_10594185 Ga0157378_105941851 229
179 3300013306 Ga0163162_10172942 Ga0163162_101729422 229
180 3300013307 Ga0157372_10053387 Ga0157372_100533873 229
181 3300013307 Ga0157372_10107240 Ga0157372_101072403 229
182 3300013307 Ga0157372_11165304 Ga0157372_111653042 229
183 3300013307 Ga0157372_11372333 Ga0157372_113723331 229
184 3300013308 Ga0157375_10211732 Ga0157375_102117321 229
185 3300013308 Ga0157375_10227395 Ga0157375_102273952 229
186 3300014325 Ga0163163_10001753 Ga0163163_100017534 229
187 3300014325 Ga0163163_10276699 Ga0163163_102766992 229
188 3300014745 Ga0157377_10021575 Ga0157377_100215752 229
189 3300014745 Ga0157377_10083855 Ga0157377_100838553 229
190 3300014969 Ga0157376_10061038 Ga0157376_100610382 229
191 3300014969 Ga0157376_10543233 Ga0157376_105432332 229
192 3300017792 Ga0163161_10039345 Ga0163161_100393453 229
193 3300017792 Ga0163161_10409513 Ga0163161_104095132 229
194 3300021384 Ga0213876_10012974 Ga0213876_100129742 229
195 3300025315 Ga0207697_10114295 Ga0207697_101142952 229
196 3300025321 Ga0207656_10261089 Ga0207656_102610892 229
197 3300025904 Ga0207647_10041916 Ga0207647_100419164 229
198 3300025907 Ga0207645_10046954 Ga0207645_100469541 229
199 3300025907 Ga0207645_10082001 Ga0207645_100820012 229
200 3300025907 Ga0207645_10157573 Ga0207645_101575732 229
201 3300025911 Ga0207654_10224234 Ga0207654_102242342 229
202 3300025912 Ga0207707_10385436 Ga0207707_103854362 229
203 3300025912 Ga0207707_10386624 Ga0207707_103866242 229
204 3300025912 Ga0207707_10477052 Ga0207707_104770522 229
205 3300025917 Ga0207660_10021310 Ga0207660_100213103 229
206 3300025919 Ga0207657_10028682 Ga0207657_100286824 229
207 3300025919 Ga0207657_10088416 Ga0207657_100884164 229
208 3300025919 Ga0207657_10419254 Ga0207657_104192541 229
209 3300025920 Ga0207649_10087229 Ga0207649_100872292 229
210 3300025921 Ga0207652_10033484 Ga0207652_100334843 229
211 3300025925 Ga0207650_10086314 Ga0207650_100863142 229
212 3300025925 Ga0207650_10413451 Ga0207650_104134512 229
213 3300025926 Ga0207659_10014000 Ga0207659_100140002 229
214 3300025931 Ga0207644_10198384 Ga0207644_101983842 229
215 3300025932 Ga0207690_10017765 Ga0207690_100177652 229
216 3300025932 Ga0207690_10084309 Ga0207690_100843092 229
217 3300025933 Ga0207706_10027788 Ga0207706_100277882 229
218 3300025933 Ga0207706_10028286 Ga0207706_100282861 229
219 3300025933 Ga0207706_10817573 Ga0207706_108175731 229
220 3300025938 Ga0207704_10037235 Ga0207704_100372353 229
221 3300025938 Ga0207704_10620461 Ga0207704_106204611 229
222 3300025940 Ga0207691_10072636 Ga0207691_100726363 229
223 3300025940 Ga0207691_10089212 Ga0207691_100892123 229
224 3300025942 Ga0207689_10015942 Ga0207689_100159425 229
225 3300025942 Ga0207689_10035934 Ga0207689_100359344 229
226 3300025944 Ga0207661_10478636 Ga0207661_104786361 229
227 3300025944 Ga0207661_10806530 Ga0207661_108065301 229
228 3300025945 Ga0207679_10002585 Ga0207679_100025858 229
229 3300025949 Ga0207667_10086421 Ga0207667_100864212 229
230 3300025960 Ga0207651_10205281 Ga0207651_102052812 229
231 3300025961 Ga0207712_10008002 Ga0207712_100080025 229
232 3300025981 Ga0207640_10043487 Ga0207640_100434871 229
233 3300025986 Ga0207658_10058676 Ga0207658_100586762 229
234 3300026023 Ga0207677_10002528 Ga0207677_100025288 229
235 3300026023 Ga0207677_10054223 Ga0207677_100542233 229
236 3300026041 Ga0207639_10086953 Ga0207639_100869532 229
237 3300026067 Ga0207678_10063575 Ga0207678_100635753 229
238 3300026067 Ga0207678_10170807 Ga0207678_101708072 229
239 3300026089 Ga0207648_10079248 Ga0207648_100792482 229
240 3300026095 Ga0207676_10011316 Ga0207676_100113165 229
241 3300026095 Ga0207676_10069682 Ga0207676_100696823 229
242 3300026095 Ga0207676_10436645 Ga0207676_104366452 229
243 3300026116 Ga0207674_10027729 Ga0207674_100277292 229
244 3300026116 Ga0207674_10036746 Ga0207674_100367466 229
245 3300026116 Ga0207674_10456867 Ga0207674_104568672 229
246 3300026118 Ga0207675_100063971 Ga0207675_1000639713 229
247 3300026142 Ga0207698_10404643 Ga0207698_104046432 229
248 3300026142 Ga0207698_10422490 Ga0207698_104224901 229
249 3300026142 Ga0207698_10769692 Ga0207698_107696921 229
250 3300028380 Ga0268265_10096767 Ga0268265_100967672 229
251 3300028380 Ga0268265_10266513 Ga0268265_102665132 229
252 3300028381 Ga0268264_10025491 Ga0268264_100254913 229
253 3300031251 Ga0265327_10062068 Ga0265327_100620682 229
254 3300037312 Ga0395899_0015685 Ga0395899_0015685_41_730 229
255 3300037418 Ga0395900_0047839 Ga0395900_0047839_1734_2423 229
256 3300037466 Ga0395898_0015536 Ga0395898_0015536_44_733 229
257 3300038443 Ga0395901_0003272 Ga0395901_0003272_635_1324 229
258 3300039437 Ga0436365_0298838 Ga0436365_0298838_445_1134 229
259 3300039437 Ga0436365_1778757 Ga0436365_1778757_3776_4465 229
260 3300044658 Ga0466972_0000016 Ga0466972_0000016_139020_139709 229
261 3300044712 Ga0453684_0021387 Ga0453684_0021387_1306_1998 229
262 3300044712 Ga0453684_0038554 Ga0453684_0038554_826_1524 229
263 3300044765 Ga0466970_0043550 Ga0466970_0043550_1353_2042 229
264 3300045051 Ga0451576_0133276 Ga0451576_0133276_1019_1717 229
265 3300048912 Ga0496109_0288820 Ga0496109_0288820_713_1429 229
266 3300048913 Ga0496110_0065694 Ga0496110_0065694_1212_1928 229
267 3300049568 Ga0501031_0363715 Ga0501031_0363715_149_838 229
268 3300049569 Ga0501032_0201334 Ga0501032_0201334_83_772 229
269 3300049570 Ga0501033_0006858 Ga0501033_0006858_3805_4494 229
270 3300049570 Ga0501033_0094311 Ga0501033_0094311_311_1000 229
271 3300049571 Ga0501034_0012890 Ga0501034_0012890_1709_2398 229
272 3300049571 Ga0501034_0022986 Ga0501034_0022986_3885_4574 229
273 3300049571 Ga0501034_0097671 Ga0501034_0097671_340_1029 229
274 3300049571 Ga0501034_0106927 Ga0501034_0106927_78_767 229
275 3300049573 Ga0501037_0175444 Ga0501037_0175444_47_736 229
276 3300049574 Ga0501038_0100211 Ga0501038_0100211_107_796 229
277 3300049586 Ga0501070_0396254 Ga0501070_0396254_395_1084 229
278 3300049742 Ga0501080_0314414 Ga0501080_0314414_561_1250 229
279 3300049822 Ga0501035_0065820 Ga0501035_0065820_669_1358 229
280 3300049822 Ga0501035_0531458 Ga0501035_0531458_72_761 229
281 3300049823 Ga0501044_0026210 Ga0501044_0026210_1680_2369 229
282 2162886011 MRS1b_contig_8282875 MRS1b_0034.00002960 230
283 2162886012 MBSR1b_contig_807238 MBSR1b_0974.00005190 230
284 3300002077 JGI24744J21845_10019960 JGI24744J21845_100199601 230
285 3300002155 JGI24033J26618_1007474 JGI24033J26618_10074742 230
286 3300003203 JGI25406J46586_10000143 JGI25406J46586_100001438 230
287 3300003203 JGI25406J46586_10048452 JGI25406J46586_100484522 230
288 3300003316 rootH1_10024197 rootH1_100241973 230
289 3300003322 rootL2_10216868 rootL2_102168683 230
290 3300003322 rootL2_10230147 rootL2_102301472 230
291 3300003323 rootH1_10073697 rootH1_100736973 230
292 3300005288 Ga0065714_10090598 Ga0065714_100905983 230
293 3300005289 Ga0065704_10091559 Ga0065704_100915592 230
294 3300005289 Ga0065704_10149944 Ga0065704_101499442 230
295 3300005290 Ga0065712_10114193 Ga0065712_101141931 230
296 3300005293 Ga0065715_10008112 Ga0065715_100081122 230
297 3300005293 Ga0065715_10189048 Ga0065715_101890482 230
298 3300005293 Ga0065715_10381257 Ga0065715_103812571 230
299 3300005328 Ga0070676_10000238 Ga0070676_100002388 230
300 3300005328 Ga0070676_10173976 Ga0070676_101739761 230
301 3300005328 Ga0070676_10341912 Ga0070676_103419121 230
302 3300005330 Ga0070690_100018274 Ga0070690_1000182744 230
303 3300005331 Ga0070670_100021331 Ga0070670_1000213312 230
304 3300005331 Ga0070670_100066171 Ga0070670_1000661712 230
305 3300005331 Ga0070670_100088043 Ga0070670_1000880432 230
306 3300005331 Ga0070670_100092922 Ga0070670_1000929223 230
307 3300005331 Ga0070670_100257530 Ga0070670_1002575303 230
308 3300005331 Ga0070670_100541003 Ga0070670_1005410032 230
309 3300005333 Ga0070677_10011093 Ga0070677_100110933 230
310 3300005334 Ga0068869_100005951 Ga0068869_1000059517 230
311 3300005334 Ga0068869_100010616 Ga0068869_1000106163 230
312 3300005334 Ga0068869_100011620 Ga0068869_1000116203 230
313 3300005334 Ga0068869_100017491 Ga0068869_1000174913 230
314 3300005334 Ga0068869_100029659 Ga0068869_1000296591 230
315 3300005334 Ga0068869_100081983 Ga0068869_1000819832 230
316 3300005334 Ga0068869_100158273 Ga0068869_1001582732 230
317 3300005334 Ga0068869_100318764 Ga0068869_1003187642 230
318 3300005335 Ga0070666_10000019 Ga0070666_10000019122 230
319 3300005335 Ga0070666_10000966 Ga0070666_100009664 230
320 3300005335 Ga0070666_10173240 Ga0070666_101732402 230
321 3300005335 Ga0070666_10232849 Ga0070666_102328491 230
322 3300005336 Ga0070680_100000930 Ga0070680_10000093013 230
323 3300005337 Ga0070682_100000423 Ga0070682_10000042317 230
324 3300005337 Ga0070682_100001176 Ga0070682_10000117610 230
325 3300005337 Ga0070682_100079043 Ga0070682_1000790432 230
326 3300005337 Ga0070682_100091788 Ga0070682_1000917882 230
327 3300005337 Ga0070682_100259407 Ga0070682_1002594072 230
328 3300005338 Ga0068868_100002525 Ga0068868_1000025257 230
329 3300005338 Ga0068868_100004975 Ga0068868_1000049756 230
330 3300005338 Ga0068868_100019194 Ga0068868_1000191945 230
331 3300005338 Ga0068868_100063169 Ga0068868_1000631692 230
332 3300005338 Ga0068868_100144041 Ga0068868_1001440412 230
333 3300005339 Ga0070660_100122274 Ga0070660_1001222742 230
334 3300005339 Ga0070660_100533699 Ga0070660_1005336991 230
335 3300005340 Ga0070689_100023578 Ga0070689_1000235786 230
336 3300005340 Ga0070689_100188755 Ga0070689_1001887551 230
337 3300005343 Ga0070687_100013338 Ga0070687_1000133383 230
338 3300005343 Ga0070687_100080022 Ga0070687_1000800222 230
339 3300005347 Ga0070668_100000981 Ga0070668_10000098113 230
340 3300005347 Ga0070668_100016663 Ga0070668_1000166634 230
341 3300005347 Ga0070668_100037453 Ga0070668_1000374533 230
342 3300005347 Ga0070668_100140486 Ga0070668_1001404862 230
343 3300005347 Ga0070668_100159587 Ga0070668_1001595871 230
344 3300005347 Ga0070668_100235022 Ga0070668_1002350222 230
345 3300005353 Ga0070669_100000826 Ga0070669_10000082617 230
346 3300005353 Ga0070669_100023785 Ga0070669_1000237854 230
347 3300005353 Ga0070669_100096692 Ga0070669_1000966922 230
348 3300005353 Ga0070669_100206721 Ga0070669_1002067211 230
349 3300005354 Ga0070675_100011529 Ga0070675_1000115297 230
350 3300005354 Ga0070675_100012707 Ga0070675_1000127073 230
351 3300005354 Ga0070675_100069637 Ga0070675_1000696372 230
352 3300005354 Ga0070675_100281514 Ga0070675_1002815142 230
353 3300005354 Ga0070675_100560982 Ga0070675_1005609821 230
354 3300005355 Ga0070671_100032220 Ga0070671_1000322202 230
355 3300005355 Ga0070671_100054717 Ga0070671_1000547173 230
356 3300005355 Ga0070671_100224205 Ga0070671_1002242052 230
357 3300005355 Ga0070671_100641687 Ga0070671_1006416871 230
358 3300005356 Ga0070674_100136372 Ga0070674_1001363723 230
359 3300005364 Ga0070673_100001854 Ga0070673_1000018544 230
360 3300005364 Ga0070673_100008764 Ga0070673_1000087645 230
361 3300005364 Ga0070673_100012202 Ga0070673_1000122022 230
362 3300005364 Ga0070673_100036038 Ga0070673_1000360383 230
363 3300005364 Ga0070673_100079878 Ga0070673_1000798782 230
364 3300005364 Ga0070673_100112347 Ga0070673_1001123472 230
365 3300005364 Ga0070673_100130947 Ga0070673_1001309472 230
366 3300005364 Ga0070673_100138587 Ga0070673_1001385872 230
367 3300005364 Ga0070673_100219197 Ga0070673_1002191972 230
368 3300005365 Ga0070688_100001299 Ga0070688_1000012993 230
369 3300005365 Ga0070688_100253364 Ga0070688_1002533642 230
370 3300005367 Ga0070667_100001589 Ga0070667_10000158916 230
371 3300005367 Ga0070667_100011530 Ga0070667_1000115304 230
372 3300005367 Ga0070667_100012973 Ga0070667_1000129732 230
373 3300005367 Ga0070667_100014864 Ga0070667_1000148647 230
374 3300005367 Ga0070667_100226056 Ga0070667_1002260562 230
375 3300005367 Ga0070667_100242036 Ga0070667_1002420362 230
376 3300005367 Ga0070667_100257172 Ga0070667_1002571722 230
377 3300005367 Ga0070667_100406789 Ga0070667_1004067892 230
378 3300005441 Ga0070700_100148522 Ga0070700_1001485221 230
379 3300005455 Ga0070663_100452975 Ga0070663_1004529751 230
380 3300005456 Ga0070678_100003466 Ga0070678_1000034662 230
381 3300005456 Ga0070678_100325856 Ga0070678_1003258562 230
382 3300005456 Ga0070678_100478616 Ga0070678_1004786162 230
383 3300005457 Ga0070662_100002104 Ga0070662_1000021043 230
384 3300005457 Ga0070662_100237271 Ga0070662_1002372712 230
385 3300005458 Ga0070681_10078658 Ga0070681_100786584 230
386 3300005459 Ga0068867_100004334 Ga0068867_1000043344 230
387 3300005459 Ga0068867_100011177 Ga0068867_1000111775 230
388 3300005459 Ga0068867_100015145 Ga0068867_1000151453 230
389 3300005459 Ga0068867_100028178 Ga0068867_1000281782 230
390 3300005459 Ga0068867_100028654 Ga0068867_1000286545 230
391 3300005459 Ga0068867_100054313 Ga0068867_1000543133 230
392 3300005459 Ga0068867_100064586 Ga0068867_1000645863 230
393 3300005459 Ga0068867_100108848 Ga0068867_1001088483 230
394 3300005459 Ga0068867_100117163 Ga0068867_1001171631 230
395 3300005459 Ga0068867_100725156 Ga0068867_1007251562 230
396 3300005466 Ga0070685_10128264 Ga0070685_101282642 230
397 3300005467 Ga0070706_100444877 Ga0070706_1004448771 230
398 3300005468 Ga0070707_100148980 Ga0070707_1001489801 230
399 3300005471 Ga0070698_100001267 Ga0070698_10000126715 230
400 3300005471 Ga0070698_100019395 Ga0070698_1000193955 230
401 3300005471 Ga0070698_100054424 Ga0070698_1000544245 230
402 3300005471 Ga0070698_100066940 Ga0070698_1000669401 230
403 3300005471 Ga0070698_100664676 Ga0070698_1006646761 230
404 3300005518 Ga0070699_100055087 Ga0070699_1000550874 230
405 3300005530 Ga0070679_100062849 Ga0070679_1000628492 230
406 3300005536 Ga0070697_100334894 Ga0070697_1003348941 230
407 3300005539 Ga0068853_100009326 Ga0068853_1000093263 230
408 3300005539 Ga0068853_100085771 Ga0068853_1000857713 230
409 3300005539 Ga0068853_100165384 Ga0068853_1001653843 230
410 3300005539 Ga0068853_100176568 Ga0068853_1001765683 230
411 3300005539 Ga0068853_100346450 Ga0068853_1003464502 230
412 3300005543 Ga0070672_100001555 Ga0070672_1000015554 230
413 3300005543 Ga0070672_100011979 Ga0070672_1000119795 230
414 3300005543 Ga0070672_100058606 Ga0070672_1000586062 230
415 3300005543 Ga0070672_100112553 Ga0070672_1001125532 230
416 3300005543 Ga0070672_100388203 Ga0070672_1003882032 230
417 3300005543 Ga0070672_100539695 Ga0070672_1005396952 230
418 3300005544 Ga0070686_100213621 Ga0070686_1002136212 230
419 3300005544 Ga0070686_100475980 Ga0070686_1004759802 230
420 3300005544 Ga0070686_100477280 Ga0070686_1004772801 230
421 3300005547 Ga0070693_100071864 Ga0070693_1000718642 230
422 3300005547 Ga0070693_100092842 Ga0070693_1000928422 230
423 3300005548 Ga0070665_100002381 Ga0070665_10000238110 230
424 3300005548 Ga0070665_100018175 Ga0070665_1000181754 230
425 3300005548 Ga0070665_100687807 Ga0070665_1006878071 230
426 3300005563 Ga0068855_100005983 Ga0068855_1000059833 230
427 3300005563 Ga0068855_100083430 Ga0068855_1000834303 230
428 3300005563 Ga0068855_100253182 Ga0068855_1002531821 230
429 3300005564 Ga0070664_100061322 Ga0070664_1000613222 230
430 3300005564 Ga0070664_100064495 Ga0070664_1000644953 230
431 3300005564 Ga0070664_100533505 Ga0070664_1005335052 230
432 3300005564 Ga0070664_100573254 Ga0070664_1005732542 230
433 3300005577 Ga0068857_100023123 Ga0068857_1000231234 230
434 3300005577 Ga0068857_100597673 Ga0068857_1005976732 230
435 3300005578 Ga0068854_100037680 Ga0068854_1000376802 230
436 3300005578 Ga0068854_100189763 Ga0068854_1001897632 230
437 3300005614 Ga0068856_100007851 Ga0068856_1000078513 230
438 3300005615 Ga0070702_100066427 Ga0070702_1000664273 230
439 3300005615 Ga0070702_100113874 Ga0070702_1001138741 230
440 3300005616 Ga0068852_100031375 Ga0068852_1000313753 230
441 3300005616 Ga0068852_100102496 Ga0068852_1001024962 230
442 3300005616 Ga0068852_100135178 Ga0068852_1001351782 230
443 3300005617 Ga0068859_100000013 Ga0068859_100000013157 230
444 3300005617 Ga0068859_100010041 Ga0068859_1000100416 230
445 3300005617 Ga0068859_100019858 Ga0068859_1000198583 230
446 3300005617 Ga0068859_100029925 Ga0068859_1000299252 230
447 3300005617 Ga0068859_100038541 Ga0068859_1000385415 230
448 3300005617 Ga0068859_100054597 Ga0068859_1000545973 230
449 3300005617 Ga0068859_100058980 Ga0068859_1000589803 230
450 3300005617 Ga0068859_100090332 Ga0068859_1000903323 230
451 3300005617 Ga0068859_100139162 Ga0068859_1001391622 230
452 3300005617 Ga0068859_100284061 Ga0068859_1002840612 230
453 3300005617 Ga0068859_100382405 Ga0068859_1003824052 230
454 3300005617 Ga0068859_100632298 Ga0068859_1006322982 230
455 3300005618 Ga0068864_100000357 Ga0068864_1000003577 230
456 3300005618 Ga0068864_100001339 Ga0068864_1000013397 230
457 3300005618 Ga0068864_100450642 Ga0068864_1004506422 230
458 3300005618 Ga0068864_100498590 Ga0068864_1004985903 230
459 3300005718 Ga0068866_10003544 Ga0068866_100035446 230
460 3300005718 Ga0068866_10217405 Ga0068866_102174052 230
461 3300005719 Ga0068861_100009344 Ga0068861_1000093443 230
462 3300005719 Ga0068861_100014355 Ga0068861_1000143555 230
463 3300005719 Ga0068861_100045063 Ga0068861_1000450633 230
464 3300005719 Ga0068861_100141357 Ga0068861_1001413572 230
465 3300005719 Ga0068861_100279769 Ga0068861_1002797692 230
466 3300005719 Ga0068861_100361218 Ga0068861_1003612182 230
467 3300005719 Ga0068861_100372015 Ga0068861_1003720152 230
468 3300005834 Ga0068851_10000433 Ga0068851_1000043316 230
469 3300005834 Ga0068851_10025715 Ga0068851_100257151 230
470 3300005834 Ga0068851_10252166 Ga0068851_102521661 230
471 3300005840 Ga0068870_10001616 Ga0068870_100016164 230
472 3300005840 Ga0068870_10088732 Ga0068870_100887322 230
473 3300005840 Ga0068870_10436643 Ga0068870_104366431 230
474 3300005841 Ga0068863_100001616 Ga0068863_1000016163 230
475 3300005841 Ga0068863_100002217 Ga0068863_10000221710 230
476 3300005841 Ga0068863_100026605 Ga0068863_1000266055 230
477 3300005841 Ga0068863_100067788 Ga0068863_1000677883 230
478 3300005841 Ga0068863_100110030 Ga0068863_1001100302 230
479 3300005841 Ga0068863_100275815 Ga0068863_1002758152 230
480 3300005841 Ga0068863_100299336 Ga0068863_1002993362 230
481 3300005841 Ga0068863_100352403 Ga0068863_1003524031 230
482 3300005841 Ga0068863_100626159 Ga0068863_1006261592 230
483 3300005842 Ga0068858_100006851 Ga0068858_1000068519 230
484 3300005842 Ga0068858_100013114 Ga0068858_1000131147 230
485 3300005842 Ga0068858_100102257 Ga0068858_1001022572 230
486 3300005842 Ga0068858_100126686 Ga0068858_1001266863 230
487 3300005842 Ga0068858_100789562 Ga0068858_1007895622 230
488 3300005843 Ga0068860_100000948 Ga0068860_1000009483 230
489 3300005843 Ga0068860_100002928 Ga0068860_1000029287 230
490 3300005843 Ga0068860_100008208 Ga0068860_1000082084 230
491 3300005843 Ga0068860_100011092 Ga0068860_1000110928 230
492 3300005843 Ga0068860_100019036 Ga0068860_1000190366 230
493 3300005843 Ga0068860_100037012 Ga0068860_1000370126 230
494 3300005843 Ga0068860_100163293 Ga0068860_1001632933 230
495 3300005843 Ga0068860_100174243 Ga0068860_1001742433 230
496 3300005843 Ga0068860_100188881 Ga0068860_1001888812 230
497 3300005844 Ga0068862_100040502 Ga0068862_1000405024 230
498 3300005844 Ga0068862_100110877 Ga0068862_1001108773 230
499 3300005844 Ga0068862_100167921 Ga0068862_1001679213 230
500 3300005844 Ga0068862_100452332 Ga0068862_1004523322 230
501 3300005985 Ga0081539_10000402 Ga0081539_1000040274 230
502 3300005985 Ga0081539_10026620 Ga0081539_100266203 230
503 3300006195 Ga0075366_10005580 Ga0075366_100055802 230
504 3300006195 Ga0075366_10010004 Ga0075366_100100042 230
505 3300006195 Ga0075366_10083828 Ga0075366_100838283 230
506 3300006195 Ga0075366_10244292 Ga0075366_102442921 230
507 3300006237 Ga0097621_100000960 Ga0097621_10000096012 230
508 3300006237 Ga0097621_100003944 Ga0097621_1000039444 230
509 3300006237 Ga0097621_100017259 Ga0097621_1000172593 230
510 3300006237 Ga0097621_100040578 Ga0097621_1000405783 230
511 3300006237 Ga0097621_100110271 Ga0097621_1001102711 230
512 3300006353 Ga0075370_10147888 Ga0075370_101478882 230
513 3300006353 Ga0075370_10204252 Ga0075370_102042522 230
514 3300006358 Ga0068871_100000582 Ga0068871_1000005823 230
515 3300006358 Ga0068871_100001510 Ga0068871_10000151013 230
516 3300006358 Ga0068871_100001981 Ga0068871_1000019818 230
517 3300006358 Ga0068871_100076476 Ga0068871_1000764762 230
518 3300006358 Ga0068871_100116632 Ga0068871_1001166322 230
519 3300006358 Ga0068871_100348634 Ga0068871_1003486341 230
520 3300006358 Ga0068871_100353048 Ga0068871_1003530482 230
521 3300006358 Ga0068871_100564957 Ga0068871_1005649571 230
522 3300006358 Ga0068871_100649722 Ga0068871_1006497222 230
523 3300006844 Ga0075428_100041147 Ga0075428_1000411475 230
524 3300006846 Ga0075430_100005897 Ga0075430_1000058974 230
525 3300006847 Ga0075431_100020982 Ga0075431_1000209822 230
526 3300006847 Ga0075431_100317946 Ga0075431_1003179462 230
527 3300006880 Ga0075429_100030293 Ga0075429_1000302934 230
528 3300006880 Ga0075429_100157104 Ga0075429_1001571042 230
529 3300006881 Ga0068865_100005767 Ga0068865_1000057677 230
530 3300006881 Ga0068865_100018860 Ga0068865_1000188604 230
531 3300006881 Ga0068865_100162117 Ga0068865_1001621173 230
532 3300006931 Ga0097620_100000013 Ga0097620_100000013157 230
533 3300006931 Ga0097620_100010041 Ga0097620_1000100415 230
534 3300006931 Ga0097620_100019858 Ga0097620_1000198587 230
535 3300006931 Ga0097620_100029926 Ga0097620_1000299262 230
536 3300006931 Ga0097620_100038543 Ga0097620_1000385435 230
537 3300006931 Ga0097620_100054597 Ga0097620_1000545973 230
538 3300006931 Ga0097620_100058980 Ga0097620_1000589803 230
539 3300006931 Ga0097620_100090336 Ga0097620_1000903363 230
540 3300006931 Ga0097620_100139165 Ga0097620_1001391652 230
541 3300006931 Ga0097620_100284040 Ga0097620_1002840402 230
542 3300006931 Ga0097620_100382392 Ga0097620_1003823922 230
543 3300006931 Ga0097620_100632282 Ga0097620_1006322822 230
544 3300009093 Ga0105240_10001908 Ga0105240_100019087 230
545 3300009094 Ga0111539_10028550 Ga0111539_100285501 230
546 3300009094 Ga0111539_10047620 Ga0111539_100476203 230
547 3300009094 Ga0111539_10114039 Ga0111539_101140392 230
548 3300009094 Ga0111539_10129092 Ga0111539_101290924 230
549 3300009094 Ga0111539_11278505 Ga0111539_112785051 230
550 3300009098 Ga0105245_10051281 Ga0105245_100512812 230
551 3300009098 Ga0105245_10068267 Ga0105245_100682672 230
552 3300009101 Ga0105247_10000906 Ga0105247_1000090619 230
553 3300009101 Ga0105247_10011607 Ga0105247_100116075 230
554 3300009147 Ga0114129_10033187 Ga0114129_100331873 230
555 3300009148 Ga0105243_10070257 Ga0105243_100702572 230
556 3300009148 Ga0105243_10073565 Ga0105243_100735653 230
557 3300009174 Ga0105241_10000858 Ga0105241_1000085813 230
558 3300009174 Ga0105241_10005708 Ga0105241_100057087 230
559 3300009174 Ga0105241_10008625 Ga0105241_100086255 230
560 3300009174 Ga0105241_10097998 Ga0105241_100979982 230
561 3300009174 Ga0105241_10200902 Ga0105241_102009022 230
562 3300009174 Ga0105241_10437512 Ga0105241_104375122 230
563 3300009174 Ga0105241_10619090 Ga0105241_106190901 230
564 3300009176 Ga0105242_10010225 Ga0105242_100102252 230
565 3300009176 Ga0105242_10029115 Ga0105242_100291152 230
566 3300009176 Ga0105242_10042800 Ga0105242_100428004 230
567 3300009176 Ga0105242_10066209 Ga0105242_100662092 230
568 3300009176 Ga0105242_10164073 Ga0105242_101640731 230
569 3300009176 Ga0105242_10276328 Ga0105242_102763282 230
570 3300009176 Ga0105242_10331238 Ga0105242_103312382 230
571 3300009176 Ga0105242_10419863 Ga0105242_104198632 230
572 3300009176 Ga0105242_10835750 Ga0105242_108357501 230
573 3300009177 Ga0105248_10074758 Ga0105248_100747584 230
574 3300009177 Ga0105248_10085106 Ga0105248_100851064 230
575 3300009545 Ga0105237_10026673 Ga0105237_100266731 230
576 3300009545 Ga0105237_10038845 Ga0105237_100388455 230
577 3300009553 Ga0105249_10001507 Ga0105249_100015079 230
578 3300009553 Ga0105249_10001918 Ga0105249_1000191812 230
579 3300009553 Ga0105249_10006005 Ga0105249_100060053 230
580 3300009553 Ga0105249_10011132 Ga0105249_100111324 230
581 3300009553 Ga0105249_10032555 Ga0105249_100325555 230
582 3300009553 Ga0105249_10052361 Ga0105249_100523613 230
583 3300009553 Ga0105249_10077670 Ga0105249_100776703 230
584 3300009553 Ga0105249_10109955 Ga0105249_101099552 230
585 3300009553 Ga0105249_10240861 Ga0105249_102408612 230
586 3300010375 Ga0105239_10001102 Ga0105239_100011028 230
587 3300010375 Ga0105239_10582044 Ga0105239_105820442 230
588 3300011119 Ga0105246_10012996 Ga0105246_100129963 230
589 3300011119 Ga0105246_10204976 Ga0105246_102049762 230
590 3300013104 Ga0157370_10001507 Ga0157370_100015077 230
591 3300013104 Ga0157370_10294963 Ga0157370_102949632 230
592 3300013296 Ga0157374_10002251 Ga0157374_100022518 230
593 3300013296 Ga0157374_10141538 Ga0157374_101415383 230
594 3300013296 Ga0157374_10705627 Ga0157374_107056272 230
595 3300013296 Ga0157374_10983454 Ga0157374_109834541 230
596 3300013297 Ga0157378_10011546 Ga0157378_100115467 230
597 3300013297 Ga0157378_10013523 Ga0157378_100135232 230
598 3300013297 Ga0157378_10015823 Ga0157378_100158235 230
599 3300013297 Ga0157378_10017243 Ga0157378_100172436 230
600 3300013297 Ga0157378_10020057 Ga0157378_100200576 230
601 3300013297 Ga0157378_10029140 Ga0157378_100291406 230
602 3300013297 Ga0157378_10051030 Ga0157378_100510303 230
603 3300013297 Ga0157378_10073011 Ga0157378_100730113 230
604 3300013297 Ga0157378_10670193 Ga0157378_106701932 230
605 3300013297 Ga0157378_10763422 Ga0157378_107634222 230
606 3300013297 Ga0157378_10872330 Ga0157378_108723302 230
607 3300013306 Ga0163162_10001002 Ga0163162_100010025 230
608 3300013306 Ga0163162_10001863 Ga0163162_1000186312 230
609 3300013306 Ga0163162_10012341 Ga0163162_100123417 230
610 3300013306 Ga0163162_10054538 Ga0163162_100545382 230
611 3300013306 Ga0163162_10153151 Ga0163162_101531512 230
612 3300013306 Ga0163162_10359976 Ga0163162_103599762 230
613 3300013306 Ga0163162_10368078 Ga0163162_103680781 230
614 3300013307 Ga0157372_10156597 Ga0157372_101565973 230
615 3300013308 Ga0157375_10000186 Ga0157375_100001869 230
616 3300013308 Ga0157375_10000827 Ga0157375_1000082716 230
617 3300013308 Ga0157375_10035495 Ga0157375_100354954 230
618 3300013308 Ga0157375_10133808 Ga0157375_101338082 230
619 3300013308 Ga0157375_10152272 Ga0157375_101522724 230
620 3300013308 Ga0157375_10403786 Ga0157375_104037861 230
621 3300013308 Ga0157375_10503547 Ga0157375_105035472 230
622 3300013308 Ga0157375_10624499 Ga0157375_106244992 230
623 3300014325 Ga0163163_10066412 Ga0163163_100664123 230
624 3300014325 Ga0163163_10140861 Ga0163163_101408612 230
625 3300014325 Ga0163163_10621308 Ga0163163_106213082 230
626 3300014326 Ga0157380_10000650 Ga0157380_1000065013 230
627 3300014326 Ga0157380_10003052 Ga0157380_100030523 230
628 3300014326 Ga0157380_10025482 Ga0157380_100254822 230
629 3300014326 Ga0157380_10371768 Ga0157380_103717681 230
630 3300014326 Ga0157380_10444385 Ga0157380_104443852 230
631 3300014326 Ga0157380_10521547 Ga0157380_105215471 230
632 3300014745 Ga0157377_10000426 Ga0157377_1000042615 230
633 3300014745 Ga0157377_10026874 Ga0157377_100268742 230
634 3300014745 Ga0157377_10066059 Ga0157377_100660593 230
635 3300014968 Ga0157379_10000976 Ga0157379_1000097613 230
636 3300014968 Ga0157379_10016659 Ga0157379_100166595 230
637 3300014968 Ga0157379_10037296 Ga0157379_100372965 230
638 3300014968 Ga0157379_10180962 Ga0157379_101809622 230
639 3300014968 Ga0157379_10429861 Ga0157379_104298612 230
640 3300014969 Ga0157376_10000650 Ga0157376_100006505 230
641 3300014969 Ga0157376_10008988 Ga0157376_100089885 230
642 3300014969 Ga0157376_10124854 Ga0157376_101248542 230
643 3300017792 Ga0163161_10004470 Ga0163161_100044705 230
644 3300017792 Ga0163161_10025267 Ga0163161_100252675 230
645 3300017792 Ga0163161_10044628 Ga0163161_100446282 230
646 3300025321 Ga0207656_10001978 Ga0207656_100019785 230
647 3300025321 Ga0207656_10011320 Ga0207656_100113203 230
648 3300025321 Ga0207656_10034210 Ga0207656_100342102 230
649 3300025893 Ga0207682_10021187 Ga0207682_100211872 230
650 3300025893 Ga0207682_10025688 Ga0207682_100256883 230
651 3300025893 Ga0207682_10031701 Ga0207682_100317012 230
652 3300025899 Ga0207642_10006779 Ga0207642_100067794 230
653 3300025900 Ga0207710_10000417 Ga0207710_100004179 230
654 3300025900 Ga0207710_10103541 Ga0207710_101035411 230
655 3300025901 Ga0207688_10120088 Ga0207688_101200882 230
656 3300025903 Ga0207680_10000673 Ga0207680_100006733 230
657 3300025903 Ga0207680_10105322 Ga0207680_101053222 230
658 3300025903 Ga0207680_10204976 Ga0207680_102049762 230
659 3300025903 Ga0207680_10233803 Ga0207680_102338032 230
660 3300025905 Ga0207685_10128385 Ga0207685_101283852 230
661 3300025907 Ga0207645_10000684 Ga0207645_1000068423 230
662 3300025907 Ga0207645_10001198 Ga0207645_1000119812 230
663 3300025907 Ga0207645_10015549 Ga0207645_100155491 230
664 3300025907 Ga0207645_10065076 Ga0207645_100650761 230
665 3300025907 Ga0207645_10103782 Ga0207645_101037821 230
666 3300025907 Ga0207645_10307144 Ga0207645_103071442 230
667 3300025908 Ga0207643_10010782 Ga0207643_100107824 230
668 3300025908 Ga0207643_10021449 Ga0207643_100214493 230
669 3300025908 Ga0207643_10304794 Ga0207643_103047942 230
670 3300025909 Ga0207705_10010195 Ga0207705_100101954 230
671 3300025911 Ga0207654_10000569 Ga0207654_1000056912 230
672 3300025911 Ga0207654_10002605 Ga0207654_100026059 230
673 3300025911 Ga0207654_10304868 Ga0207654_103048682 230
674 3300025911 Ga0207654_10315026 Ga0207654_103150261 230
675 3300025912 Ga0207707_10000299 Ga0207707_1000029927 230
676 3300025913 Ga0207695_10014544 Ga0207695_100145447 230
677 3300025914 Ga0207671_10007851 Ga0207671_1000785112 230
678 3300025914 Ga0207671_10018917 Ga0207671_100189175 230
679 3300025917 Ga0207660_10004975 Ga0207660_100049758 230
680 3300025918 Ga0207662_10000535 Ga0207662_100005355 230
681 3300025919 Ga0207657_10113696 Ga0207657_101136962 230
682 3300025921 Ga0207652_10013799 Ga0207652_100137997 230
683 3300025921 Ga0207652_10222080 Ga0207652_102220802 230
684 3300025922 Ga0207646_10798337 Ga0207646_107983371 230
685 3300025923 Ga0207681_10085979 Ga0207681_100859792 230
686 3300025923 Ga0207681_10097085 Ga0207681_100970853 230
687 3300025923 Ga0207681_10129501 Ga0207681_101295011 230
688 3300025923 Ga0207681_10225019 Ga0207681_102250192 230
689 3300025923 Ga0207681_10270733 Ga0207681_102707332 230
690 3300025923 Ga0207681_10355544 Ga0207681_103555441 230
691 3300025925 Ga0207650_10095012 Ga0207650_100950122 230
692 3300025925 Ga0207650_10099351 Ga0207650_100993512 230
693 3300025925 Ga0207650_10114342 Ga0207650_101143422 230
694 3300025925 Ga0207650_10150942 Ga0207650_101509423 230
695 3300025925 Ga0207650_10271446 Ga0207650_102714462 230
696 3300025926 Ga0207659_10009317 Ga0207659_100093172 230
697 3300025926 Ga0207659_10014978 Ga0207659_100149783 230
698 3300025926 Ga0207659_10050875 Ga0207659_100508752 230
699 3300025926 Ga0207659_10055643 Ga0207659_100556432 230
700 3300025926 Ga0207659_10193585 Ga0207659_101935852 230
701 3300025927 Ga0207687_10283307 Ga0207687_102833071 230
702 3300025931 Ga0207644_10033752 Ga0207644_100337523 230
703 3300025931 Ga0207644_10208113 Ga0207644_102081132 230
704 3300025931 Ga0207644_10548283 Ga0207644_105482832 230
705 3300025931 Ga0207644_10782563 Ga0207644_107825631 230
706 3300025932 Ga0207690_10256772 Ga0207690_102567722 230
707 3300025933 Ga0207706_10005121 Ga0207706_100051219 230
708 3300025933 Ga0207706_10340490 Ga0207706_103404902 230
709 3300025934 Ga0207686_10001802 Ga0207686_100018026 230
710 3300025934 Ga0207686_10045206 Ga0207686_100452062 230
711 3300025934 Ga0207686_10147386 Ga0207686_101473862 230
712 3300025934 Ga0207686_10705821 Ga0207686_107058211 230
713 3300025935 Ga0207709_10061250 Ga0207709_100612502 230
714 3300025936 Ga0207670_10136932 Ga0207670_101369322 230
715 3300025936 Ga0207670_10713195 Ga0207670_107131951 230
716 3300025937 Ga0207669_10055077 Ga0207669_100550773 230
717 3300025937 Ga0207669_10093896 Ga0207669_100938962 230
718 3300025937 Ga0207669_10385712 Ga0207669_103857121 230
719 3300025938 Ga0207704_10037101 Ga0207704_100371012 230
720 3300025938 Ga0207704_10093507 Ga0207704_100935072 230
721 3300025938 Ga0207704_10280838 Ga0207704_102808382 230
722 3300025940 Ga0207691_10000076 Ga0207691_1000007619 230
723 3300025940 Ga0207691_10003310 Ga0207691_100033102 230
724 3300025940 Ga0207691_10026563 Ga0207691_100265634 230
725 3300025940 Ga0207691_10040327 Ga0207691_100403273 230
726 3300025940 Ga0207691_10079309 Ga0207691_100793092 230
727 3300025940 Ga0207691_10099507 Ga0207691_100995073 230
728 3300025940 Ga0207691_10669181 Ga0207691_106691812 230
729 3300025941 Ga0207711_10109221 Ga0207711_101092212 230
730 3300025941 Ga0207711_10255166 Ga0207711_102551661 230
731 3300025942 Ga0207689_10001148 Ga0207689_1000114812 230
732 3300025942 Ga0207689_10002202 Ga0207689_100022027 230
733 3300025942 Ga0207689_10004010 Ga0207689_100040109 230
734 3300025942 Ga0207689_10017269 Ga0207689_100172693 230
735 3300025942 Ga0207689_10156204 Ga0207689_101562042 230
736 3300025942 Ga0207689_10161836 Ga0207689_101618362 230
737 3300025942 Ga0207689_10167365 Ga0207689_101673652 230
738 3300025942 Ga0207689_10192959 Ga0207689_101929592 230
739 3300025942 Ga0207689_10196534 Ga0207689_101965342 230
740 3300025942 Ga0207689_10393235 Ga0207689_103932352 230
741 3300025945 Ga0207679_10117752 Ga0207679_101177522 230
742 3300025945 Ga0207679_10557287 Ga0207679_105572872 230
743 3300025945 Ga0207679_10792209 Ga0207679_107922091 230
744 3300025949 Ga0207667_10075896 Ga0207667_100758963 230
745 3300025949 Ga0207667_10108676 Ga0207667_101086762 230
746 3300025949 Ga0207667_10147491 Ga0207667_101474912 230
747 3300025960 Ga0207651_10001378 Ga0207651_100013785 230
748 3300025960 Ga0207651_10032539 Ga0207651_100325393 230
749 3300025960 Ga0207651_10109564 Ga0207651_101095643 230
750 3300025960 Ga0207651_10122701 Ga0207651_101227012 230
751 3300025960 Ga0207651_10131231 Ga0207651_101312312 230
752 3300025960 Ga0207651_10172666 Ga0207651_101726662 230
753 3300025960 Ga0207651_10302024 Ga0207651_103020241 230
754 3300025961 Ga0207712_10003179 Ga0207712_100031795 230
755 3300025961 Ga0207712_10004545 Ga0207712_100045454 230
756 3300025961 Ga0207712_10011029 Ga0207712_100110292 230
757 3300025961 Ga0207712_10063039 Ga0207712_100630393 230
758 3300025961 Ga0207712_10067357 Ga0207712_100673573 230
759 3300025972 Ga0207668_10009407 Ga0207668_100094075 230
760 3300025972 Ga0207668_10290495 Ga0207668_102904952 230
761 3300025972 Ga0207668_10396971 Ga0207668_103969712 230
762 3300025972 Ga0207668_10522606 Ga0207668_105226062 230
763 3300025986 Ga0207658_10003801 Ga0207658_100038017 230
764 3300025986 Ga0207658_10017334 Ga0207658_100173344 230
765 3300025986 Ga0207658_10025533 Ga0207658_100255331 230
766 3300025986 Ga0207658_10211973 Ga0207658_102119732 230
767 3300025986 Ga0207658_10543960 Ga0207658_105439602 230
768 3300026023 Ga0207677_10044505 Ga0207677_100445054 230
769 3300026023 Ga0207677_10100519 Ga0207677_101005192 230
770 3300026023 Ga0207677_10125779 Ga0207677_101257792 230
771 3300026023 Ga0207677_10279216 Ga0207677_102792162 230
772 3300026035 Ga0207703_10002545 Ga0207703_1000254510 230
773 3300026035 Ga0207703_10003606 Ga0207703_100036069 230
774 3300026035 Ga0207703_10339693 Ga0207703_103396932 230
775 3300026041 Ga0207639_10002738 Ga0207639_100027384 230
776 3300026041 Ga0207639_10009982 Ga0207639_100099825 230
777 3300026041 Ga0207639_10065405 Ga0207639_100654052 230
778 3300026041 Ga0207639_10608182 Ga0207639_106081822 230
779 3300026075 Ga0207708_10016926 Ga0207708_100169265 230
780 3300026075 Ga0207708_10077631 Ga0207708_100776312 230
781 3300026075 Ga0207708_10517588 Ga0207708_105175882 230
782 3300026075 Ga0207708_10527723 Ga0207708_105277232 230
783 3300026088 Ga0207641_10000184 Ga0207641_1000018455 230
784 3300026088 Ga0207641_10003089 Ga0207641_100030892 230
785 3300026088 Ga0207641_10004182 Ga0207641_100041825 230
786 3300026088 Ga0207641_10046443 Ga0207641_100464432 230
787 3300026088 Ga0207641_10073835 Ga0207641_100738352 230
788 3300026088 Ga0207641_10311829 Ga0207641_103118292 230
789 3300026088 Ga0207641_10368053 Ga0207641_103680532 230
790 3300026088 Ga0207641_10519400 Ga0207641_105194001 230
791 3300026089 Ga0207648_10000488 Ga0207648_1000048819 230
792 3300026089 Ga0207648_10006518 Ga0207648_100065186 230
793 3300026089 Ga0207648_10016043 Ga0207648_100160437 230
794 3300026089 Ga0207648_10024406 Ga0207648_100244063 230
795 3300026089 Ga0207648_10030559 Ga0207648_100305593 230
796 3300026089 Ga0207648_10034010 Ga0207648_100340104 230
797 3300026089 Ga0207648_10046889 Ga0207648_100468893 230
798 3300026089 Ga0207648_10087305 Ga0207648_100873051 230
799 3300026089 Ga0207648_10830143 Ga0207648_108301431 230
800 3300026095 Ga0207676_10003388 Ga0207676_100033885 230
801 3300026095 Ga0207676_10030308 Ga0207676_100303084 230
802 3300026095 Ga0207676_10049366 Ga0207676_100493663 230
803 3300026095 Ga0207676_10549461 Ga0207676_105494612 230
804 3300026116 Ga0207674_10008650 Ga0207674_1000865010 230
805 3300026116 Ga0207674_10076348 Ga0207674_100763482 230
806 3300026116 Ga0207674_10105672 Ga0207674_101056722 230
807 3300026116 Ga0207674_10277979 Ga0207674_102779792 230
808 3300026116 Ga0207674_10901502 Ga0207674_109015021 230
809 3300026118 Ga0207675_100003643 Ga0207675_1000036433 230
810 3300026118 Ga0207675_100007531 Ga0207675_1000075313 230
811 3300026118 Ga0207675_100060176 Ga0207675_1000601762 230
812 3300026118 Ga0207675_100097749 Ga0207675_1000977493 230
813 3300026118 Ga0207675_100238776 Ga0207675_1002387761 230
814 3300026118 Ga0207675_100243594 Ga0207675_1002435942 230
815 3300026118 Ga0207675_100330999 Ga0207675_1003309992 230
816 3300026118 Ga0207675_100596880 Ga0207675_1005968802 230
817 3300026118 Ga0207675_100607235 Ga0207675_1006072352 230
818 3300026121 Ga0207683_10002620 Ga0207683_100026207 230
819 3300026121 Ga0207683_10026193 Ga0207683_100261935 230
820 3300026121 Ga0207683_10026625 Ga0207683_100266251 230
821 3300026121 Ga0207683_10085974 Ga0207683_100859743 230
822 3300026121 Ga0207683_10093250 Ga0207683_100932503 230
823 3300026121 Ga0207683_10278135 Ga0207683_102781352 230
824 3300026142 Ga0207698_10097916 Ga0207698_100979162 230
825 3300026142 Ga0207698_10762707 Ga0207698_107627071 230
826 3300027907 Ga0207428_10013560 Ga0207428_100135602 230
827 3300027907 Ga0207428_10044663 Ga0207428_100446633 230
828 3300028379 Ga0268266_10003446 Ga0268266_100034465 230
829 3300028379 Ga0268266_10545767 Ga0268266_105457671 230
830 3300028380 Ga0268265_10019847 Ga0268265_100198472 230
831 3300028380 Ga0268265_10046626 Ga0268265_100466262 230
832 3300028380 Ga0268265_10095069 Ga0268265_100950693 230
833 3300028381 Ga0268264_10002907 Ga0268264_1000290714 230
834 3300028381 Ga0268264_10007740 Ga0268264_100077407 230
835 3300028381 Ga0268264_10012563 Ga0268264_100125633 230
836 3300028381 Ga0268264_10023693 Ga0268264_100236936 230
837 3300028381 Ga0268264_10046502 Ga0268264_100465024 230
838 3300028381 Ga0268264_10068267 Ga0268264_100682673 230
839 3300028381 Ga0268264_10113047 Ga0268264_101130472 230
840 3300028381 Ga0268264_10139237 Ga0268264_101392372 230
841 3300028381 Ga0268264_10171535 Ga0268264_101715351 230
842 3300028381 Ga0268264_10301685 Ga0268264_103016851 230
843 3300028381 Ga0268264_10491116 Ga0268264_104911162 230
844 3300028794 Ga0307515_10000455 Ga0307515_1000045545 230
845 3300030731 Ga0316177_1064545 Ga0316177_10645452 230
846 3300031251 Ga0265327_10000013 Ga0265327_10000013107 230
847 3300031251 Ga0265327_10000254 Ga0265327_1000025431 230
848 3300031251 Ga0265327_10032002 Ga0265327_100320023 230
849 3300031456 Ga0307513_10124861 Ga0307513_101248611 230
850 3300031456 Ga0307513_10463790 Ga0307513_104637902 230
851 3300031507 Ga0307509_10043969 Ga0307509_100439695 230
852 3300031507 Ga0307509_10535933 Ga0307509_105359331 230
853 3300031595 Ga0265313_10029162 Ga0265313_100291622 230
854 3300031616 Ga0307508_10000603 Ga0307508_1000060328 230
855 3300031901 Ga0307406_10013998 Ga0307406_100139982 230
856 3300032002 Ga0307416_100467654 Ga0307416_1004676542 230
857 3300032004 Ga0307414_10150774 Ga0307414_101507742 230
858 3300032004 Ga0307414_10427274 Ga0307414_104272742 230
859 3300032126 Ga0307415_100129468 Ga0307415_1001294681 230
860 3300032126 Ga0307415_100182501 Ga0307415_1001825012 230
861 3300035724 Ga0373933_0057220 Ga0373933_0057220_656_1351 230
862 3300037418 Ga0395900_0125735 Ga0395900_0125735_1570_2271 230
863 3300039437 Ga0436365_1889540 Ga0436365_1889540_522_1217 230
864 3300041404 Ga0439436_0000413 Ga0439436_0000413_1128_1823 230
865 3300041486 Ga0451807_2402910 Ga0451807_2402910_223_915 230
866 3300042001 Ga0439441_014677 Ga0439441_014677_81_773 230
867 3300042007 Ga0439449_0016026 Ga0439449_0016026_590_1285 230
868 3300042007 Ga0439449_0017796 Ga0439449_0017796_1183_1887 230
869 3300042014 Ga0439457_003832 Ga0439457_003832_1469_2164 230
870 3300042014 Ga0439457_014419 Ga0439457_014419_1013_1705 230
871 3300042015 Ga0439462_0042841 Ga0439462_0042841_330_1034 230
872 3300042128 Ga0450897_007222 Ga0450897_007222_255_947 230
873 3300042128 Ga0450897_007938 Ga0450897_007938_35_727 230
874 3300042131 Ga0450894_014063 Ga0450894_014063_295_987 230
875 3300042134 Ga0450898_030723 Ga0450898_030723_68_763 230
876 3300042135 Ga0450899_009011 Ga0450899_009011_227_919 230
877 3300042156 Ga0439446_0024266 Ga0439446_0024266_873_1565 230
878 3300042532 Ga0450893_0021987 Ga0450893_0021987_73_768 230
879 3300042876 Ga0451577_0020044 Ga0451577_0020044_5381_6073 230
880 3300044656 Ga0466969_0004123 Ga0466969_0004123_1231_1926 230
881 3300044658 Ga0466972_0000104 Ga0466972_0000104_63515_64210 230
882 3300044683 Ga0466965_0189992 Ga0466965_0189992_241_936 230
883 3300044684 Ga0466966_0000193 Ga0466966_0000193_28214_28909 230
884 3300044693 Ga0466961_0211192 Ga0466961_0211192_309_1004 230
885 3300044735 Ga0466968_0010449 Ga0466968_0010449_1105_1800 230
886 3300044842 Ga0466957_0001943 Ga0466957_0001943_7918_8613 230
887 3300044842 Ga0466957_0110513 Ga0466957_0110513_404_1096 230
888 3300044901 Ga0466960_0054762 Ga0466960_0054762_340_1032 230
889 3300045049 Ga0466959_0002486 Ga0466959_0002486_4014_4709 230
890 3300046455 Ga0495603_0170933 Ga0495603_0170933_167_937 230
891 3300046460 Ga0495638_0023753 Ga0495638_0023753_2507_3202 230
892 3300046471 Ga0495650_0029888 Ga0495650_0029888_922_1614 230
893 3300046616 Ga0495668_0000242 Ga0495668_0000242_49015_49707 230
894 3300046616 Ga0495668_0006585 Ga0495668_0006585_122_817 230
895 3300046663 Ga0495635_0042972 Ga0495635_0042972_806_1498 230
896 3300047320 Ga0495672_0005013 Ga0495672_0005013_42_737 230
897 3300047320 Ga0495672_0020050 Ga0495672_0020050_2039_2734 230
898 3300047472 Ga0495686_0011185 Ga0495686_0011185_2330_3031 230
899 3300048904 Ga0496101_0224250 Ga0496101_0224250_176_874 230
900 3300048912 Ga0496109_0014633 Ga0496109_0014633_1206_1901 230
901 3300049127 Ga0501306_016337 Ga0501306_016337_165_860 230
902 3300049127 Ga0501306_031780 Ga0501306_031780_17_715 230
903 3300049127 Ga0501306_033411 Ga0501306_033411_16_714 230
904 3300049128 Ga0501308_001539 Ga0501308_001539_1153_1848 230
905 3300049128 Ga0501308_012590 Ga0501308_012590_16_714 230
906 3300049161 Ga0501305_030069 Ga0501305_030069_134_829 230
907 3300049513 Ga0501290_002235 Ga0501290_002235_714_1412 230
908 3300049515 Ga0501292_000995 Ga0501292_000995_309_1007 230
909 3300049521 Ga0501298_000530 Ga0501298_000530_4396_5094 230
910 3300049522 Ga0501299_001303 Ga0501299_001303_519_1217 230
911 3300049526 Ga0501303_015565 Ga0501303_015565_36_734 230
912 3300049528 Ga0501312_002971 Ga0501312_002971_1165_1860 230
913 3300049528 Ga0501312_024910 Ga0501312_024910_185_889 230
914 3300049528 Ga0501312_036890 Ga0501312_036890_19_717 230
915 3300049530 Ga0501314_009319 Ga0501314_009319_129_824 230
916 3300049532 Ga0501316_024174 Ga0501316_024174_17_715 230
917 3300049540 Ga0501324_016328 Ga0501324_016328_12_707 230
918 3300049553 Ga0501337_006885 Ga0501337_006885_17_712 230
919 3300049568 Ga0501031_0328658 Ga0501031_0328658_270_962 230
920 3300049569 Ga0501032_0004313 Ga0501032_0004313_700_1449 230
921 3300049569 Ga0501032_0045286 Ga0501032_0045286_1430_2125 230
922 3300049569 Ga0501032_0098945 Ga0501032_0098945_178_870 230
923 3300049570 Ga0501033_0214437 Ga0501033_0214437_520_1212 230
924 3300049571 Ga0501034_0000002 Ga0501034_0000002_5094_5786 230
925 3300049571 Ga0501034_0008447 Ga0501034_0008447_1956_2648 230
926 3300049571 Ga0501034_0031289 Ga0501034_0031289_2909_3601 230
927 3300049571 Ga0501034_0039862 Ga0501034_0039862_3974_4723 230
928 3300049571 Ga0501034_0098127 Ga0501034_0098127_1104_1799 230
929 3300049572 Ga0501036_0041557 Ga0501036_0041557_2069_2764 230
930 3300049573 Ga0501037_0020352 Ga0501037_0020352_3769_4461 230
931 3300049573 Ga0501037_0036949 Ga0501037_0036949_810_1559 230
932 3300049573 Ga0501037_0042976 Ga0501037_0042976_556_1251 230
933 3300049574 Ga0501038_0005400 Ga0501038_0005400_3316_4011 230
934 3300049574 Ga0501038_0039893 Ga0501038_0039893_2229_2978 230
935 3300049574 Ga0501038_0062216 Ga0501038_0062216_638_1330 230
936 3300049574 Ga0501038_0478766 Ga0501038_0478766_23_721 230
937 3300049575 Ga0501039_0008583 Ga0501039_0008583_1146_1895 230
938 3300049575 Ga0501039_0039599 Ga0501039_0039599_2499_3191 230
939 3300049579 Ga0501043_0004656 Ga0501043_0004656_1520_2215 230
940 3300049579 Ga0501043_0013445 Ga0501043_0013445_1467_2216 230
941 3300049579 Ga0501043_0059217 Ga0501043_0059217_1408_2100 230
942 3300049579 Ga0501043_0160558 Ga0501043_0160558_105_797 230
943 3300049580 Ga0501046_0003336 Ga0501046_0003336_13897_14646 230
944 3300049580 Ga0501046_0026201 Ga0501046_0026201_2374_3069 230
945 3300049581 Ga0501047_0002513 Ga0501047_0002513_11900_12649 230
946 3300049581 Ga0501047_0088741 Ga0501047_0088741_2106_2798 230
947 3300049581 Ga0501047_0160319 Ga0501047_0160319_1086_1778 230
948 3300049581 Ga0501047_0167032 Ga0501047_0167032_206_904 230
949 3300049581 Ga0501047_0199458 Ga0501047_0199458_495_1187 230
950 3300049582 Ga0501048_0390018 Ga0501048_0390018_230_922 230
951 3300049585 Ga0501069_0080213 Ga0501069_0080213_574_1272 230
952 3300049586 Ga0501070_0006730 Ga0501070_0006730_2255_3004 230
953 3300049586 Ga0501070_0103596 Ga0501070_0103596_1270_1968 230
954 3300049588 Ga0501072_0013863 Ga0501072_0013863_4094_4786 230
955 3300049588 Ga0501072_0526879 Ga0501072_0526879_49_744 230
956 3300049589 Ga0501073_0001665 Ga0501073_0001665_4186_4935 230
957 3300049589 Ga0501073_0093194 Ga0501073_0093194_918_1613 230
958 3300049590 Ga0501074_0102143 Ga0501074_0102143_517_1215 230
959 3300049649 Ga0501198_000711 Ga0501198_000711_559_1257 230
960 3300049649 Ga0501198_011403 Ga0501198_011403_141_839 230
961 3300049651 Ga0501201_000337 Ga0501201_000337_2717_3415 230
962 3300049652 Ga0501202_005557 Ga0501202_005557_332_1030 230
963 3300049653 Ga0501206_007100 Ga0501206_007100_656_1354 230
964 3300049654 Ga0501207_001019 Ga0501207_001019_2384_3082 230
965 3300049660 Ga0501216_001931 Ga0501216_001931_1864_2562 230
966 3300049661 Ga0501217_000623 Ga0501217_000623_308_1006 230
967 3300049661 Ga0501217_008287 Ga0501217_008287_575_1273 230
968 3300049662 Ga0501222_009960 Ga0501222_009960_174_872 230
969 3300049663 Ga0501223_000612 Ga0501223_000612_4565_5263 230
970 3300049665 Ga0501227_013552 Ga0501227_013552_22_720 230
971 3300049666 Ga0501228_005443 Ga0501228_005443_50_748 230
972 3300049668 Ga0501233_036779 Ga0501233_036779_331_1029 230
973 3300049669 Ga0501235_001816 Ga0501235_001816_1068_1766 230
974 3300049669 Ga0501235_023363 Ga0501235_023363_352_1050 230
975 3300049670 Ga0501236_008339 Ga0501236_008339_265_963 230
976 3300049673 Ga0501240_000563 Ga0501240_000563_863_1561 230
977 3300049674 Ga0501242_002993 Ga0501242_002993_27_725 230
978 3300049674 Ga0501242_009611 Ga0501242_009611_243_941 230
979 3300049675 Ga0501243_000175 Ga0501243_000175_4757_5455 230
980 3300049681 Ga0501251_001086 Ga0501251_001086_1349_2047 230
981 3300049682 Ga0501252_000056 Ga0501252_000056_313_1011 230
982 3300049683 Ga0501253_004251 Ga0501253_004251_717_1415 230
983 3300049686 Ga0501257_030121 Ga0501257_030121_434_1132 230
984 3300049688 Ga0501259_000471 Ga0501259_000471_4638_5336 230
985 3300049688 Ga0501259_004572 Ga0501259_004572_250_948 230
986 3300049690 Ga0501261_000479 Ga0501261_000479_3092_3790 230
987 3300049703 Ga0501219_000944 Ga0501219_000944_2479_3171 230
988 3300049704 Ga0501221_000519 Ga0501221_000519_684_1382 230
989 3300049705 Ga0501225_0001014 Ga0501225_0001014_3570_4265 230
990 3300049705 Ga0501225_0002100 Ga0501225_0002100_537_1235 230
991 3300049705 Ga0501225_0111651 Ga0501225_0111651_55_747 230
992 3300049707 Ga0501234_000632 Ga0501234_000632_1156_1854 230
993 3300049707 Ga0501234_007549 Ga0501234_007549_203_901 230
994 3300049708 Ga0501245_010223 Ga0501245_010223_340_1038 230
995 3300049741 Ga0501079_0064510 Ga0501079_0064510_2088_2780 230
996 3300049741 Ga0501079_0191309 Ga0501079_0191309_420_1118 230
997 3300049742 Ga0501080_0077292 Ga0501080_0077292_1036_1785 230
998 3300049744 Ga0501083_0086403 Ga0501083_0086403_15_764 230
999 3300049744 Ga0501083_0148600 Ga0501083_0148600_672_1364 230
1000 3300049758 Ga0501241_018032 Ga0501241_018032_332_1030 230
1001 3300049761 Ga0501264_004095 Ga0501264_004095_438_1136 230
1002 3300049763 Ga0501266_013482 Ga0501266_013482_87_785 230
1003 3300049764 Ga0501267_002942 Ga0501267_002942_674_1372 230
1004 3300049765 Ga0501268_006384 Ga0501268_006384_613_1311 230
1005 3300049775 Ga0501279_009957 Ga0501279_009957_174_872 230
1006 3300049778 Ga0501282_005688 Ga0501282_005688_104_802 230
1007 3300049822 Ga0501035_0001789 Ga0501035_0001789_16659_17408 230
1008 3300049822 Ga0501035_0019698 Ga0501035_0019698_3661_4353 230
1009 3300049822 Ga0501035_0075123 Ga0501035_0075123_2038_2733 230
1010 3300049823 Ga0501044_0004121 Ga0501044_0004121_14308_15057 230
1011 3300049823 Ga0501044_0012046 Ga0501044_0012046_7750_8442 230
1012 3300049823 Ga0501044_0039575 Ga0501044_0039575_3280_3975 230
1013 3300049823 Ga0501044_0273289 Ga0501044_0273289_853_1545 230
1014 3300049823 Ga0501044_0369310 Ga0501044_0369310_340_1032 230
1015 3300049850 Ga0501204_004697 Ga0501204_004697_133_831 230
1016 3300049851 Ga0501212_004479 Ga0501212_004479_54_752 230
1017 3300050005 Ga0501284_00006 Ga0501284_00006_77023_77715 230
1018 3300050493 nmdc:mga0k408_101998_c1 nmdc:mga0k408_101998_c1_748_1443 230
1019 3300050493 nmdc:mga0k408_105792_c1 nmdc:mga0k408_105792_c1_679_1371 230
1020 3300050493 nmdc:mga0k408_18195_c1 nmdc:mga0k408_18195_c1_1067_1768 230
1021 3300050493 nmdc:mga0k408_3671_c2 nmdc:mga0k408_3671_c2_251_943 230
1022 3300050493 nmdc:mga0k408_54565_c2 nmdc:mga0k408_54565_c2_99_791 230
1023 3300050507 nmdc:mga05p37_48940_c1 nmdc:mga05p37_48940_c1_2914_3609 230
1024 3300050507 nmdc:mga05p37_53739_c1 nmdc:mga05p37_53739_c1_3523_4215 230
1025 3300050509 nmdc:mga0qj67_84982_c1 nmdc:mga0qj67_84982_c1_1690_2382 230
1026 3300050510 nmdc:mga06r32_131083_c1 nmdc:mga06r32_131083_c1_424_1116 230
1027 3300050510 nmdc:mga06r32_23249_c1 nmdc:mga06r32_23249_c1_1984_2679 230
1028 3300050511 nmdc:mga08y16_39378_c1 nmdc:mga08y16_39378_c1_2134_2826 230
1029 3300050511 nmdc:mga08y16_423395_c1 nmdc:mga08y16_423395_c1_428_1120 230
1030 3300050511 nmdc:mga08y16_470754_c1 nmdc:mga08y16_470754_c1_93_788 230
1031 3300050511 nmdc:mga08y16_820311_c1 nmdc:mga08y16_820311_c1_11_781 230
1032 3300050511 nmdc:mga08y16_880207_c1 nmdc:mga08y16_880207_c1_63_755 230
1033 3300053086 Ga0500578_0011031 Ga0500578_0011031_968_1663 230
1034 3300053092 Ga0500583_0000009 Ga0500583_0000009_94931_95626 230
1035 3300053092 Ga0500583_0000258 Ga0500583_0000258_14180_14872 230
1036 3300053096 Ga0500641_0091345 Ga0500641_0091345_145_837 230
1037 3300053103 Ga0500555_024159 Ga0500555_024159_1022_1717 230
1038 3300053130 Ga0500642_0043895 Ga0500642_0043895_56_748 230
1039 3300053130 Ga0500642_0135173 Ga0500642_0135173_145_840 230
1040 3300053131 Ga0500652_018206 Ga0500652_018206_690_1385 230
1041 3300053131 Ga0500652_086308 Ga0500652_086308_215_910 230
1042 3300053136 Ga0500559_0024426 Ga0500559_0024426_1249_1944 230
1043 3300053139 Ga0500568_0000895 Ga0500568_0000895_8651_9346 230
1044 3300053147 Ga0500589_001419 Ga0500589_001419_5602_6294 230
1045 3300053151 Ga0500604_0010575 Ga0500604_0010575_1041_1736 230
1046 3300053153 Ga0500616_0176839 Ga0500616_0176839_63_761 230
1047 3300053156 Ga0500622_0000615 Ga0500622_0000615_22083_22781 230
1048 3300053156 Ga0500622_0058994 Ga0500622_0058994_1125_1817 230
1049 3300053163 Ga0500639_037414 Ga0500639_037414_1579_2271 230
1050 3300053727 Ga0500611_000005 Ga0500611_000005_57975_58670 230
1051 3300053730 Ga0500645_034780 Ga0500645_034780_278_973 230
1052 3300054114 Ga0501084_0018691 Ga0501084_0018691_1431_2129 230
1053 3300054114 Ga0501084_0183587 Ga0501084_0183587_149_898 230
1054 3300055283 Ga0500661_001332 Ga0500661_001332_1458_2156 230
1055 3300060353 Ga0501082_0070209 Ga0501082_0070209_923_1621 230

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00574

CLP_protease

Clp protease

43

216

0.98

Feature Viewer

pLDDT pTM Quality
58.9 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map