F489154
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1055 | 625 | 2110 | 310 |
Family's Representative Sequence
| Representative Sequence | 3300026116|Ga0207674_10050854|Ga0207674_100508542 |
| Length | 363 |
| Sequence | MEAGNPATPLHGRDACRPIEVRQESVSVERPGTPARDHHPGRAAAHGNLLQPMSASDQTSHAAPTRSSHWIANQPYVLLCITALCWAGNAIVGRLAAGHIPPVTLSFLRWGTAFLLILPFAWKHLVRDWPAIRGKLGIMILVSITGIGIFNTLQYWSLEYTTALNTLLLQSAGPLIVAVWSLLLLRVRLTLAQAIGVLVSLSGVLVIVMHGDLTALSNISFNRGDLIFLVALTIFGLYSVLTLKRPAIHGLSFAAFTFGTSTVFLIPLFVRELLTRPAMAFNAQNLLSLLYVAIFPSIVAYLCFNRGVQLIGANRAAPFFHVVPVFGSVMAIVFLGEEPHLFHLIGFGLVLTGVYVASRKPAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 62 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 80 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 110 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 111 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 112 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 115 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 176 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 177 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 178 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 179 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 186 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 187 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 188 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 192 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 195 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 196 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 203 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 204 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 205 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 206 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 207 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 208 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 209 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 211 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 218 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 225 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 226 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 227 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 228 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 229 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 230 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 231 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 232 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 233 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 234 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 235 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 236 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 237 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 238 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 239 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 240 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 241 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 242 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 243 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 244 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 245 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 246 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 247 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 248 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 249 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 252 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 253 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 336 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 337 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 338 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 353 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 354 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 355 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 356 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 357 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 358 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 359 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 365 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 366 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 369 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 370 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 371 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 372 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 373 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 375 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 376 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 377 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 378 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 379 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 380 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 381 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 382 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 383 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 385 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 386 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 387 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 389 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 390 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 392 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 393 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 394 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 395 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 396 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 397 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 398 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 399 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 400 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 401 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 402 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 403 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 404 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 405 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 406 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 407 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 408 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 409 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 410 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 411 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 412 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 413 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 414 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 415 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 416 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 417 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 418 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 419 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 420 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 421 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 422 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 423 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 424 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 425 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 426 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 427 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 428 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 429 | 2791355199 | |||
| 430 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 431 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 432 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 433 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 434 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 435 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 436 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 437 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 438 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 439 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 440 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 441 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 442 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 443 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 444 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 445 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 446 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 447 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 448 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 449 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 450 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 451 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 452 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 453 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 454 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 455 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 456 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 457 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 458 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 459 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 460 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 461 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 462 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 463 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 464 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 465 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 466 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 467 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 468 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 469 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 470 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 471 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 472 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 473 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 474 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 475 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 476 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 477 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 478 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 479 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 480 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 481 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 482 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 483 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 484 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 485 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 486 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 487 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 488 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 489 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 490 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 491 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 492 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 493 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 494 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 495 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 496 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 497 | 2904699407 | |||
| 498 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 499 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 500 | 2906610324 | |||
| 501 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 502 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 503 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 504 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 505 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 506 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 507 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 508 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 509 | 2922368715 | |||
| 510 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 511 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 512 | 2922425934 | |||
| 513 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 514 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 515 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 516 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 517 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 518 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 519 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 520 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 521 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 522 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 523 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 524 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 525 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 526 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 527 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 528 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 529 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 530 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 531 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 532 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 533 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 534 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 535 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 536 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 537 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 538 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 539 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 540 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 541 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 542 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 543 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 544 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 545 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 546 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 547 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 548 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 549 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 550 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 551 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 552 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 553 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 554 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 555 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 556 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 557 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 558 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 559 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 560 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 561 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 562 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 563 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 564 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 565 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 566 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 567 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 568 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 569 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 570 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 571 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 572 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 573 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 574 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 575 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 576 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 577 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 578 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 579 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 580 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 581 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 582 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 583 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 584 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 585 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 586 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 587 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 588 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 589 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 590 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 591 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 592 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 593 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 594 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 595 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 596 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 597 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 598 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 599 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 600 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 601 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 602 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 603 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 604 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 605 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 606 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 607 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 608 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 609 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 610 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 611 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 612 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 613 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 614 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 615 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 616 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 617 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 618 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 619 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 620 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 621 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 622 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 623 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 624 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 625 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 78.67 |
| Metatranscriptomes | 0 |
| Isolates | 21.33 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.18 |
| Nodule | 17.25 |
| Rhizoplane | 5.12 |
| Rhizosphere | 56.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207674_10050854 | 3300026116 | Bacteria | 4232 |
| 2 | JGI25165J46597_1006170 | 3300003214 | Bacteria | 2160 |
| 3 | rootH1_10087822 | 3300003323 | Bacteria | 3633 |
| 4 | JGI25160J50197_1009314 | 3300003354 | Bacteria | 3656 |
| 5 | JGI25160J50197_1010686 | 3300003354 | Bacteria | 3302 |
| 6 | JGI25160J50197_1022482 | 3300003354 | Bacteria | 1847 |
| 7 | JGI25404J52841_10001294 | 3300003659 | Bacteria | 4338 |
| 8 | JGI25404J52841_10002561 | 3300003659 | Bacteria | 3457 |
| 9 | JGI25404J52841_10011860 | 3300003659 | Bacteria | 1883 |
| 10 | JGI25404J52841_10019493 | 3300003659 | Bacteria | 1470 |
| 11 | Ga0055531_10014879 | 3300003794 | Bacteria | 3474 |
| 12 | Ga0055543_1001485 | 3300004625 | Bacteria | 9236 |
| 13 | Ga0065165_1001376 | 3300005262 | Bacteria | 26733 |
| 14 | Ga0065165_1005421 | 3300005262 | Bacteria | 7182 |
| 15 | Ga0070658_10087865 | 3300005327 | Bacteria | 2559 |
| 16 | Ga0070658_10207249 | 3300005327 | Bacteria | 1655 |
| 17 | Ga0070683_100227303 | 3300005329 | Bacteria | 1774 |
| 18 | Ga0070683_100253308 | 3300005329 | Bacteria | 1674 |
| 19 | Ga0070670_100070676 | 3300005331 | Bacteria | 2997 |
| 20 | Ga0068869_100021269 | 3300005334 | Bacteria | 4461 |
| 21 | Ga0070680_100040184 | 3300005336 | Bacteria | 3786 |
| 22 | Ga0070680_100340756 | 3300005336 | Bacteria | 1274 |
| 23 | Ga0070682_100038542 | 3300005337 | Bacteria | 2931 |
| 24 | Ga0068868_100016760 | 3300005338 | Bacteria | 5448 |
| 25 | Ga0068868_100022538 | 3300005338 | Bacteria | 4755 |
| 26 | Ga0068868_100221960 | 3300005338 | Bacteria | 1582 |
| 27 | Ga0070660_100182043 | 3300005339 | Bacteria | 1700 |
| 28 | Ga0070691_10060494 | 3300005341 | Bacteria | 1821 |
| 29 | Ga0070687_100262398 | 3300005343 | Bacteria | 1079 |
| 30 | Ga0070661_100207321 | 3300005344 | Bacteria | 1499 |
| 31 | Ga0070661_100228438 | 3300005344 | Bacteria | 1430 |
| 32 | Ga0070668_100036126 | 3300005347 | Bacteria | 3770 |
| 33 | Ga0070668_100085347 | 3300005347 | Bacteria | 2481 |
| 34 | Ga0070668_100141123 | 3300005347 | Bacteria | 1941 |
| 35 | Ga0070669_100075838 | 3300005353 | Bacteria | 2495 |
| 36 | Ga0070671_100004615 | 3300005355 | Bacteria | 10924 |
| 37 | Ga0070673_100039182 | 3300005364 | Bacteria | 3625 |
| 38 | Ga0070659_100128239 | 3300005366 | Bacteria | 2059 |
| 39 | Ga0070709_10009471 | 3300005434 | Bacteria | 5376 |
| 40 | Ga0070709_10009924 | 3300005434 | Bacteria | 5263 |
| 41 | Ga0070714_100090281 | 3300005435 | Bacteria | 2683 |
| 42 | Ga0070714_100100486 | 3300005435 | Bacteria | 2548 |
| 43 | Ga0070714_100223751 | 3300005435 | Bacteria | 1731 |
| 44 | Ga0070714_100483641 | 3300005435 | Bacteria | 1179 |
| 45 | Ga0070713_100003995 | 3300005436 | Bacteria | 9817 |
| 46 | Ga0070713_100060683 | 3300005436 | Bacteria | 3162 |
| 47 | Ga0070713_100111409 | 3300005436 | Bacteria | 2387 |
| 48 | Ga0070710_10000354 | 3300005437 | Bacteria | 21680 |
| 49 | Ga0070711_100079786 | 3300005439 | Bacteria | 2328 |
| 50 | Ga0070711_100153125 | 3300005439 | Bacteria | 1741 |
| 51 | Ga0070708_100032198 | 3300005445 | Bacteria | 4545 |
| 52 | Ga0070663_100034425 | 3300005455 | Bacteria | 3508 |
| 53 | Ga0070663_100062682 | 3300005455 | Bacteria | 2681 |
| 54 | Ga0070681_10043868 | 3300005458 | Bacteria | 4476 |
| 55 | Ga0070681_10147849 | 3300005458 | Bacteria | 2277 |
| 56 | Ga0070681_10152124 | 3300005458 | Bacteria | 2240 |
| 57 | Ga0070681_10156834 | 3300005458 | Bacteria | 2201 |
| 58 | Ga0070698_100103607 | 3300005471 | Bacteria | 2815 |
| 59 | Ga0070679_100008173 | 3300005530 | Bacteria | 9833 |
| 60 | Ga0070679_100043766 | 3300005530 | Bacteria | 4458 |
| 61 | Ga0070679_100116448 | 3300005530 | Bacteria | 2657 |
| 62 | Ga0070679_100144623 | 3300005530 | Bacteria | 2356 |
| 63 | Ga0070679_100313829 | 3300005530 | Bacteria | 1517 |
| 64 | Ga0070679_100496038 | 3300005530 | Bacteria | 1165 |
| 65 | Ga0070684_100007383 | 3300005535 | Bacteria | 8546 |
| 66 | Ga0070684_100041482 | 3300005535 | Bacteria | 3968 |
| 67 | Ga0070684_100044811 | 3300005535 | Bacteria | 3827 |
| 68 | Ga0070697_100040016 | 3300005536 | Bacteria | 3791 |
| 69 | Ga0068853_100009856 | 3300005539 | Bacteria | 7710 |
| 70 | Ga0068853_100029321 | 3300005539 | Bacteria | 4637 |
| 71 | Ga0068853_100079038 | 3300005539 | Bacteria | 2876 |
| 72 | Ga0068853_100162707 | 3300005539 | Bacteria | 2015 |
| 73 | Ga0068853_100224536 | 3300005539 | Bacteria | 1716 |
| 74 | Ga0068853_100265006 | 3300005539 | Bacteria | 1581 |
| 75 | Ga0070672_100044913 | 3300005543 | Bacteria | 3414 |
| 76 | Ga0070672_100111369 | 3300005543 | Bacteria | 2231 |
| 77 | Ga0070665_100015994 | 3300005548 | Bacteria | 7531 |
| 78 | Ga0070665_100044686 | 3300005548 | Bacteria | 4449 |
| 79 | Ga0070665_100124841 | 3300005548 | Bacteria | 2576 |
| 80 | Ga0068855_100053745 | 3300005563 | Bacteria | 4737 |
| 81 | Ga0068855_100183563 | 3300005563 | Bacteria | 2364 |
| 82 | Ga0068855_100390481 | 3300005563 | Bacteria | 1527 |
| 83 | Ga0070664_100014972 | 3300005564 | Bacteria | 6330 |
| 84 | Ga0070664_100257083 | 3300005564 | Bacteria | 1571 |
| 85 | Ga0068857_100031797 | 3300005577 | Bacteria | 4663 |
| 86 | Ga0068854_100136291 | 3300005578 | Bacteria | 1879 |
| 87 | Ga0068856_100002849 | 3300005614 | Bacteria | 17692 |
| 88 | Ga0068856_100279553 | 3300005614 | Bacteria | 1686 |
| 89 | Ga0070702_100032076 | 3300005615 | Bacteria | 2881 |
| 90 | Ga0068852_100022694 | 3300005616 | Bacteria | 5038 |
| 91 | Ga0068852_100220177 | 3300005616 | Bacteria | 1805 |
| 92 | Ga0068852_100331439 | 3300005616 | Bacteria | 1481 |
| 93 | Ga0068859_100301163 | 3300005617 | Bacteria | 1696 |
| 94 | Ga0068864_100017485 | 3300005618 | Bacteria | 5979 |
| 95 | Ga0068861_100010994 | 3300005719 | Bacteria | 6289 |
| 96 | Ga0068861_100048183 | 3300005719 | Bacteria | 3220 |
| 97 | Ga0068851_10018196 | 3300005834 | Bacteria | 3384 |
| 98 | Ga0068851_10033883 | 3300005834 | Bacteria | 2547 |
| 99 | Ga0068870_10078771 | 3300005840 | Bacteria | 1816 |
| 100 | Ga0068863_100029494 | 3300005841 | Bacteria | 5236 |
| 101 | Ga0068863_100224386 | 3300005841 | Bacteria | 1811 |
| 102 | Ga0068858_100060910 | 3300005842 | Bacteria | 3489 |
| 103 | Ga0068858_100093556 | 3300005842 | Bacteria | 2798 |
| 104 | Ga0068858_100201196 | 3300005842 | Bacteria | 1884 |
| 105 | Ga0068860_100101612 | 3300005843 | Bacteria | 2743 |
| 106 | Ga0068860_100127112 | 3300005843 | Bacteria | 2443 |
| 107 | Ga0068860_100366897 | 3300005843 | Bacteria | 1419 |
| 108 | Ga0068862_100047874 | 3300005844 | Bacteria | 3649 |
| 109 | Ga0068862_100052726 | 3300005844 | Bacteria | 3481 |
| 110 | Ga0068862_100073668 | 3300005844 | Bacteria | 2951 |
| 111 | Ga0068862_100112368 | 3300005844 | Bacteria | 2392 |
| 112 | Ga0068862_100226201 | 3300005844 | Bacteria | 1695 |
| 113 | Ga0081455_10002391 | 3300005937 | Bacteria | 22405 |
| 114 | Ga0081455_10008216 | 3300005937 | Bacteria | 10883 |
| 115 | Ga0081455_10025742 | 3300005937 | Bacteria | 5426 |
| 116 | Ga0081455_10082273 | 3300005937 | Bacteria | 2634 |
| 117 | Ga0081455_10083718 | 3300005937 | Bacteria | 2606 |
| 118 | Ga0081540_1000876 | 3300005983 | Bacteria | 27180 |
| 119 | Ga0081540_1001057 | 3300005983 | Bacteria | 24537 |
| 120 | Ga0081540_1001355 | 3300005983 | Bacteria | 21285 |
| 121 | Ga0081540_1006825 | 3300005983 | Bacteria | 8245 |
| 122 | Ga0081540_1008183 | 3300005983 | Bacteria | 7326 |
| 123 | Ga0081540_1013124 | 3300005983 | Bacteria | 5409 |
| 124 | Ga0081540_1013668 | 3300005983 | Bacteria | 5263 |
| 125 | Ga0081540_1026846 | 3300005983 | Bacteria | 3277 |
| 126 | Ga0081540_1034143 | 3300005983 | Bacteria | 2749 |
| 127 | Ga0081540_1044842 | 3300005983 | Bacteria | 2253 |
| 128 | Ga0081540_1060292 | 3300005983 | Bacteria | 1816 |
| 129 | Ga0081539_10000958 | 3300005985 | Bacteria | 54105 |
| 130 | Ga0081539_10037151 | 3300005985 | Bacteria | 2904 |
| 131 | Ga0070717_10000879 | 3300006028 | Bacteria | 19872 |
| 132 | Ga0070717_10004010 | 3300006028 | Bacteria | 10602 |
| 133 | Ga0070717_10159239 | 3300006028 | Bacteria | 1958 |
| 134 | Ga0070717_10227624 | 3300006028 | Bacteria | 1641 |
| 135 | Ga0075365_10006174 | 3300006038 | Bacteria | 6563 |
| 136 | Ga0075365_10076606 | 3300006038 | Bacteria | 2258 |
| 137 | Ga0075365_10079609 | 3300006038 | Bacteria | 2217 |
| 138 | Ga0075368_10008768 | 3300006042 | Bacteria | 3619 |
| 139 | Ga0075368_10057356 | 3300006042 | Bacteria | 1555 |
| 140 | Ga0075363_100002408 | 3300006048 | Bacteria | 7631 |
| 141 | Ga0075363_100035826 | 3300006048 | Bacteria | 2599 |
| 142 | Ga0075363_100056365 | 3300006048 | Bacteria | 2107 |
| 143 | Ga0075364_10021061 | 3300006051 | Bacteria | 4107 |
| 144 | Ga0075364_10051999 | 3300006051 | Bacteria | 2676 |
| 145 | Ga0075364_10062058 | 3300006051 | Bacteria | 2452 |
| 146 | Ga0075432_10086113 | 3300006058 | Bacteria | 1145 |
| 147 | Ga0070712_100053314 | 3300006175 | Bacteria | 2824 |
| 148 | Ga0075367_10019327 | 3300006178 | Bacteria | 3777 |
| 149 | Ga0075367_10060627 | 3300006178 | Bacteria | 2256 |
| 150 | Ga0075367_10081126 | 3300006178 | Bacteria | 1963 |
| 151 | Ga0075367_10120902 | 3300006178 | Bacteria | 1614 |
| 152 | Ga0075369_10022623 | 3300006186 | Bacteria | 2594 |
| 153 | Ga0075369_10028690 | 3300006186 | Bacteria | 2334 |
| 154 | Ga0075366_10011991 | 3300006195 | Bacteria | 4909 |
| 155 | Ga0075366_10025819 | 3300006195 | Bacteria | 3435 |
| 156 | Ga0075366_10111921 | 3300006195 | Bacteria | 1642 |
| 157 | Ga0075366_10128390 | 3300006195 | Bacteria | 1529 |
| 158 | Ga0075366_10202879 | 3300006195 | Bacteria | 1206 |
| 159 | Ga0097621_100211157 | 3300006237 | Bacteria | 1689 |
| 160 | Ga0075370_10082553 | 3300006353 | Bacteria | 1848 |
| 161 | Ga0068871_100033296 | 3300006358 | Bacteria | 4080 |
| 162 | Ga0068871_100064105 | 3300006358 | Bacteria | 3007 |
| 163 | Ga0068871_100117942 | 3300006358 | Bacteria | 2239 |
| 164 | Ga0075428_100057249 | 3300006844 | Bacteria | 4267 |
| 165 | Ga0075434_100104926 | 3300006871 | Bacteria | 2836 |
| 166 | Ga0068865_100235411 | 3300006881 | Bacteria | 1439 |
| 167 | Ga0075436_100124040 | 3300006914 | Bacteria | 1809 |
| 168 | Ga0097620_100301155 | 3300006931 | Bacteria | 1696 |
| 169 | Ga0099823_1008012 | 3300006944 | Bacteria | 10753 |
| 170 | Ga0075435_100061613 | 3300007076 | Bacteria | 3044 |
| 171 | Ga0099795_10032255 | 3300007788 | Bacteria | 1810 |
| 172 | Ga0105244_10077045 | 3300009036 | Bacteria | 1655 |
| 173 | Ga0105250_10041582 | 3300009092 | Bacteria | 1843 |
| 174 | Ga0105240_10002375 | 3300009093 | Bacteria | 30348 |
| 175 | Ga0105240_10012518 | 3300009093 | Bacteria | 11703 |
| 176 | Ga0105240_10021194 | 3300009093 | Bacteria | 8650 |
| 177 | Ga0105240_10113195 | 3300009093 | Bacteria | 3279 |
| 178 | Ga0105240_10182585 | 3300009093 | Bacteria | 2474 |
| 179 | Ga0105240_10394089 | 3300009093 | Bacteria | 1561 |
| 180 | Ga0111539_10479835 | 3300009094 | Bacteria | 1448 |
| 181 | Ga0105245_10022776 | 3300009098 | Bacteria | 5497 |
| 182 | Ga0105245_10229823 | 3300009098 | Bacteria | 1794 |
| 183 | Ga0105245_10277838 | 3300009098 | Bacteria | 1636 |
| 184 | Ga0105245_10520430 | 3300009098 | Bacteria | 1208 |
| 185 | Ga0105245_10718977 | 3300009098 | Bacteria | 1033 |
| 186 | Ga0105247_10027347 | 3300009101 | Bacteria | 3450 |
| 187 | Ga0105247_10073898 | 3300009101 | Bacteria | 2137 |
| 188 | Ga0105247_10083393 | 3300009101 | Bacteria | 2019 |
| 189 | Ga0114129_10082526 | 3300009147 | Bacteria | 4466 |
| 190 | Ga0114129_10310362 | 3300009147 | Bacteria | 2100 |
| 191 | Ga0105243_10088147 | 3300009148 | Bacteria | 2549 |
| 192 | Ga0105241_10070681 | 3300009174 | Bacteria | 2709 |
| 193 | Ga0105241_10087873 | 3300009174 | Bacteria | 2447 |
| 194 | Ga0105241_10116546 | 3300009174 | Bacteria | 2145 |
| 195 | Ga0105241_10134747 | 3300009174 | Bacteria | 2004 |
| 196 | Ga0105242_10203890 | 3300009176 | Bacteria | 1758 |
| 197 | Ga0105248_10018230 | 3300009177 | Bacteria | 7752 |
| 198 | Ga0105248_10026667 | 3300009177 | Bacteria | 6425 |
| 199 | Ga0105248_10043229 | 3300009177 | Bacteria | 5052 |
| 200 | Ga0105248_10180112 | 3300009177 | Bacteria | 2381 |
| 201 | Ga0105248_10196203 | 3300009177 | Bacteria | 2274 |
| 202 | Ga0105248_10410721 | 3300009177 | Bacteria | 1524 |
| 203 | Ga0105237_10005704 | 3300009545 | Bacteria | 13994 |
| 204 | Ga0105237_10015508 | 3300009545 | Bacteria | 7928 |
| 205 | Ga0105237_10018101 | 3300009545 | Bacteria | 7296 |
| 206 | Ga0105237_10023103 | 3300009545 | Bacteria | 6376 |
| 207 | Ga0105237_10082020 | 3300009545 | Bacteria | 3216 |
| 208 | Ga0105237_10108656 | 3300009545 | Bacteria | 2765 |
| 209 | Ga0105237_10118480 | 3300009545 | Bacteria | 2641 |
| 210 | Ga0105238_10044702 | 3300009551 | Bacteria | 4477 |
| 211 | Ga0105238_10068523 | 3300009551 | Bacteria | 3549 |
| 212 | Ga0105238_10121083 | 3300009551 | Bacteria | 2596 |
| 213 | Ga0105249_10072669 | 3300009553 | Bacteria | 3180 |
| 214 | Ga0105249_10180362 | 3300009553 | Bacteria | 2054 |
| 215 | Ga0105249_10686885 | 3300009553 | Bacteria | 1083 |
| 216 | Ga0105249_10723966 | 3300009553 | Bacteria | 1056 |
| 217 | Ga0099796_10001408 | 3300010159 | Bacteria | 4821 |
| 218 | Ga0099796_10062361 | 3300010159 | Bacteria | 1325 |
| 219 | Ga0105239_10011442 | 3300010375 | Bacteria | 9896 |
| 220 | Ga0105239_10046389 | 3300010375 | Bacteria | 4762 |
| 221 | Ga0105239_10050756 | 3300010375 | Bacteria | 4548 |
| 222 | Ga0105239_10093670 | 3300010375 | Bacteria | 3317 |
| 223 | Ga0105239_10127494 | 3300010375 | Bacteria | 2829 |
| 224 | Ga0105239_10181637 | 3300010375 | Bacteria | 2354 |
| 225 | Ga0105239_10212611 | 3300010375 | Bacteria | 2168 |
| 226 | Ga0105246_10207022 | 3300011119 | Bacteria | 1529 |
| 227 | Ga0157370_10040683 | 3300013104 | Bacteria | 4487 |
| 228 | Ga0157370_10073270 | 3300013104 | Bacteria | 3231 |
| 229 | Ga0157370_10145697 | 3300013104 | Bacteria | 2205 |
| 230 | Ga0157369_10013879 | 3300013105 | Bacteria | 9100 |
| 231 | Ga0157369_10032628 | 3300013105 | Bacteria | 5725 |
| 232 | Ga0157369_10053166 | 3300013105 | Bacteria | 4378 |
| 233 | Ga0157374_10043558 | 3300013296 | Bacteria | 4147 |
| 234 | Ga0157378_10056131 | 3300013297 | Bacteria | 3508 |
| 235 | Ga0163162_10060537 | 3300013306 | Bacteria | 3822 |
| 236 | Ga0163162_10126411 | 3300013306 | Bacteria | 2663 |
| 237 | Ga0163162_10253647 | 3300013306 | Bacteria | 1891 |
| 238 | Ga0157372_10203594 | 3300013307 | Bacteria | 2293 |
| 239 | Ga0157372_10270010 | 3300013307 | Bacteria | 1976 |
| 240 | Ga0157375_10203812 | 3300013308 | Bacteria | 2134 |
| 241 | Ga0163163_10009057 | 3300014325 | Bacteria | 8871 |
| 242 | Ga0157380_10061401 | 3300014326 | Bacteria | 3007 |
| 243 | Ga0157377_10283262 | 3300014745 | Bacteria | 1087 |
| 244 | Ga0157379_10044212 | 3300014968 | Bacteria | 3975 |
| 245 | Ga0157379_10057511 | 3300014968 | Bacteria | 3475 |
| 246 | Ga0157379_10215715 | 3300014968 | Bacteria | 1738 |
| 247 | Ga0157376_10017125 | 3300014969 | Bacteria | 5520 |
| 248 | Ga0157376_10099309 | 3300014969 | Bacteria | 2539 |
| 249 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 250 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 251 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 252 | Ga0214545_1031225 | 3300021324 | Bacteria | 2180 |
| 253 | Ga0214543_1000564 | 3300021327 | Bacteria | 63531 |
| 254 | Ga0213876_10008568 | 3300021384 | Bacteria | 5535 |
| 255 | Ga0213871_10007091 | 3300021441 | Bacteria | 2406 |
| 256 | Ga0209677_100391 | 3300025253 | Bacteria | 26540 |
| 257 | Ga0209677_104865 | 3300025253 | Bacteria | 3697 |
| 258 | Ga0209148_1000900 | 3300025254 | Bacteria | 20229 |
| 259 | Ga0209148_1007943 | 3300025254 | Bacteria | 2164 |
| 260 | Ga0209233_1001098 | 3300025261 | Bacteria | 11109 |
| 261 | Ga0209233_1007522 | 3300025261 | Bacteria | 3447 |
| 262 | Ga0209455_1001425 | 3300025272 | Bacteria | 10837 |
| 263 | Ga0209455_1003294 | 3300025272 | Bacteria | 5799 |
| 264 | Ga0209455_1018859 | 3300025272 | Bacteria | 1406 |
| 265 | Ga0209758_1000102 | 3300025297 | Bacteria | 224851 |
| 266 | Ga0209758_1000732 | 3300025297 | Bacteria | 48005 |
| 267 | Ga0209758_1003159 | 3300025297 | Bacteria | 15477 |
| 268 | Ga0209758_1004735 | 3300025297 | Bacteria | 11071 |
| 269 | Ga0209758_1017230 | 3300025297 | Bacteria | 3612 |
| 270 | Ga0209758_1068105 | 3300025297 | Bacteria | 1135 |
| 271 | Ga0207426_1000354 | 3300025302 | Bacteria | 83734 |
| 272 | Ga0207426_1000521 | 3300025302 | Bacteria | 55976 |
| 273 | Ga0207426_1005878 | 3300025302 | Bacteria | 5464 |
| 274 | Ga0209257_1001340 | 3300025304 | Bacteria | 29845 |
| 275 | Ga0207697_10067290 | 3300025315 | Bacteria | 1498 |
| 276 | Ga0207656_10019673 | 3300025321 | Bacteria | 2673 |
| 277 | Ga0207656_10044922 | 3300025321 | Bacteria | 1888 |
| 278 | Ga0207692_10000064 | 3300025898 | Bacteria | 31069 |
| 279 | Ga0207692_10231610 | 3300025898 | Bacteria | 1099 |
| 280 | Ga0207642_10135723 | 3300025899 | Bacteria | 1290 |
| 281 | Ga0207710_10092290 | 3300025900 | Bacteria | 1419 |
| 282 | Ga0207688_10052008 | 3300025901 | Bacteria | 2295 |
| 283 | Ga0207647_10001590 | 3300025904 | Bacteria | 17424 |
| 284 | Ga0207647_10060689 | 3300025904 | Bacteria | 2311 |
| 285 | Ga0207647_10102104 | 3300025904 | Bacteria | 1701 |
| 286 | Ga0207699_10010189 | 3300025906 | Bacteria | 4705 |
| 287 | Ga0207699_10012565 | 3300025906 | Bacteria | 4309 |
| 288 | Ga0207699_10037112 | 3300025906 | Bacteria | 2783 |
| 289 | Ga0207643_10113049 | 3300025908 | Bacteria | 1601 |
| 290 | Ga0207705_10184488 | 3300025909 | Bacteria | 1576 |
| 291 | Ga0207684_10099753 | 3300025910 | Bacteria | 2481 |
| 292 | Ga0207654_10034161 | 3300025911 | Bacteria | 2824 |
| 293 | Ga0207654_10036401 | 3300025911 | Bacteria | 2749 |
| 294 | Ga0207654_10048473 | 3300025911 | Bacteria | 2431 |
| 295 | Ga0207707_10000827 | 3300025912 | Bacteria | 30384 |
| 296 | Ga0207707_10001679 | 3300025912 | Bacteria | 20395 |
| 297 | Ga0207707_10053392 | 3300025912 | Bacteria | 3518 |
| 298 | Ga0207707_10059228 | 3300025912 | Bacteria | 3332 |
| 299 | Ga0207707_10109761 | 3300025912 | Bacteria | 2411 |
| 300 | Ga0207707_10247492 | 3300025912 | Bacteria | 1549 |
| 301 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 302 | Ga0207695_10063403 | 3300025913 | Bacteria | 3811 |
| 303 | Ga0207695_10123854 | 3300025913 | Bacteria | 2550 |
| 304 | Ga0207671_10003551 | 3300025914 | Bacteria | 15456 |
| 305 | Ga0207671_10034572 | 3300025914 | Bacteria | 3754 |
| 306 | Ga0207671_10073678 | 3300025914 | Bacteria | 2551 |
| 307 | Ga0207671_10116409 | 3300025914 | Bacteria | 2039 |
| 308 | Ga0207671_10168137 | 3300025914 | Bacteria | 1701 |
| 309 | Ga0207671_10189095 | 3300025914 | Bacteria | 1605 |
| 310 | Ga0207671_10313147 | 3300025914 | Bacteria | 1241 |
| 311 | Ga0207693_10012104 | 3300025915 | Bacteria | 6975 |
| 312 | Ga0207693_10036737 | 3300025915 | Bacteria | 3862 |
| 313 | Ga0207693_10060877 | 3300025915 | Bacteria | 2957 |
| 314 | Ga0207693_10213002 | 3300025915 | Bacteria | 1519 |
| 315 | Ga0207660_10021880 | 3300025917 | Bacteria | 4303 |
| 316 | Ga0207660_10081175 | 3300025917 | Bacteria | 2383 |
| 317 | Ga0207660_10299321 | 3300025917 | Bacteria | 1280 |
| 318 | Ga0207657_10001315 | 3300025919 | Bacteria | 26383 |
| 319 | Ga0207657_10088631 | 3300025919 | Bacteria | 2586 |
| 320 | Ga0207657_10152790 | 3300025919 | Bacteria | 1879 |
| 321 | Ga0207649_10076160 | 3300025920 | Bacteria | 2158 |
| 322 | Ga0207649_10104401 | 3300025920 | Bacteria | 1882 |
| 323 | Ga0207652_10001089 | 3300025921 | Bacteria | 24596 |
| 324 | Ga0207652_10022161 | 3300025921 | Bacteria | 5251 |
| 325 | Ga0207652_10044205 | 3300025921 | Bacteria | 3794 |
| 326 | Ga0207652_10145609 | 3300025921 | Bacteria | 2120 |
| 327 | Ga0207652_10299022 | 3300025921 | Bacteria | 1453 |
| 328 | Ga0207646_10017460 | 3300025922 | Bacteria | 6713 |
| 329 | Ga0207694_10195557 | 3300025924 | Bacteria | 1644 |
| 330 | Ga0207659_10355514 | 3300025926 | Bacteria | 1216 |
| 331 | Ga0207687_10065085 | 3300025927 | Bacteria | 2588 |
| 332 | Ga0207700_10001903 | 3300025928 | Bacteria | 11863 |
| 333 | Ga0207700_10086868 | 3300025928 | Bacteria | 2458 |
| 334 | Ga0207664_10047855 | 3300025929 | Bacteria | 3361 |
| 335 | Ga0207664_10245383 | 3300025929 | Bacteria | 1561 |
| 336 | Ga0207664_10470080 | 3300025929 | Bacteria | 1124 |
| 337 | Ga0207644_10248745 | 3300025931 | Bacteria | 1418 |
| 338 | Ga0207706_10428022 | 3300025933 | Bacteria | 1146 |
| 339 | Ga0207709_10010026 | 3300025935 | Bacteria | 5220 |
| 340 | Ga0207670_10301873 | 3300025936 | Bacteria | 1254 |
| 341 | Ga0207669_10002843 | 3300025937 | Bacteria | 7421 |
| 342 | Ga0207704_10319368 | 3300025938 | Bacteria | 1197 |
| 343 | Ga0207665_10008591 | 3300025939 | Bacteria | 6722 |
| 344 | Ga0207665_10055029 | 3300025939 | Bacteria | 2684 |
| 345 | Ga0207665_10095014 | 3300025939 | Bacteria | 2071 |
| 346 | Ga0207691_10114965 | 3300025940 | Bacteria | 2390 |
| 347 | Ga0207691_10119416 | 3300025940 | Bacteria | 2338 |
| 348 | Ga0207691_10179879 | 3300025940 | Bacteria | 1848 |
| 349 | Ga0207691_10225268 | 3300025940 | Bacteria | 1625 |
| 350 | Ga0207711_10041679 | 3300025941 | Bacteria | 3910 |
| 351 | Ga0207711_10430746 | 3300025941 | Bacteria | 1227 |
| 352 | Ga0207689_10033789 | 3300025942 | Bacteria | 4248 |
| 353 | Ga0207689_10053585 | 3300025942 | Bacteria | 3323 |
| 354 | Ga0207689_10272365 | 3300025942 | Bacteria | 1402 |
| 355 | Ga0207661_10003154 | 3300025944 | Bacteria | 11437 |
| 356 | Ga0207661_10095826 | 3300025944 | Bacteria | 2482 |
| 357 | Ga0207661_10178100 | 3300025944 | Bacteria | 1855 |
| 358 | Ga0207679_10174460 | 3300025945 | Bacteria | 1773 |
| 359 | Ga0207667_10023055 | 3300025949 | Bacteria | 6860 |
| 360 | Ga0207712_10037787 | 3300025961 | Bacteria | 3296 |
| 361 | Ga0207712_10253518 | 3300025961 | Bacteria | 1424 |
| 362 | Ga0207712_10482123 | 3300025961 | Bacteria | 1057 |
| 363 | Ga0207668_10069976 | 3300025972 | Bacteria | 2500 |
| 364 | Ga0207668_10227217 | 3300025972 | Bacteria | 1502 |
| 365 | Ga0207640_10011386 | 3300025981 | Bacteria | 5035 |
| 366 | Ga0207640_10189279 | 3300025981 | Bacteria | 1550 |
| 367 | Ga0207677_10029411 | 3300026023 | Bacteria | 3491 |
| 368 | Ga0207703_10060227 | 3300026035 | Bacteria | 3104 |
| 369 | Ga0207703_10126175 | 3300026035 | Bacteria | 2204 |
| 370 | Ga0207703_10285034 | 3300026035 | Bacteria | 1501 |
| 371 | Ga0207639_10009882 | 3300026041 | Bacteria | 6591 |
| 372 | Ga0207639_10022260 | 3300026041 | Bacteria | 4564 |
| 373 | Ga0207639_10110862 | 3300026041 | Bacteria | 2236 |
| 374 | Ga0207639_10149151 | 3300026041 | Bacteria | 1957 |
| 375 | Ga0207639_10215143 | 3300026041 | Bacteria | 1657 |
| 376 | Ga0207678_10003718 | 3300026067 | Bacteria | 13719 |
| 377 | Ga0207678_10038266 | 3300026067 | Bacteria | 4168 |
| 378 | Ga0207678_10059272 | 3300026067 | Bacteria | 3294 |
| 379 | Ga0207678_10097524 | 3300026067 | Bacteria | 2512 |
| 380 | Ga0207708_10080240 | 3300026075 | Bacteria | 2507 |
| 381 | Ga0207702_10000325 | 3300026078 | Bacteria | 54690 |
| 382 | Ga0207702_10058600 | 3300026078 | Bacteria | 3277 |
| 383 | Ga0207641_10037207 | 3300026088 | Bacteria | 4064 |
| 384 | Ga0207641_10306106 | 3300026088 | Bacteria | 1503 |
| 385 | Ga0207641_10509501 | 3300026088 | Bacteria | 1169 |
| 386 | Ga0207648_10028909 | 3300026089 | Bacteria | 4914 |
| 387 | Ga0207648_10081895 | 3300026089 | Bacteria | 2814 |
| 388 | Ga0207674_10039712 | 3300026116 | Bacteria | 4878 |
| 389 | Ga0207675_100082737 | 3300026118 | Bacteria | 3011 |
| 390 | Ga0207683_10046036 | 3300026121 | Bacteria | 3816 |
| 391 | Ga0207698_10245913 | 3300026142 | Bacteria | 1633 |
| 392 | Ga0207698_10327503 | 3300026142 | Bacteria | 1437 |
| 393 | Ga0209389_1000021 | 3300027296 | Bacteria | 169506 |
| 394 | Ga0209389_1000086 | 3300027296 | Bacteria | 84925 |
| 395 | Ga0209589_1000005 | 3300027357 | Bacteria | 530958 |
| 396 | Ga0209589_1000027 | 3300027357 | Bacteria | 155295 |
| 397 | Ga0209489_100005 | 3300027361 | Bacteria | 530958 |
| 398 | Ga0209489_100313 | 3300027361 | Bacteria | 85507 |
| 399 | Ga0209489_105143 | 3300027361 | Bacteria | 23183 |
| 400 | Ga0209700_100006 | 3300027363 | Bacteria | 530958 |
| 401 | Ga0209700_100483 | 3300027363 | Bacteria | 74857 |
| 402 | Ga0209588_1011445 | 3300027671 | Bacteria | 2681 |
| 403 | Ga0209813_10082380 | 3300027866 | Bacteria | 1066 |
| 404 | Ga0268266_10001864 | 3300028379 | Bacteria | 23828 |
| 405 | Ga0268266_10003347 | 3300028379 | Bacteria | 16051 |
| 406 | Ga0268266_10014684 | 3300028379 | Bacteria | 6728 |
| 407 | Ga0268266_10046928 | 3300028379 | Bacteria | 3698 |
| 408 | Ga0268266_10113604 | 3300028379 | Bacteria | 2402 |
| 409 | Ga0268265_10008324 | 3300028380 | Bacteria | 7003 |
| 410 | Ga0268265_10050516 | 3300028380 | Bacteria | 3134 |
| 411 | Ga0268265_10192782 | 3300028380 | Bacteria | 1761 |
| 412 | Ga0268264_10000174 | 3300028381 | Bacteria | 137254 |
| 413 | Ga0268264_10109509 | 3300028381 | Bacteria | 2417 |
| 414 | Ga0268264_10296137 | 3300028381 | Bacteria | 1521 |
| 415 | Ga0265319_1009526 | 3300028563 | Bacteria | 4130 |
| 416 | Ga0265334_10077862 | 3300028573 | Bacteria | 1226 |
| 417 | Ga0265336_10000187 | 3300028666 | Bacteria | 43247 |
| 418 | Ga0307517_10000124 | 3300028786 | Bacteria | 115570 |
| 419 | Ga0307517_10201173 | 3300028786 | Bacteria | 1245 |
| 420 | Ga0307515_10299424 | 3300028794 | Bacteria | 1295 |
| 421 | Ga0265338_10001016 | 3300028800 | Bacteria | 47131 |
| 422 | Ga0265324_10003444 | 3300029957 | Bacteria | 7528 |
| 423 | Ga0265325_10056438 | 3300031241 | Bacteria | 2006 |
| 424 | Ga0265340_10008671 | 3300031247 | Bacteria | 5482 |
| 425 | Ga0265340_10102843 | 3300031247 | Bacteria | 1326 |
| 426 | Ga0265339_10001394 | 3300031249 | Bacteria | 17992 |
| 427 | Ga0265339_10025376 | 3300031249 | Bacteria | 3401 |
| 428 | Ga0265316_10109081 | 3300031344 | Bacteria | 2098 |
| 429 | Ga0307509_10331849 | 3300031507 | Bacteria | 1252 |
| 430 | Ga0307508_10018487 | 3300031616 | Bacteria | 6334 |
| 431 | Ga0307508_10045268 | 3300031616 | Bacteria | 3932 |
| 432 | Ga0265314_10002593 | 3300031711 | Bacteria | 18286 |
| 433 | Ga0265314_10055522 | 3300031711 | Bacteria | 2733 |
| 434 | Ga0265342_10064069 | 3300031712 | Bacteria | 2159 |
| 435 | Ga0265342_10094777 | 3300031712 | Bacteria | 1707 |
| 436 | Ga0307516_10114947 | 3300031730 | Bacteria | 2488 |
| 437 | Ga0307412_10094907 | 3300031911 | Bacteria | 2096 |
| 438 | Ga0307409_100374935 | 3300031995 | Bacteria | 1350 |
| 439 | Ga0307415_100217806 | 3300032126 | Bacteria | 1528 |
| 440 | Ga0307510_10049437 | 3300033180 | Bacteria | 4472 |
| 441 | Ga0307510_10066290 | 3300033180 | Bacteria | 3648 |
| 442 | Ga0315911_1000041 | 3300033442 | Bacteria | 50391 |
| 443 | Ga0316215_1001232 | 3300033544 | Bacteria | 2484 |
| 444 | Ga0373930_0000900 | 3300034816 | Bacteria | 4255 |
| 445 | Ga0373950_0019509 | 3300034818 | Bacteria | 1185 |
| 446 | Ga0373958_0021649 | 3300034819 | Bacteria | 1195 |
| 447 | Ga0373934_0043554 | 3300035086 | Bacteria | 1774 |
| 448 | Ga0373923_0030651 | 3300035111 | Bacteria | 2164 |
| 449 | Ga0373945_0019029 | 3300035116 | Bacteria | 2341 |
| 450 | Ga0373945_0025597 | 3300035116 | Bacteria | 2051 |
| 451 | Ga0373945_0039927 | 3300035116 | Bacteria | 1693 |
| 452 | Ga0373956_0002585 | 3300035119 | Bacteria | 7344 |
| 453 | Ga0373956_0057140 | 3300035119 | Bacteria | 1763 |
| 454 | Ga0373957_0002973 | 3300035120 | Bacteria | 4918 |
| 455 | Ga0373943_0004058 | 3300035170 | Bacteria | 6646 |
| 456 | Ga0373946_0012851 | 3300035171 | Bacteria | 3140 |
| 457 | Ga0373955_0002301 | 3300035172 | Bacteria | 8307 |
| 458 | Ga0373924_0011130 | 3300035410 | Bacteria | 3334 |
| 459 | Ga0373931_0002920 | 3300035691 | Bacteria | 7629 |
| 460 | Ga0373931_0188392 | 3300035691 | Bacteria | 1226 |
| 461 | Ga0373935_0000562 | 3300035692 | Bacteria | 19338 |
| 462 | Ga0373935_0260930 | 3300035692 | Bacteria | 1215 |
| 463 | Ga0373927_0001832 | 3300035695 | Bacteria | 15797 |
| 464 | Ga0373927_0013030 | 3300035695 | Bacteria | 5531 |
| 465 | Ga0373927_0031076 | 3300035695 | Bacteria | 3483 |
| 466 | Ga0373927_0067302 | 3300035695 | Bacteria | 2317 |
| 467 | Ga0373927_0257581 | 3300035695 | Bacteria | 1147 |
| 468 | Ga0373933_0008030 | 3300035724 | Bacteria | 5756 |
| 469 | Ga0373933_0010257 | 3300035724 | Bacteria | 5132 |
| 470 | Ga0373933_0060228 | 3300035724 | Bacteria | 2289 |
| 471 | Ga0373933_0109511 | 3300035724 | Bacteria | 1722 |
| 472 | Ga0373947_0007458 | 3300035725 | Bacteria | 6331 |
| 473 | Ga0373947_0011887 | 3300035725 | Bacteria | 4987 |
| 474 | Ga0373947_0044339 | 3300035725 | Bacteria | 2658 |
| 475 | Ga0373947_0058251 | 3300035725 | Bacteria | 2340 |
| 476 | Ga0373947_0202343 | 3300035725 | Bacteria | 1300 |
| 477 | Ga0373937_0055338 | 3300036401 | Bacteria | 3642 |
| 478 | Ga0373937_0112057 | 3300036401 | Bacteria | 2538 |
| 479 | Ga0373937_0213919 | 3300036401 | Bacteria | 1814 |
| 480 | Ga0373937_0513183 | 3300036401 | Bacteria | 1139 |
| 481 | Ga0373925_0001669 | 3300037068 | Bacteria | 18688 |
| 482 | Ga0373925_0035611 | 3300037068 | Bacteria | 3673 |
| 483 | Ga0373925_0223351 | 3300037068 | Bacteria | 1504 |
| 484 | Ga0373925_0526914 | 3300037068 | Bacteria | 971 |
| 485 | Ga0395899_0062298 | 3300037312 | Bacteria | 2747 |
| 486 | Ga0395900_0021484 | 3300037418 | Bacteria | 6600 |
| 487 | Ga0395900_0025417 | 3300037418 | Bacteria | 6063 |
| 488 | Ga0395900_0353417 | 3300037418 | Bacteria | 1443 |
| 489 | Ga0395898_0097123 | 3300037466 | Bacteria | 2830 |
| 490 | Ga0395898_0116414 | 3300037466 | Bacteria | 2561 |
| 491 | Ga0395898_0139257 | 3300037466 | Bacteria | 2323 |
| 492 | Ga0395898_0141641 | 3300037466 | Bacteria | 2302 |
| 493 | Ga0395905_0002158 | 3300037471 | Bacteria | 22308 |
| 494 | Ga0395905_0065008 | 3300037471 | Bacteria | 3415 |
| 495 | Ga0395905_0090968 | 3300037471 | Bacteria | 2861 |
| 496 | Ga0436364_0084522 | 3300037853 | Bacteria | 1825 |
| 497 | Ga0436364_0815325 | 3300037853 | Bacteria | 1726 |
| 498 | Ga0395901_0048271 | 3300038443 | Bacteria | 4421 |
| 499 | Ga0395901_0207784 | 3300038443 | Bacteria | 2050 |
| 500 | Ga0436365_1071754 | 3300039437 | Bacteria | 2852 |
| 501 | Ga0436365_1439813 | 3300039437 | Bacteria | 24357 |
| 502 | Ga0436360_0143183 | 3300039438 | Bacteria | 2179 |
| 503 | Ga0436360_0650426 | 3300039438 | Bacteria | 1703 |
| 504 | Ga0436361_0090009 | 3300039447 | Bacteria | 2221 |
| 505 | Ga0436363_1183617 | 3300039450 | Bacteria | 3356 |
| 506 | Ga0436363_1312646 | 3300039450 | Bacteria | 7026 |
| 507 | Ga0436362_0264286 | 3300039453 | Bacteria | 3010 |
| 508 | Ga0436362_0951882 | 3300039453 | Bacteria | 4090 |
| 509 | Ga0439465_0058202 | 3300041413 | Bacteria | 1277 |
| 510 | Ga0451793_1839637 | 3300041452 | Bacteria | 1813 |
| 511 | Ga0451795_0758075 | 3300041456 | Bacteria | 1399 |
| 512 | Ga0451804_0633050 | 3300041463 | Bacteria | 1204 |
| 513 | Ga0451845_0934764 | 3300041501 | Bacteria | 1616 |
| 514 | Ga0466972_0000266 | 3300044658 | Bacteria | 33408 |
| 515 | Ga0466965_0052121 | 3300044683 | Bacteria | 2031 |
| 516 | Ga0466966_0003043 | 3300044684 | Bacteria | 11075 |
| 517 | Ga0466961_0000172 | 3300044693 | Bacteria | 44200 |
| 518 | Ga0466963_0029690 | 3300044694 | Bacteria | 3522 |
| 519 | Ga0466964_0102285 | 3300044706 | Bacteria | 1265 |
| 520 | Ga0466971_0034106 | 3300044719 | Bacteria | 2281 |
| 521 | Ga0466968_0012638 | 3300044735 | Bacteria | 3310 |
| 522 | Ga0466970_0160427 | 3300044765 | Bacteria | 1244 |
| 523 | Ga0466957_0214786 | 3300044842 | Bacteria | 1268 |
| 524 | Ga0466959_0035913 | 3300045049 | Bacteria | 3662 |
| 525 | Ga0466959_0077585 | 3300045049 | Bacteria | 2397 |
| 526 | Ga0466967_0390228 | 3300045976 | Bacteria | 1353 |
| 527 | Ga0495617_041043 | 3300046452 | Bacteria | 1547 |
| 528 | Ga0495592_0004765 | 3300046454 | Bacteria | 9960 |
| 529 | Ga0495592_0072002 | 3300046454 | Bacteria | 2515 |
| 530 | Ga0495603_0001885 | 3300046455 | Bacteria | 12368 |
| 531 | Ga0495603_0002323 | 3300046455 | Bacteria | 11164 |
| 532 | Ga0495603_0034967 | 3300046455 | Bacteria | 3020 |
| 533 | Ga0495603_0037566 | 3300046455 | Bacteria | 2906 |
| 534 | Ga0495603_0076222 | 3300046455 | Bacteria | 1968 |
| 535 | Ga0495629_0000913 | 3300046459 | Bacteria | 23749 |
| 536 | Ga0495629_0111696 | 3300046459 | Bacteria | 1905 |
| 537 | Ga0495638_0005734 | 3300046460 | Bacteria | 9151 |
| 538 | Ga0495638_0133441 | 3300046460 | Bacteria | 1456 |
| 539 | Ga0495641_0030774 | 3300046461 | Bacteria | 2569 |
| 540 | Ga0495651_0011025 | 3300046462 | Bacteria | 6955 |
| 541 | Ga0495651_0017587 | 3300046462 | Bacteria | 5535 |
| 542 | Ga0495653_0006954 | 3300046463 | Bacteria | 9288 |
| 543 | Ga0495653_0143935 | 3300046463 | Bacteria | 1673 |
| 544 | Ga0495580_0000514 | 3300046472 | Bacteria | 32568 |
| 545 | Ga0495580_0084672 | 3300046472 | Bacteria | 2208 |
| 546 | Ga0495580_0161119 | 3300046472 | Bacteria | 1553 |
| 547 | Ga0495582_0000854 | 3300046473 | Bacteria | 16907 |
| 548 | Ga0495639_0000533 | 3300046475 | Bacteria | 17855 |
| 549 | Ga0495639_0041951 | 3300046475 | Bacteria | 2062 |
| 550 | Ga0495662_0000117 | 3300046476 | Bacteria | 29710 |
| 551 | Ga0495662_0056305 | 3300046476 | Bacteria | 1899 |
| 552 | Ga0495664_0144225 | 3300046477 | Bacteria | 1444 |
| 553 | Ga0495584_0111324 | 3300046491 | Bacteria | 1385 |
| 554 | Ga0495585_0039378 | 3300046492 | Bacteria | 2657 |
| 555 | Ga0495594_0000083 | 3300046499 | Bacteria | 42703 |
| 556 | Ga0495596_0056043 | 3300046500 | Bacteria | 1540 |
| 557 | Ga0495596_0058216 | 3300046500 | Bacteria | 1507 |
| 558 | Ga0495608_0068488 | 3300046511 | Bacteria | 2320 |
| 559 | Ga0495608_0072758 | 3300046511 | Bacteria | 2242 |
| 560 | Ga0495618_0038223 | 3300046514 | Bacteria | 3015 |
| 561 | Ga0495618_0110131 | 3300046514 | Bacteria | 1763 |
| 562 | Ga0495618_0200967 | 3300046514 | Bacteria | 1261 |
| 563 | Ga0495620_0034145 | 3300046515 | Bacteria | 2302 |
| 564 | Ga0495628_0015330 | 3300046516 | Bacteria | 6401 |
| 565 | Ga0495628_0271138 | 3300046516 | Bacteria | 1262 |
| 566 | Ga0495628_0290858 | 3300046516 | Bacteria | 1211 |
| 567 | Ga0495630_0019357 | 3300046517 | Bacteria | 5002 |
| 568 | Ga0495630_0132515 | 3300046517 | Bacteria | 1893 |
| 569 | Ga0495631_0086131 | 3300046518 | Bacteria | 1353 |
| 570 | Ga0495632_0057162 | 3300046519 | Bacteria | 1905 |
| 571 | Ga0495632_0070599 | 3300046519 | Bacteria | 1679 |
| 572 | Ga0495643_0048452 | 3300046522 | Bacteria | 2296 |
| 573 | Ga0495648_0036431 | 3300046524 | Bacteria | 3175 |
| 574 | Ga0495648_0188390 | 3300046524 | Bacteria | 1043 |
| 575 | Ga0495666_0007828 | 3300046526 | Bacteria | 5352 |
| 576 | Ga0495652_0006066 | 3300046529 | Bacteria | 11300 |
| 577 | Ga0495652_0010138 | 3300046529 | Bacteria | 8544 |
| 578 | Ga0495652_0025202 | 3300046529 | Bacteria | 5265 |
| 579 | Ga0495652_0085803 | 3300046529 | Bacteria | 2586 |
| 580 | Ga0495665_0006135 | 3300046531 | Bacteria | 6491 |
| 581 | Ga0495640_0003805 | 3300046533 | Bacteria | 12119 |
| 582 | Ga0495640_0006162 | 3300046533 | Bacteria | 9506 |
| 583 | Ga0495640_0013689 | 3300046533 | Bacteria | 6163 |
| 584 | Ga0495640_0038450 | 3300046533 | Bacteria | 3366 |
| 585 | Ga0495640_0106950 | 3300046533 | Bacteria | 1831 |
| 586 | Ga0495587_0021695 | 3300046536 | Bacteria | 3962 |
| 587 | Ga0495609_0017503 | 3300046538 | Bacteria | 3328 |
| 588 | Ga0495609_0046196 | 3300046538 | Bacteria | 1950 |
| 589 | Ga0495621_0014359 | 3300046539 | Bacteria | 2504 |
| 590 | Ga0495645_0139418 | 3300046543 | Bacteria | 1693 |
| 591 | Ga0495622_0007389 | 3300046557 | Bacteria | 5097 |
| 592 | Ga0495622_0010845 | 3300046557 | Bacteria | 4207 |
| 593 | Ga0495622_0031021 | 3300046557 | Bacteria | 2499 |
| 594 | Ga0495633_0032800 | 3300046558 | Bacteria | 2507 |
| 595 | Ga0495633_0101237 | 3300046558 | Bacteria | 1337 |
| 596 | Ga0495667_0014470 | 3300046559 | Bacteria | 5331 |
| 597 | Ga0495667_0020782 | 3300046559 | Bacteria | 4430 |
| 598 | Ga0495667_0042634 | 3300046559 | Bacteria | 3009 |
| 599 | Ga0495667_0219966 | 3300046559 | Bacteria | 1212 |
| 600 | Ga0495656_0014086 | 3300046615 | Bacteria | 2991 |
| 601 | Ga0495656_0052064 | 3300046615 | Bacteria | 1754 |
| 602 | Ga0495634_0021669 | 3300046642 | Bacteria | 4538 |
| 603 | Ga0495634_0059329 | 3300046642 | Bacteria | 2549 |
| 604 | Ga0495634_0202786 | 3300046642 | Bacteria | 1231 |
| 605 | Ga0495625_0039007 | 3300046660 | Bacteria | 3472 |
| 606 | Ga0495625_0080523 | 3300046660 | Bacteria | 2268 |
| 607 | Ga0495635_0000420 | 3300046663 | Bacteria | 26860 |
| 608 | Ga0495635_0001211 | 3300046663 | Bacteria | 17255 |
| 609 | Ga0495635_0013526 | 3300046663 | Bacteria | 5711 |
| 610 | Ga0495635_0060970 | 3300046663 | Bacteria | 2591 |
| 611 | Ga0495635_0083102 | 3300046663 | Bacteria | 2191 |
| 612 | Ga0495659_0006783 | 3300046664 | Bacteria | 3619 |
| 613 | Ga0495659_0011010 | 3300046664 | Bacteria | 2913 |
| 614 | Ga0495661_0068316 | 3300046665 | Bacteria | 2085 |
| 615 | Ga0495661_0094910 | 3300046665 | Bacteria | 1690 |
| 616 | Ga0495588_0001455 | 3300046674 | Bacteria | 10155 |
| 617 | Ga0495657_0029176 | 3300046675 | Bacteria | 3871 |
| 618 | Ga0495657_0031200 | 3300046675 | Bacteria | 3726 |
| 619 | Ga0495657_0119361 | 3300046675 | Bacteria | 1662 |
| 620 | Ga0495599_0017674 | 3300046678 | Bacteria | 4436 |
| 621 | Ga0495599_0123454 | 3300046678 | Bacteria | 1609 |
| 622 | Ga0495623_0006232 | 3300046679 | Bacteria | 7759 |
| 623 | Ga0495623_0055297 | 3300046679 | Bacteria | 2502 |
| 624 | Ga0495646_0073095 | 3300046680 | Bacteria | 2015 |
| 625 | Ga0495647_0006007 | 3300046681 | Bacteria | 4002 |
| 626 | Ga0495647_0015725 | 3300046681 | Bacteria | 2656 |
| 627 | Ga0495669_0030227 | 3300046684 | Bacteria | 2378 |
| 628 | Ga0495669_0049054 | 3300046684 | Bacteria | 1890 |
| 629 | Ga0495613_0005598 | 3300046689 | Bacteria | 9432 |
| 630 | Ga0495624_0050148 | 3300046690 | Bacteria | 2645 |
| 631 | Ga0495670_0013904 | 3300046691 | Bacteria | 3959 |
| 632 | Ga0495600_0006611 | 3300046809 | Bacteria | 7064 |
| 633 | Ga0495600_0079639 | 3300046809 | Bacteria | 2138 |
| 634 | Ga0495581_0052673 | 3300047315 | Bacteria | 2351 |
| 635 | Ga0495581_0128293 | 3300047315 | Bacteria | 1477 |
| 636 | Ga0495604_0006766 | 3300047317 | Bacteria | 9096 |
| 637 | Ga0495604_0026715 | 3300047317 | Bacteria | 4594 |
| 638 | Ga0495636_0138660 | 3300047318 | Bacteria | 1085 |
| 639 | Ga0495674_0001076 | 3300047319 | Bacteria | 26284 |
| 640 | Ga0495674_0062202 | 3300047319 | Bacteria | 3251 |
| 641 | Ga0495674_0179687 | 3300047319 | Bacteria | 1763 |
| 642 | Ga0495676_0004681 | 3300047321 | Bacteria | 12528 |
| 643 | Ga0495676_0133887 | 3300047321 | Bacteria | 1785 |
| 644 | Ga0495680_0008969 | 3300047322 | Bacteria | 9038 |
| 645 | Ga0495675_0028405 | 3300047444 | Bacteria | 3565 |
| 646 | Ga0495675_0034240 | 3300047444 | Bacteria | 3242 |
| 647 | Ga0495675_0070015 | 3300047444 | Bacteria | 2214 |
| 648 | Ga0495673_0068811 | 3300047469 | Bacteria | 1495 |
| 649 | Ga0495684_0014378 | 3300047471 | Bacteria | 6090 |
| 650 | Ga0495684_0055640 | 3300047471 | Bacteria | 3017 |
| 651 | Ga0495684_0089670 | 3300047471 | Bacteria | 2330 |
| 652 | Ga0495686_0067923 | 3300047472 | Bacteria | 2200 |
| 653 | Ga0495686_0111193 | 3300047472 | Bacteria | 1643 |
| 654 | Ga0495593_0000653 | 3300047673 | Bacteria | 19952 |
| 655 | Ga0495593_0001276 | 3300047673 | Bacteria | 14742 |
| 656 | Ga0495593_0014057 | 3300047673 | Bacteria | 4557 |
| 657 | Ga0495593_0052654 | 3300047673 | Bacteria | 2151 |
| 658 | Ga0495593_0104111 | 3300047673 | Bacteria | 1454 |
| 659 | Ga0495602_0008796 | 3300048088 | Bacteria | 10534 |
| 660 | Ga0495602_0093998 | 3300048088 | Bacteria | 2479 |
| 661 | Ga0495602_0220122 | 3300048088 | Bacteria | 1434 |
| 662 | Ga0495602_0310774 | 3300048088 | Bacteria | 1150 |
| 663 | Ga0495614_0021334 | 3300048089 | Bacteria | 2797 |
| 664 | Ga0495614_0111564 | 3300048089 | Bacteria | 1201 |
| 665 | Ga0496100_0044040 | 3300048903 | Bacteria | 2857 |
| 666 | Ga0496101_0001505 | 3300048904 | Bacteria | 13949 |
| 667 | Ga0496101_0003279 | 3300048904 | Bacteria | 10062 |
| 668 | Ga0496101_0051304 | 3300048904 | Bacteria | 2972 |
| 669 | Ga0496101_0271915 | 3300048904 | Bacteria | 1323 |
| 670 | Ga0496102_0002625 | 3300048905 | Bacteria | 15281 |
| 671 | Ga0496102_0086424 | 3300048905 | Bacteria | 2896 |
| 672 | Ga0496102_0113606 | 3300048905 | Bacteria | 2526 |
| 673 | Ga0496102_0254473 | 3300048905 | Bacteria | 1656 |
| 674 | Ga0496103_0048045 | 3300048906 | Bacteria | 2637 |
| 675 | Ga0496104_0005208 | 3300048907 | Bacteria | 11372 |
| 676 | Ga0496104_0006416 | 3300048907 | Bacteria | 10344 |
| 677 | Ga0496104_0014207 | 3300048907 | Bacteria | 7185 |
| 678 | Ga0496104_0076455 | 3300048907 | Bacteria | 3189 |
| 679 | Ga0496104_0094615 | 3300048907 | Bacteria | 2858 |
| 680 | Ga0496104_0136335 | 3300048907 | Bacteria | 2358 |
| 681 | Ga0496104_0170803 | 3300048907 | Bacteria | 2085 |
| 682 | Ga0496106_0008683 | 3300048909 | Bacteria | 7520 |
| 683 | Ga0496106_0016980 | 3300048909 | Bacteria | 5386 |
| 684 | Ga0496106_0050726 | 3300048909 | Bacteria | 3127 |
| 685 | Ga0496107_0009500 | 3300048910 | Bacteria | 6747 |
| 686 | Ga0496107_0018392 | 3300048910 | Bacteria | 4920 |
| 687 | Ga0496107_0077056 | 3300048910 | Bacteria | 2428 |
| 688 | Ga0496107_0111453 | 3300048910 | Bacteria | 2011 |
| 689 | Ga0496108_0000764 | 3300048911 | Bacteria | 25051 |
| 690 | Ga0496108_0028753 | 3300048911 | Bacteria | 4599 |
| 691 | Ga0496108_0063507 | 3300048911 | Bacteria | 3110 |
| 692 | Ga0496109_0003258 | 3300048912 | Bacteria | 13534 |
| 693 | Ga0496109_0004144 | 3300048912 | Bacteria | 12110 |
| 694 | Ga0496109_0015531 | 3300048912 | Bacteria | 6638 |
| 695 | Ga0496109_0052370 | 3300048912 | Bacteria | 3720 |
| 696 | Ga0496109_0111561 | 3300048912 | Bacteria | 2543 |
| 697 | Ga0496110_0001592 | 3300048913 | Bacteria | 16587 |
| 698 | Ga0496110_0050613 | 3300048913 | Bacteria | 3648 |
| 699 | Ga0496111_0008321 | 3300048914 | Bacteria | 6858 |
| 700 | Ga0496111_0011228 | 3300048914 | Bacteria | 6029 |
| 701 | Ga0496111_0015152 | 3300048914 | Bacteria | 5284 |
| 702 | Ga0496112_0013390 | 3300048915 | Bacteria | 7571 |
| 703 | Ga0496112_0020166 | 3300048915 | Bacteria | 6312 |
| 704 | Ga0496112_0032410 | 3300048915 | Bacteria | 5073 |
| 705 | Ga0496113_0002790 | 3300048916 | Bacteria | 10274 |
| 706 | Ga0496113_0008244 | 3300048916 | Bacteria | 6773 |
| 707 | Ga0496113_0046126 | 3300048916 | Bacteria | 3235 |
| 708 | Ga0496113_0066034 | 3300048916 | Bacteria | 2739 |
| 709 | Ga0496114_0007929 | 3300048917 | Bacteria | 8404 |
| 710 | Ga0496114_0011845 | 3300048917 | Bacteria | 6977 |
| 711 | Ga0496114_0100837 | 3300048917 | Bacteria | 2464 |
| 712 | Ga0496115_0010237 | 3300048918 | Bacteria | 6998 |
| 713 | Ga0496115_0095421 | 3300048918 | Bacteria | 2434 |
| 714 | Ga0496115_0132984 | 3300048918 | Bacteria | 2050 |
| 715 | Ga0496117_0063045 | 3300048920 | Bacteria | 2536 |
| 716 | Ga0496117_0124311 | 3300048920 | Bacteria | 1578 |
| 717 | Ga0496118_0014751 | 3300048921 | Bacteria | 7292 |
| 718 | Ga0496118_0092782 | 3300048921 | Bacteria | 2071 |
| 719 | Ga0496119_0007992 | 3300048922 | Bacteria | 9404 |
| 720 | Ga0496120_0013893 | 3300048923 | Bacteria | 5390 |
| 721 | Ga0496121_0007199 | 3300048924 | Bacteria | 13477 |
| 722 | Ga0496121_0020369 | 3300048924 | Bacteria | 6572 |
| 723 | Ga0496121_0022522 | 3300048924 | Bacteria | 6109 |
| 724 | Ga0496121_0032702 | 3300048924 | Bacteria | 4722 |
| 725 | Ga0496121_0032851 | 3300048924 | Bacteria | 4708 |
| 726 | Ga0496121_0035506 | 3300048924 | Bacteria | 4467 |
| 727 | Ga0496121_0340114 | 3300048924 | Bacteria | 1003 |
| 728 | Ga0496124_0054062 | 3300048927 | Bacteria | 3400 |
| 729 | Ga0496124_0081544 | 3300048927 | Bacteria | 2658 |
| 730 | Ga0496124_0110897 | 3300048927 | Bacteria | 2208 |
| 731 | Ga0496124_0125451 | 3300048927 | Bacteria | 2046 |
| 732 | Ga0496124_0147350 | 3300048927 | Bacteria | 1851 |
| 733 | Ga0496125_0014324 | 3300048928 | Bacteria | 7727 |
| 734 | Ga0496126_0005048 | 3300048929 | Bacteria | 15322 |
| 735 | Ga0496126_0008555 | 3300048929 | Bacteria | 11028 |
| 736 | Ga0496126_0010760 | 3300048929 | Bacteria | 9554 |
| 737 | Ga0496126_0042062 | 3300048929 | Bacteria | 4223 |
| 738 | Ga0496126_0065641 | 3300048929 | Bacteria | 3247 |
| 739 | Ga0496126_0107798 | 3300048929 | Bacteria | 2429 |
| 740 | Ga0496126_0156597 | 3300048929 | Bacteria | 1949 |
| 741 | Ga0496126_0251891 | 3300048929 | Bacteria | 1471 |
| 742 | Ga0496126_0347503 | 3300048929 | Bacteria | 1214 |
| 743 | Ga0501046_0060470 | 3300049580 | Bacteria | 2964 |
| 744 | Ga0501047_0010696 | 3300049581 | Bacteria | 8671 |
| 745 | Ga0501070_0019681 | 3300049586 | Bacteria | 5660 |
| 746 | Ga0501071_0203954 | 3300049587 | Bacteria | 1486 |
| 747 | Ga0501073_0096623 | 3300049589 | Bacteria | 2052 |
| 748 | Ga0501074_0097902 | 3300049590 | Bacteria | 2100 |
| 749 | Ga0501080_0005746 | 3300049742 | Bacteria | 11094 |
| 750 | Ga0501035_0239239 | 3300049822 | Bacteria | 1545 |
| 751 | Ga0501044_0490751 | 3300049823 | Bacteria | 1130 |
| 752 | nmdc:mga03n38_33846_c1 | 3300050490 | Bacteria | 2177 |
| 753 | nmdc:mga00v17_16164_c1 | 3300050491 | Bacteria | 4204 |
| 754 | nmdc:mga00v17_173280_c1 | 3300050491 | Bacteria | 1392 |
| 755 | nmdc:mga00v17_40097_c1 | 3300050491 | Bacteria | 2808 |
| 756 | nmdc:mga00v17_53285_c1 | 3300050491 | Bacteria | 2465 |
| 757 | nmdc:mga0yw44_117206_c1 | 3300050492 | Bacteria | 1712 |
| 758 | nmdc:mga0yw44_175254_c1 | 3300050492 | Bacteria | 1410 |
| 759 | nmdc:mga0yw44_19078_c1 | 3300050492 | Bacteria | 3774 |
| 760 | nmdc:mga0yw44_32783_c1 | 3300050492 | Bacteria | 3030 |
| 761 | nmdc:mga0yw44_35935_c1 | 3300050492 | Bacteria | 2916 |
| 762 | nmdc:mga0yw44_55619_c1 | 3300050492 | Bacteria | 2408 |
| 763 | nmdc:mga0k408_38450_c1 | 3300050493 | Bacteria | 2746 |
| 764 | nmdc:mga06z11_2658_c1 | 3300050494 | Bacteria | 6852 |
| 765 | nmdc:mga06z11_4741_c1 | 3300050494 | Bacteria | 5378 |
| 766 | nmdc:mga04h51_29938_c1 | 3300050495 | Bacteria | 1710 |
| 767 | nmdc:mga07m45_116892_c1 | 3300050496 | Bacteria | 1539 |
| 768 | nmdc:mga07m45_22323_c1 | 3300050496 | Bacteria | 3050 |
| 769 | nmdc:mga0n895_177960_c1 | 3300050512 | Bacteria | 2158 |
| 770 | nmdc:mga0n895_44071_c1 | 3300050512 | Bacteria | 4351 |
| 771 | nmdc:mga0rr50_70465_c1 | 3300050513 | Bacteria | 2664 |
| 772 | nmdc:mga0sz30_11563_c1 | 3300050516 | Bacteria | 3412 |
| 773 | nmdc:mga0sz30_15647_c1 | 3300050516 | Bacteria | 3000 |
| 774 | Ga0495601_0082252 | 3300053077 | Bacteria | 2067 |
| 775 | Ga0495601_0174799 | 3300053077 | Bacteria | 1404 |
| 776 | Ga0495612_0099967 | 3300053078 | Bacteria | 1234 |
| 777 | Ga0500610_0066863 | 3300053079 | Bacteria | 1874 |
| 778 | Ga0500635_0009119 | 3300053080 | Bacteria | 2743 |
| 779 | Ga0500635_0039638 | 3300053080 | Bacteria | 1568 |
| 780 | Ga0495595_0005159 | 3300053084 | Bacteria | 5277 |
| 781 | Ga0495619_0107001 | 3300053085 | Bacteria | 1907 |
| 782 | Ga0500578_0051961 | 3300053086 | Bacteria | 2625 |
| 783 | Ga0500643_000016 | 3300053087 | Bacteria | 309502 |
| 784 | Ga0500651_0155439 | 3300053093 | Bacteria | 1371 |
| 785 | Ga0500566_0000359 | 3300053094 | Bacteria | 24838 |
| 786 | Ga0500566_0001465 | 3300053094 | Bacteria | 13815 |
| 787 | Ga0500566_0015284 | 3300053094 | Bacteria | 4504 |
| 788 | Ga0500640_000223 | 3300053095 | Bacteria | 12307 |
| 789 | Ga0500640_039226 | 3300053095 | Bacteria | 2080 |
| 790 | Ga0500641_0007766 | 3300053096 | Bacteria | 3822 |
| 791 | Ga0500554_005241 | 3300053102 | Bacteria | 2808 |
| 792 | Ga0500557_000058 | 3300053105 | Bacteria | 45990 |
| 793 | Ga0500572_002073 | 3300053111 | Bacteria | 4973 |
| 794 | Ga0500595_004601 | 3300053119 | Bacteria | 6154 |
| 795 | Ga0500595_065123 | 3300053119 | Bacteria | 1092 |
| 796 | Ga0500608_017957 | 3300053122 | Bacteria | 3221 |
| 797 | Ga0500614_001118 | 3300053123 | Bacteria | 6612 |
| 798 | Ga0500614_007120 | 3300053123 | Bacteria | 2352 |
| 799 | Ga0500642_0000109 | 3300053130 | Bacteria | 40031 |
| 800 | Ga0500642_0042284 | 3300053130 | Bacteria | 1974 |
| 801 | Ga0500559_0000691 | 3300053136 | Bacteria | 22192 |
| 802 | Ga0500559_0002060 | 3300053136 | Bacteria | 10756 |
| 803 | Ga0500568_0012527 | 3300053139 | Bacteria | 3895 |
| 804 | Ga0500603_000310 | 3300053150 | Bacteria | 12812 |
| 805 | Ga0500603_000334 | 3300053150 | Bacteria | 12330 |
| 806 | Ga0500616_0020069 | 3300053153 | Bacteria | 3757 |
| 807 | Ga0500620_007078 | 3300053155 | Bacteria | 2743 |
| 808 | Ga0500622_0022779 | 3300053156 | Bacteria | 3317 |
| 809 | Ga0500630_000749 | 3300053159 | Bacteria | 14863 |
| 810 | Ga0500638_004286 | 3300053162 | Bacteria | 5464 |
| 811 | Ga0500638_011067 | 3300053162 | Bacteria | 3984 |
| 812 | Ga0500639_000274 | 3300053163 | Bacteria | 25567 |
| 813 | Ga0500639_044133 | 3300053163 | Bacteria | 2335 |
| 814 | Ga0500639_121143 | 3300053163 | Bacteria | 1256 |
| 815 | Ga0500636_0000146 | 3300053177 | Bacteria | 37168 |
| 816 | Ga0500637_0000764 | 3300053178 | Bacteria | 12913 |
| 817 | Ga0500637_0001741 | 3300053178 | Bacteria | 9389 |
| 818 | Ga0500637_0006310 | 3300053178 | Bacteria | 5829 |
| 819 | Ga0500637_0073699 | 3300053178 | Bacteria | 1966 |
| 820 | Ga0500625_025702 | 3300053729 | Bacteria | 2785 |
| 821 | Ga0500645_004354 | 3300053730 | Bacteria | 5442 |
| 822 | Ga0500645_044685 | 3300053730 | Bacteria | 1303 |
| 823 | Ga0500596_000610 | 3300053735 | Bacteria | 6867 |
| 824 | Ga0500596_003361 | 3300053735 | Bacteria | 3053 |
| 825 | Ga0500601_000511 | 3300053737 | Bacteria | 5950 |
| 826 | Ga0500661_020656 | 3300055283 | Bacteria | 1170 |
| 827 | 2507511384 | 2507262055 | Bacteria | 8048963 |
| 828 | 2508545181 | 2508501009 | Bacteria | 7784016 |
| 829 | 2508694021 | 2508501042 | Bacteria | 8719808 |
| 830 | 2509146642 | 2508501128 | Bacteria | 8613869 |
| 831 | 2511398289 | 2511231028 | Bacteria | 8046582 |
| 832 | 2513624136 | 2513237092 | Bacteria | 8341956 |
| 833 | 2513641099 | 2513237094 | Bacteria | 8789602 |
| 834 | 2513648526 | 2513237095 | Bacteria | 8976980 |
| 835 | 2513656099 | 2513237096 | Bacteria | 8722461 |
| 836 | 2513673448 | 2513237098 | Bacteria | 9902361 |
| 837 | 2513696363 | 2513237101 | Bacteria | 7952346 |
| 838 | 2513702633 | 2513237102 | Bacteria | 7703324 |
| 839 | 2513717818 | 2513237104 | Bacteria | 10034502 |
| 840 | 2513862904 | 2513237137 | Bacteria | 9558895 |
| 841 | 2513874972 | 2513237139 | Bacteria | 8737671 |
| 842 | 2513887703 | 2513237141 | Bacteria | 8496279 |
| 843 | 2513920892 | 2513237145 | Bacteria | 8979722 |
| 844 | 2514010313 | 2513237161 | Bacteria | 8871253 |
| 845 | 2515625036 | 2515154112 | Bacteria | 8294334 |
| 846 | 2517101125 | 2517093001 | Bacteria | 9002274 |
| 847 | 2517895919 | 2517572143 | Bacteria | 9484767 |
| 848 | 2524439932 | 2524023205 | Bacteria | 8918781 |
| 849 | 2524464756 | 2524023210 | Bacteria | 9029266 |
| 850 | 2524534789 | 2524023228 | Bacteria | 10118060 |
| 851 | 2617348464 | 2617270735 | Bacteria | 9163226 |
| 852 | 2617375009 | 2617270741 | Bacteria | 8201522 |
| 853 | 2671122711 | 2667528175 | Bacteria | 7532676 |
| 854 | 2723842862 | 2721755755 | Bacteria | 8322773 |
| 855 | 2728752968 | 2728368998 | Bacteria | 8720350 |
| 856 | 2745075786 | 2744054633 | Bacteria | 8678936 |
| 857 | 2793061655 | 2791355196 | Bacteria | 7323613 |
| 858 | 2793069653 | 2791355197 | Bacteria | 8420563 |
| 859 | 2793080251 | |||
| 860 | 2805916440 | 2802429603 | Bacteria | 8777136 |
| 861 | 2818240109 | 2816332527 | Bacteria | 8933356 |
| 862 | 2824608113 | 2824600985 | Bacteria | 8488197 |
| 863 | 2824615705 | 2824609381 | Bacteria | 8672835 |
| 864 | 2824625815 | 2824617872 | Bacteria | 8814715 |
| 865 | 2824634609 | 2824626560 | Bacteria | 8813858 |
| 866 | 2824642259 | 2824635225 | Bacteria | 8785348 |
| 867 | 2824652074 | 2824644064 | Bacteria | 8743947 |
| 868 | 2824660560 | 2824653114 | Bacteria | 8493680 |
| 869 | 2824665458 | 2824661429 | Bacteria | 9877870 |
| 870 | 2824679175 | 2824671348 | Bacteria | 8369588 |
| 871 | 2824686232 | 2824679649 | Bacteria | 8248951 |
| 872 | 2824695772 | 2824687955 | Bacteria | 8360029 |
| 873 | 2824702792 | 2824696289 | Bacteria | 8335049 |
| 874 | 2824709860 | 2824704595 | Bacteria | 9667483 |
| 875 | 2824719568 | 2824714736 | Bacteria | 8717648 |
| 876 | 2824732040 | 2824723954 | Bacteria | 8758240 |
| 877 | 2824738909 | 2824732956 | Bacteria | 7810675 |
| 878 | 2824752955 | 2824746037 | Bacteria | 7911610 |
| 879 | 2824759973 | 2824753945 | Bacteria | 9787441 |
| 880 | 2824769377 | 2824763712 | Bacteria | 9792355 |
| 881 | 2824779002 | 2824773399 | Bacteria | 8360218 |
| 882 | 2838128966 | 2838122688 | Bacteria | 8803140 |
| 883 | 2841946931 | 2841941048 | Bacteria | 8688029 |
| 884 | 2841957261 | 2841949485 | Bacteria | 8680857 |
| 885 | 2841961542 | 2841957949 | Bacteria | 8652217 |
| 886 | 2841970095 | 2841966195 | Bacteria | 8673214 |
| 887 | 2841977261 | 2841974524 | Bacteria | 8931498 |
| 888 | 2841985608 | 2841983080 | Bacteria | 8395090 |
| 889 | 2842042325 | 2842038055 | Bacteria | 8002051 |
| 890 | 2842050368 | 2842045827 | Bacteria | 8006841 |
| 891 | 2844316526 | 2844315083 | Bacteria | 8138177 |
| 892 | 2847939161 | 2847930680 | Bacteria | 9342022 |
| 893 | 2847943886 | 2847939898 | Bacteria | 8606328 |
| 894 | 2849081887 | 2849076700 | Bacteria | 7039503 |
| 895 | 2857513628 | 2857509624 | Bacteria | 7472071 |
| 896 | 2874594603 | 2874590934 | Bacteria | 8299676 |
| 897 | 2874606471 | 2874604998 | Bacteria | 7834745 |
| 898 | 2874615357 | 2874612657 | Bacteria | 8252029 |
| 899 | 2874620639 | 2874620515 | Bacteria | 8290088 |
| 900 | 2874633708 | 2874628541 | Bacteria | 8630250 |
| 901 | 2874649648 | 2874645413 | Bacteria | 8214782 |
| 902 | 2876766315 | 2876761206 | Bacteria | 10111113 |
| 903 | 2876773735 | 2876771140 | Bacteria | 8287509 |
| 904 | 2876809455 | 2876808645 | Bacteria | 8824342 |
| 905 | 2876820726 | 2876818435 | Bacteria | 8274608 |
| 906 | 2879076928 | 2879074833 | Bacteria | 8279565 |
| 907 | 2879090300 | 2879083081 | Bacteria | 8587928 |
| 908 | 2879100830 | 2879099564 | Bacteria | 10442239 |
| 909 | 2879113729 | 2879110137 | Bacteria | 8907982 |
| 910 | 2879130284 | 2879127579 | Bacteria | 8294491 |
| 911 | 2879146800 | 2879142872 | Bacteria | 8267021 |
| 912 | 2881367310 | 2881364244 | Bacteria | 7710352 |
| 913 | 2881668699 | 2881665667 | Bacteria | 8175609 |
| 914 | 2885373752 | 2885366525 | Bacteria | 8326213 |
| 915 | 2885382955 | 2885374607 | Bacteria | 8927485 |
| 916 | 2885386434 | 2885383462 | Bacteria | 9473874 |
| 917 | 2885412254 | 2885409591 | Bacteria | 9235467 |
| 918 | 2888386939 | 2888378607 | Bacteria | 9652610 |
| 919 | 2888389636 | 2888388044 | Bacteria | 7304136 |
| 920 | 2888421456 | 2888419890 | Bacteria | 7857137 |
| 921 | 2889033816 | 2889033259 | Bacteria | 9099371 |
| 922 | 2903732405 | 2903727486 | Bacteria | 8281579 |
| 923 | 2903755989 | 2903748898 | Bacteria | 9972761 |
| 924 | 2903773225 | 2903768456 | Bacteria | 9749579 |
| 925 | 2904666563 | 2904666416 | Bacteria | 8226587 |
| 926 | 2904699068 | 2904690495 | Bacteria | 9412302 |
| 927 | 2904707059 | |||
| 928 | 2904719528 | 2904711408 | Bacteria | 9771557 |
| 929 | 2906606280 | 2906602504 | Bacteria | 8295279 |
| 930 | 2906615614 | |||
| 931 | 2906626734 | 2906626472 | Bacteria | 8826946 |
| 932 | 2906638098 | 2906635258 | Bacteria | 8601019 |
| 933 | 2906647851 | 2906643746 | Bacteria | 8722424 |
| 934 | 2906665049 | 2906660503 | Bacteria | 8595048 |
| 935 | 2908745567 | 2908739725 | Bacteria | 8628932 |
| 936 | 2908763551 | 2908756301 | Bacteria | 8864324 |
| 937 | 2908777493 | 2908775508 | Bacteria | 8092255 |
| 938 | 2922367227 | 2922361189 | Bacteria | 7436256 |
| 939 | 2922377069 | |||
| 940 | 2922390053 | 2922386360 | Bacteria | 7017218 |
| 941 | 2922398223 | 2922393267 | Bacteria | 8285685 |
| 942 | 2922432393 | |||
| 943 | 2929619098 | 2929615660 | Bacteria | 9193770 |
| 944 | 2929628407 | 2929624759 | Bacteria | 9339455 |
| 945 | 2932791327 | 2932784394 | Bacteria | 9704911 |
| 946 | 2932795754 | 2932794094 | Bacteria | 7915132 |
| 947 | 2932801992 | 2932801729 | Bacteria | 7987968 |
| 948 | 2932817647 | 2932809354 | Bacteria | 9135765 |
| 949 | 2932826933 | 2932818245 | Bacteria | 9955613 |
| 950 | 2932833104 | 2932828146 | Bacteria | 9745859 |
| 951 | 2933581020 | 2933577622 | Bacteria | 9116884 |
| 952 | 2935612290 | 2935608549 | Bacteria | 8203142 |
| 953 | 2935623833 | 2935616580 | Bacteria | 9032984 |
| 954 | 2935630782 | 2935630451 | Bacteria | 8169952 |
| 955 | 2935639608 | 2935638405 | Bacteria | 10015038 |
| 956 | 2935650129 | 2935648319 | Bacteria | 8801166 |
| 957 | 2935658276 | 2935656913 | Bacteria | 8965014 |
| 958 | 2935667553 | 2935665750 | Bacteria | 9571747 |
| 959 | 2935682884 | 2935675223 | Bacteria | 9928132 |
| 960 | 2935687547 | 2935684952 | Bacteria | 9590419 |
| 961 | 2935696481 | 2935694250 | Bacteria | 9291695 |
| 962 | 2935705294 | 2935703347 | Bacteria | 10242284 |
| 963 | 2935719007 | 2935713505 | Bacteria | 9608509 |
| 964 | 2935728659 | 2935722832 | Bacteria | 9608746 |
| 965 | 2935736745 | 2935732158 | Bacteria | 9706831 |
| 966 | 2935746253 | 2935741537 | Bacteria | 9707219 |
| 967 | 2935753513 | 2935750917 | Bacteria | 9590372 |
| 968 | 2935767710 | 2935760218 | Bacteria | 9817913 |
| 969 | 2935770472 | 2935769743 | Bacteria | 7878163 |
| 970 | 2935782501 | 2935777560 | Bacteria | 8077691 |
| 971 | 2935786475 | 2935785616 | Bacteria | 7962367 |
| 972 | 2935794530 | 2935793552 | Bacteria | 8012592 |
| 973 | 2935807039 | 2935801545 | Bacteria | 9301974 |
| 974 | 2935814046 | 2935810662 | Bacteria | 9401221 |
| 975 | 2935823778 | 2935819856 | Bacteria | 8261050 |
| 976 | 2935829090 | 2935827899 | Bacteria | 10038562 |
| 977 | 2935845375 | 2935837841 | Bacteria | 9454360 |
| 978 | 2935854416 | 2935847175 | Bacteria | 8228321 |
| 979 | 2935861942 | 2935855204 | Bacteria | 9035059 |
| 980 | 2935872808 | 2935864058 | Bacteria | 9784707 |
| 981 | 2935880383 | 2935873716 | Bacteria | 9632195 |
| 982 | 2935886180 | 2935883170 | Bacteria | 7964738 |
| 983 | 2935913490 | 2935908558 | Bacteria | 8568796 |
| 984 | 2935923387 | 2935916978 | Bacteria | 9113783 |
| 985 | 2935931193 | 2935926038 | Bacteria | 8601059 |
| 986 | 2935935475 | 2935934488 | Bacteria | 8602579 |
| 987 | 2935947041 | 2935942939 | Bacteria | 8599779 |
| 988 | 2935953864 | 2935951376 | Bacteria | 8602333 |
| 989 | 2935961500 | 2935959822 | Bacteria | 7869783 |
| 990 | 2935968890 | 2935967501 | Bacteria | 8603075 |
| 991 | 2935982443 | 2935975950 | Bacteria | 8347125 |
| 992 | 2935985908 | 2935984226 | Bacteria | 8302647 |
| 993 | 2935994993 | 2935992306 | Bacteria | 9802711 |
| 994 | 2936006086 | 2936002035 | Bacteria | 9362176 |
| 995 | 2936013312 | 2936011229 | Bacteria | 8801034 |
| 996 | 2936021601 | 2936019824 | Bacteria | 8804134 |
| 997 | 2936030605 | 2936028420 | Bacteria | 8965941 |
| 998 | 2936039601 | 2936037263 | Bacteria | 9446081 |
| 999 | 2936047795 | 2936046547 | Bacteria | 8903709 |
| 1000 | 2936057797 | 2936055302 | Bacteria | 8785755 |
| 1001 | 2940559426 | 2940556831 | Bacteria | 9590747 |
| 1002 | 2941507434 | 2941507105 | Bacteria | 8166816 |
| 1003 | 2941515861 | 2941515067 | Bacteria | 8166720 |
| 1004 | 2941523431 | 2941523033 | Bacteria | 8169134 |
| 1005 | 2941536995 | 2941531003 | Bacteria | 7653939 |
| 1006 | 2941545654 | 2941538514 | Bacteria | 9402094 |
| 1007 | 3005476646 | 3005474847 | Bacteria | 9259049 |
| 1008 | 3005487666 | 3005483717 | Bacteria | 7877331 |
| 1009 | 3005511183 | 3005506211 | Bacteria | 6943378 |
| 1010 | 3005592034 | 3005587118 | Bacteria | 7794411 |
| 1011 | 3005596152 | 3005594810 | Bacteria | 8716512 |
| 1012 | 3005712099 | 3005710791 | Bacteria | 7622528 |
| 1013 | 3005719336 | 3005718088 | Bacteria | 8283608 |
| 1014 | 8006929437 | 8006926726 | Bacteria | 6749210 |
| 1015 | 8006934834 | 8006933436 | Bacteria | 10410654 |
| 1016 | 8006966177 | 8006964411 | Bacteria | 8966052 |
| 1017 | 8006974802 | 8006973647 | Bacteria | 10679141 |
| 1018 | 8006989654 | 8006984368 | Bacteria | 9651211 |
| 1019 | 8006998046 | 8006994254 | Bacteria | 8309700 |
| 1020 | 8016516935 | 8016511872 | Bacteria | 9921665 |
| 1021 | 8016524515 | 8016522445 | Bacteria | 8156687 |
| 1022 | 8016538076 | 8016530956 | Bacteria | 8155261 |
| 1023 | 8016542352 | 8016539877 | Bacteria | 8155419 |
| 1024 | 8016550925 | 8016548790 | Bacteria | 8155074 |
| 1025 | 8016559339 | 8016557553 | Bacteria | 8154380 |
| 1026 | 8016567739 | 8016566248 | Bacteria | 8158151 |
| 1027 | 8016580432 | 8016575299 | Bacteria | 8154085 |
| 1028 | 8016588620 | 8016583857 | Bacteria | 10421953 |
| 1029 | 8016597280 | 8016595262 | Bacteria | 8149947 |
| 1030 | 8016604979 | 8016603502 | Bacteria | 8731218 |
| 1031 | 8016620031 | 8016613128 | Bacteria | 8794220 |
| 1032 | 8016624251 | 8016622563 | Bacteria | 7999408 |
| 1033 | 8016637657 | 8016630954 | Bacteria | 9217207 |
| 1034 | 8017059635 | 8017057580 | Bacteria | 10023680 |
| 1035 | 8019537743 | 8019530166 | Bacteria | 8155624 |
| 1036 | 8019539374 | 8019538911 | Bacteria | 7872763 |
| 1037 | 8019551271 | 8019547302 | Bacteria | 7996444 |
| 1038 | 8019563822 | 8019555841 | Bacteria | 9642137 |
| 1039 | 8019573890 | 8019565922 | Bacteria | 9639779 |
| 1040 | 8019579109 | 8019576017 | Bacteria | 10049540 |
| 1041 | 8019597163 | 8019586578 | Bacteria | 10212056 |
| 1042 | 8019604527 | 8019597564 | Bacteria | 10041141 |
| 1043 | 8019614004 | 8019608314 | Bacteria | 10042931 |
| 1044 | 8019624550 | 8019619141 | Bacteria | 9218857 |
| 1045 | 8019637492 | 8019629233 | Bacteria | 8687553 |
| 1046 | 8019642118 | 8019638758 | Bacteria | 9062356 |
| 1047 | 8019650403 | 8019648815 | Bacteria | 10014479 |
| 1048 | 8019665424 | 8019659431 | Bacteria | 8577854 |
| 1049 | 8019674970 | 8019668869 | Bacteria | 8791617 |
| 1050 | 8019681126 | 8019678201 | Bacteria | 8863603 |
| 1051 | 8019694574 | 8019687851 | Bacteria | 8712826 |
| 1052 | 8055749644 | 8055742211 | Bacteria | 9226248 |
| 1053 | 8056675078 | 8056673599 | Bacteria | 7871253 |
| 1054 | 8056684662 | 8056681323 | Bacteria | 8472857 |
| 1055 | 8056973862 | 8056967851 | Bacteria | 9038162 |
| 1056 | Ga0207674_10050854 | |||
| 1057 | JGI25165J46597_1006170 | |||
| 1058 | rootH1_10087822 | |||
| 1059 | JGI25160J50197_1009314 | |||
| 1060 | JGI25160J50197_1010686 | |||
| 1061 | JGI25160J50197_1022482 | |||
| 1062 | JGI25404J52841_10001294 | |||
| 1063 | JGI25404J52841_10002561 | |||
| 1064 | JGI25404J52841_10011860 | |||
| 1065 | JGI25404J52841_10019493 | |||
| 1066 | Ga0055531_10014879 | |||
| 1067 | Ga0055543_1001485 | |||
| 1068 | Ga0065165_1001376 | |||
| 1069 | Ga0065165_1005421 | |||
| 1070 | Ga0070658_10087865 | |||
| 1071 | Ga0070658_10207249 | |||
| 1072 | Ga0070683_100227303 | |||
| 1073 | Ga0070683_100253308 | |||
| 1074 | Ga0070670_100070676 | |||
| 1075 | Ga0068869_100021269 | |||
| 1076 | Ga0070680_100040184 | |||
| 1077 | Ga0070680_100340756 | |||
| 1078 | Ga0070682_100038542 | |||
| 1079 | Ga0068868_100016760 | |||
| 1080 | Ga0068868_100022538 | |||
| 1081 | Ga0068868_100221960 | |||
| 1082 | Ga0070660_100182043 | |||
| 1083 | Ga0070691_10060494 | |||
| 1084 | Ga0070687_100262398 | |||
| 1085 | Ga0070661_100207321 | |||
| 1086 | Ga0070661_100228438 | |||
| 1087 | Ga0070668_100036126 | |||
| 1088 | Ga0070668_100085347 | |||
| 1089 | Ga0070668_100141123 | |||
| 1090 | Ga0070669_100075838 | |||
| 1091 | Ga0070671_100004615 | |||
| 1092 | Ga0070673_100039182 | |||
| 1093 | Ga0070659_100128239 | |||
| 1094 | Ga0070709_10009471 | |||
| 1095 | Ga0070709_10009924 | |||
| 1096 | Ga0070714_100090281 | |||
| 1097 | Ga0070714_100100486 | |||
| 1098 | Ga0070714_100223751 | |||
| 1099 | Ga0070714_100483641 | |||
| 1100 | Ga0070713_100003995 | |||
| 1101 | Ga0070713_100060683 | |||
| 1102 | Ga0070713_100111409 | |||
| 1103 | Ga0070710_10000354 | |||
| 1104 | Ga0070711_100079786 | |||
| 1105 | Ga0070711_100153125 | |||
| 1106 | Ga0070708_100032198 | |||
| 1107 | Ga0070663_100034425 | |||
| 1108 | Ga0070663_100062682 | |||
| 1109 | Ga0070681_10043868 | |||
| 1110 | Ga0070681_10147849 | |||
| 1111 | Ga0070681_10152124 | |||
| 1112 | Ga0070681_10156834 | |||
| 1113 | Ga0070698_100103607 | |||
| 1114 | Ga0070679_100008173 | |||
| 1115 | Ga0070679_100043766 | |||
| 1116 | Ga0070679_100116448 | |||
| 1117 | Ga0070679_100144623 | |||
| 1118 | Ga0070679_100313829 | |||
| 1119 | Ga0070679_100496038 | |||
| 1120 | Ga0070684_100007383 | |||
| 1121 | Ga0070684_100041482 | |||
| 1122 | Ga0070684_100044811 | |||
| 1123 | Ga0070697_100040016 | |||
| 1124 | Ga0068853_100009856 | |||
| 1125 | Ga0068853_100029321 | |||
| 1126 | Ga0068853_100079038 | |||
| 1127 | Ga0068853_100162707 | |||
| 1128 | Ga0068853_100224536 | |||
| 1129 | Ga0068853_100265006 | |||
| 1130 | Ga0070672_100044913 | |||
| 1131 | Ga0070672_100111369 | |||
| 1132 | Ga0070665_100015994 | |||
| 1133 | Ga0070665_100044686 | |||
| 1134 | Ga0070665_100124841 | |||
| 1135 | Ga0068855_100053745 | |||
| 1136 | Ga0068855_100183563 | |||
| 1137 | Ga0068855_100390481 | |||
| 1138 | Ga0070664_100014972 | |||
| 1139 | Ga0070664_100257083 | |||
| 1140 | Ga0068857_100031797 | |||
| 1141 | Ga0068854_100136291 | |||
| 1142 | Ga0068856_100002849 | |||
| 1143 | Ga0068856_100279553 | |||
| 1144 | Ga0070702_100032076 | |||
| 1145 | Ga0068852_100022694 | |||
| 1146 | Ga0068852_100220177 | |||
| 1147 | Ga0068852_100331439 | |||
| 1148 | Ga0068859_100301163 | |||
| 1149 | Ga0068864_100017485 | |||
| 1150 | Ga0068861_100010994 | |||
| 1151 | Ga0068861_100048183 | |||
| 1152 | Ga0068851_10018196 | |||
| 1153 | Ga0068851_10033883 | |||
| 1154 | Ga0068870_10078771 | |||
| 1155 | Ga0068863_100029494 | |||
| 1156 | Ga0068863_100224386 | |||
| 1157 | Ga0068858_100060910 | |||
| 1158 | Ga0068858_100093556 | |||
| 1159 | Ga0068858_100201196 | |||
| 1160 | Ga0068860_100101612 | |||
| 1161 | Ga0068860_100127112 | |||
| 1162 | Ga0068860_100366897 | |||
| 1163 | Ga0068862_100047874 | |||
| 1164 | Ga0068862_100052726 | |||
| 1165 | Ga0068862_100073668 | |||
| 1166 | Ga0068862_100112368 | |||
| 1167 | Ga0068862_100226201 | |||
| 1168 | Ga0081455_10002391 | |||
| 1169 | Ga0081455_10008216 | |||
| 1170 | Ga0081455_10025742 | |||
| 1171 | Ga0081455_10082273 | |||
| 1172 | Ga0081455_10083718 | |||
| 1173 | Ga0081540_1000876 | |||
| 1174 | Ga0081540_1001057 | |||
| 1175 | Ga0081540_1001355 | |||
| 1176 | Ga0081540_1006825 | |||
| 1177 | Ga0081540_1008183 | |||
| 1178 | Ga0081540_1013124 | |||
| 1179 | Ga0081540_1013668 | |||
| 1180 | Ga0081540_1026846 | |||
| 1181 | Ga0081540_1034143 | |||
| 1182 | Ga0081540_1044842 | |||
| 1183 | Ga0081540_1060292 | |||
| 1184 | Ga0081539_10000958 | |||
| 1185 | Ga0081539_10037151 | |||
| 1186 | Ga0070717_10000879 | |||
| 1187 | Ga0070717_10004010 | |||
| 1188 | Ga0070717_10159239 | |||
| 1189 | Ga0070717_10227624 | |||
| 1190 | Ga0075365_10006174 | |||
| 1191 | Ga0075365_10076606 | |||
| 1192 | Ga0075365_10079609 | |||
| 1193 | Ga0075368_10008768 | |||
| 1194 | Ga0075368_10057356 | |||
| 1195 | Ga0075363_100002408 | |||
| 1196 | Ga0075363_100035826 | |||
| 1197 | Ga0075363_100056365 | |||
| 1198 | Ga0075364_10021061 | |||
| 1199 | Ga0075364_10051999 | |||
| 1200 | Ga0075364_10062058 | |||
| 1201 | Ga0075432_10086113 | |||
| 1202 | Ga0070712_100053314 | |||
| 1203 | Ga0075367_10019327 | |||
| 1204 | Ga0075367_10060627 | |||
| 1205 | Ga0075367_10081126 | |||
| 1206 | Ga0075367_10120902 | |||
| 1207 | Ga0075369_10022623 | |||
| 1208 | Ga0075369_10028690 | |||
| 1209 | Ga0075366_10011991 | |||
| 1210 | Ga0075366_10025819 | |||
| 1211 | Ga0075366_10111921 | |||
| 1212 | Ga0075366_10128390 | |||
| 1213 | Ga0075366_10202879 | |||
| 1214 | Ga0097621_100211157 | |||
| 1215 | Ga0075370_10082553 | |||
| 1216 | Ga0068871_100033296 | |||
| 1217 | Ga0068871_100064105 | |||
| 1218 | Ga0068871_100117942 | |||
| 1219 | Ga0075428_100057249 | |||
| 1220 | Ga0075434_100104926 | |||
| 1221 | Ga0068865_100235411 | |||
| 1222 | Ga0075436_100124040 | |||
| 1223 | Ga0097620_100301155 | |||
| 1224 | Ga0099823_1008012 | |||
| 1225 | Ga0075435_100061613 | |||
| 1226 | Ga0099795_10032255 | |||
| 1227 | Ga0105244_10077045 | |||
| 1228 | Ga0105250_10041582 | |||
| 1229 | Ga0105240_10002375 | |||
| 1230 | Ga0105240_10012518 | |||
| 1231 | Ga0105240_10021194 | |||
| 1232 | Ga0105240_10113195 | |||
| 1233 | Ga0105240_10182585 | |||
| 1234 | Ga0105240_10394089 | |||
| 1235 | Ga0111539_10479835 | |||
| 1236 | Ga0105245_10022776 | |||
| 1237 | Ga0105245_10229823 | |||
| 1238 | Ga0105245_10277838 | |||
| 1239 | Ga0105245_10520430 | |||
| 1240 | Ga0105245_10718977 | |||
| 1241 | Ga0105247_10027347 | |||
| 1242 | Ga0105247_10073898 | |||
| 1243 | Ga0105247_10083393 | |||
| 1244 | Ga0114129_10082526 | |||
| 1245 | Ga0114129_10310362 | |||
| 1246 | Ga0105243_10088147 | |||
| 1247 | Ga0105241_10070681 | |||
| 1248 | Ga0105241_10087873 | |||
| 1249 | Ga0105241_10116546 | |||
| 1250 | Ga0105241_10134747 | |||
| 1251 | Ga0105242_10203890 | |||
| 1252 | Ga0105248_10018230 | |||
| 1253 | Ga0105248_10026667 | |||
| 1254 | Ga0105248_10043229 | |||
| 1255 | Ga0105248_10180112 | |||
| 1256 | Ga0105248_10196203 | |||
| 1257 | Ga0105248_10410721 | |||
| 1258 | Ga0105237_10005704 | |||
| 1259 | Ga0105237_10015508 | |||
| 1260 | Ga0105237_10018101 | |||
| 1261 | Ga0105237_10023103 | |||
| 1262 | Ga0105237_10082020 | |||
| 1263 | Ga0105237_10108656 | |||
| 1264 | Ga0105237_10118480 | |||
| 1265 | Ga0105238_10044702 | |||
| 1266 | Ga0105238_10068523 | |||
| 1267 | Ga0105238_10121083 | |||
| 1268 | Ga0105249_10072669 | |||
| 1269 | Ga0105249_10180362 | |||
| 1270 | Ga0105249_10686885 | |||
| 1271 | Ga0105249_10723966 | |||
| 1272 | Ga0099796_10001408 | |||
| 1273 | Ga0099796_10062361 | |||
| 1274 | Ga0105239_10011442 | |||
| 1275 | Ga0105239_10046389 | |||
| 1276 | Ga0105239_10050756 | |||
| 1277 | Ga0105239_10093670 | |||
| 1278 | Ga0105239_10127494 | |||
| 1279 | Ga0105239_10181637 | |||
| 1280 | Ga0105239_10212611 | |||
| 1281 | Ga0105246_10207022 | |||
| 1282 | Ga0157370_10040683 | |||
| 1283 | Ga0157370_10073270 | |||
| 1284 | Ga0157370_10145697 | |||
| 1285 | Ga0157369_10013879 | |||
| 1286 | Ga0157369_10032628 | |||
| 1287 | Ga0157369_10053166 | |||
| 1288 | Ga0157374_10043558 | |||
| 1289 | Ga0157378_10056131 | |||
| 1290 | Ga0163162_10060537 | |||
| 1291 | Ga0163162_10126411 | |||
| 1292 | Ga0163162_10253647 | |||
| 1293 | Ga0157372_10203594 | |||
| 1294 | Ga0157372_10270010 | |||
| 1295 | Ga0157375_10203812 | |||
| 1296 | Ga0163163_10009057 | |||
| 1297 | Ga0157380_10061401 | |||
| 1298 | Ga0157377_10283262 | |||
| 1299 | Ga0157379_10044212 | |||
| 1300 | Ga0157379_10057511 | |||
| 1301 | Ga0157379_10215715 | |||
| 1302 | Ga0157376_10017125 | |||
| 1303 | Ga0157376_10099309 | |||
| 1304 | Ga0214544_1000005 | |||
| 1305 | Ga0214542_1000004 | |||
| 1306 | Ga0214545_1000005 | |||
| 1307 | Ga0214545_1031225 | |||
| 1308 | Ga0214543_1000564 | |||
| 1309 | Ga0213876_10008568 | |||
| 1310 | Ga0213871_10007091 | |||
| 1311 | Ga0209677_100391 | |||
| 1312 | Ga0209677_104865 | |||
| 1313 | Ga0209148_1000900 | |||
| 1314 | Ga0209148_1007943 | |||
| 1315 | Ga0209233_1001098 | |||
| 1316 | Ga0209233_1007522 | |||
| 1317 | Ga0209455_1001425 | |||
| 1318 | Ga0209455_1003294 | |||
| 1319 | Ga0209455_1018859 | |||
| 1320 | Ga0209758_1000102 | |||
| 1321 | Ga0209758_1000732 | |||
| 1322 | Ga0209758_1003159 | |||
| 1323 | Ga0209758_1004735 | |||
| 1324 | Ga0209758_1017230 | |||
| 1325 | Ga0209758_1068105 | |||
| 1326 | Ga0207426_1000354 | |||
| 1327 | Ga0207426_1000521 | |||
| 1328 | Ga0207426_1005878 | |||
| 1329 | Ga0209257_1001340 | |||
| 1330 | Ga0207697_10067290 | |||
| 1331 | Ga0207656_10019673 | |||
| 1332 | Ga0207656_10044922 | |||
| 1333 | Ga0207692_10000064 | |||
| 1334 | Ga0207692_10231610 | |||
| 1335 | Ga0207642_10135723 | |||
| 1336 | Ga0207710_10092290 | |||
| 1337 | Ga0207688_10052008 | |||
| 1338 | Ga0207647_10001590 | |||
| 1339 | Ga0207647_10060689 | |||
| 1340 | Ga0207647_10102104 | |||
| 1341 | Ga0207699_10010189 | |||
| 1342 | Ga0207699_10012565 | |||
| 1343 | Ga0207699_10037112 | |||
| 1344 | Ga0207643_10113049 | |||
| 1345 | Ga0207705_10184488 | |||
| 1346 | Ga0207684_10099753 | |||
| 1347 | Ga0207654_10034161 | |||
| 1348 | Ga0207654_10036401 | |||
| 1349 | Ga0207654_10048473 | |||
| 1350 | Ga0207707_10000827 | |||
| 1351 | Ga0207707_10001679 | |||
| 1352 | Ga0207707_10053392 | |||
| 1353 | Ga0207707_10059228 | |||
| 1354 | Ga0207707_10109761 | |||
| 1355 | Ga0207707_10247492 | |||
| 1356 | Ga0207695_10000006 | |||
| 1357 | Ga0207695_10063403 | |||
| 1358 | Ga0207695_10123854 | |||
| 1359 | Ga0207671_10003551 | |||
| 1360 | Ga0207671_10034572 | |||
| 1361 | Ga0207671_10073678 | |||
| 1362 | Ga0207671_10116409 | |||
| 1363 | Ga0207671_10168137 | |||
| 1364 | Ga0207671_10189095 | |||
| 1365 | Ga0207671_10313147 | |||
| 1366 | Ga0207693_10012104 | |||
| 1367 | Ga0207693_10036737 | |||
| 1368 | Ga0207693_10060877 | |||
| 1369 | Ga0207693_10213002 | |||
| 1370 | Ga0207660_10021880 | |||
| 1371 | Ga0207660_10081175 | |||
| 1372 | Ga0207660_10299321 | |||
| 1373 | Ga0207657_10001315 | |||
| 1374 | Ga0207657_10088631 | |||
| 1375 | Ga0207657_10152790 | |||
| 1376 | Ga0207649_10076160 | |||
| 1377 | Ga0207649_10104401 | |||
| 1378 | Ga0207652_10001089 | |||
| 1379 | Ga0207652_10022161 | |||
| 1380 | Ga0207652_10044205 | |||
| 1381 | Ga0207652_10145609 | |||
| 1382 | Ga0207652_10299022 | |||
| 1383 | Ga0207646_10017460 | |||
| 1384 | Ga0207694_10195557 | |||
| 1385 | Ga0207659_10355514 | |||
| 1386 | Ga0207687_10065085 | |||
| 1387 | Ga0207700_10001903 | |||
| 1388 | Ga0207700_10086868 | |||
| 1389 | Ga0207664_10047855 | |||
| 1390 | Ga0207664_10245383 | |||
| 1391 | Ga0207664_10470080 | |||
| 1392 | Ga0207644_10248745 | |||
| 1393 | Ga0207706_10428022 | |||
| 1394 | Ga0207709_10010026 | |||
| 1395 | Ga0207670_10301873 | |||
| 1396 | Ga0207669_10002843 | |||
| 1397 | Ga0207704_10319368 | |||
| 1398 | Ga0207665_10008591 | |||
| 1399 | Ga0207665_10055029 | |||
| 1400 | Ga0207665_10095014 | |||
| 1401 | Ga0207691_10114965 | |||
| 1402 | Ga0207691_10119416 | |||
| 1403 | Ga0207691_10179879 | |||
| 1404 | Ga0207691_10225268 | |||
| 1405 | Ga0207711_10041679 | |||
| 1406 | Ga0207711_10430746 | |||
| 1407 | Ga0207689_10033789 | |||
| 1408 | Ga0207689_10053585 | |||
| 1409 | Ga0207689_10272365 | |||
| 1410 | Ga0207661_10003154 | |||
| 1411 | Ga0207661_10095826 | |||
| 1412 | Ga0207661_10178100 | |||
| 1413 | Ga0207679_10174460 | |||
| 1414 | Ga0207667_10023055 | |||
| 1415 | Ga0207712_10037787 | |||
| 1416 | Ga0207712_10253518 | |||
| 1417 | Ga0207712_10482123 | |||
| 1418 | Ga0207668_10069976 | |||
| 1419 | Ga0207668_10227217 | |||
| 1420 | Ga0207640_10011386 | |||
| 1421 | Ga0207640_10189279 | |||
| 1422 | Ga0207677_10029411 | |||
| 1423 | Ga0207703_10060227 | |||
| 1424 | Ga0207703_10126175 | |||
| 1425 | Ga0207703_10285034 | |||
| 1426 | Ga0207639_10009882 | |||
| 1427 | Ga0207639_10022260 | |||
| 1428 | Ga0207639_10110862 | |||
| 1429 | Ga0207639_10149151 | |||
| 1430 | Ga0207639_10215143 | |||
| 1431 | Ga0207678_10003718 | |||
| 1432 | Ga0207678_10038266 | |||
| 1433 | Ga0207678_10059272 | |||
| 1434 | Ga0207678_10097524 | |||
| 1435 | Ga0207708_10080240 | |||
| 1436 | Ga0207702_10000325 | |||
| 1437 | Ga0207702_10058600 | |||
| 1438 | Ga0207641_10037207 | |||
| 1439 | Ga0207641_10306106 | |||
| 1440 | Ga0207641_10509501 | |||
| 1441 | Ga0207648_10028909 | |||
| 1442 | Ga0207648_10081895 | |||
| 1443 | Ga0207674_10039712 | |||
| 1444 | Ga0207675_100082737 | |||
| 1445 | Ga0207683_10046036 | |||
| 1446 | Ga0207698_10245913 | |||
| 1447 | Ga0207698_10327503 | |||
| 1448 | Ga0209389_1000021 | |||
| 1449 | Ga0209389_1000086 | |||
| 1450 | Ga0209589_1000005 | |||
| 1451 | Ga0209589_1000027 | |||
| 1452 | Ga0209489_100005 | |||
| 1453 | Ga0209489_100313 | |||
| 1454 | Ga0209489_105143 | |||
| 1455 | Ga0209700_100006 | |||
| 1456 | Ga0209700_100483 | |||
| 1457 | Ga0209588_1011445 | |||
| 1458 | Ga0209813_10082380 | |||
| 1459 | Ga0268266_10001864 | |||
| 1460 | Ga0268266_10003347 | |||
| 1461 | Ga0268266_10014684 | |||
| 1462 | Ga0268266_10046928 | |||
| 1463 | Ga0268266_10113604 | |||
| 1464 | Ga0268265_10008324 | |||
| 1465 | Ga0268265_10050516 | |||
| 1466 | Ga0268265_10192782 | |||
| 1467 | Ga0268264_10000174 | |||
| 1468 | Ga0268264_10109509 | |||
| 1469 | Ga0268264_10296137 | |||
| 1470 | Ga0265319_1009526 | |||
| 1471 | Ga0265334_10077862 | |||
| 1472 | Ga0265336_10000187 | |||
| 1473 | Ga0307517_10000124 | |||
| 1474 | Ga0307517_10201173 | |||
| 1475 | Ga0307515_10299424 | |||
| 1476 | Ga0265338_10001016 | |||
| 1477 | Ga0265324_10003444 | |||
| 1478 | Ga0265325_10056438 | |||
| 1479 | Ga0265340_10008671 | |||
| 1480 | Ga0265340_10102843 | |||
| 1481 | Ga0265339_10001394 | |||
| 1482 | Ga0265339_10025376 | |||
| 1483 | Ga0265316_10109081 | |||
| 1484 | Ga0307509_10331849 | |||
| 1485 | Ga0307508_10018487 | |||
| 1486 | Ga0307508_10045268 | |||
| 1487 | Ga0265314_10002593 | |||
| 1488 | Ga0265314_10055522 | |||
| 1489 | Ga0265342_10064069 | |||
| 1490 | Ga0265342_10094777 | |||
| 1491 | Ga0307516_10114947 | |||
| 1492 | Ga0307412_10094907 | |||
| 1493 | Ga0307409_100374935 | |||
| 1494 | Ga0307415_100217806 | |||
| 1495 | Ga0307510_10049437 | |||
| 1496 | Ga0307510_10066290 | |||
| 1497 | Ga0315911_1000041 | |||
| 1498 | Ga0316215_1001232 | |||
| 1499 | Ga0373930_0000900 | |||
| 1500 | Ga0373950_0019509 | |||
| 1501 | Ga0373958_0021649 | |||
| 1502 | Ga0373934_0043554 | |||
| 1503 | Ga0373923_0030651 | |||
| 1504 | Ga0373945_0019029 | |||
| 1505 | Ga0373945_0025597 | |||
| 1506 | Ga0373945_0039927 | |||
| 1507 | Ga0373956_0002585 | |||
| 1508 | Ga0373956_0057140 | |||
| 1509 | Ga0373957_0002973 | |||
| 1510 | Ga0373943_0004058 | |||
| 1511 | Ga0373946_0012851 | |||
| 1512 | Ga0373955_0002301 | |||
| 1513 | Ga0373924_0011130 | |||
| 1514 | Ga0373931_0002920 | |||
| 1515 | Ga0373931_0188392 | |||
| 1516 | Ga0373935_0000562 | |||
| 1517 | Ga0373935_0260930 | |||
| 1518 | Ga0373927_0001832 | |||
| 1519 | Ga0373927_0013030 | |||
| 1520 | Ga0373927_0031076 | |||
| 1521 | Ga0373927_0067302 | |||
| 1522 | Ga0373927_0257581 | |||
| 1523 | Ga0373933_0008030 | |||
| 1524 | Ga0373933_0010257 | |||
| 1525 | Ga0373933_0060228 | |||
| 1526 | Ga0373933_0109511 | |||
| 1527 | Ga0373947_0007458 | |||
| 1528 | Ga0373947_0011887 | |||
| 1529 | Ga0373947_0044339 | |||
| 1530 | Ga0373947_0058251 | |||
| 1531 | Ga0373947_0202343 | |||
| 1532 | Ga0373937_0055338 | |||
| 1533 | Ga0373937_0112057 | |||
| 1534 | Ga0373937_0213919 | |||
| 1535 | Ga0373937_0513183 | |||
| 1536 | Ga0373925_0001669 | |||
| 1537 | Ga0373925_0035611 | |||
| 1538 | Ga0373925_0223351 | |||
| 1539 | Ga0373925_0526914 | |||
| 1540 | Ga0395899_0062298 | |||
| 1541 | Ga0395900_0021484 | |||
| 1542 | Ga0395900_0025417 | |||
| 1543 | Ga0395900_0353417 | |||
| 1544 | Ga0395898_0097123 | |||
| 1545 | Ga0395898_0116414 | |||
| 1546 | Ga0395898_0139257 | |||
| 1547 | Ga0395898_0141641 | |||
| 1548 | Ga0395905_0002158 | |||
| 1549 | Ga0395905_0065008 | |||
| 1550 | Ga0395905_0090968 | |||
| 1551 | Ga0436364_0084522 | |||
| 1552 | Ga0436364_0815325 | |||
| 1553 | Ga0395901_0048271 | |||
| 1554 | Ga0395901_0207784 | |||
| 1555 | Ga0436365_1071754 | |||
| 1556 | Ga0436365_1439813 | |||
| 1557 | Ga0436360_0143183 | |||
| 1558 | Ga0436360_0650426 | |||
| 1559 | Ga0436361_0090009 | |||
| 1560 | Ga0436363_1183617 | |||
| 1561 | Ga0436363_1312646 | |||
| 1562 | Ga0436362_0264286 | |||
| 1563 | Ga0436362_0951882 | |||
| 1564 | Ga0439465_0058202 | |||
| 1565 | Ga0451793_1839637 | |||
| 1566 | Ga0451795_0758075 | |||
| 1567 | Ga0451804_0633050 | |||
| 1568 | Ga0451845_0934764 | |||
| 1569 | Ga0466972_0000266 | |||
| 1570 | Ga0466965_0052121 | |||
| 1571 | Ga0466966_0003043 | |||
| 1572 | Ga0466961_0000172 | |||
| 1573 | Ga0466963_0029690 | |||
| 1574 | Ga0466964_0102285 | |||
| 1575 | Ga0466971_0034106 | |||
| 1576 | Ga0466968_0012638 | |||
| 1577 | Ga0466970_0160427 | |||
| 1578 | Ga0466957_0214786 | |||
| 1579 | Ga0466959_0035913 | |||
| 1580 | Ga0466959_0077585 | |||
| 1581 | Ga0466967_0390228 | |||
| 1582 | Ga0495617_041043 | |||
| 1583 | Ga0495592_0004765 | |||
| 1584 | Ga0495592_0072002 | |||
| 1585 | Ga0495603_0001885 | |||
| 1586 | Ga0495603_0002323 | |||
| 1587 | Ga0495603_0034967 | |||
| 1588 | Ga0495603_0037566 | |||
| 1589 | Ga0495603_0076222 | |||
| 1590 | Ga0495629_0000913 | |||
| 1591 | Ga0495629_0111696 | |||
| 1592 | Ga0495638_0005734 | |||
| 1593 | Ga0495638_0133441 | |||
| 1594 | Ga0495641_0030774 | |||
| 1595 | Ga0495651_0011025 | |||
| 1596 | Ga0495651_0017587 | |||
| 1597 | Ga0495653_0006954 | |||
| 1598 | Ga0495653_0143935 | |||
| 1599 | Ga0495580_0000514 | |||
| 1600 | Ga0495580_0084672 | |||
| 1601 | Ga0495580_0161119 | |||
| 1602 | Ga0495582_0000854 | |||
| 1603 | Ga0495639_0000533 | |||
| 1604 | Ga0495639_0041951 | |||
| 1605 | Ga0495662_0000117 | |||
| 1606 | Ga0495662_0056305 | |||
| 1607 | Ga0495664_0144225 | |||
| 1608 | Ga0495584_0111324 | |||
| 1609 | Ga0495585_0039378 | |||
| 1610 | Ga0495594_0000083 | |||
| 1611 | Ga0495596_0056043 | |||
| 1612 | Ga0495596_0058216 | |||
| 1613 | Ga0495608_0068488 | |||
| 1614 | Ga0495608_0072758 | |||
| 1615 | Ga0495618_0038223 | |||
| 1616 | Ga0495618_0110131 | |||
| 1617 | Ga0495618_0200967 | |||
| 1618 | Ga0495620_0034145 | |||
| 1619 | Ga0495628_0015330 | |||
| 1620 | Ga0495628_0271138 | |||
| 1621 | Ga0495628_0290858 | |||
| 1622 | Ga0495630_0019357 | |||
| 1623 | Ga0495630_0132515 | |||
| 1624 | Ga0495631_0086131 | |||
| 1625 | Ga0495632_0057162 | |||
| 1626 | Ga0495632_0070599 | |||
| 1627 | Ga0495643_0048452 | |||
| 1628 | Ga0495648_0036431 | |||
| 1629 | Ga0495648_0188390 | |||
| 1630 | Ga0495666_0007828 | |||
| 1631 | Ga0495652_0006066 | |||
| 1632 | Ga0495652_0010138 | |||
| 1633 | Ga0495652_0025202 | |||
| 1634 | Ga0495652_0085803 | |||
| 1635 | Ga0495665_0006135 | |||
| 1636 | Ga0495640_0003805 | |||
| 1637 | Ga0495640_0006162 | |||
| 1638 | Ga0495640_0013689 | |||
| 1639 | Ga0495640_0038450 | |||
| 1640 | Ga0495640_0106950 | |||
| 1641 | Ga0495587_0021695 | |||
| 1642 | Ga0495609_0017503 | |||
| 1643 | Ga0495609_0046196 | |||
| 1644 | Ga0495621_0014359 | |||
| 1645 | Ga0495645_0139418 | |||
| 1646 | Ga0495622_0007389 | |||
| 1647 | Ga0495622_0010845 | |||
| 1648 | Ga0495622_0031021 | |||
| 1649 | Ga0495633_0032800 | |||
| 1650 | Ga0495633_0101237 | |||
| 1651 | Ga0495667_0014470 | |||
| 1652 | Ga0495667_0020782 | |||
| 1653 | Ga0495667_0042634 | |||
| 1654 | Ga0495667_0219966 | |||
| 1655 | Ga0495656_0014086 | |||
| 1656 | Ga0495656_0052064 | |||
| 1657 | Ga0495634_0021669 | |||
| 1658 | Ga0495634_0059329 | |||
| 1659 | Ga0495634_0202786 | |||
| 1660 | Ga0495625_0039007 | |||
| 1661 | Ga0495625_0080523 | |||
| 1662 | Ga0495635_0000420 | |||
| 1663 | Ga0495635_0001211 | |||
| 1664 | Ga0495635_0013526 | |||
| 1665 | Ga0495635_0060970 | |||
| 1666 | Ga0495635_0083102 | |||
| 1667 | Ga0495659_0006783 | |||
| 1668 | Ga0495659_0011010 | |||
| 1669 | Ga0495661_0068316 | |||
| 1670 | Ga0495661_0094910 | |||
| 1671 | Ga0495588_0001455 | |||
| 1672 | Ga0495657_0029176 | |||
| 1673 | Ga0495657_0031200 | |||
| 1674 | Ga0495657_0119361 | |||
| 1675 | Ga0495599_0017674 | |||
| 1676 | Ga0495599_0123454 | |||
| 1677 | Ga0495623_0006232 | |||
| 1678 | Ga0495623_0055297 | |||
| 1679 | Ga0495646_0073095 | |||
| 1680 | Ga0495647_0006007 | |||
| 1681 | Ga0495647_0015725 | |||
| 1682 | Ga0495669_0030227 | |||
| 1683 | Ga0495669_0049054 | |||
| 1684 | Ga0495613_0005598 | |||
| 1685 | Ga0495624_0050148 | |||
| 1686 | Ga0495670_0013904 | |||
| 1687 | Ga0495600_0006611 | |||
| 1688 | Ga0495600_0079639 | |||
| 1689 | Ga0495581_0052673 | |||
| 1690 | Ga0495581_0128293 | |||
| 1691 | Ga0495604_0006766 | |||
| 1692 | Ga0495604_0026715 | |||
| 1693 | Ga0495636_0138660 | |||
| 1694 | Ga0495674_0001076 | |||
| 1695 | Ga0495674_0062202 | |||
| 1696 | Ga0495674_0179687 | |||
| 1697 | Ga0495676_0004681 | |||
| 1698 | Ga0495676_0133887 | |||
| 1699 | Ga0495680_0008969 | |||
| 1700 | Ga0495675_0028405 | |||
| 1701 | Ga0495675_0034240 | |||
| 1702 | Ga0495675_0070015 | |||
| 1703 | Ga0495673_0068811 | |||
| 1704 | Ga0495684_0014378 | |||
| 1705 | Ga0495684_0055640 | |||
| 1706 | Ga0495684_0089670 | |||
| 1707 | Ga0495686_0067923 | |||
| 1708 | Ga0495686_0111193 | |||
| 1709 | Ga0495593_0000653 | |||
| 1710 | Ga0495593_0001276 | |||
| 1711 | Ga0495593_0014057 | |||
| 1712 | Ga0495593_0052654 | |||
| 1713 | Ga0495593_0104111 | |||
| 1714 | Ga0495602_0008796 | |||
| 1715 | Ga0495602_0093998 | |||
| 1716 | Ga0495602_0220122 | |||
| 1717 | Ga0495602_0310774 | |||
| 1718 | Ga0495614_0021334 | |||
| 1719 | Ga0495614_0111564 | |||
| 1720 | Ga0496100_0044040 | |||
| 1721 | Ga0496101_0001505 | |||
| 1722 | Ga0496101_0003279 | |||
| 1723 | Ga0496101_0051304 | |||
| 1724 | Ga0496101_0271915 | |||
| 1725 | Ga0496102_0002625 | |||
| 1726 | Ga0496102_0086424 | |||
| 1727 | Ga0496102_0113606 | |||
| 1728 | Ga0496102_0254473 | |||
| 1729 | Ga0496103_0048045 | |||
| 1730 | Ga0496104_0005208 | |||
| 1731 | Ga0496104_0006416 | |||
| 1732 | Ga0496104_0014207 | |||
| 1733 | Ga0496104_0076455 | |||
| 1734 | Ga0496104_0094615 | |||
| 1735 | Ga0496104_0136335 | |||
| 1736 | Ga0496104_0170803 | |||
| 1737 | Ga0496106_0008683 | |||
| 1738 | Ga0496106_0016980 | |||
| 1739 | Ga0496106_0050726 | |||
| 1740 | Ga0496107_0009500 | |||
| 1741 | Ga0496107_0018392 | |||
| 1742 | Ga0496107_0077056 | |||
| 1743 | Ga0496107_0111453 | |||
| 1744 | Ga0496108_0000764 | |||
| 1745 | Ga0496108_0028753 | |||
| 1746 | Ga0496108_0063507 | |||
| 1747 | Ga0496109_0003258 | |||
| 1748 | Ga0496109_0004144 | |||
| 1749 | Ga0496109_0015531 | |||
| 1750 | Ga0496109_0052370 | |||
| 1751 | Ga0496109_0111561 | |||
| 1752 | Ga0496110_0001592 | |||
| 1753 | Ga0496110_0050613 | |||
| 1754 | Ga0496111_0008321 | |||
| 1755 | Ga0496111_0011228 | |||
| 1756 | Ga0496111_0015152 | |||
| 1757 | Ga0496112_0013390 | |||
| 1758 | Ga0496112_0020166 | |||
| 1759 | Ga0496112_0032410 | |||
| 1760 | Ga0496113_0002790 | |||
| 1761 | Ga0496113_0008244 | |||
| 1762 | Ga0496113_0046126 | |||
| 1763 | Ga0496113_0066034 | |||
| 1764 | Ga0496114_0007929 | |||
| 1765 | Ga0496114_0011845 | |||
| 1766 | Ga0496114_0100837 | |||
| 1767 | Ga0496115_0010237 | |||
| 1768 | Ga0496115_0095421 | |||
| 1769 | Ga0496115_0132984 | |||
| 1770 | Ga0496117_0063045 | |||
| 1771 | Ga0496117_0124311 | |||
| 1772 | Ga0496118_0014751 | |||
| 1773 | Ga0496118_0092782 | |||
| 1774 | Ga0496119_0007992 | |||
| 1775 | Ga0496120_0013893 | |||
| 1776 | Ga0496121_0007199 | |||
| 1777 | Ga0496121_0020369 | |||
| 1778 | Ga0496121_0022522 | |||
| 1779 | Ga0496121_0032702 | |||
| 1780 | Ga0496121_0032851 | |||
| 1781 | Ga0496121_0035506 | |||
| 1782 | Ga0496121_0340114 | |||
| 1783 | Ga0496124_0054062 | |||
| 1784 | Ga0496124_0081544 | |||
| 1785 | Ga0496124_0110897 | |||
| 1786 | Ga0496124_0125451 | |||
| 1787 | Ga0496124_0147350 | |||
| 1788 | Ga0496125_0014324 | |||
| 1789 | Ga0496126_0005048 | |||
| 1790 | Ga0496126_0008555 | |||
| 1791 | Ga0496126_0010760 | |||
| 1792 | Ga0496126_0042062 | |||
| 1793 | Ga0496126_0065641 | |||
| 1794 | Ga0496126_0107798 | |||
| 1795 | Ga0496126_0156597 | |||
| 1796 | Ga0496126_0251891 | |||
| 1797 | Ga0496126_0347503 | |||
| 1798 | Ga0501046_0060470 | |||
| 1799 | Ga0501047_0010696 | |||
| 1800 | Ga0501070_0019681 | |||
| 1801 | Ga0501071_0203954 | |||
| 1802 | Ga0501073_0096623 | |||
| 1803 | Ga0501074_0097902 | |||
| 1804 | Ga0501080_0005746 | |||
| 1805 | Ga0501035_0239239 | |||
| 1806 | Ga0501044_0490751 | |||
| 1807 | nmdc:mga03n38_33846_c1 | |||
| 1808 | nmdc:mga00v17_16164_c1 | |||
| 1809 | nmdc:mga00v17_173280_c1 | |||
| 1810 | nmdc:mga00v17_40097_c1 | |||
| 1811 | nmdc:mga00v17_53285_c1 | |||
| 1812 | nmdc:mga0yw44_117206_c1 | |||
| 1813 | nmdc:mga0yw44_175254_c1 | |||
| 1814 | nmdc:mga0yw44_19078_c1 | |||
| 1815 | nmdc:mga0yw44_32783_c1 | |||
| 1816 | nmdc:mga0yw44_35935_c1 | |||
| 1817 | nmdc:mga0yw44_55619_c1 | |||
| 1818 | nmdc:mga0k408_38450_c1 | |||
| 1819 | nmdc:mga06z11_2658_c1 | |||
| 1820 | nmdc:mga06z11_4741_c1 | |||
| 1821 | nmdc:mga04h51_29938_c1 | |||
| 1822 | nmdc:mga07m45_116892_c1 | |||
| 1823 | nmdc:mga07m45_22323_c1 | |||
| 1824 | nmdc:mga0n895_177960_c1 | |||
| 1825 | nmdc:mga0n895_44071_c1 | |||
| 1826 | nmdc:mga0rr50_70465_c1 | |||
| 1827 | nmdc:mga0sz30_11563_c1 | |||
| 1828 | nmdc:mga0sz30_15647_c1 | |||
| 1829 | Ga0495601_0082252 | |||
| 1830 | Ga0495601_0174799 | |||
| 1831 | Ga0495612_0099967 | |||
| 1832 | Ga0500610_0066863 | |||
| 1833 | Ga0500635_0009119 | |||
| 1834 | Ga0500635_0039638 | |||
| 1835 | Ga0495595_0005159 | |||
| 1836 | Ga0495619_0107001 | |||
| 1837 | Ga0500578_0051961 | |||
| 1838 | Ga0500643_000016 | |||
| 1839 | Ga0500651_0155439 | |||
| 1840 | Ga0500566_0000359 | |||
| 1841 | Ga0500566_0001465 | |||
| 1842 | Ga0500566_0015284 | |||
| 1843 | Ga0500640_000223 | |||
| 1844 | Ga0500640_039226 | |||
| 1845 | Ga0500641_0007766 | |||
| 1846 | Ga0500554_005241 | |||
| 1847 | Ga0500557_000058 | |||
| 1848 | Ga0500572_002073 | |||
| 1849 | Ga0500595_004601 | |||
| 1850 | Ga0500595_065123 | |||
| 1851 | Ga0500608_017957 | |||
| 1852 | Ga0500614_001118 | |||
| 1853 | Ga0500614_007120 | |||
| 1854 | Ga0500642_0000109 | |||
| 1855 | Ga0500642_0042284 | |||
| 1856 | Ga0500559_0000691 | |||
| 1857 | Ga0500559_0002060 | |||
| 1858 | Ga0500568_0012527 | |||
| 1859 | Ga0500603_000310 | |||
| 1860 | Ga0500603_000334 | |||
| 1861 | Ga0500616_0020069 | |||
| 1862 | Ga0500620_007078 | |||
| 1863 | Ga0500622_0022779 | |||
| 1864 | Ga0500630_000749 | |||
| 1865 | Ga0500638_004286 | |||
| 1866 | Ga0500638_011067 | |||
| 1867 | Ga0500639_000274 | |||
| 1868 | Ga0500639_044133 | |||
| 1869 | Ga0500639_121143 | |||
| 1870 | Ga0500636_0000146 | |||
| 1871 | Ga0500637_0000764 | |||
| 1872 | Ga0500637_0001741 | |||
| 1873 | Ga0500637_0006310 | |||
| 1874 | Ga0500637_0073699 | |||
| 1875 | Ga0500625_025702 | |||
| 1876 | Ga0500645_004354 | |||
| 1877 | Ga0500645_044685 | |||
| 1878 | Ga0500596_000610 | |||
| 1879 | Ga0500596_003361 | |||
| 1880 | Ga0500601_000511 | |||
| 1881 | Ga0500661_020656 | |||
| 1882 | 2507511384 | |||
| 1883 | 2508545181 | |||
| 1884 | 2508694021 | |||
| 1885 | 2509146642 | |||
| 1886 | 2511398289 | |||
| 1887 | 2513624136 | |||
| 1888 | 2513641099 | |||
| 1889 | 2513648526 | |||
| 1890 | 2513656099 | |||
| 1891 | 2513673448 | |||
| 1892 | 2513696363 | |||
| 1893 | 2513702633 | |||
| 1894 | 2513717818 | |||
| 1895 | 2513862904 | |||
| 1896 | 2513874972 | |||
| 1897 | 2513887703 | |||
| 1898 | 2513920892 | |||
| 1899 | 2514010313 | |||
| 1900 | 2515625036 | |||
| 1901 | 2517101125 | |||
| 1902 | 2517895919 | |||
| 1903 | 2524439932 | |||
| 1904 | 2524464756 | |||
| 1905 | 2524534789 | |||
| 1906 | 2617348464 | |||
| 1907 | 2617375009 | |||
| 1908 | 2671122711 | |||
| 1909 | 2723842862 | |||
| 1910 | 2728752968 | |||
| 1911 | 2745075786 | |||
| 1912 | 2793061655 | |||
| 1913 | 2793069653 | |||
| 1914 | 2793080251 | |||
| 1915 | 2805916440 | |||
| 1916 | 2818240109 | |||
| 1917 | 2824608113 | |||
| 1918 | 2824615705 | |||
| 1919 | 2824625815 | |||
| 1920 | 2824634609 | |||
| 1921 | 2824642259 | |||
| 1922 | 2824652074 | |||
| 1923 | 2824660560 | |||
| 1924 | 2824665458 | |||
| 1925 | 2824679175 | |||
| 1926 | 2824686232 | |||
| 1927 | 2824695772 | |||
| 1928 | 2824702792 | |||
| 1929 | 2824709860 | |||
| 1930 | 2824719568 | |||
| 1931 | 2824732040 | |||
| 1932 | 2824738909 | |||
| 1933 | 2824752955 | |||
| 1934 | 2824759973 | |||
| 1935 | 2824769377 | |||
| 1936 | 2824779002 | |||
| 1937 | 2838128966 | |||
| 1938 | 2841946931 | |||
| 1939 | 2841957261 | |||
| 1940 | 2841961542 | |||
| 1941 | 2841970095 | |||
| 1942 | 2841977261 | |||
| 1943 | 2841985608 | |||
| 1944 | 2842042325 | |||
| 1945 | 2842050368 | |||
| 1946 | 2844316526 | |||
| 1947 | 2847939161 | |||
| 1948 | 2847943886 | |||
| 1949 | 2849081887 | |||
| 1950 | 2857513628 | |||
| 1951 | 2874594603 | |||
| 1952 | 2874606471 | |||
| 1953 | 2874615357 | |||
| 1954 | 2874620639 | |||
| 1955 | 2874633708 | |||
| 1956 | 2874649648 | |||
| 1957 | 2876766315 | |||
| 1958 | 2876773735 | |||
| 1959 | 2876809455 | |||
| 1960 | 2876820726 | |||
| 1961 | 2879076928 | |||
| 1962 | 2879090300 | |||
| 1963 | 2879100830 | |||
| 1964 | 2879113729 | |||
| 1965 | 2879130284 | |||
| 1966 | 2879146800 | |||
| 1967 | 2881367310 | |||
| 1968 | 2881668699 | |||
| 1969 | 2885373752 | |||
| 1970 | 2885382955 | |||
| 1971 | 2885386434 | |||
| 1972 | 2885412254 | |||
| 1973 | 2888386939 | |||
| 1974 | 2888389636 | |||
| 1975 | 2888421456 | |||
| 1976 | 2889033816 | |||
| 1977 | 2903732405 | |||
| 1978 | 2903755989 | |||
| 1979 | 2903773225 | |||
| 1980 | 2904666563 | |||
| 1981 | 2904699068 | |||
| 1982 | 2904707059 | |||
| 1983 | 2904719528 | |||
| 1984 | 2906606280 | |||
| 1985 | 2906615614 | |||
| 1986 | 2906626734 | |||
| 1987 | 2906638098 | |||
| 1988 | 2906647851 | |||
| 1989 | 2906665049 | |||
| 1990 | 2908745567 | |||
| 1991 | 2908763551 | |||
| 1992 | 2908777493 | |||
| 1993 | 2922367227 | |||
| 1994 | 2922377069 | |||
| 1995 | 2922390053 | |||
| 1996 | 2922398223 | |||
| 1997 | 2922432393 | |||
| 1998 | 2929619098 | |||
| 1999 | 2929628407 | |||
| 2000 | 2932791327 | |||
| 2001 | 2932795754 | |||
| 2002 | 2932801992 | |||
| 2003 | 2932817647 | |||
| 2004 | 2932826933 | |||
| 2005 | 2932833104 | |||
| 2006 | 2933581020 | |||
| 2007 | 2935612290 | |||
| 2008 | 2935623833 | |||
| 2009 | 2935630782 | |||
| 2010 | 2935639608 | |||
| 2011 | 2935650129 | |||
| 2012 | 2935658276 | |||
| 2013 | 2935667553 | |||
| 2014 | 2935682884 | |||
| 2015 | 2935687547 | |||
| 2016 | 2935696481 | |||
| 2017 | 2935705294 | |||
| 2018 | 2935719007 | |||
| 2019 | 2935728659 | |||
| 2020 | 2935736745 | |||
| 2021 | 2935746253 | |||
| 2022 | 2935753513 | |||
| 2023 | 2935767710 | |||
| 2024 | 2935770472 | |||
| 2025 | 2935782501 | |||
| 2026 | 2935786475 | |||
| 2027 | 2935794530 | |||
| 2028 | 2935807039 | |||
| 2029 | 2935814046 | |||
| 2030 | 2935823778 | |||
| 2031 | 2935829090 | |||
| 2032 | 2935845375 | |||
| 2033 | 2935854416 | |||
| 2034 | 2935861942 | |||
| 2035 | 2935872808 | |||
| 2036 | 2935880383 | |||
| 2037 | 2935886180 | |||
| 2038 | 2935913490 | |||
| 2039 | 2935923387 | |||
| 2040 | 2935931193 | |||
| 2041 | 2935935475 | |||
| 2042 | 2935947041 | |||
| 2043 | 2935953864 | |||
| 2044 | 2935961500 | |||
| 2045 | 2935968890 | |||
| 2046 | 2935982443 | |||
| 2047 | 2935985908 | |||
| 2048 | 2935994993 | |||
| 2049 | 2936006086 | |||
| 2050 | 2936013312 | |||
| 2051 | 2936021601 | |||
| 2052 | 2936030605 | |||
| 2053 | 2936039601 | |||
| 2054 | 2936047795 | |||
| 2055 | 2936057797 | |||
| 2056 | 2940559426 | |||
| 2057 | 2941507434 | |||
| 2058 | 2941515861 | |||
| 2059 | 2941523431 | |||
| 2060 | 2941536995 | |||
| 2061 | 2941545654 | |||
| 2062 | 3005476646 | |||
| 2063 | 3005487666 | |||
| 2064 | 3005511183 | |||
| 2065 | 3005592034 | |||
| 2066 | 3005596152 | |||
| 2067 | 3005712099 | |||
| 2068 | 3005719336 | |||
| 2069 | 8006929437 | |||
| 2070 | 8006934834 | |||
| 2071 | 8006966177 | |||
| 2072 | 8006974802 | |||
| 2073 | 8006989654 | |||
| 2074 | 8006998046 | |||
| 2075 | 8016516935 | |||
| 2076 | 8016524515 | |||
| 2077 | 8016538076 | |||
| 2078 | 8016542352 | |||
| 2079 | 8016550925 | |||
| 2080 | 8016559339 | |||
| 2081 | 8016567739 | |||
| 2082 | 8016580432 | |||
| 2083 | 8016588620 | |||
| 2084 | 8016597280 | |||
| 2085 | 8016604979 | |||
| 2086 | 8016620031 | |||
| 2087 | 8016624251 | |||
| 2088 | 8016637657 | |||
| 2089 | 8017059635 | |||
| 2090 | 8019537743 | |||
| 2091 | 8019539374 | |||
| 2092 | 8019551271 | |||
| 2093 | 8019563822 | |||
| 2094 | 8019573890 | |||
| 2095 | 8019579109 | |||
| 2096 | 8019597163 | |||
| 2097 | 8019604527 | |||
| 2098 | 8019614004 | |||
| 2099 | 8019624550 | |||
| 2100 | 8019637492 | |||
| 2101 | 8019642118 | |||
| 2102 | 8019650403 | |||
| 2103 | 8019665424 | |||
| 2104 | 8019674970 | |||
| 2105 | 8019681126 | |||
| 2106 | 8019694574 | |||
| 2107 | 8055749644 | |||
| 2108 | 8056675078 | |||
| 2109 | 8056684662 | |||
| 2110 | 8056973862 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5i20-assembly5.cif.gz_E | crystal structure of protein | 0.8094 | 18 | 305 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.7993 | 25 | 304 |
| 5i20-assembly4.cif.gz_D | crystal structure of protein | 0.7959 | 18 | 305 |
| 5i20-assembly1.cif.gz_A | crystal structure of protein | 0.7956 | 25 | 305 |
| 5i20-assembly2.cif.gz_B | crystal structure of protein | 0.7889 | 25 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0GBE4_5_124_1.10.3730.20 | Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; | 0.6994 | 213 | 304 | 1.10.3730.20 |
| af_A0A0P0WMA8_96_409_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6864 | 27 | 305 | 1.20.1740.10 |
| af_Q8RY83_36_351_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6646 | 26 | 305 | 1.20.1740.10 |
| af_A0A0P0YAS8_28_439_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6632 | 19 | 305 | 1.20.1740.10 |
| af_Q20583_6_327_1.20.1740.10 | Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I | 0.6546 | 22 | 305 | 1.20.1740.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537QQX6-F1-model_v4 | DMT family transporter | 0.9961 | 15 | 310 |
GO:0005886
|
| AF-A0A418UX48-F1-model_v4 | DMT family transporter | 0.9881 | 15 | 307 |
GO:0005886
|
| AF-H0TKZ1-F1-model_v4 | Putative transport protein permease of the drug/metabolite transporter (DMT) superfamily | 0.9839 | 26 | 310 |
GO:0005886
|
| AF-A0A5J4DUI9-F1-model_v4 | S-adenosylmethionine/S-adenosylhomocysteine transporter | 0.9836 | 15 | 310 |
GO:0016020
|
| AF-Q131W8-F1-model_v4 | EamA domain-containing protein | 0.9804 | 15 | 307 |
GO:0005886
|