F489154

General Info

Members Datasets Scaffolds Average Seq Length
1055 625 2110 310

Family's Representative Sequence

Representative Sequence 3300026116|Ga0207674_10050854|Ga0207674_100508542
Length 363
Sequence MEAGNPATPLHGRDACRPIEVRQESVSVERPGTPARDHHPGRAAAHGNLLQPMSASDQTSHAAPTRSSHWIANQPYVLLCITALCWAGNAIVGRLAAGHIPPVTLSFLRWGTAFLLILPFAWKHLVRDWPAIRGKLGIMILVSITGIGIFNTLQYWSLEYTTALNTLLLQSAGPLIVAVWSLLLLRVRLTLAQAIGVLVSLSGVLVIVMHGDLTALSNISFNRGDLIFLVALTIFGLYSVLTLKRPAIHGLSFAAFTFGTSTVFLIPLFVRELLTRPAMAFNAQNLLSLLYVAIFPSIVAYLCFNRGVQLIGANRAAPFFHVVPVFGSVMAIVFLGEEPHLFHLIGFGLVLTGVYVASRKPAK

Samples

Sample ID Description Type Environment
1 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
110 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
111 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
112 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
118 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
120 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
176 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
177 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
178 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
179 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
185 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
186 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
187 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
188 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
205 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
206 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
207 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
208 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
209 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
210 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
226 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
227 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
228 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
229 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
235 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
238 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
239 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
240 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
241 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
249 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
250 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
253 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
258 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
259 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
260 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
261 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
262 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
263 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
264 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
265 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
268 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
269 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
270 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
271 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
272 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
273 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
274 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
275 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
276 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
277 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
278 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
279 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
280 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
281 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
293 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
294 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
295 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
296 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
297 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
298 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
299 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
300 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
301 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
302 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
305 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
306 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
307 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
308 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
309 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
310 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
311 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
312 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
313 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
314 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
315 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
320 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
321 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
322 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
323 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
336 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
337 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
338 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
353 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
354 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
355 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
356 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
357 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
360 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
361 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
362 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
363 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
364 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
365 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
366 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
367 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
368 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
369 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
370 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
371 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
372 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
375 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
376 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
377 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
378 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
379 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
380 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
381 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
382 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
383 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
384 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
385 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
388 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
389 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
390 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
391 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
392 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
393 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
394 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
395 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
396 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
397 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
398 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
399 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
400 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
401 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
402 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
403 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
404 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
405 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
406 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
407 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
408 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
409 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
410 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
411 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
412 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
413 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
414 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
415 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
416 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
417 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
418 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
419 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
420 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
421 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
422 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
423 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
424 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
425 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
426 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
427 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
428 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
429 2791355199
430 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
431 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
432 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
433 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
434 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
435 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
436 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
437 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
438 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
439 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
440 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
441 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
442 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
443 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
444 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
445 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
446 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
447 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
448 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
449 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
450 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
451 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
452 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
453 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
454 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
455 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
456 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
457 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
458 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
459 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
460 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
461 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
462 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
463 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
464 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
465 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
466 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
467 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
468 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
469 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
470 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
471 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
472 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
473 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
474 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
475 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
476 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
477 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
478 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
479 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
480 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
481 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
482 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
483 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
484 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
485 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
486 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
487 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
488 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
489 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
490 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
491 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
492 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
493 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
494 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
495 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
496 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
497 2904699407
498 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
499 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
500 2906610324
501 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
502 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
503 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
504 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
505 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
506 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
507 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
508 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
509 2922368715
510 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
511 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
512 2922425934
513 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
514 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
515 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
516 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
517 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
518 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
519 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
520 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
521 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
522 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
523 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
524 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
525 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
526 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
527 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
528 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
529 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
530 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
531 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
532 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
533 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
534 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
535 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
536 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
537 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
538 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
539 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
540 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
541 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
542 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
543 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
544 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
545 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
546 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
547 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
548 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
549 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
550 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
551 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
552 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
553 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
554 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
555 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
556 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
557 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
558 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
559 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
560 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
561 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
562 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
563 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
564 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
565 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
566 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
567 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
568 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
569 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
570 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
571 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
572 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
573 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
574 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
575 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
576 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
577 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
578 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
579 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
580 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
581 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
582 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
583 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
584 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
585 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
586 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
587 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
588 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
589 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
590 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
591 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
592 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
593 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
594 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
595 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
596 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
597 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
598 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
599 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
600 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
601 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
602 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
603 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
604 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
605 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
606 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
607 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
608 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
609 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
610 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
611 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
612 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
613 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
614 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
615 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
616 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
617 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
618 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
619 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
620 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
621 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
622 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
623 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
624 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
625 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 78.67
Metatranscriptomes 0
Isolates 21.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.18
Nodule 17.25
Rhizoplane 5.12
Rhizosphere 56.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207674_10050854 3300026116 Bacteria 4232
2 JGI25165J46597_1006170 3300003214 Bacteria 2160
3 rootH1_10087822 3300003323 Bacteria 3633
4 JGI25160J50197_1009314 3300003354 Bacteria 3656
5 JGI25160J50197_1010686 3300003354 Bacteria 3302
6 JGI25160J50197_1022482 3300003354 Bacteria 1847
7 JGI25404J52841_10001294 3300003659 Bacteria 4338
8 JGI25404J52841_10002561 3300003659 Bacteria 3457
9 JGI25404J52841_10011860 3300003659 Bacteria 1883
10 JGI25404J52841_10019493 3300003659 Bacteria 1470
11 Ga0055531_10014879 3300003794 Bacteria 3474
12 Ga0055543_1001485 3300004625 Bacteria 9236
13 Ga0065165_1001376 3300005262 Bacteria 26733
14 Ga0065165_1005421 3300005262 Bacteria 7182
15 Ga0070658_10087865 3300005327 Bacteria 2559
16 Ga0070658_10207249 3300005327 Bacteria 1655
17 Ga0070683_100227303 3300005329 Bacteria 1774
18 Ga0070683_100253308 3300005329 Bacteria 1674
19 Ga0070670_100070676 3300005331 Bacteria 2997
20 Ga0068869_100021269 3300005334 Bacteria 4461
21 Ga0070680_100040184 3300005336 Bacteria 3786
22 Ga0070680_100340756 3300005336 Bacteria 1274
23 Ga0070682_100038542 3300005337 Bacteria 2931
24 Ga0068868_100016760 3300005338 Bacteria 5448
25 Ga0068868_100022538 3300005338 Bacteria 4755
26 Ga0068868_100221960 3300005338 Bacteria 1582
27 Ga0070660_100182043 3300005339 Bacteria 1700
28 Ga0070691_10060494 3300005341 Bacteria 1821
29 Ga0070687_100262398 3300005343 Bacteria 1079
30 Ga0070661_100207321 3300005344 Bacteria 1499
31 Ga0070661_100228438 3300005344 Bacteria 1430
32 Ga0070668_100036126 3300005347 Bacteria 3770
33 Ga0070668_100085347 3300005347 Bacteria 2481
34 Ga0070668_100141123 3300005347 Bacteria 1941
35 Ga0070669_100075838 3300005353 Bacteria 2495
36 Ga0070671_100004615 3300005355 Bacteria 10924
37 Ga0070673_100039182 3300005364 Bacteria 3625
38 Ga0070659_100128239 3300005366 Bacteria 2059
39 Ga0070709_10009471 3300005434 Bacteria 5376
40 Ga0070709_10009924 3300005434 Bacteria 5263
41 Ga0070714_100090281 3300005435 Bacteria 2683
42 Ga0070714_100100486 3300005435 Bacteria 2548
43 Ga0070714_100223751 3300005435 Bacteria 1731
44 Ga0070714_100483641 3300005435 Bacteria 1179
45 Ga0070713_100003995 3300005436 Bacteria 9817
46 Ga0070713_100060683 3300005436 Bacteria 3162
47 Ga0070713_100111409 3300005436 Bacteria 2387
48 Ga0070710_10000354 3300005437 Bacteria 21680
49 Ga0070711_100079786 3300005439 Bacteria 2328
50 Ga0070711_100153125 3300005439 Bacteria 1741
51 Ga0070708_100032198 3300005445 Bacteria 4545
52 Ga0070663_100034425 3300005455 Bacteria 3508
53 Ga0070663_100062682 3300005455 Bacteria 2681
54 Ga0070681_10043868 3300005458 Bacteria 4476
55 Ga0070681_10147849 3300005458 Bacteria 2277
56 Ga0070681_10152124 3300005458 Bacteria 2240
57 Ga0070681_10156834 3300005458 Bacteria 2201
58 Ga0070698_100103607 3300005471 Bacteria 2815
59 Ga0070679_100008173 3300005530 Bacteria 9833
60 Ga0070679_100043766 3300005530 Bacteria 4458
61 Ga0070679_100116448 3300005530 Bacteria 2657
62 Ga0070679_100144623 3300005530 Bacteria 2356
63 Ga0070679_100313829 3300005530 Bacteria 1517
64 Ga0070679_100496038 3300005530 Bacteria 1165
65 Ga0070684_100007383 3300005535 Bacteria 8546
66 Ga0070684_100041482 3300005535 Bacteria 3968
67 Ga0070684_100044811 3300005535 Bacteria 3827
68 Ga0070697_100040016 3300005536 Bacteria 3791
69 Ga0068853_100009856 3300005539 Bacteria 7710
70 Ga0068853_100029321 3300005539 Bacteria 4637
71 Ga0068853_100079038 3300005539 Bacteria 2876
72 Ga0068853_100162707 3300005539 Bacteria 2015
73 Ga0068853_100224536 3300005539 Bacteria 1716
74 Ga0068853_100265006 3300005539 Bacteria 1581
75 Ga0070672_100044913 3300005543 Bacteria 3414
76 Ga0070672_100111369 3300005543 Bacteria 2231
77 Ga0070665_100015994 3300005548 Bacteria 7531
78 Ga0070665_100044686 3300005548 Bacteria 4449
79 Ga0070665_100124841 3300005548 Bacteria 2576
80 Ga0068855_100053745 3300005563 Bacteria 4737
81 Ga0068855_100183563 3300005563 Bacteria 2364
82 Ga0068855_100390481 3300005563 Bacteria 1527
83 Ga0070664_100014972 3300005564 Bacteria 6330
84 Ga0070664_100257083 3300005564 Bacteria 1571
85 Ga0068857_100031797 3300005577 Bacteria 4663
86 Ga0068854_100136291 3300005578 Bacteria 1879
87 Ga0068856_100002849 3300005614 Bacteria 17692
88 Ga0068856_100279553 3300005614 Bacteria 1686
89 Ga0070702_100032076 3300005615 Bacteria 2881
90 Ga0068852_100022694 3300005616 Bacteria 5038
91 Ga0068852_100220177 3300005616 Bacteria 1805
92 Ga0068852_100331439 3300005616 Bacteria 1481
93 Ga0068859_100301163 3300005617 Bacteria 1696
94 Ga0068864_100017485 3300005618 Bacteria 5979
95 Ga0068861_100010994 3300005719 Bacteria 6289
96 Ga0068861_100048183 3300005719 Bacteria 3220
97 Ga0068851_10018196 3300005834 Bacteria 3384
98 Ga0068851_10033883 3300005834 Bacteria 2547
99 Ga0068870_10078771 3300005840 Bacteria 1816
100 Ga0068863_100029494 3300005841 Bacteria 5236
101 Ga0068863_100224386 3300005841 Bacteria 1811
102 Ga0068858_100060910 3300005842 Bacteria 3489
103 Ga0068858_100093556 3300005842 Bacteria 2798
104 Ga0068858_100201196 3300005842 Bacteria 1884
105 Ga0068860_100101612 3300005843 Bacteria 2743
106 Ga0068860_100127112 3300005843 Bacteria 2443
107 Ga0068860_100366897 3300005843 Bacteria 1419
108 Ga0068862_100047874 3300005844 Bacteria 3649
109 Ga0068862_100052726 3300005844 Bacteria 3481
110 Ga0068862_100073668 3300005844 Bacteria 2951
111 Ga0068862_100112368 3300005844 Bacteria 2392
112 Ga0068862_100226201 3300005844 Bacteria 1695
113 Ga0081455_10002391 3300005937 Bacteria 22405
114 Ga0081455_10008216 3300005937 Bacteria 10883
115 Ga0081455_10025742 3300005937 Bacteria 5426
116 Ga0081455_10082273 3300005937 Bacteria 2634
117 Ga0081455_10083718 3300005937 Bacteria 2606
118 Ga0081540_1000876 3300005983 Bacteria 27180
119 Ga0081540_1001057 3300005983 Bacteria 24537
120 Ga0081540_1001355 3300005983 Bacteria 21285
121 Ga0081540_1006825 3300005983 Bacteria 8245
122 Ga0081540_1008183 3300005983 Bacteria 7326
123 Ga0081540_1013124 3300005983 Bacteria 5409
124 Ga0081540_1013668 3300005983 Bacteria 5263
125 Ga0081540_1026846 3300005983 Bacteria 3277
126 Ga0081540_1034143 3300005983 Bacteria 2749
127 Ga0081540_1044842 3300005983 Bacteria 2253
128 Ga0081540_1060292 3300005983 Bacteria 1816
129 Ga0081539_10000958 3300005985 Bacteria 54105
130 Ga0081539_10037151 3300005985 Bacteria 2904
131 Ga0070717_10000879 3300006028 Bacteria 19872
132 Ga0070717_10004010 3300006028 Bacteria 10602
133 Ga0070717_10159239 3300006028 Bacteria 1958
134 Ga0070717_10227624 3300006028 Bacteria 1641
135 Ga0075365_10006174 3300006038 Bacteria 6563
136 Ga0075365_10076606 3300006038 Bacteria 2258
137 Ga0075365_10079609 3300006038 Bacteria 2217
138 Ga0075368_10008768 3300006042 Bacteria 3619
139 Ga0075368_10057356 3300006042 Bacteria 1555
140 Ga0075363_100002408 3300006048 Bacteria 7631
141 Ga0075363_100035826 3300006048 Bacteria 2599
142 Ga0075363_100056365 3300006048 Bacteria 2107
143 Ga0075364_10021061 3300006051 Bacteria 4107
144 Ga0075364_10051999 3300006051 Bacteria 2676
145 Ga0075364_10062058 3300006051 Bacteria 2452
146 Ga0075432_10086113 3300006058 Bacteria 1145
147 Ga0070712_100053314 3300006175 Bacteria 2824
148 Ga0075367_10019327 3300006178 Bacteria 3777
149 Ga0075367_10060627 3300006178 Bacteria 2256
150 Ga0075367_10081126 3300006178 Bacteria 1963
151 Ga0075367_10120902 3300006178 Bacteria 1614
152 Ga0075369_10022623 3300006186 Bacteria 2594
153 Ga0075369_10028690 3300006186 Bacteria 2334
154 Ga0075366_10011991 3300006195 Bacteria 4909
155 Ga0075366_10025819 3300006195 Bacteria 3435
156 Ga0075366_10111921 3300006195 Bacteria 1642
157 Ga0075366_10128390 3300006195 Bacteria 1529
158 Ga0075366_10202879 3300006195 Bacteria 1206
159 Ga0097621_100211157 3300006237 Bacteria 1689
160 Ga0075370_10082553 3300006353 Bacteria 1848
161 Ga0068871_100033296 3300006358 Bacteria 4080
162 Ga0068871_100064105 3300006358 Bacteria 3007
163 Ga0068871_100117942 3300006358 Bacteria 2239
164 Ga0075428_100057249 3300006844 Bacteria 4267
165 Ga0075434_100104926 3300006871 Bacteria 2836
166 Ga0068865_100235411 3300006881 Bacteria 1439
167 Ga0075436_100124040 3300006914 Bacteria 1809
168 Ga0097620_100301155 3300006931 Bacteria 1696
169 Ga0099823_1008012 3300006944 Bacteria 10753
170 Ga0075435_100061613 3300007076 Bacteria 3044
171 Ga0099795_10032255 3300007788 Bacteria 1810
172 Ga0105244_10077045 3300009036 Bacteria 1655
173 Ga0105250_10041582 3300009092 Bacteria 1843
174 Ga0105240_10002375 3300009093 Bacteria 30348
175 Ga0105240_10012518 3300009093 Bacteria 11703
176 Ga0105240_10021194 3300009093 Bacteria 8650
177 Ga0105240_10113195 3300009093 Bacteria 3279
178 Ga0105240_10182585 3300009093 Bacteria 2474
179 Ga0105240_10394089 3300009093 Bacteria 1561
180 Ga0111539_10479835 3300009094 Bacteria 1448
181 Ga0105245_10022776 3300009098 Bacteria 5497
182 Ga0105245_10229823 3300009098 Bacteria 1794
183 Ga0105245_10277838 3300009098 Bacteria 1636
184 Ga0105245_10520430 3300009098 Bacteria 1208
185 Ga0105245_10718977 3300009098 Bacteria 1033
186 Ga0105247_10027347 3300009101 Bacteria 3450
187 Ga0105247_10073898 3300009101 Bacteria 2137
188 Ga0105247_10083393 3300009101 Bacteria 2019
189 Ga0114129_10082526 3300009147 Bacteria 4466
190 Ga0114129_10310362 3300009147 Bacteria 2100
191 Ga0105243_10088147 3300009148 Bacteria 2549
192 Ga0105241_10070681 3300009174 Bacteria 2709
193 Ga0105241_10087873 3300009174 Bacteria 2447
194 Ga0105241_10116546 3300009174 Bacteria 2145
195 Ga0105241_10134747 3300009174 Bacteria 2004
196 Ga0105242_10203890 3300009176 Bacteria 1758
197 Ga0105248_10018230 3300009177 Bacteria 7752
198 Ga0105248_10026667 3300009177 Bacteria 6425
199 Ga0105248_10043229 3300009177 Bacteria 5052
200 Ga0105248_10180112 3300009177 Bacteria 2381
201 Ga0105248_10196203 3300009177 Bacteria 2274
202 Ga0105248_10410721 3300009177 Bacteria 1524
203 Ga0105237_10005704 3300009545 Bacteria 13994
204 Ga0105237_10015508 3300009545 Bacteria 7928
205 Ga0105237_10018101 3300009545 Bacteria 7296
206 Ga0105237_10023103 3300009545 Bacteria 6376
207 Ga0105237_10082020 3300009545 Bacteria 3216
208 Ga0105237_10108656 3300009545 Bacteria 2765
209 Ga0105237_10118480 3300009545 Bacteria 2641
210 Ga0105238_10044702 3300009551 Bacteria 4477
211 Ga0105238_10068523 3300009551 Bacteria 3549
212 Ga0105238_10121083 3300009551 Bacteria 2596
213 Ga0105249_10072669 3300009553 Bacteria 3180
214 Ga0105249_10180362 3300009553 Bacteria 2054
215 Ga0105249_10686885 3300009553 Bacteria 1083
216 Ga0105249_10723966 3300009553 Bacteria 1056
217 Ga0099796_10001408 3300010159 Bacteria 4821
218 Ga0099796_10062361 3300010159 Bacteria 1325
219 Ga0105239_10011442 3300010375 Bacteria 9896
220 Ga0105239_10046389 3300010375 Bacteria 4762
221 Ga0105239_10050756 3300010375 Bacteria 4548
222 Ga0105239_10093670 3300010375 Bacteria 3317
223 Ga0105239_10127494 3300010375 Bacteria 2829
224 Ga0105239_10181637 3300010375 Bacteria 2354
225 Ga0105239_10212611 3300010375 Bacteria 2168
226 Ga0105246_10207022 3300011119 Bacteria 1529
227 Ga0157370_10040683 3300013104 Bacteria 4487
228 Ga0157370_10073270 3300013104 Bacteria 3231
229 Ga0157370_10145697 3300013104 Bacteria 2205
230 Ga0157369_10013879 3300013105 Bacteria 9100
231 Ga0157369_10032628 3300013105 Bacteria 5725
232 Ga0157369_10053166 3300013105 Bacteria 4378
233 Ga0157374_10043558 3300013296 Bacteria 4147
234 Ga0157378_10056131 3300013297 Bacteria 3508
235 Ga0163162_10060537 3300013306 Bacteria 3822
236 Ga0163162_10126411 3300013306 Bacteria 2663
237 Ga0163162_10253647 3300013306 Bacteria 1891
238 Ga0157372_10203594 3300013307 Bacteria 2293
239 Ga0157372_10270010 3300013307 Bacteria 1976
240 Ga0157375_10203812 3300013308 Bacteria 2134
241 Ga0163163_10009057 3300014325 Bacteria 8871
242 Ga0157380_10061401 3300014326 Bacteria 3007
243 Ga0157377_10283262 3300014745 Bacteria 1087
244 Ga0157379_10044212 3300014968 Bacteria 3975
245 Ga0157379_10057511 3300014968 Bacteria 3475
246 Ga0157379_10215715 3300014968 Bacteria 1738
247 Ga0157376_10017125 3300014969 Bacteria 5520
248 Ga0157376_10099309 3300014969 Bacteria 2539
249 Ga0214544_1000005 3300021320 Bacteria 387675
250 Ga0214542_1000004 3300021321 Bacteria 415597
251 Ga0214545_1000005 3300021324 Bacteria 415590
252 Ga0214545_1031225 3300021324 Bacteria 2180
253 Ga0214543_1000564 3300021327 Bacteria 63531
254 Ga0213876_10008568 3300021384 Bacteria 5535
255 Ga0213871_10007091 3300021441 Bacteria 2406
256 Ga0209677_100391 3300025253 Bacteria 26540
257 Ga0209677_104865 3300025253 Bacteria 3697
258 Ga0209148_1000900 3300025254 Bacteria 20229
259 Ga0209148_1007943 3300025254 Bacteria 2164
260 Ga0209233_1001098 3300025261 Bacteria 11109
261 Ga0209233_1007522 3300025261 Bacteria 3447
262 Ga0209455_1001425 3300025272 Bacteria 10837
263 Ga0209455_1003294 3300025272 Bacteria 5799
264 Ga0209455_1018859 3300025272 Bacteria 1406
265 Ga0209758_1000102 3300025297 Bacteria 224851
266 Ga0209758_1000732 3300025297 Bacteria 48005
267 Ga0209758_1003159 3300025297 Bacteria 15477
268 Ga0209758_1004735 3300025297 Bacteria 11071
269 Ga0209758_1017230 3300025297 Bacteria 3612
270 Ga0209758_1068105 3300025297 Bacteria 1135
271 Ga0207426_1000354 3300025302 Bacteria 83734
272 Ga0207426_1000521 3300025302 Bacteria 55976
273 Ga0207426_1005878 3300025302 Bacteria 5464
274 Ga0209257_1001340 3300025304 Bacteria 29845
275 Ga0207697_10067290 3300025315 Bacteria 1498
276 Ga0207656_10019673 3300025321 Bacteria 2673
277 Ga0207656_10044922 3300025321 Bacteria 1888
278 Ga0207692_10000064 3300025898 Bacteria 31069
279 Ga0207692_10231610 3300025898 Bacteria 1099
280 Ga0207642_10135723 3300025899 Bacteria 1290
281 Ga0207710_10092290 3300025900 Bacteria 1419
282 Ga0207688_10052008 3300025901 Bacteria 2295
283 Ga0207647_10001590 3300025904 Bacteria 17424
284 Ga0207647_10060689 3300025904 Bacteria 2311
285 Ga0207647_10102104 3300025904 Bacteria 1701
286 Ga0207699_10010189 3300025906 Bacteria 4705
287 Ga0207699_10012565 3300025906 Bacteria 4309
288 Ga0207699_10037112 3300025906 Bacteria 2783
289 Ga0207643_10113049 3300025908 Bacteria 1601
290 Ga0207705_10184488 3300025909 Bacteria 1576
291 Ga0207684_10099753 3300025910 Bacteria 2481
292 Ga0207654_10034161 3300025911 Bacteria 2824
293 Ga0207654_10036401 3300025911 Bacteria 2749
294 Ga0207654_10048473 3300025911 Bacteria 2431
295 Ga0207707_10000827 3300025912 Bacteria 30384
296 Ga0207707_10001679 3300025912 Bacteria 20395
297 Ga0207707_10053392 3300025912 Bacteria 3518
298 Ga0207707_10059228 3300025912 Bacteria 3332
299 Ga0207707_10109761 3300025912 Bacteria 2411
300 Ga0207707_10247492 3300025912 Bacteria 1549
301 Ga0207695_10000006 3300025913 Bacteria 1135309
302 Ga0207695_10063403 3300025913 Bacteria 3811
303 Ga0207695_10123854 3300025913 Bacteria 2550
304 Ga0207671_10003551 3300025914 Bacteria 15456
305 Ga0207671_10034572 3300025914 Bacteria 3754
306 Ga0207671_10073678 3300025914 Bacteria 2551
307 Ga0207671_10116409 3300025914 Bacteria 2039
308 Ga0207671_10168137 3300025914 Bacteria 1701
309 Ga0207671_10189095 3300025914 Bacteria 1605
310 Ga0207671_10313147 3300025914 Bacteria 1241
311 Ga0207693_10012104 3300025915 Bacteria 6975
312 Ga0207693_10036737 3300025915 Bacteria 3862
313 Ga0207693_10060877 3300025915 Bacteria 2957
314 Ga0207693_10213002 3300025915 Bacteria 1519
315 Ga0207660_10021880 3300025917 Bacteria 4303
316 Ga0207660_10081175 3300025917 Bacteria 2383
317 Ga0207660_10299321 3300025917 Bacteria 1280
318 Ga0207657_10001315 3300025919 Bacteria 26383
319 Ga0207657_10088631 3300025919 Bacteria 2586
320 Ga0207657_10152790 3300025919 Bacteria 1879
321 Ga0207649_10076160 3300025920 Bacteria 2158
322 Ga0207649_10104401 3300025920 Bacteria 1882
323 Ga0207652_10001089 3300025921 Bacteria 24596
324 Ga0207652_10022161 3300025921 Bacteria 5251
325 Ga0207652_10044205 3300025921 Bacteria 3794
326 Ga0207652_10145609 3300025921 Bacteria 2120
327 Ga0207652_10299022 3300025921 Bacteria 1453
328 Ga0207646_10017460 3300025922 Bacteria 6713
329 Ga0207694_10195557 3300025924 Bacteria 1644
330 Ga0207659_10355514 3300025926 Bacteria 1216
331 Ga0207687_10065085 3300025927 Bacteria 2588
332 Ga0207700_10001903 3300025928 Bacteria 11863
333 Ga0207700_10086868 3300025928 Bacteria 2458
334 Ga0207664_10047855 3300025929 Bacteria 3361
335 Ga0207664_10245383 3300025929 Bacteria 1561
336 Ga0207664_10470080 3300025929 Bacteria 1124
337 Ga0207644_10248745 3300025931 Bacteria 1418
338 Ga0207706_10428022 3300025933 Bacteria 1146
339 Ga0207709_10010026 3300025935 Bacteria 5220
340 Ga0207670_10301873 3300025936 Bacteria 1254
341 Ga0207669_10002843 3300025937 Bacteria 7421
342 Ga0207704_10319368 3300025938 Bacteria 1197
343 Ga0207665_10008591 3300025939 Bacteria 6722
344 Ga0207665_10055029 3300025939 Bacteria 2684
345 Ga0207665_10095014 3300025939 Bacteria 2071
346 Ga0207691_10114965 3300025940 Bacteria 2390
347 Ga0207691_10119416 3300025940 Bacteria 2338
348 Ga0207691_10179879 3300025940 Bacteria 1848
349 Ga0207691_10225268 3300025940 Bacteria 1625
350 Ga0207711_10041679 3300025941 Bacteria 3910
351 Ga0207711_10430746 3300025941 Bacteria 1227
352 Ga0207689_10033789 3300025942 Bacteria 4248
353 Ga0207689_10053585 3300025942 Bacteria 3323
354 Ga0207689_10272365 3300025942 Bacteria 1402
355 Ga0207661_10003154 3300025944 Bacteria 11437
356 Ga0207661_10095826 3300025944 Bacteria 2482
357 Ga0207661_10178100 3300025944 Bacteria 1855
358 Ga0207679_10174460 3300025945 Bacteria 1773
359 Ga0207667_10023055 3300025949 Bacteria 6860
360 Ga0207712_10037787 3300025961 Bacteria 3296
361 Ga0207712_10253518 3300025961 Bacteria 1424
362 Ga0207712_10482123 3300025961 Bacteria 1057
363 Ga0207668_10069976 3300025972 Bacteria 2500
364 Ga0207668_10227217 3300025972 Bacteria 1502
365 Ga0207640_10011386 3300025981 Bacteria 5035
366 Ga0207640_10189279 3300025981 Bacteria 1550
367 Ga0207677_10029411 3300026023 Bacteria 3491
368 Ga0207703_10060227 3300026035 Bacteria 3104
369 Ga0207703_10126175 3300026035 Bacteria 2204
370 Ga0207703_10285034 3300026035 Bacteria 1501
371 Ga0207639_10009882 3300026041 Bacteria 6591
372 Ga0207639_10022260 3300026041 Bacteria 4564
373 Ga0207639_10110862 3300026041 Bacteria 2236
374 Ga0207639_10149151 3300026041 Bacteria 1957
375 Ga0207639_10215143 3300026041 Bacteria 1657
376 Ga0207678_10003718 3300026067 Bacteria 13719
377 Ga0207678_10038266 3300026067 Bacteria 4168
378 Ga0207678_10059272 3300026067 Bacteria 3294
379 Ga0207678_10097524 3300026067 Bacteria 2512
380 Ga0207708_10080240 3300026075 Bacteria 2507
381 Ga0207702_10000325 3300026078 Bacteria 54690
382 Ga0207702_10058600 3300026078 Bacteria 3277
383 Ga0207641_10037207 3300026088 Bacteria 4064
384 Ga0207641_10306106 3300026088 Bacteria 1503
385 Ga0207641_10509501 3300026088 Bacteria 1169
386 Ga0207648_10028909 3300026089 Bacteria 4914
387 Ga0207648_10081895 3300026089 Bacteria 2814
388 Ga0207674_10039712 3300026116 Bacteria 4878
389 Ga0207675_100082737 3300026118 Bacteria 3011
390 Ga0207683_10046036 3300026121 Bacteria 3816
391 Ga0207698_10245913 3300026142 Bacteria 1633
392 Ga0207698_10327503 3300026142 Bacteria 1437
393 Ga0209389_1000021 3300027296 Bacteria 169506
394 Ga0209389_1000086 3300027296 Bacteria 84925
395 Ga0209589_1000005 3300027357 Bacteria 530958
396 Ga0209589_1000027 3300027357 Bacteria 155295
397 Ga0209489_100005 3300027361 Bacteria 530958
398 Ga0209489_100313 3300027361 Bacteria 85507
399 Ga0209489_105143 3300027361 Bacteria 23183
400 Ga0209700_100006 3300027363 Bacteria 530958
401 Ga0209700_100483 3300027363 Bacteria 74857
402 Ga0209588_1011445 3300027671 Bacteria 2681
403 Ga0209813_10082380 3300027866 Bacteria 1066
404 Ga0268266_10001864 3300028379 Bacteria 23828
405 Ga0268266_10003347 3300028379 Bacteria 16051
406 Ga0268266_10014684 3300028379 Bacteria 6728
407 Ga0268266_10046928 3300028379 Bacteria 3698
408 Ga0268266_10113604 3300028379 Bacteria 2402
409 Ga0268265_10008324 3300028380 Bacteria 7003
410 Ga0268265_10050516 3300028380 Bacteria 3134
411 Ga0268265_10192782 3300028380 Bacteria 1761
412 Ga0268264_10000174 3300028381 Bacteria 137254
413 Ga0268264_10109509 3300028381 Bacteria 2417
414 Ga0268264_10296137 3300028381 Bacteria 1521
415 Ga0265319_1009526 3300028563 Bacteria 4130
416 Ga0265334_10077862 3300028573 Bacteria 1226
417 Ga0265336_10000187 3300028666 Bacteria 43247
418 Ga0307517_10000124 3300028786 Bacteria 115570
419 Ga0307517_10201173 3300028786 Bacteria 1245
420 Ga0307515_10299424 3300028794 Bacteria 1295
421 Ga0265338_10001016 3300028800 Bacteria 47131
422 Ga0265324_10003444 3300029957 Bacteria 7528
423 Ga0265325_10056438 3300031241 Bacteria 2006
424 Ga0265340_10008671 3300031247 Bacteria 5482
425 Ga0265340_10102843 3300031247 Bacteria 1326
426 Ga0265339_10001394 3300031249 Bacteria 17992
427 Ga0265339_10025376 3300031249 Bacteria 3401
428 Ga0265316_10109081 3300031344 Bacteria 2098
429 Ga0307509_10331849 3300031507 Bacteria 1252
430 Ga0307508_10018487 3300031616 Bacteria 6334
431 Ga0307508_10045268 3300031616 Bacteria 3932
432 Ga0265314_10002593 3300031711 Bacteria 18286
433 Ga0265314_10055522 3300031711 Bacteria 2733
434 Ga0265342_10064069 3300031712 Bacteria 2159
435 Ga0265342_10094777 3300031712 Bacteria 1707
436 Ga0307516_10114947 3300031730 Bacteria 2488
437 Ga0307412_10094907 3300031911 Bacteria 2096
438 Ga0307409_100374935 3300031995 Bacteria 1350
439 Ga0307415_100217806 3300032126 Bacteria 1528
440 Ga0307510_10049437 3300033180 Bacteria 4472
441 Ga0307510_10066290 3300033180 Bacteria 3648
442 Ga0315911_1000041 3300033442 Bacteria 50391
443 Ga0316215_1001232 3300033544 Bacteria 2484
444 Ga0373930_0000900 3300034816 Bacteria 4255
445 Ga0373950_0019509 3300034818 Bacteria 1185
446 Ga0373958_0021649 3300034819 Bacteria 1195
447 Ga0373934_0043554 3300035086 Bacteria 1774
448 Ga0373923_0030651 3300035111 Bacteria 2164
449 Ga0373945_0019029 3300035116 Bacteria 2341
450 Ga0373945_0025597 3300035116 Bacteria 2051
451 Ga0373945_0039927 3300035116 Bacteria 1693
452 Ga0373956_0002585 3300035119 Bacteria 7344
453 Ga0373956_0057140 3300035119 Bacteria 1763
454 Ga0373957_0002973 3300035120 Bacteria 4918
455 Ga0373943_0004058 3300035170 Bacteria 6646
456 Ga0373946_0012851 3300035171 Bacteria 3140
457 Ga0373955_0002301 3300035172 Bacteria 8307
458 Ga0373924_0011130 3300035410 Bacteria 3334
459 Ga0373931_0002920 3300035691 Bacteria 7629
460 Ga0373931_0188392 3300035691 Bacteria 1226
461 Ga0373935_0000562 3300035692 Bacteria 19338
462 Ga0373935_0260930 3300035692 Bacteria 1215
463 Ga0373927_0001832 3300035695 Bacteria 15797
464 Ga0373927_0013030 3300035695 Bacteria 5531
465 Ga0373927_0031076 3300035695 Bacteria 3483
466 Ga0373927_0067302 3300035695 Bacteria 2317
467 Ga0373927_0257581 3300035695 Bacteria 1147
468 Ga0373933_0008030 3300035724 Bacteria 5756
469 Ga0373933_0010257 3300035724 Bacteria 5132
470 Ga0373933_0060228 3300035724 Bacteria 2289
471 Ga0373933_0109511 3300035724 Bacteria 1722
472 Ga0373947_0007458 3300035725 Bacteria 6331
473 Ga0373947_0011887 3300035725 Bacteria 4987
474 Ga0373947_0044339 3300035725 Bacteria 2658
475 Ga0373947_0058251 3300035725 Bacteria 2340
476 Ga0373947_0202343 3300035725 Bacteria 1300
477 Ga0373937_0055338 3300036401 Bacteria 3642
478 Ga0373937_0112057 3300036401 Bacteria 2538
479 Ga0373937_0213919 3300036401 Bacteria 1814
480 Ga0373937_0513183 3300036401 Bacteria 1139
481 Ga0373925_0001669 3300037068 Bacteria 18688
482 Ga0373925_0035611 3300037068 Bacteria 3673
483 Ga0373925_0223351 3300037068 Bacteria 1504
484 Ga0373925_0526914 3300037068 Bacteria 971
485 Ga0395899_0062298 3300037312 Bacteria 2747
486 Ga0395900_0021484 3300037418 Bacteria 6600
487 Ga0395900_0025417 3300037418 Bacteria 6063
488 Ga0395900_0353417 3300037418 Bacteria 1443
489 Ga0395898_0097123 3300037466 Bacteria 2830
490 Ga0395898_0116414 3300037466 Bacteria 2561
491 Ga0395898_0139257 3300037466 Bacteria 2323
492 Ga0395898_0141641 3300037466 Bacteria 2302
493 Ga0395905_0002158 3300037471 Bacteria 22308
494 Ga0395905_0065008 3300037471 Bacteria 3415
495 Ga0395905_0090968 3300037471 Bacteria 2861
496 Ga0436364_0084522 3300037853 Bacteria 1825
497 Ga0436364_0815325 3300037853 Bacteria 1726
498 Ga0395901_0048271 3300038443 Bacteria 4421
499 Ga0395901_0207784 3300038443 Bacteria 2050
500 Ga0436365_1071754 3300039437 Bacteria 2852
501 Ga0436365_1439813 3300039437 Bacteria 24357
502 Ga0436360_0143183 3300039438 Bacteria 2179
503 Ga0436360_0650426 3300039438 Bacteria 1703
504 Ga0436361_0090009 3300039447 Bacteria 2221
505 Ga0436363_1183617 3300039450 Bacteria 3356
506 Ga0436363_1312646 3300039450 Bacteria 7026
507 Ga0436362_0264286 3300039453 Bacteria 3010
508 Ga0436362_0951882 3300039453 Bacteria 4090
509 Ga0439465_0058202 3300041413 Bacteria 1277
510 Ga0451793_1839637 3300041452 Bacteria 1813
511 Ga0451795_0758075 3300041456 Bacteria 1399
512 Ga0451804_0633050 3300041463 Bacteria 1204
513 Ga0451845_0934764 3300041501 Bacteria 1616
514 Ga0466972_0000266 3300044658 Bacteria 33408
515 Ga0466965_0052121 3300044683 Bacteria 2031
516 Ga0466966_0003043 3300044684 Bacteria 11075
517 Ga0466961_0000172 3300044693 Bacteria 44200
518 Ga0466963_0029690 3300044694 Bacteria 3522
519 Ga0466964_0102285 3300044706 Bacteria 1265
520 Ga0466971_0034106 3300044719 Bacteria 2281
521 Ga0466968_0012638 3300044735 Bacteria 3310
522 Ga0466970_0160427 3300044765 Bacteria 1244
523 Ga0466957_0214786 3300044842 Bacteria 1268
524 Ga0466959_0035913 3300045049 Bacteria 3662
525 Ga0466959_0077585 3300045049 Bacteria 2397
526 Ga0466967_0390228 3300045976 Bacteria 1353
527 Ga0495617_041043 3300046452 Bacteria 1547
528 Ga0495592_0004765 3300046454 Bacteria 9960
529 Ga0495592_0072002 3300046454 Bacteria 2515
530 Ga0495603_0001885 3300046455 Bacteria 12368
531 Ga0495603_0002323 3300046455 Bacteria 11164
532 Ga0495603_0034967 3300046455 Bacteria 3020
533 Ga0495603_0037566 3300046455 Bacteria 2906
534 Ga0495603_0076222 3300046455 Bacteria 1968
535 Ga0495629_0000913 3300046459 Bacteria 23749
536 Ga0495629_0111696 3300046459 Bacteria 1905
537 Ga0495638_0005734 3300046460 Bacteria 9151
538 Ga0495638_0133441 3300046460 Bacteria 1456
539 Ga0495641_0030774 3300046461 Bacteria 2569
540 Ga0495651_0011025 3300046462 Bacteria 6955
541 Ga0495651_0017587 3300046462 Bacteria 5535
542 Ga0495653_0006954 3300046463 Bacteria 9288
543 Ga0495653_0143935 3300046463 Bacteria 1673
544 Ga0495580_0000514 3300046472 Bacteria 32568
545 Ga0495580_0084672 3300046472 Bacteria 2208
546 Ga0495580_0161119 3300046472 Bacteria 1553
547 Ga0495582_0000854 3300046473 Bacteria 16907
548 Ga0495639_0000533 3300046475 Bacteria 17855
549 Ga0495639_0041951 3300046475 Bacteria 2062
550 Ga0495662_0000117 3300046476 Bacteria 29710
551 Ga0495662_0056305 3300046476 Bacteria 1899
552 Ga0495664_0144225 3300046477 Bacteria 1444
553 Ga0495584_0111324 3300046491 Bacteria 1385
554 Ga0495585_0039378 3300046492 Bacteria 2657
555 Ga0495594_0000083 3300046499 Bacteria 42703
556 Ga0495596_0056043 3300046500 Bacteria 1540
557 Ga0495596_0058216 3300046500 Bacteria 1507
558 Ga0495608_0068488 3300046511 Bacteria 2320
559 Ga0495608_0072758 3300046511 Bacteria 2242
560 Ga0495618_0038223 3300046514 Bacteria 3015
561 Ga0495618_0110131 3300046514 Bacteria 1763
562 Ga0495618_0200967 3300046514 Bacteria 1261
563 Ga0495620_0034145 3300046515 Bacteria 2302
564 Ga0495628_0015330 3300046516 Bacteria 6401
565 Ga0495628_0271138 3300046516 Bacteria 1262
566 Ga0495628_0290858 3300046516 Bacteria 1211
567 Ga0495630_0019357 3300046517 Bacteria 5002
568 Ga0495630_0132515 3300046517 Bacteria 1893
569 Ga0495631_0086131 3300046518 Bacteria 1353
570 Ga0495632_0057162 3300046519 Bacteria 1905
571 Ga0495632_0070599 3300046519 Bacteria 1679
572 Ga0495643_0048452 3300046522 Bacteria 2296
573 Ga0495648_0036431 3300046524 Bacteria 3175
574 Ga0495648_0188390 3300046524 Bacteria 1043
575 Ga0495666_0007828 3300046526 Bacteria 5352
576 Ga0495652_0006066 3300046529 Bacteria 11300
577 Ga0495652_0010138 3300046529 Bacteria 8544
578 Ga0495652_0025202 3300046529 Bacteria 5265
579 Ga0495652_0085803 3300046529 Bacteria 2586
580 Ga0495665_0006135 3300046531 Bacteria 6491
581 Ga0495640_0003805 3300046533 Bacteria 12119
582 Ga0495640_0006162 3300046533 Bacteria 9506
583 Ga0495640_0013689 3300046533 Bacteria 6163
584 Ga0495640_0038450 3300046533 Bacteria 3366
585 Ga0495640_0106950 3300046533 Bacteria 1831
586 Ga0495587_0021695 3300046536 Bacteria 3962
587 Ga0495609_0017503 3300046538 Bacteria 3328
588 Ga0495609_0046196 3300046538 Bacteria 1950
589 Ga0495621_0014359 3300046539 Bacteria 2504
590 Ga0495645_0139418 3300046543 Bacteria 1693
591 Ga0495622_0007389 3300046557 Bacteria 5097
592 Ga0495622_0010845 3300046557 Bacteria 4207
593 Ga0495622_0031021 3300046557 Bacteria 2499
594 Ga0495633_0032800 3300046558 Bacteria 2507
595 Ga0495633_0101237 3300046558 Bacteria 1337
596 Ga0495667_0014470 3300046559 Bacteria 5331
597 Ga0495667_0020782 3300046559 Bacteria 4430
598 Ga0495667_0042634 3300046559 Bacteria 3009
599 Ga0495667_0219966 3300046559 Bacteria 1212
600 Ga0495656_0014086 3300046615 Bacteria 2991
601 Ga0495656_0052064 3300046615 Bacteria 1754
602 Ga0495634_0021669 3300046642 Bacteria 4538
603 Ga0495634_0059329 3300046642 Bacteria 2549
604 Ga0495634_0202786 3300046642 Bacteria 1231
605 Ga0495625_0039007 3300046660 Bacteria 3472
606 Ga0495625_0080523 3300046660 Bacteria 2268
607 Ga0495635_0000420 3300046663 Bacteria 26860
608 Ga0495635_0001211 3300046663 Bacteria 17255
609 Ga0495635_0013526 3300046663 Bacteria 5711
610 Ga0495635_0060970 3300046663 Bacteria 2591
611 Ga0495635_0083102 3300046663 Bacteria 2191
612 Ga0495659_0006783 3300046664 Bacteria 3619
613 Ga0495659_0011010 3300046664 Bacteria 2913
614 Ga0495661_0068316 3300046665 Bacteria 2085
615 Ga0495661_0094910 3300046665 Bacteria 1690
616 Ga0495588_0001455 3300046674 Bacteria 10155
617 Ga0495657_0029176 3300046675 Bacteria 3871
618 Ga0495657_0031200 3300046675 Bacteria 3726
619 Ga0495657_0119361 3300046675 Bacteria 1662
620 Ga0495599_0017674 3300046678 Bacteria 4436
621 Ga0495599_0123454 3300046678 Bacteria 1609
622 Ga0495623_0006232 3300046679 Bacteria 7759
623 Ga0495623_0055297 3300046679 Bacteria 2502
624 Ga0495646_0073095 3300046680 Bacteria 2015
625 Ga0495647_0006007 3300046681 Bacteria 4002
626 Ga0495647_0015725 3300046681 Bacteria 2656
627 Ga0495669_0030227 3300046684 Bacteria 2378
628 Ga0495669_0049054 3300046684 Bacteria 1890
629 Ga0495613_0005598 3300046689 Bacteria 9432
630 Ga0495624_0050148 3300046690 Bacteria 2645
631 Ga0495670_0013904 3300046691 Bacteria 3959
632 Ga0495600_0006611 3300046809 Bacteria 7064
633 Ga0495600_0079639 3300046809 Bacteria 2138
634 Ga0495581_0052673 3300047315 Bacteria 2351
635 Ga0495581_0128293 3300047315 Bacteria 1477
636 Ga0495604_0006766 3300047317 Bacteria 9096
637 Ga0495604_0026715 3300047317 Bacteria 4594
638 Ga0495636_0138660 3300047318 Bacteria 1085
639 Ga0495674_0001076 3300047319 Bacteria 26284
640 Ga0495674_0062202 3300047319 Bacteria 3251
641 Ga0495674_0179687 3300047319 Bacteria 1763
642 Ga0495676_0004681 3300047321 Bacteria 12528
643 Ga0495676_0133887 3300047321 Bacteria 1785
644 Ga0495680_0008969 3300047322 Bacteria 9038
645 Ga0495675_0028405 3300047444 Bacteria 3565
646 Ga0495675_0034240 3300047444 Bacteria 3242
647 Ga0495675_0070015 3300047444 Bacteria 2214
648 Ga0495673_0068811 3300047469 Bacteria 1495
649 Ga0495684_0014378 3300047471 Bacteria 6090
650 Ga0495684_0055640 3300047471 Bacteria 3017
651 Ga0495684_0089670 3300047471 Bacteria 2330
652 Ga0495686_0067923 3300047472 Bacteria 2200
653 Ga0495686_0111193 3300047472 Bacteria 1643
654 Ga0495593_0000653 3300047673 Bacteria 19952
655 Ga0495593_0001276 3300047673 Bacteria 14742
656 Ga0495593_0014057 3300047673 Bacteria 4557
657 Ga0495593_0052654 3300047673 Bacteria 2151
658 Ga0495593_0104111 3300047673 Bacteria 1454
659 Ga0495602_0008796 3300048088 Bacteria 10534
660 Ga0495602_0093998 3300048088 Bacteria 2479
661 Ga0495602_0220122 3300048088 Bacteria 1434
662 Ga0495602_0310774 3300048088 Bacteria 1150
663 Ga0495614_0021334 3300048089 Bacteria 2797
664 Ga0495614_0111564 3300048089 Bacteria 1201
665 Ga0496100_0044040 3300048903 Bacteria 2857
666 Ga0496101_0001505 3300048904 Bacteria 13949
667 Ga0496101_0003279 3300048904 Bacteria 10062
668 Ga0496101_0051304 3300048904 Bacteria 2972
669 Ga0496101_0271915 3300048904 Bacteria 1323
670 Ga0496102_0002625 3300048905 Bacteria 15281
671 Ga0496102_0086424 3300048905 Bacteria 2896
672 Ga0496102_0113606 3300048905 Bacteria 2526
673 Ga0496102_0254473 3300048905 Bacteria 1656
674 Ga0496103_0048045 3300048906 Bacteria 2637
675 Ga0496104_0005208 3300048907 Bacteria 11372
676 Ga0496104_0006416 3300048907 Bacteria 10344
677 Ga0496104_0014207 3300048907 Bacteria 7185
678 Ga0496104_0076455 3300048907 Bacteria 3189
679 Ga0496104_0094615 3300048907 Bacteria 2858
680 Ga0496104_0136335 3300048907 Bacteria 2358
681 Ga0496104_0170803 3300048907 Bacteria 2085
682 Ga0496106_0008683 3300048909 Bacteria 7520
683 Ga0496106_0016980 3300048909 Bacteria 5386
684 Ga0496106_0050726 3300048909 Bacteria 3127
685 Ga0496107_0009500 3300048910 Bacteria 6747
686 Ga0496107_0018392 3300048910 Bacteria 4920
687 Ga0496107_0077056 3300048910 Bacteria 2428
688 Ga0496107_0111453 3300048910 Bacteria 2011
689 Ga0496108_0000764 3300048911 Bacteria 25051
690 Ga0496108_0028753 3300048911 Bacteria 4599
691 Ga0496108_0063507 3300048911 Bacteria 3110
692 Ga0496109_0003258 3300048912 Bacteria 13534
693 Ga0496109_0004144 3300048912 Bacteria 12110
694 Ga0496109_0015531 3300048912 Bacteria 6638
695 Ga0496109_0052370 3300048912 Bacteria 3720
696 Ga0496109_0111561 3300048912 Bacteria 2543
697 Ga0496110_0001592 3300048913 Bacteria 16587
698 Ga0496110_0050613 3300048913 Bacteria 3648
699 Ga0496111_0008321 3300048914 Bacteria 6858
700 Ga0496111_0011228 3300048914 Bacteria 6029
701 Ga0496111_0015152 3300048914 Bacteria 5284
702 Ga0496112_0013390 3300048915 Bacteria 7571
703 Ga0496112_0020166 3300048915 Bacteria 6312
704 Ga0496112_0032410 3300048915 Bacteria 5073
705 Ga0496113_0002790 3300048916 Bacteria 10274
706 Ga0496113_0008244 3300048916 Bacteria 6773
707 Ga0496113_0046126 3300048916 Bacteria 3235
708 Ga0496113_0066034 3300048916 Bacteria 2739
709 Ga0496114_0007929 3300048917 Bacteria 8404
710 Ga0496114_0011845 3300048917 Bacteria 6977
711 Ga0496114_0100837 3300048917 Bacteria 2464
712 Ga0496115_0010237 3300048918 Bacteria 6998
713 Ga0496115_0095421 3300048918 Bacteria 2434
714 Ga0496115_0132984 3300048918 Bacteria 2050
715 Ga0496117_0063045 3300048920 Bacteria 2536
716 Ga0496117_0124311 3300048920 Bacteria 1578
717 Ga0496118_0014751 3300048921 Bacteria 7292
718 Ga0496118_0092782 3300048921 Bacteria 2071
719 Ga0496119_0007992 3300048922 Bacteria 9404
720 Ga0496120_0013893 3300048923 Bacteria 5390
721 Ga0496121_0007199 3300048924 Bacteria 13477
722 Ga0496121_0020369 3300048924 Bacteria 6572
723 Ga0496121_0022522 3300048924 Bacteria 6109
724 Ga0496121_0032702 3300048924 Bacteria 4722
725 Ga0496121_0032851 3300048924 Bacteria 4708
726 Ga0496121_0035506 3300048924 Bacteria 4467
727 Ga0496121_0340114 3300048924 Bacteria 1003
728 Ga0496124_0054062 3300048927 Bacteria 3400
729 Ga0496124_0081544 3300048927 Bacteria 2658
730 Ga0496124_0110897 3300048927 Bacteria 2208
731 Ga0496124_0125451 3300048927 Bacteria 2046
732 Ga0496124_0147350 3300048927 Bacteria 1851
733 Ga0496125_0014324 3300048928 Bacteria 7727
734 Ga0496126_0005048 3300048929 Bacteria 15322
735 Ga0496126_0008555 3300048929 Bacteria 11028
736 Ga0496126_0010760 3300048929 Bacteria 9554
737 Ga0496126_0042062 3300048929 Bacteria 4223
738 Ga0496126_0065641 3300048929 Bacteria 3247
739 Ga0496126_0107798 3300048929 Bacteria 2429
740 Ga0496126_0156597 3300048929 Bacteria 1949
741 Ga0496126_0251891 3300048929 Bacteria 1471
742 Ga0496126_0347503 3300048929 Bacteria 1214
743 Ga0501046_0060470 3300049580 Bacteria 2964
744 Ga0501047_0010696 3300049581 Bacteria 8671
745 Ga0501070_0019681 3300049586 Bacteria 5660
746 Ga0501071_0203954 3300049587 Bacteria 1486
747 Ga0501073_0096623 3300049589 Bacteria 2052
748 Ga0501074_0097902 3300049590 Bacteria 2100
749 Ga0501080_0005746 3300049742 Bacteria 11094
750 Ga0501035_0239239 3300049822 Bacteria 1545
751 Ga0501044_0490751 3300049823 Bacteria 1130
752 nmdc:mga03n38_33846_c1 3300050490 Bacteria 2177
753 nmdc:mga00v17_16164_c1 3300050491 Bacteria 4204
754 nmdc:mga00v17_173280_c1 3300050491 Bacteria 1392
755 nmdc:mga00v17_40097_c1 3300050491 Bacteria 2808
756 nmdc:mga00v17_53285_c1 3300050491 Bacteria 2465
757 nmdc:mga0yw44_117206_c1 3300050492 Bacteria 1712
758 nmdc:mga0yw44_175254_c1 3300050492 Bacteria 1410
759 nmdc:mga0yw44_19078_c1 3300050492 Bacteria 3774
760 nmdc:mga0yw44_32783_c1 3300050492 Bacteria 3030
761 nmdc:mga0yw44_35935_c1 3300050492 Bacteria 2916
762 nmdc:mga0yw44_55619_c1 3300050492 Bacteria 2408
763 nmdc:mga0k408_38450_c1 3300050493 Bacteria 2746
764 nmdc:mga06z11_2658_c1 3300050494 Bacteria 6852
765 nmdc:mga06z11_4741_c1 3300050494 Bacteria 5378
766 nmdc:mga04h51_29938_c1 3300050495 Bacteria 1710
767 nmdc:mga07m45_116892_c1 3300050496 Bacteria 1539
768 nmdc:mga07m45_22323_c1 3300050496 Bacteria 3050
769 nmdc:mga0n895_177960_c1 3300050512 Bacteria 2158
770 nmdc:mga0n895_44071_c1 3300050512 Bacteria 4351
771 nmdc:mga0rr50_70465_c1 3300050513 Bacteria 2664
772 nmdc:mga0sz30_11563_c1 3300050516 Bacteria 3412
773 nmdc:mga0sz30_15647_c1 3300050516 Bacteria 3000
774 Ga0495601_0082252 3300053077 Bacteria 2067
775 Ga0495601_0174799 3300053077 Bacteria 1404
776 Ga0495612_0099967 3300053078 Bacteria 1234
777 Ga0500610_0066863 3300053079 Bacteria 1874
778 Ga0500635_0009119 3300053080 Bacteria 2743
779 Ga0500635_0039638 3300053080 Bacteria 1568
780 Ga0495595_0005159 3300053084 Bacteria 5277
781 Ga0495619_0107001 3300053085 Bacteria 1907
782 Ga0500578_0051961 3300053086 Bacteria 2625
783 Ga0500643_000016 3300053087 Bacteria 309502
784 Ga0500651_0155439 3300053093 Bacteria 1371
785 Ga0500566_0000359 3300053094 Bacteria 24838
786 Ga0500566_0001465 3300053094 Bacteria 13815
787 Ga0500566_0015284 3300053094 Bacteria 4504
788 Ga0500640_000223 3300053095 Bacteria 12307
789 Ga0500640_039226 3300053095 Bacteria 2080
790 Ga0500641_0007766 3300053096 Bacteria 3822
791 Ga0500554_005241 3300053102 Bacteria 2808
792 Ga0500557_000058 3300053105 Bacteria 45990
793 Ga0500572_002073 3300053111 Bacteria 4973
794 Ga0500595_004601 3300053119 Bacteria 6154
795 Ga0500595_065123 3300053119 Bacteria 1092
796 Ga0500608_017957 3300053122 Bacteria 3221
797 Ga0500614_001118 3300053123 Bacteria 6612
798 Ga0500614_007120 3300053123 Bacteria 2352
799 Ga0500642_0000109 3300053130 Bacteria 40031
800 Ga0500642_0042284 3300053130 Bacteria 1974
801 Ga0500559_0000691 3300053136 Bacteria 22192
802 Ga0500559_0002060 3300053136 Bacteria 10756
803 Ga0500568_0012527 3300053139 Bacteria 3895
804 Ga0500603_000310 3300053150 Bacteria 12812
805 Ga0500603_000334 3300053150 Bacteria 12330
806 Ga0500616_0020069 3300053153 Bacteria 3757
807 Ga0500620_007078 3300053155 Bacteria 2743
808 Ga0500622_0022779 3300053156 Bacteria 3317
809 Ga0500630_000749 3300053159 Bacteria 14863
810 Ga0500638_004286 3300053162 Bacteria 5464
811 Ga0500638_011067 3300053162 Bacteria 3984
812 Ga0500639_000274 3300053163 Bacteria 25567
813 Ga0500639_044133 3300053163 Bacteria 2335
814 Ga0500639_121143 3300053163 Bacteria 1256
815 Ga0500636_0000146 3300053177 Bacteria 37168
816 Ga0500637_0000764 3300053178 Bacteria 12913
817 Ga0500637_0001741 3300053178 Bacteria 9389
818 Ga0500637_0006310 3300053178 Bacteria 5829
819 Ga0500637_0073699 3300053178 Bacteria 1966
820 Ga0500625_025702 3300053729 Bacteria 2785
821 Ga0500645_004354 3300053730 Bacteria 5442
822 Ga0500645_044685 3300053730 Bacteria 1303
823 Ga0500596_000610 3300053735 Bacteria 6867
824 Ga0500596_003361 3300053735 Bacteria 3053
825 Ga0500601_000511 3300053737 Bacteria 5950
826 Ga0500661_020656 3300055283 Bacteria 1170
827 2507511384 2507262055 Bacteria 8048963
828 2508545181 2508501009 Bacteria 7784016
829 2508694021 2508501042 Bacteria 8719808
830 2509146642 2508501128 Bacteria 8613869
831 2511398289 2511231028 Bacteria 8046582
832 2513624136 2513237092 Bacteria 8341956
833 2513641099 2513237094 Bacteria 8789602
834 2513648526 2513237095 Bacteria 8976980
835 2513656099 2513237096 Bacteria 8722461
836 2513673448 2513237098 Bacteria 9902361
837 2513696363 2513237101 Bacteria 7952346
838 2513702633 2513237102 Bacteria 7703324
839 2513717818 2513237104 Bacteria 10034502
840 2513862904 2513237137 Bacteria 9558895
841 2513874972 2513237139 Bacteria 8737671
842 2513887703 2513237141 Bacteria 8496279
843 2513920892 2513237145 Bacteria 8979722
844 2514010313 2513237161 Bacteria 8871253
845 2515625036 2515154112 Bacteria 8294334
846 2517101125 2517093001 Bacteria 9002274
847 2517895919 2517572143 Bacteria 9484767
848 2524439932 2524023205 Bacteria 8918781
849 2524464756 2524023210 Bacteria 9029266
850 2524534789 2524023228 Bacteria 10118060
851 2617348464 2617270735 Bacteria 9163226
852 2617375009 2617270741 Bacteria 8201522
853 2671122711 2667528175 Bacteria 7532676
854 2723842862 2721755755 Bacteria 8322773
855 2728752968 2728368998 Bacteria 8720350
856 2745075786 2744054633 Bacteria 8678936
857 2793061655 2791355196 Bacteria 7323613
858 2793069653 2791355197 Bacteria 8420563
859 2793080251
860 2805916440 2802429603 Bacteria 8777136
861 2818240109 2816332527 Bacteria 8933356
862 2824608113 2824600985 Bacteria 8488197
863 2824615705 2824609381 Bacteria 8672835
864 2824625815 2824617872 Bacteria 8814715
865 2824634609 2824626560 Bacteria 8813858
866 2824642259 2824635225 Bacteria 8785348
867 2824652074 2824644064 Bacteria 8743947
868 2824660560 2824653114 Bacteria 8493680
869 2824665458 2824661429 Bacteria 9877870
870 2824679175 2824671348 Bacteria 8369588
871 2824686232 2824679649 Bacteria 8248951
872 2824695772 2824687955 Bacteria 8360029
873 2824702792 2824696289 Bacteria 8335049
874 2824709860 2824704595 Bacteria 9667483
875 2824719568 2824714736 Bacteria 8717648
876 2824732040 2824723954 Bacteria 8758240
877 2824738909 2824732956 Bacteria 7810675
878 2824752955 2824746037 Bacteria 7911610
879 2824759973 2824753945 Bacteria 9787441
880 2824769377 2824763712 Bacteria 9792355
881 2824779002 2824773399 Bacteria 8360218
882 2838128966 2838122688 Bacteria 8803140
883 2841946931 2841941048 Bacteria 8688029
884 2841957261 2841949485 Bacteria 8680857
885 2841961542 2841957949 Bacteria 8652217
886 2841970095 2841966195 Bacteria 8673214
887 2841977261 2841974524 Bacteria 8931498
888 2841985608 2841983080 Bacteria 8395090
889 2842042325 2842038055 Bacteria 8002051
890 2842050368 2842045827 Bacteria 8006841
891 2844316526 2844315083 Bacteria 8138177
892 2847939161 2847930680 Bacteria 9342022
893 2847943886 2847939898 Bacteria 8606328
894 2849081887 2849076700 Bacteria 7039503
895 2857513628 2857509624 Bacteria 7472071
896 2874594603 2874590934 Bacteria 8299676
897 2874606471 2874604998 Bacteria 7834745
898 2874615357 2874612657 Bacteria 8252029
899 2874620639 2874620515 Bacteria 8290088
900 2874633708 2874628541 Bacteria 8630250
901 2874649648 2874645413 Bacteria 8214782
902 2876766315 2876761206 Bacteria 10111113
903 2876773735 2876771140 Bacteria 8287509
904 2876809455 2876808645 Bacteria 8824342
905 2876820726 2876818435 Bacteria 8274608
906 2879076928 2879074833 Bacteria 8279565
907 2879090300 2879083081 Bacteria 8587928
908 2879100830 2879099564 Bacteria 10442239
909 2879113729 2879110137 Bacteria 8907982
910 2879130284 2879127579 Bacteria 8294491
911 2879146800 2879142872 Bacteria 8267021
912 2881367310 2881364244 Bacteria 7710352
913 2881668699 2881665667 Bacteria 8175609
914 2885373752 2885366525 Bacteria 8326213
915 2885382955 2885374607 Bacteria 8927485
916 2885386434 2885383462 Bacteria 9473874
917 2885412254 2885409591 Bacteria 9235467
918 2888386939 2888378607 Bacteria 9652610
919 2888389636 2888388044 Bacteria 7304136
920 2888421456 2888419890 Bacteria 7857137
921 2889033816 2889033259 Bacteria 9099371
922 2903732405 2903727486 Bacteria 8281579
923 2903755989 2903748898 Bacteria 9972761
924 2903773225 2903768456 Bacteria 9749579
925 2904666563 2904666416 Bacteria 8226587
926 2904699068 2904690495 Bacteria 9412302
927 2904707059
928 2904719528 2904711408 Bacteria 9771557
929 2906606280 2906602504 Bacteria 8295279
930 2906615614
931 2906626734 2906626472 Bacteria 8826946
932 2906638098 2906635258 Bacteria 8601019
933 2906647851 2906643746 Bacteria 8722424
934 2906665049 2906660503 Bacteria 8595048
935 2908745567 2908739725 Bacteria 8628932
936 2908763551 2908756301 Bacteria 8864324
937 2908777493 2908775508 Bacteria 8092255
938 2922367227 2922361189 Bacteria 7436256
939 2922377069
940 2922390053 2922386360 Bacteria 7017218
941 2922398223 2922393267 Bacteria 8285685
942 2922432393
943 2929619098 2929615660 Bacteria 9193770
944 2929628407 2929624759 Bacteria 9339455
945 2932791327 2932784394 Bacteria 9704911
946 2932795754 2932794094 Bacteria 7915132
947 2932801992 2932801729 Bacteria 7987968
948 2932817647 2932809354 Bacteria 9135765
949 2932826933 2932818245 Bacteria 9955613
950 2932833104 2932828146 Bacteria 9745859
951 2933581020 2933577622 Bacteria 9116884
952 2935612290 2935608549 Bacteria 8203142
953 2935623833 2935616580 Bacteria 9032984
954 2935630782 2935630451 Bacteria 8169952
955 2935639608 2935638405 Bacteria 10015038
956 2935650129 2935648319 Bacteria 8801166
957 2935658276 2935656913 Bacteria 8965014
958 2935667553 2935665750 Bacteria 9571747
959 2935682884 2935675223 Bacteria 9928132
960 2935687547 2935684952 Bacteria 9590419
961 2935696481 2935694250 Bacteria 9291695
962 2935705294 2935703347 Bacteria 10242284
963 2935719007 2935713505 Bacteria 9608509
964 2935728659 2935722832 Bacteria 9608746
965 2935736745 2935732158 Bacteria 9706831
966 2935746253 2935741537 Bacteria 9707219
967 2935753513 2935750917 Bacteria 9590372
968 2935767710 2935760218 Bacteria 9817913
969 2935770472 2935769743 Bacteria 7878163
970 2935782501 2935777560 Bacteria 8077691
971 2935786475 2935785616 Bacteria 7962367
972 2935794530 2935793552 Bacteria 8012592
973 2935807039 2935801545 Bacteria 9301974
974 2935814046 2935810662 Bacteria 9401221
975 2935823778 2935819856 Bacteria 8261050
976 2935829090 2935827899 Bacteria 10038562
977 2935845375 2935837841 Bacteria 9454360
978 2935854416 2935847175 Bacteria 8228321
979 2935861942 2935855204 Bacteria 9035059
980 2935872808 2935864058 Bacteria 9784707
981 2935880383 2935873716 Bacteria 9632195
982 2935886180 2935883170 Bacteria 7964738
983 2935913490 2935908558 Bacteria 8568796
984 2935923387 2935916978 Bacteria 9113783
985 2935931193 2935926038 Bacteria 8601059
986 2935935475 2935934488 Bacteria 8602579
987 2935947041 2935942939 Bacteria 8599779
988 2935953864 2935951376 Bacteria 8602333
989 2935961500 2935959822 Bacteria 7869783
990 2935968890 2935967501 Bacteria 8603075
991 2935982443 2935975950 Bacteria 8347125
992 2935985908 2935984226 Bacteria 8302647
993 2935994993 2935992306 Bacteria 9802711
994 2936006086 2936002035 Bacteria 9362176
995 2936013312 2936011229 Bacteria 8801034
996 2936021601 2936019824 Bacteria 8804134
997 2936030605 2936028420 Bacteria 8965941
998 2936039601 2936037263 Bacteria 9446081
999 2936047795 2936046547 Bacteria 8903709
1000 2936057797 2936055302 Bacteria 8785755
1001 2940559426 2940556831 Bacteria 9590747
1002 2941507434 2941507105 Bacteria 8166816
1003 2941515861 2941515067 Bacteria 8166720
1004 2941523431 2941523033 Bacteria 8169134
1005 2941536995 2941531003 Bacteria 7653939
1006 2941545654 2941538514 Bacteria 9402094
1007 3005476646 3005474847 Bacteria 9259049
1008 3005487666 3005483717 Bacteria 7877331
1009 3005511183 3005506211 Bacteria 6943378
1010 3005592034 3005587118 Bacteria 7794411
1011 3005596152 3005594810 Bacteria 8716512
1012 3005712099 3005710791 Bacteria 7622528
1013 3005719336 3005718088 Bacteria 8283608
1014 8006929437 8006926726 Bacteria 6749210
1015 8006934834 8006933436 Bacteria 10410654
1016 8006966177 8006964411 Bacteria 8966052
1017 8006974802 8006973647 Bacteria 10679141
1018 8006989654 8006984368 Bacteria 9651211
1019 8006998046 8006994254 Bacteria 8309700
1020 8016516935 8016511872 Bacteria 9921665
1021 8016524515 8016522445 Bacteria 8156687
1022 8016538076 8016530956 Bacteria 8155261
1023 8016542352 8016539877 Bacteria 8155419
1024 8016550925 8016548790 Bacteria 8155074
1025 8016559339 8016557553 Bacteria 8154380
1026 8016567739 8016566248 Bacteria 8158151
1027 8016580432 8016575299 Bacteria 8154085
1028 8016588620 8016583857 Bacteria 10421953
1029 8016597280 8016595262 Bacteria 8149947
1030 8016604979 8016603502 Bacteria 8731218
1031 8016620031 8016613128 Bacteria 8794220
1032 8016624251 8016622563 Bacteria 7999408
1033 8016637657 8016630954 Bacteria 9217207
1034 8017059635 8017057580 Bacteria 10023680
1035 8019537743 8019530166 Bacteria 8155624
1036 8019539374 8019538911 Bacteria 7872763
1037 8019551271 8019547302 Bacteria 7996444
1038 8019563822 8019555841 Bacteria 9642137
1039 8019573890 8019565922 Bacteria 9639779
1040 8019579109 8019576017 Bacteria 10049540
1041 8019597163 8019586578 Bacteria 10212056
1042 8019604527 8019597564 Bacteria 10041141
1043 8019614004 8019608314 Bacteria 10042931
1044 8019624550 8019619141 Bacteria 9218857
1045 8019637492 8019629233 Bacteria 8687553
1046 8019642118 8019638758 Bacteria 9062356
1047 8019650403 8019648815 Bacteria 10014479
1048 8019665424 8019659431 Bacteria 8577854
1049 8019674970 8019668869 Bacteria 8791617
1050 8019681126 8019678201 Bacteria 8863603
1051 8019694574 8019687851 Bacteria 8712826
1052 8055749644 8055742211 Bacteria 9226248
1053 8056675078 8056673599 Bacteria 7871253
1054 8056684662 8056681323 Bacteria 8472857
1055 8056973862 8056967851 Bacteria 9038162
1056 Ga0207674_10050854
1057 JGI25165J46597_1006170
1058 rootH1_10087822
1059 JGI25160J50197_1009314
1060 JGI25160J50197_1010686
1061 JGI25160J50197_1022482
1062 JGI25404J52841_10001294
1063 JGI25404J52841_10002561
1064 JGI25404J52841_10011860
1065 JGI25404J52841_10019493
1066 Ga0055531_10014879
1067 Ga0055543_1001485
1068 Ga0065165_1001376
1069 Ga0065165_1005421
1070 Ga0070658_10087865
1071 Ga0070658_10207249
1072 Ga0070683_100227303
1073 Ga0070683_100253308
1074 Ga0070670_100070676
1075 Ga0068869_100021269
1076 Ga0070680_100040184
1077 Ga0070680_100340756
1078 Ga0070682_100038542
1079 Ga0068868_100016760
1080 Ga0068868_100022538
1081 Ga0068868_100221960
1082 Ga0070660_100182043
1083 Ga0070691_10060494
1084 Ga0070687_100262398
1085 Ga0070661_100207321
1086 Ga0070661_100228438
1087 Ga0070668_100036126
1088 Ga0070668_100085347
1089 Ga0070668_100141123
1090 Ga0070669_100075838
1091 Ga0070671_100004615
1092 Ga0070673_100039182
1093 Ga0070659_100128239
1094 Ga0070709_10009471
1095 Ga0070709_10009924
1096 Ga0070714_100090281
1097 Ga0070714_100100486
1098 Ga0070714_100223751
1099 Ga0070714_100483641
1100 Ga0070713_100003995
1101 Ga0070713_100060683
1102 Ga0070713_100111409
1103 Ga0070710_10000354
1104 Ga0070711_100079786
1105 Ga0070711_100153125
1106 Ga0070708_100032198
1107 Ga0070663_100034425
1108 Ga0070663_100062682
1109 Ga0070681_10043868
1110 Ga0070681_10147849
1111 Ga0070681_10152124
1112 Ga0070681_10156834
1113 Ga0070698_100103607
1114 Ga0070679_100008173
1115 Ga0070679_100043766
1116 Ga0070679_100116448
1117 Ga0070679_100144623
1118 Ga0070679_100313829
1119 Ga0070679_100496038
1120 Ga0070684_100007383
1121 Ga0070684_100041482
1122 Ga0070684_100044811
1123 Ga0070697_100040016
1124 Ga0068853_100009856
1125 Ga0068853_100029321
1126 Ga0068853_100079038
1127 Ga0068853_100162707
1128 Ga0068853_100224536
1129 Ga0068853_100265006
1130 Ga0070672_100044913
1131 Ga0070672_100111369
1132 Ga0070665_100015994
1133 Ga0070665_100044686
1134 Ga0070665_100124841
1135 Ga0068855_100053745
1136 Ga0068855_100183563
1137 Ga0068855_100390481
1138 Ga0070664_100014972
1139 Ga0070664_100257083
1140 Ga0068857_100031797
1141 Ga0068854_100136291
1142 Ga0068856_100002849
1143 Ga0068856_100279553
1144 Ga0070702_100032076
1145 Ga0068852_100022694
1146 Ga0068852_100220177
1147 Ga0068852_100331439
1148 Ga0068859_100301163
1149 Ga0068864_100017485
1150 Ga0068861_100010994
1151 Ga0068861_100048183
1152 Ga0068851_10018196
1153 Ga0068851_10033883
1154 Ga0068870_10078771
1155 Ga0068863_100029494
1156 Ga0068863_100224386
1157 Ga0068858_100060910
1158 Ga0068858_100093556
1159 Ga0068858_100201196
1160 Ga0068860_100101612
1161 Ga0068860_100127112
1162 Ga0068860_100366897
1163 Ga0068862_100047874
1164 Ga0068862_100052726
1165 Ga0068862_100073668
1166 Ga0068862_100112368
1167 Ga0068862_100226201
1168 Ga0081455_10002391
1169 Ga0081455_10008216
1170 Ga0081455_10025742
1171 Ga0081455_10082273
1172 Ga0081455_10083718
1173 Ga0081540_1000876
1174 Ga0081540_1001057
1175 Ga0081540_1001355
1176 Ga0081540_1006825
1177 Ga0081540_1008183
1178 Ga0081540_1013124
1179 Ga0081540_1013668
1180 Ga0081540_1026846
1181 Ga0081540_1034143
1182 Ga0081540_1044842
1183 Ga0081540_1060292
1184 Ga0081539_10000958
1185 Ga0081539_10037151
1186 Ga0070717_10000879
1187 Ga0070717_10004010
1188 Ga0070717_10159239
1189 Ga0070717_10227624
1190 Ga0075365_10006174
1191 Ga0075365_10076606
1192 Ga0075365_10079609
1193 Ga0075368_10008768
1194 Ga0075368_10057356
1195 Ga0075363_100002408
1196 Ga0075363_100035826
1197 Ga0075363_100056365
1198 Ga0075364_10021061
1199 Ga0075364_10051999
1200 Ga0075364_10062058
1201 Ga0075432_10086113
1202 Ga0070712_100053314
1203 Ga0075367_10019327
1204 Ga0075367_10060627
1205 Ga0075367_10081126
1206 Ga0075367_10120902
1207 Ga0075369_10022623
1208 Ga0075369_10028690
1209 Ga0075366_10011991
1210 Ga0075366_10025819
1211 Ga0075366_10111921
1212 Ga0075366_10128390
1213 Ga0075366_10202879
1214 Ga0097621_100211157
1215 Ga0075370_10082553
1216 Ga0068871_100033296
1217 Ga0068871_100064105
1218 Ga0068871_100117942
1219 Ga0075428_100057249
1220 Ga0075434_100104926
1221 Ga0068865_100235411
1222 Ga0075436_100124040
1223 Ga0097620_100301155
1224 Ga0099823_1008012
1225 Ga0075435_100061613
1226 Ga0099795_10032255
1227 Ga0105244_10077045
1228 Ga0105250_10041582
1229 Ga0105240_10002375
1230 Ga0105240_10012518
1231 Ga0105240_10021194
1232 Ga0105240_10113195
1233 Ga0105240_10182585
1234 Ga0105240_10394089
1235 Ga0111539_10479835
1236 Ga0105245_10022776
1237 Ga0105245_10229823
1238 Ga0105245_10277838
1239 Ga0105245_10520430
1240 Ga0105245_10718977
1241 Ga0105247_10027347
1242 Ga0105247_10073898
1243 Ga0105247_10083393
1244 Ga0114129_10082526
1245 Ga0114129_10310362
1246 Ga0105243_10088147
1247 Ga0105241_10070681
1248 Ga0105241_10087873
1249 Ga0105241_10116546
1250 Ga0105241_10134747
1251 Ga0105242_10203890
1252 Ga0105248_10018230
1253 Ga0105248_10026667
1254 Ga0105248_10043229
1255 Ga0105248_10180112
1256 Ga0105248_10196203
1257 Ga0105248_10410721
1258 Ga0105237_10005704
1259 Ga0105237_10015508
1260 Ga0105237_10018101
1261 Ga0105237_10023103
1262 Ga0105237_10082020
1263 Ga0105237_10108656
1264 Ga0105237_10118480
1265 Ga0105238_10044702
1266 Ga0105238_10068523
1267 Ga0105238_10121083
1268 Ga0105249_10072669
1269 Ga0105249_10180362
1270 Ga0105249_10686885
1271 Ga0105249_10723966
1272 Ga0099796_10001408
1273 Ga0099796_10062361
1274 Ga0105239_10011442
1275 Ga0105239_10046389
1276 Ga0105239_10050756
1277 Ga0105239_10093670
1278 Ga0105239_10127494
1279 Ga0105239_10181637
1280 Ga0105239_10212611
1281 Ga0105246_10207022
1282 Ga0157370_10040683
1283 Ga0157370_10073270
1284 Ga0157370_10145697
1285 Ga0157369_10013879
1286 Ga0157369_10032628
1287 Ga0157369_10053166
1288 Ga0157374_10043558
1289 Ga0157378_10056131
1290 Ga0163162_10060537
1291 Ga0163162_10126411
1292 Ga0163162_10253647
1293 Ga0157372_10203594
1294 Ga0157372_10270010
1295 Ga0157375_10203812
1296 Ga0163163_10009057
1297 Ga0157380_10061401
1298 Ga0157377_10283262
1299 Ga0157379_10044212
1300 Ga0157379_10057511
1301 Ga0157379_10215715
1302 Ga0157376_10017125
1303 Ga0157376_10099309
1304 Ga0214544_1000005
1305 Ga0214542_1000004
1306 Ga0214545_1000005
1307 Ga0214545_1031225
1308 Ga0214543_1000564
1309 Ga0213876_10008568
1310 Ga0213871_10007091
1311 Ga0209677_100391
1312 Ga0209677_104865
1313 Ga0209148_1000900
1314 Ga0209148_1007943
1315 Ga0209233_1001098
1316 Ga0209233_1007522
1317 Ga0209455_1001425
1318 Ga0209455_1003294
1319 Ga0209455_1018859
1320 Ga0209758_1000102
1321 Ga0209758_1000732
1322 Ga0209758_1003159
1323 Ga0209758_1004735
1324 Ga0209758_1017230
1325 Ga0209758_1068105
1326 Ga0207426_1000354
1327 Ga0207426_1000521
1328 Ga0207426_1005878
1329 Ga0209257_1001340
1330 Ga0207697_10067290
1331 Ga0207656_10019673
1332 Ga0207656_10044922
1333 Ga0207692_10000064
1334 Ga0207692_10231610
1335 Ga0207642_10135723
1336 Ga0207710_10092290
1337 Ga0207688_10052008
1338 Ga0207647_10001590
1339 Ga0207647_10060689
1340 Ga0207647_10102104
1341 Ga0207699_10010189
1342 Ga0207699_10012565
1343 Ga0207699_10037112
1344 Ga0207643_10113049
1345 Ga0207705_10184488
1346 Ga0207684_10099753
1347 Ga0207654_10034161
1348 Ga0207654_10036401
1349 Ga0207654_10048473
1350 Ga0207707_10000827
1351 Ga0207707_10001679
1352 Ga0207707_10053392
1353 Ga0207707_10059228
1354 Ga0207707_10109761
1355 Ga0207707_10247492
1356 Ga0207695_10000006
1357 Ga0207695_10063403
1358 Ga0207695_10123854
1359 Ga0207671_10003551
1360 Ga0207671_10034572
1361 Ga0207671_10073678
1362 Ga0207671_10116409
1363 Ga0207671_10168137
1364 Ga0207671_10189095
1365 Ga0207671_10313147
1366 Ga0207693_10012104
1367 Ga0207693_10036737
1368 Ga0207693_10060877
1369 Ga0207693_10213002
1370 Ga0207660_10021880
1371 Ga0207660_10081175
1372 Ga0207660_10299321
1373 Ga0207657_10001315
1374 Ga0207657_10088631
1375 Ga0207657_10152790
1376 Ga0207649_10076160
1377 Ga0207649_10104401
1378 Ga0207652_10001089
1379 Ga0207652_10022161
1380 Ga0207652_10044205
1381 Ga0207652_10145609
1382 Ga0207652_10299022
1383 Ga0207646_10017460
1384 Ga0207694_10195557
1385 Ga0207659_10355514
1386 Ga0207687_10065085
1387 Ga0207700_10001903
1388 Ga0207700_10086868
1389 Ga0207664_10047855
1390 Ga0207664_10245383
1391 Ga0207664_10470080
1392 Ga0207644_10248745
1393 Ga0207706_10428022
1394 Ga0207709_10010026
1395 Ga0207670_10301873
1396 Ga0207669_10002843
1397 Ga0207704_10319368
1398 Ga0207665_10008591
1399 Ga0207665_10055029
1400 Ga0207665_10095014
1401 Ga0207691_10114965
1402 Ga0207691_10119416
1403 Ga0207691_10179879
1404 Ga0207691_10225268
1405 Ga0207711_10041679
1406 Ga0207711_10430746
1407 Ga0207689_10033789
1408 Ga0207689_10053585
1409 Ga0207689_10272365
1410 Ga0207661_10003154
1411 Ga0207661_10095826
1412 Ga0207661_10178100
1413 Ga0207679_10174460
1414 Ga0207667_10023055
1415 Ga0207712_10037787
1416 Ga0207712_10253518
1417 Ga0207712_10482123
1418 Ga0207668_10069976
1419 Ga0207668_10227217
1420 Ga0207640_10011386
1421 Ga0207640_10189279
1422 Ga0207677_10029411
1423 Ga0207703_10060227
1424 Ga0207703_10126175
1425 Ga0207703_10285034
1426 Ga0207639_10009882
1427 Ga0207639_10022260
1428 Ga0207639_10110862
1429 Ga0207639_10149151
1430 Ga0207639_10215143
1431 Ga0207678_10003718
1432 Ga0207678_10038266
1433 Ga0207678_10059272
1434 Ga0207678_10097524
1435 Ga0207708_10080240
1436 Ga0207702_10000325
1437 Ga0207702_10058600
1438 Ga0207641_10037207
1439 Ga0207641_10306106
1440 Ga0207641_10509501
1441 Ga0207648_10028909
1442 Ga0207648_10081895
1443 Ga0207674_10039712
1444 Ga0207675_100082737
1445 Ga0207683_10046036
1446 Ga0207698_10245913
1447 Ga0207698_10327503
1448 Ga0209389_1000021
1449 Ga0209389_1000086
1450 Ga0209589_1000005
1451 Ga0209589_1000027
1452 Ga0209489_100005
1453 Ga0209489_100313
1454 Ga0209489_105143
1455 Ga0209700_100006
1456 Ga0209700_100483
1457 Ga0209588_1011445
1458 Ga0209813_10082380
1459 Ga0268266_10001864
1460 Ga0268266_10003347
1461 Ga0268266_10014684
1462 Ga0268266_10046928
1463 Ga0268266_10113604
1464 Ga0268265_10008324
1465 Ga0268265_10050516
1466 Ga0268265_10192782
1467 Ga0268264_10000174
1468 Ga0268264_10109509
1469 Ga0268264_10296137
1470 Ga0265319_1009526
1471 Ga0265334_10077862
1472 Ga0265336_10000187
1473 Ga0307517_10000124
1474 Ga0307517_10201173
1475 Ga0307515_10299424
1476 Ga0265338_10001016
1477 Ga0265324_10003444
1478 Ga0265325_10056438
1479 Ga0265340_10008671
1480 Ga0265340_10102843
1481 Ga0265339_10001394
1482 Ga0265339_10025376
1483 Ga0265316_10109081
1484 Ga0307509_10331849
1485 Ga0307508_10018487
1486 Ga0307508_10045268
1487 Ga0265314_10002593
1488 Ga0265314_10055522
1489 Ga0265342_10064069
1490 Ga0265342_10094777
1491 Ga0307516_10114947
1492 Ga0307412_10094907
1493 Ga0307409_100374935
1494 Ga0307415_100217806
1495 Ga0307510_10049437
1496 Ga0307510_10066290
1497 Ga0315911_1000041
1498 Ga0316215_1001232
1499 Ga0373930_0000900
1500 Ga0373950_0019509
1501 Ga0373958_0021649
1502 Ga0373934_0043554
1503 Ga0373923_0030651
1504 Ga0373945_0019029
1505 Ga0373945_0025597
1506 Ga0373945_0039927
1507 Ga0373956_0002585
1508 Ga0373956_0057140
1509 Ga0373957_0002973
1510 Ga0373943_0004058
1511 Ga0373946_0012851
1512 Ga0373955_0002301
1513 Ga0373924_0011130
1514 Ga0373931_0002920
1515 Ga0373931_0188392
1516 Ga0373935_0000562
1517 Ga0373935_0260930
1518 Ga0373927_0001832
1519 Ga0373927_0013030
1520 Ga0373927_0031076
1521 Ga0373927_0067302
1522 Ga0373927_0257581
1523 Ga0373933_0008030
1524 Ga0373933_0010257
1525 Ga0373933_0060228
1526 Ga0373933_0109511
1527 Ga0373947_0007458
1528 Ga0373947_0011887
1529 Ga0373947_0044339
1530 Ga0373947_0058251
1531 Ga0373947_0202343
1532 Ga0373937_0055338
1533 Ga0373937_0112057
1534 Ga0373937_0213919
1535 Ga0373937_0513183
1536 Ga0373925_0001669
1537 Ga0373925_0035611
1538 Ga0373925_0223351
1539 Ga0373925_0526914
1540 Ga0395899_0062298
1541 Ga0395900_0021484
1542 Ga0395900_0025417
1543 Ga0395900_0353417
1544 Ga0395898_0097123
1545 Ga0395898_0116414
1546 Ga0395898_0139257
1547 Ga0395898_0141641
1548 Ga0395905_0002158
1549 Ga0395905_0065008
1550 Ga0395905_0090968
1551 Ga0436364_0084522
1552 Ga0436364_0815325
1553 Ga0395901_0048271
1554 Ga0395901_0207784
1555 Ga0436365_1071754
1556 Ga0436365_1439813
1557 Ga0436360_0143183
1558 Ga0436360_0650426
1559 Ga0436361_0090009
1560 Ga0436363_1183617
1561 Ga0436363_1312646
1562 Ga0436362_0264286
1563 Ga0436362_0951882
1564 Ga0439465_0058202
1565 Ga0451793_1839637
1566 Ga0451795_0758075
1567 Ga0451804_0633050
1568 Ga0451845_0934764
1569 Ga0466972_0000266
1570 Ga0466965_0052121
1571 Ga0466966_0003043
1572 Ga0466961_0000172
1573 Ga0466963_0029690
1574 Ga0466964_0102285
1575 Ga0466971_0034106
1576 Ga0466968_0012638
1577 Ga0466970_0160427
1578 Ga0466957_0214786
1579 Ga0466959_0035913
1580 Ga0466959_0077585
1581 Ga0466967_0390228
1582 Ga0495617_041043
1583 Ga0495592_0004765
1584 Ga0495592_0072002
1585 Ga0495603_0001885
1586 Ga0495603_0002323
1587 Ga0495603_0034967
1588 Ga0495603_0037566
1589 Ga0495603_0076222
1590 Ga0495629_0000913
1591 Ga0495629_0111696
1592 Ga0495638_0005734
1593 Ga0495638_0133441
1594 Ga0495641_0030774
1595 Ga0495651_0011025
1596 Ga0495651_0017587
1597 Ga0495653_0006954
1598 Ga0495653_0143935
1599 Ga0495580_0000514
1600 Ga0495580_0084672
1601 Ga0495580_0161119
1602 Ga0495582_0000854
1603 Ga0495639_0000533
1604 Ga0495639_0041951
1605 Ga0495662_0000117
1606 Ga0495662_0056305
1607 Ga0495664_0144225
1608 Ga0495584_0111324
1609 Ga0495585_0039378
1610 Ga0495594_0000083
1611 Ga0495596_0056043
1612 Ga0495596_0058216
1613 Ga0495608_0068488
1614 Ga0495608_0072758
1615 Ga0495618_0038223
1616 Ga0495618_0110131
1617 Ga0495618_0200967
1618 Ga0495620_0034145
1619 Ga0495628_0015330
1620 Ga0495628_0271138
1621 Ga0495628_0290858
1622 Ga0495630_0019357
1623 Ga0495630_0132515
1624 Ga0495631_0086131
1625 Ga0495632_0057162
1626 Ga0495632_0070599
1627 Ga0495643_0048452
1628 Ga0495648_0036431
1629 Ga0495648_0188390
1630 Ga0495666_0007828
1631 Ga0495652_0006066
1632 Ga0495652_0010138
1633 Ga0495652_0025202
1634 Ga0495652_0085803
1635 Ga0495665_0006135
1636 Ga0495640_0003805
1637 Ga0495640_0006162
1638 Ga0495640_0013689
1639 Ga0495640_0038450
1640 Ga0495640_0106950
1641 Ga0495587_0021695
1642 Ga0495609_0017503
1643 Ga0495609_0046196
1644 Ga0495621_0014359
1645 Ga0495645_0139418
1646 Ga0495622_0007389
1647 Ga0495622_0010845
1648 Ga0495622_0031021
1649 Ga0495633_0032800
1650 Ga0495633_0101237
1651 Ga0495667_0014470
1652 Ga0495667_0020782
1653 Ga0495667_0042634
1654 Ga0495667_0219966
1655 Ga0495656_0014086
1656 Ga0495656_0052064
1657 Ga0495634_0021669
1658 Ga0495634_0059329
1659 Ga0495634_0202786
1660 Ga0495625_0039007
1661 Ga0495625_0080523
1662 Ga0495635_0000420
1663 Ga0495635_0001211
1664 Ga0495635_0013526
1665 Ga0495635_0060970
1666 Ga0495635_0083102
1667 Ga0495659_0006783
1668 Ga0495659_0011010
1669 Ga0495661_0068316
1670 Ga0495661_0094910
1671 Ga0495588_0001455
1672 Ga0495657_0029176
1673 Ga0495657_0031200
1674 Ga0495657_0119361
1675 Ga0495599_0017674
1676 Ga0495599_0123454
1677 Ga0495623_0006232
1678 Ga0495623_0055297
1679 Ga0495646_0073095
1680 Ga0495647_0006007
1681 Ga0495647_0015725
1682 Ga0495669_0030227
1683 Ga0495669_0049054
1684 Ga0495613_0005598
1685 Ga0495624_0050148
1686 Ga0495670_0013904
1687 Ga0495600_0006611
1688 Ga0495600_0079639
1689 Ga0495581_0052673
1690 Ga0495581_0128293
1691 Ga0495604_0006766
1692 Ga0495604_0026715
1693 Ga0495636_0138660
1694 Ga0495674_0001076
1695 Ga0495674_0062202
1696 Ga0495674_0179687
1697 Ga0495676_0004681
1698 Ga0495676_0133887
1699 Ga0495680_0008969
1700 Ga0495675_0028405
1701 Ga0495675_0034240
1702 Ga0495675_0070015
1703 Ga0495673_0068811
1704 Ga0495684_0014378
1705 Ga0495684_0055640
1706 Ga0495684_0089670
1707 Ga0495686_0067923
1708 Ga0495686_0111193
1709 Ga0495593_0000653
1710 Ga0495593_0001276
1711 Ga0495593_0014057
1712 Ga0495593_0052654
1713 Ga0495593_0104111
1714 Ga0495602_0008796
1715 Ga0495602_0093998
1716 Ga0495602_0220122
1717 Ga0495602_0310774
1718 Ga0495614_0021334
1719 Ga0495614_0111564
1720 Ga0496100_0044040
1721 Ga0496101_0001505
1722 Ga0496101_0003279
1723 Ga0496101_0051304
1724 Ga0496101_0271915
1725 Ga0496102_0002625
1726 Ga0496102_0086424
1727 Ga0496102_0113606
1728 Ga0496102_0254473
1729 Ga0496103_0048045
1730 Ga0496104_0005208
1731 Ga0496104_0006416
1732 Ga0496104_0014207
1733 Ga0496104_0076455
1734 Ga0496104_0094615
1735 Ga0496104_0136335
1736 Ga0496104_0170803
1737 Ga0496106_0008683
1738 Ga0496106_0016980
1739 Ga0496106_0050726
1740 Ga0496107_0009500
1741 Ga0496107_0018392
1742 Ga0496107_0077056
1743 Ga0496107_0111453
1744 Ga0496108_0000764
1745 Ga0496108_0028753
1746 Ga0496108_0063507
1747 Ga0496109_0003258
1748 Ga0496109_0004144
1749 Ga0496109_0015531
1750 Ga0496109_0052370
1751 Ga0496109_0111561
1752 Ga0496110_0001592
1753 Ga0496110_0050613
1754 Ga0496111_0008321
1755 Ga0496111_0011228
1756 Ga0496111_0015152
1757 Ga0496112_0013390
1758 Ga0496112_0020166
1759 Ga0496112_0032410
1760 Ga0496113_0002790
1761 Ga0496113_0008244
1762 Ga0496113_0046126
1763 Ga0496113_0066034
1764 Ga0496114_0007929
1765 Ga0496114_0011845
1766 Ga0496114_0100837
1767 Ga0496115_0010237
1768 Ga0496115_0095421
1769 Ga0496115_0132984
1770 Ga0496117_0063045
1771 Ga0496117_0124311
1772 Ga0496118_0014751
1773 Ga0496118_0092782
1774 Ga0496119_0007992
1775 Ga0496120_0013893
1776 Ga0496121_0007199
1777 Ga0496121_0020369
1778 Ga0496121_0022522
1779 Ga0496121_0032702
1780 Ga0496121_0032851
1781 Ga0496121_0035506
1782 Ga0496121_0340114
1783 Ga0496124_0054062
1784 Ga0496124_0081544
1785 Ga0496124_0110897
1786 Ga0496124_0125451
1787 Ga0496124_0147350
1788 Ga0496125_0014324
1789 Ga0496126_0005048
1790 Ga0496126_0008555
1791 Ga0496126_0010760
1792 Ga0496126_0042062
1793 Ga0496126_0065641
1794 Ga0496126_0107798
1795 Ga0496126_0156597
1796 Ga0496126_0251891
1797 Ga0496126_0347503
1798 Ga0501046_0060470
1799 Ga0501047_0010696
1800 Ga0501070_0019681
1801 Ga0501071_0203954
1802 Ga0501073_0096623
1803 Ga0501074_0097902
1804 Ga0501080_0005746
1805 Ga0501035_0239239
1806 Ga0501044_0490751
1807 nmdc:mga03n38_33846_c1
1808 nmdc:mga00v17_16164_c1
1809 nmdc:mga00v17_173280_c1
1810 nmdc:mga00v17_40097_c1
1811 nmdc:mga00v17_53285_c1
1812 nmdc:mga0yw44_117206_c1
1813 nmdc:mga0yw44_175254_c1
1814 nmdc:mga0yw44_19078_c1
1815 nmdc:mga0yw44_32783_c1
1816 nmdc:mga0yw44_35935_c1
1817 nmdc:mga0yw44_55619_c1
1818 nmdc:mga0k408_38450_c1
1819 nmdc:mga06z11_2658_c1
1820 nmdc:mga06z11_4741_c1
1821 nmdc:mga04h51_29938_c1
1822 nmdc:mga07m45_116892_c1
1823 nmdc:mga07m45_22323_c1
1824 nmdc:mga0n895_177960_c1
1825 nmdc:mga0n895_44071_c1
1826 nmdc:mga0rr50_70465_c1
1827 nmdc:mga0sz30_11563_c1
1828 nmdc:mga0sz30_15647_c1
1829 Ga0495601_0082252
1830 Ga0495601_0174799
1831 Ga0495612_0099967
1832 Ga0500610_0066863
1833 Ga0500635_0009119
1834 Ga0500635_0039638
1835 Ga0495595_0005159
1836 Ga0495619_0107001
1837 Ga0500578_0051961
1838 Ga0500643_000016
1839 Ga0500651_0155439
1840 Ga0500566_0000359
1841 Ga0500566_0001465
1842 Ga0500566_0015284
1843 Ga0500640_000223
1844 Ga0500640_039226
1845 Ga0500641_0007766
1846 Ga0500554_005241
1847 Ga0500557_000058
1848 Ga0500572_002073
1849 Ga0500595_004601
1850 Ga0500595_065123
1851 Ga0500608_017957
1852 Ga0500614_001118
1853 Ga0500614_007120
1854 Ga0500642_0000109
1855 Ga0500642_0042284
1856 Ga0500559_0000691
1857 Ga0500559_0002060
1858 Ga0500568_0012527
1859 Ga0500603_000310
1860 Ga0500603_000334
1861 Ga0500616_0020069
1862 Ga0500620_007078
1863 Ga0500622_0022779
1864 Ga0500630_000749
1865 Ga0500638_004286
1866 Ga0500638_011067
1867 Ga0500639_000274
1868 Ga0500639_044133
1869 Ga0500639_121143
1870 Ga0500636_0000146
1871 Ga0500637_0000764
1872 Ga0500637_0001741
1873 Ga0500637_0006310
1874 Ga0500637_0073699
1875 Ga0500625_025702
1876 Ga0500645_004354
1877 Ga0500645_044685
1878 Ga0500596_000610
1879 Ga0500596_003361
1880 Ga0500601_000511
1881 Ga0500661_020656
1882 2507511384
1883 2508545181
1884 2508694021
1885 2509146642
1886 2511398289
1887 2513624136
1888 2513641099
1889 2513648526
1890 2513656099
1891 2513673448
1892 2513696363
1893 2513702633
1894 2513717818
1895 2513862904
1896 2513874972
1897 2513887703
1898 2513920892
1899 2514010313
1900 2515625036
1901 2517101125
1902 2517895919
1903 2524439932
1904 2524464756
1905 2524534789
1906 2617348464
1907 2617375009
1908 2671122711
1909 2723842862
1910 2728752968
1911 2745075786
1912 2793061655
1913 2793069653
1914 2793080251
1915 2805916440
1916 2818240109
1917 2824608113
1918 2824615705
1919 2824625815
1920 2824634609
1921 2824642259
1922 2824652074
1923 2824660560
1924 2824665458
1925 2824679175
1926 2824686232
1927 2824695772
1928 2824702792
1929 2824709860
1930 2824719568
1931 2824732040
1932 2824738909
1933 2824752955
1934 2824759973
1935 2824769377
1936 2824779002
1937 2838128966
1938 2841946931
1939 2841957261
1940 2841961542
1941 2841970095
1942 2841977261
1943 2841985608
1944 2842042325
1945 2842050368
1946 2844316526
1947 2847939161
1948 2847943886
1949 2849081887
1950 2857513628
1951 2874594603
1952 2874606471
1953 2874615357
1954 2874620639
1955 2874633708
1956 2874649648
1957 2876766315
1958 2876773735
1959 2876809455
1960 2876820726
1961 2879076928
1962 2879090300
1963 2879100830
1964 2879113729
1965 2879130284
1966 2879146800
1967 2881367310
1968 2881668699
1969 2885373752
1970 2885382955
1971 2885386434
1972 2885412254
1973 2888386939
1974 2888389636
1975 2888421456
1976 2889033816
1977 2903732405
1978 2903755989
1979 2903773225
1980 2904666563
1981 2904699068
1982 2904707059
1983 2904719528
1984 2906606280
1985 2906615614
1986 2906626734
1987 2906638098
1988 2906647851
1989 2906665049
1990 2908745567
1991 2908763551
1992 2908777493
1993 2922367227
1994 2922377069
1995 2922390053
1996 2922398223
1997 2922432393
1998 2929619098
1999 2929628407
2000 2932791327
2001 2932795754
2002 2932801992
2003 2932817647
2004 2932826933
2005 2932833104
2006 2933581020
2007 2935612290
2008 2935623833
2009 2935630782
2010 2935639608
2011 2935650129
2012 2935658276
2013 2935667553
2014 2935682884
2015 2935687547
2016 2935696481
2017 2935705294
2018 2935719007
2019 2935728659
2020 2935736745
2021 2935746253
2022 2935753513
2023 2935767710
2024 2935770472
2025 2935782501
2026 2935786475
2027 2935794530
2028 2935807039
2029 2935814046
2030 2935823778
2031 2935829090
2032 2935845375
2033 2935854416
2034 2935861942
2035 2935872808
2036 2935880383
2037 2935886180
2038 2935913490
2039 2935923387
2040 2935931193
2041 2935935475
2042 2935947041
2043 2935953864
2044 2935961500
2045 2935968890
2046 2935982443
2047 2935985908
2048 2935994993
2049 2936006086
2050 2936013312
2051 2936021601
2052 2936030605
2053 2936039601
2054 2936047795
2055 2936057797
2056 2940559426
2057 2941507434
2058 2941515861
2059 2941523431
2060 2941536995
2061 2941545654
2062 3005476646
2063 3005487666
2064 3005511183
2065 3005592034
2066 3005596152
2067 3005712099
2068 3005719336
2069 8006929437
2070 8006934834
2071 8006966177
2072 8006974802
2073 8006989654
2074 8006998046
2075 8016516935
2076 8016524515
2077 8016538076
2078 8016542352
2079 8016550925
2080 8016559339
2081 8016567739
2082 8016580432
2083 8016588620
2084 8016597280
2085 8016604979
2086 8016620031
2087 8016624251
2088 8016637657
2089 8017059635
2090 8019537743
2091 8019539374
2092 8019551271
2093 8019563822
2094 8019573890
2095 8019579109
2096 8019597163
2097 8019604527
2098 8019614004
2099 8019624550
2100 8019637492
2101 8019642118
2102 8019650403
2103 8019665424
2104 8019674970
2105 8019681126
2106 8019694574
2107 8055749644
2108 8056675078
2109 8056684662
2110 8056973862

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

73

209

0.94

PF00892

EamA

EamA-like transporter family

222

359

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly5.cif.gz_E crystal structure of protein 0.8094 18 305
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7993 25 304
5i20-assembly4.cif.gz_D crystal structure of protein 0.7959 18 305
5i20-assembly1.cif.gz_A crystal structure of protein 0.7956 25 305
5i20-assembly2.cif.gz_B crystal structure of protein 0.7889 25 305
ID Description Score Start End Superfamily
af_A0A0R0GBE4_5_124_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.6994 213 304 1.10.3730.20
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6864 27 305 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6646 26 305 1.20.1740.10
af_A0A0P0YAS8_28_439_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6632 19 305 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.6546 22 305 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A537QQX6-F1-model_v4 DMT family transporter 0.9961 15 310 GO:0005886
AF-A0A418UX48-F1-model_v4 DMT family transporter 0.9881 15 307 GO:0005886
AF-H0TKZ1-F1-model_v4 Putative transport protein permease of the drug/metabolite transporter (DMT) superfamily 0.9839 26 310 GO:0005886
AF-A0A5J4DUI9-F1-model_v4 S-adenosylmethionine/S-adenosylhomocysteine transporter 0.9836 15 310 GO:0016020
AF-Q131W8-F1-model_v4 EamA domain-containing protein 0.9804 15 307 GO:0005886

Map