F489127

General Info

Members Datasets Scaffolds Average Seq Length
1054 579 2108 246

Family's Representative Sequence

Representative Sequence 3300026121|Ga0207683_10260014|Ga0207683_102600142
Length 287
Sequence MVRAPQKGCPGRFRPIKAVAARRTDEPGSGPFQPSQTRVDLTTSDRGTVAVSIVVPVRNEAENVAPLIAEIVSALEGRWAYEIIYVNDGSTDATAERLAALMKQHPQLRQLKHASSTGQSAAVRSGVRAARGAIVATLDGDGQNNPAFLPDLISAVESGGGRVGLAAGQRVGRKDTGFKKLQSKIANSVRKSILSDGTRDTGCGLKAFPREVFLSMPYFDGLHRFLPALVRREGFDIAYVDVIDRPRHSGVSNYGFFDRLWIGIMDLAGVWWLIRRKKSTPAVTEVL

Samples

Sample ID Description Type Environment
1 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
82 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
83 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
114 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
115 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
116 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
117 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
121 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
179 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
180 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
181 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
182 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
190 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
191 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
209 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
216 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
217 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
218 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
256 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
257 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
258 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
259 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
260 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
263 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
264 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
265 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
272 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
273 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
274 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
275 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
276 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
277 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
278 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
279 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
280 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
281 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
282 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
283 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
290 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
291 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
296 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
297 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
300 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
301 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
302 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
303 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
304 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
305 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
306 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
307 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
308 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
318 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
319 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
320 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
321 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
322 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
325 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
343 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
344 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
345 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
346 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
347 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
348 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
349 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
350 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
351 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
352 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
353 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
367 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
368 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
369 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
370 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
371 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
372 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
373 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
374 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
375 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
376 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
377 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
378 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
379 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
382 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
383 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
384 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
385 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
386 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
387 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
388 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
392 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
393 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
394 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
395 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
396 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
397 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
398 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
399 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
400 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
401 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
402 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
403 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
404 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
405 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
406 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
407 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
408 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
409 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
410 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
411 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
412 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
413 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
414 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
415 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
416 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
417 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
418 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
419 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
420 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
421 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
422 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
423 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
424 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
425 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
426 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
427 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
428 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
429 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
430 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
431 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
432 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
433 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
434 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
435 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
436 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
437 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
438 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
439 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
440 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
441 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
442 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
443 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
444 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
445 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
446 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
447 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
448 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
449 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
450 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
451 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
452 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
453 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
454 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
455 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
456 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
457 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
458 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
459 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
460 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
461 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
462 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
463 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
464 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
465 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
466 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
467 2791355199
468 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
469 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
470 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
471 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
472 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
473 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
474 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
475 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
476 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
477 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
478 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
479 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
480 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
481 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
482 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
483 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
484 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
485 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
486 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
487 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
488 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
489 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
490 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
491 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
492 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
493 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
494 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
495 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
496 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
497 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
498 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
499 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
500 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
501 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
502 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
503 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
504 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
505 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
506 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
507 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
508 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
509 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
510 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
511 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
512 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
513 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
514 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
515 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
516 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
517 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
518 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
519 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
520 2904699407
521 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
522 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
523 2906610324
524 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
525 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
526 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
527 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
528 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
529 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
530 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
531 2922368715
532 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
533 2922425934
534 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
535 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
536 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
537 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
538 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
539 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
540 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
541 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
542 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
543 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
544 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
545 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
546 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
547 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
548 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
549 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
550 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
551 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
552 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
553 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
554 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
555 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
556 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
557 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
558 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
559 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
560 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
561 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
562 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
563 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
564 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
565 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
566 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
567 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
568 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
569 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
570 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
571 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
572 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
573 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
574 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
575 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
576 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
577 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
578 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
579 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.32
Metatranscriptomes 0
Isolates 12.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13
Nodule 9.39
Rhizoplane 5.41
Rhizosphere 60.72
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207683_10260014 3300026121 Bacteria 1585
2 JGI25406J46586_10000004 3300003203 Bacteria 149772
3 JGI25406J46586_10001469 3300003203 Bacteria 11119
4 JGI25153J46596_10000463 3300003215 Bacteria 25957
5 JGI25153J46596_10019947 3300003215 Bacteria 2549
6 JGI25153J46596_10052453 3300003215 Bacteria 1160
7 JGI25160J50197_1000944 3300003354 Bacteria 15250
8 JGI25160J50197_1001153 3300003354 Bacteria 13498
9 JGI25160J50197_1019480 3300003354 Bacteria 2078
10 JGI25404J52841_10012581 3300003659 Bacteria 1834
11 Ga0055526_1033155 3300003771 Bacteria 1440
12 Ga0055531_10004647 3300003794 Bacteria 8246
13 Ga0055543_1003106 3300004625 Bacteria 5088
14 Ga0065165_1000827 3300005262 Bacteria 40814
15 Ga0065165_1002442 3300005262 Bacteria 15727
16 Ga0070658_10035233 3300005327 Bacteria 4031
17 Ga0070658_10084881 3300005327 Bacteria 2604
18 Ga0070683_100007459 3300005329 Bacteria 9242
19 Ga0070683_100363172 3300005329 Bacteria 1379
20 Ga0070683_100472771 3300005329 Bacteria 1197
21 Ga0070690_100060133 3300005330 Bacteria 2445
22 Ga0070690_100084577 3300005330 Bacteria 2080
23 Ga0070670_100222630 3300005331 Bacteria 1642
24 Ga0070670_100403609 3300005331 Bacteria 1207
25 Ga0068869_100017742 3300005334 Bacteria 4833
26 Ga0068869_100049759 3300005334 Bacteria 3035
27 Ga0068869_100086456 3300005334 Bacteria 2350
28 Ga0068869_100195972 3300005334 Bacteria 1591
29 Ga0070680_100013470 3300005336 Bacteria 6369
30 Ga0070680_100040467 3300005336 Bacteria 3774
31 Ga0070680_100435326 3300005336 Bacteria 1119
32 Ga0070682_100012251 3300005337 Bacteria 4911
33 Ga0070682_100455676 3300005337 Bacteria 981
34 Ga0068868_100070436 3300005338 Bacteria 2788
35 Ga0068868_100090424 3300005338 Bacteria 2465
36 Ga0068868_100204814 3300005338 Bacteria 1646
37 Ga0068868_100252213 3300005338 Bacteria 1485
38 Ga0070660_100016544 3300005339 Bacteria 5354
39 Ga0070660_100230002 3300005339 Bacteria 1509
40 Ga0070691_10022588 3300005341 Bacteria 2919
41 Ga0070668_100008017 3300005347 Bacteria 7845
42 Ga0070668_100020107 3300005347 Bacteria 5034
43 Ga0070668_100098269 3300005347 Bacteria 2316
44 Ga0070669_100084511 3300005353 Bacteria 2368
45 Ga0070674_100132152 3300005356 Bacteria 1862
46 Ga0070673_100098113 3300005364 Bacteria 2407
47 Ga0070688_100355937 3300005365 Bacteria 1073
48 Ga0070659_100046983 3300005366 Bacteria 3384
49 Ga0070667_100239226 3300005367 Bacteria 1620
50 Ga0070709_10007867 3300005434 Bacteria 5854
51 Ga0070714_100006414 3300005435 Bacteria 9086
52 Ga0070714_100229953 3300005435 Bacteria 1708
53 Ga0070713_100034134 3300005436 Bacteria 4083
54 Ga0070713_100164729 3300005436 Bacteria 1981
55 Ga0070710_10001599 3300005437 Bacteria 10684
56 Ga0070711_100002859 3300005439 Bacteria 9937
57 Ga0070700_100154114 3300005441 Bacteria 1574
58 Ga0070663_100038501 3300005455 Bacteria 3336
59 Ga0070663_100101796 3300005455 Bacteria 2145
60 Ga0070663_100101922 3300005455 Bacteria 2143
61 Ga0070663_100547016 3300005455 Bacteria 967
62 Ga0070678_100048432 3300005456 Bacteria 3060
63 Ga0070678_100071013 3300005456 Bacteria 2605
64 Ga0070678_100193321 3300005456 Bacteria 1674
65 Ga0070662_100072628 3300005457 Bacteria 2541
66 Ga0070662_100094935 3300005457 Bacteria 2246
67 Ga0070681_10030820 3300005458 Bacteria 5383
68 Ga0070681_10087520 3300005458 Bacteria 3068
69 Ga0068867_100163683 3300005459 Bacteria 1756
70 Ga0070698_100277447 3300005471 Bacteria 1608
71 Ga0070698_100394669 3300005471 Bacteria 1317
72 Ga0070679_100029787 3300005530 Bacteria 5385
73 Ga0070679_100063963 3300005530 Bacteria 3666
74 Ga0070679_100629936 3300005530 Bacteria 1015
75 Ga0070684_100181901 3300005535 Bacteria 1912
76 Ga0068853_100075347 3300005539 Bacteria 2945
77 Ga0068853_100113730 3300005539 Bacteria 2407
78 Ga0068853_100122034 3300005539 Bacteria 2325
79 Ga0068853_100560707 3300005539 Bacteria 1083
80 Ga0070672_100098199 3300005543 Bacteria 2372
81 Ga0070696_100150358 3300005546 Bacteria 1708
82 Ga0070693_100024115 3300005547 Bacteria 3258
83 Ga0070665_100014274 3300005548 Bacteria 7976
84 Ga0070665_100022844 3300005548 Bacteria 6297
85 Ga0070665_100038210 3300005548 Bacteria 4826
86 Ga0070665_100087098 3300005548 Bacteria 3128
87 Ga0070665_100106474 3300005548 Bacteria 2806
88 Ga0070665_100106784 3300005548 Bacteria 2802
89 Ga0070665_100154626 3300005548 Bacteria 2295
90 Ga0070665_100656993 3300005548 Bacteria 1061
91 Ga0068855_100012380 3300005563 Bacteria 10304
92 Ga0068855_100025899 3300005563 Bacteria 7015
93 Ga0068855_100069359 3300005563 Bacteria 4102
94 Ga0068855_100109901 3300005563 Bacteria 3165
95 Ga0068855_100299582 3300005563 Bacteria 1781
96 Ga0068855_100341218 3300005563 Bacteria 1652
97 Ga0070664_100600058 3300005564 Bacteria 1021
98 Ga0068857_100048805 3300005577 Bacteria 3756
99 Ga0068856_100109797 3300005614 Bacteria 2755
100 Ga0068856_100197926 3300005614 Bacteria 2024
101 Ga0068856_100250053 3300005614 Bacteria 1788
102 Ga0068856_100256162 3300005614 Bacteria 1765
103 Ga0068856_100365537 3300005614 Bacteria 1461
104 Ga0068852_100005825 3300005616 Bacteria 8848
105 Ga0068852_100078635 3300005616 Bacteria 2918
106 Ga0068852_100087601 3300005616 Bacteria 2779
107 Ga0068859_100158578 3300005617 Bacteria 2341
108 Ga0068859_100255646 3300005617 Bacteria 1842
109 Ga0068859_100315251 3300005617 Bacteria 1658
110 Ga0068859_100315975 3300005617 Bacteria 1656
111 Ga0068864_100015373 3300005618 Bacteria 6363
112 Ga0068861_100096843 3300005719 Bacteria 2339
113 Ga0068861_100124590 3300005719 Bacteria 2083
114 Ga0068861_100145597 3300005719 Bacteria 1938
115 Ga0068851_10022519 3300005834 Bacteria 3071
116 Ga0068870_10057800 3300005840 Bacteria 2075
117 Ga0068870_10279201 3300005840 Bacteria 1046
118 Ga0068863_100136826 3300005841 Bacteria 2340
119 Ga0068858_100175907 3300005842 Bacteria 2019
120 Ga0068858_100325823 3300005842 Bacteria 1469
121 Ga0068858_100402352 3300005842 Bacteria 1315
122 Ga0068860_100021469 3300005843 Bacteria 6252
123 Ga0068862_100046654 3300005844 Bacteria 3696
124 Ga0068862_100071298 3300005844 Bacteria 3000
125 Ga0068862_100313727 3300005844 Bacteria 1446
126 Ga0081455_10001830 3300005937 Bacteria 25613
127 Ga0081455_10002668 3300005937 Bacteria 21100
128 Ga0081455_10018581 3300005937 Bacteria 6612
129 Ga0081540_1000972 3300005983 Bacteria 25862
130 Ga0081540_1001974 3300005983 Bacteria 17113
131 Ga0081540_1002258 3300005983 Bacteria 15851
132 Ga0081540_1006693 3300005983 Bacteria 8336
133 Ga0081540_1011616 3300005983 Bacteria 5873
134 Ga0081540_1013186 3300005983 Bacteria 5390
135 Ga0081540_1034122 3300005983 Bacteria 2750
136 Ga0081540_1035077 3300005983 Bacteria 2695
137 Ga0081539_10000080 3300005985 Bacteria 222745
138 Ga0081539_10000258 3300005985 Bacteria 122213
139 Ga0070717_10258175 3300006028 Bacteria 1541
140 Ga0075365_10005896 3300006038 Bacteria 6669
141 Ga0075365_10092352 3300006038 Bacteria 2063
142 Ga0075365_10145967 3300006038 Bacteria 1644
143 Ga0075365_10290388 3300006038 Bacteria 1150
144 Ga0075368_10004517 3300006042 Bacteria 4726
145 Ga0075363_100011482 3300006048 Bacteria 4242
146 Ga0075363_100056983 3300006048 Bacteria 2096
147 Ga0075363_100111360 3300006048 Bacteria 1522
148 Ga0075364_10041807 3300006051 Bacteria 2977
149 Ga0075364_10061945 3300006051 Bacteria 2455
150 Ga0075364_10129592 3300006051 Bacteria 1692
151 Ga0075364_10289799 3300006051 Bacteria 1114
152 Ga0075432_10051891 3300006058 Bacteria 1448
153 Ga0070716_100003186 3300006173 Bacteria 7689
154 Ga0075367_10049645 3300006178 Bacteria 2474
155 Ga0075367_10056939 3300006178 Bacteria 2323
156 Ga0075367_10070969 3300006178 Bacteria 2095
157 Ga0075367_10079211 3300006178 Bacteria 1985
158 Ga0075367_10149116 3300006178 Bacteria 1451
159 Ga0075367_10240766 3300006178 Bacteria 1134
160 Ga0075367_10267912 3300006178 Bacteria 1073
161 Ga0075369_10024802 3300006186 Bacteria 2488
162 Ga0075369_10032539 3300006186 Bacteria 2206
163 Ga0075366_10023669 3300006195 Bacteria 3578
164 Ga0075366_10088393 3300006195 Bacteria 1855
165 Ga0097621_100035680 3300006237 Bacteria 3975
166 Ga0097621_100181450 3300006237 Bacteria 1819
167 Ga0075370_10214280 3300006353 Bacteria 1137
168 Ga0068871_100035610 3300006358 Bacteria 3957
169 Ga0068871_100060406 3300006358 Bacteria 3092
170 Ga0075428_100051246 3300006844 Bacteria 4526
171 Ga0075431_100755130 3300006847 Bacteria 948
172 Ga0075434_100216753 3300006871 Bacteria 1934
173 Ga0068865_100374307 3300006881 Bacteria 1160
174 Ga0097620_100158568 3300006931 Bacteria 2341
175 Ga0097620_100255626 3300006931 Bacteria 1842
176 Ga0097620_100315266 3300006931 Bacteria 1658
177 Ga0097620_100315999 3300006931 Bacteria 1656
178 Ga0099825_1034265 3300006941 Bacteria 1903
179 Ga0099824_1022323 3300006942 Bacteria 4197
180 Ga0099823_1045384 3300006944 Bacteria 2932
181 Ga0075435_100059291 3300007076 Bacteria 3102
182 Ga0099794_10091128 3300007265 Bacteria 1513
183 Ga0099795_10023245 3300007788 Bacteria 2055
184 Ga0105240_10021770 3300009093 Bacteria 8519
185 Ga0105240_10071789 3300009093 Bacteria 4281
186 Ga0105240_10369259 3300009093 Bacteria 1623
187 Ga0105240_10408789 3300009093 Bacteria 1527
188 Ga0105240_10567438 3300009093 Bacteria 1254
189 Ga0105245_10024107 3300009098 Bacteria 5342
190 Ga0105245_10045829 3300009098 Bacteria 3906
191 Ga0105247_10024859 3300009101 Bacteria 3611
192 Ga0105247_10032207 3300009101 Bacteria 3185
193 Ga0105247_10034493 3300009101 Bacteria 3082
194 Ga0105247_10154672 3300009101 Bacteria 1514
195 Ga0114129_10405345 3300009147 Bacteria 1796
196 Ga0105243_10052397 3300009148 Bacteria 3232
197 Ga0105243_10110292 3300009148 Bacteria 2301
198 Ga0105243_10165898 3300009148 Bacteria 1908
199 Ga0105241_10034659 3300009174 Bacteria 3794
200 Ga0105241_10360080 3300009174 Bacteria 1266
201 Ga0105242_10026888 3300009176 Bacteria 4564
202 Ga0105248_10032697 3300009177 Bacteria 5810
203 Ga0105248_10173110 3300009177 Bacteria 2433
204 Ga0105248_10316805 3300009177 Bacteria 1757
205 Ga0105248_10441997 3300009177 Bacteria 1465
206 Ga0105248_11020153 3300009177 Bacteria 935
207 Ga0105237_10003509 3300009545 Bacteria 18604
208 Ga0105237_10015328 3300009545 Bacteria 7983
209 Ga0105237_10476001 3300009545 Bacteria 1255
210 Ga0105238_10115791 3300009551 Bacteria 2660
211 Ga0105238_10129316 3300009551 Bacteria 2504
212 Ga0105238_10572134 3300009551 Bacteria 1136
213 Ga0105249_10151212 3300009553 Bacteria 2235
214 Ga0105249_10539080 3300009553 Bacteria 1216
215 Ga0099796_10149101 3300010159 Bacteria 920
216 Ga0105239_10158550 3300010375 Bacteria 2528
217 Ga0105239_10168078 3300010375 Bacteria 2452
218 Ga0105239_10246110 3300010375 Bacteria 2007
219 Ga0105246_10049309 3300011119 Bacteria 2883
220 Ga0157370_10149402 3300013104 Bacteria 2175
221 Ga0157370_10251364 3300013104 Bacteria 1635
222 Ga0157369_10010002 3300013105 Bacteria 10832
223 Ga0157369_10011845 3300013105 Bacteria 9907
224 Ga0157369_10258842 3300013105 Bacteria 1815
225 Ga0157369_10555062 3300013105 Bacteria 1187
226 Ga0157374_10101959 3300013296 Bacteria 2752
227 Ga0157378_10033821 3300013297 Bacteria 4521
228 Ga0163162_10063107 3300013306 Bacteria 3746
229 Ga0157372_10794743 3300013307 Bacteria 1099
230 Ga0157375_10037811 3300013308 Bacteria 4627
231 Ga0157375_10073870 3300013308 Bacteria 3430
232 Ga0157375_10243208 3300013308 Bacteria 1959
233 Ga0163163_10030215 3300014325 Bacteria 5218
234 Ga0163163_10455911 3300014325 Bacteria 1339
235 Ga0163163_10841012 3300014325 Bacteria 981
236 Ga0157377_10103187 3300014745 Bacteria 1703
237 Ga0157379_10279345 3300014968 Bacteria 1519
238 Ga0157379_10281907 3300014968 Bacteria 1512
239 Ga0157379_10585832 3300014968 Bacteria 1040
240 Ga0157376_10017507 3300014969 Bacteria 5468
241 Ga0157376_10026485 3300014969 Bacteria 4584
242 Ga0163161_10060641 3300017792 Bacteria 2753
243 Ga0214544_1000002 3300021320 Bacteria 753857
244 Ga0214542_1001264 3300021321 Bacteria 51404
245 Ga0214545_1000018 3300021324 Bacteria 172019
246 Ga0214543_1000001 3300021327 Bacteria 776921
247 Ga0213873_10013166 3300021358 Bacteria 1809
248 Ga0213876_10005326 3300021384 Bacteria 7076
249 Ga0213876_10040946 3300021384 Bacteria 2448
250 Ga0209148_1002137 3300025254 Bacteria 7369
251 Ga0209148_1004590 3300025254 Bacteria 3357
252 Ga0209233_1000762 3300025261 Bacteria 14505
253 Ga0209233_1018116 3300025261 Bacteria 1903
254 Ga0209455_1000765 3300025272 Bacteria 18071
255 Ga0209564_1008133 3300025295 Bacteria 5246
256 Ga0209758_1000021 3300025297 Bacteria 697691
257 Ga0209758_1000872 3300025297 Bacteria 41540
258 Ga0209758_1002408 3300025297 Bacteria 19166
259 Ga0209256_1008459 3300025299 Bacteria 4768
260 Ga0207426_1000143 3300025302 Bacteria 192948
261 Ga0207426_1001632 3300025302 Bacteria 17590
262 Ga0207426_1004444 3300025302 Bacteria 6840
263 Ga0207426_1014679 3300025302 Bacteria 2863
264 Ga0207426_1038939 3300025302 Bacteria 1494
265 Ga0209257_1000455 3300025304 Bacteria 75945
266 Ga0207697_10020260 3300025315 Bacteria 2723
267 Ga0207697_10178552 3300025315 Bacteria 930
268 Ga0207656_10053596 3300025321 Bacteria 1751
269 Ga0207692_10000379 3300025898 Bacteria 15350
270 Ga0207710_10028257 3300025900 Bacteria 2434
271 Ga0207710_10044276 3300025900 Bacteria 1981
272 Ga0207710_10093738 3300025900 Bacteria 1409
273 Ga0207688_10086641 3300025901 Bacteria 1795
274 Ga0207680_10033270 3300025903 Bacteria 2939
275 Ga0207699_10000287 3300025906 Bacteria 27393
276 Ga0207645_10079549 3300025907 Bacteria 2101
277 Ga0207705_10038383 3300025909 Bacteria 3429
278 Ga0207705_10288391 3300025909 Bacteria 1257
279 Ga0207654_10017381 3300025911 Bacteria 3758
280 Ga0207707_10000501 3300025912 Bacteria 40356
281 Ga0207707_10003471 3300025912 Bacteria 13963
282 Ga0207707_10440317 3300025912 Bacteria 1116
283 Ga0207695_10000015 3300025913 Bacteria 803205
284 Ga0207695_10073452 3300025913 Bacteria 3485
285 Ga0207671_10033502 3300025914 Bacteria 3821
286 Ga0207671_10040790 3300025914 Bacteria 3435
287 Ga0207671_10145723 3300025914 Bacteria 1827
288 Ga0207671_10239363 3300025914 Bacteria 1425
289 Ga0207671_10268601 3300025914 Bacteria 1343
290 Ga0207671_10345675 3300025914 Bacteria 1179
291 Ga0207693_10073242 3300025915 Bacteria 2681
292 Ga0207663_10010587 3300025916 Bacteria 4917
293 Ga0207660_10073774 3300025917 Bacteria 2488
294 Ga0207662_10020015 3300025918 Bacteria 3815
295 Ga0207657_10001475 3300025919 Bacteria 25141
296 Ga0207657_10002963 3300025919 Bacteria 18202
297 Ga0207652_10003834 3300025921 Bacteria 12335
298 Ga0207652_10099140 3300025921 Bacteria 2570
299 Ga0207652_10148678 3300025921 Bacteria 2097
300 Ga0207652_10159934 3300025921 Bacteria 2019
301 Ga0207681_10389105 3300025923 Bacteria 1124
302 Ga0207694_10003249 3300025924 Bacteria 12943
303 Ga0207694_10117247 3300025924 Bacteria 2123
304 Ga0207650_10070039 3300025925 Bacteria 2636
305 Ga0207687_10008902 3300025927 Bacteria 6562
306 Ga0207687_10151058 3300025927 Bacteria 1772
307 Ga0207700_10256766 3300025928 Bacteria 1495
308 Ga0207700_10412640 3300025928 Bacteria 1185
309 Ga0207664_10004282 3300025929 Bacteria 9659
310 Ga0207690_10029436 3300025932 Bacteria 3492
311 Ga0207706_10081026 3300025933 Bacteria 2853
312 Ga0207706_10097002 3300025933 Bacteria 2592
313 Ga0207709_10023303 3300025935 Bacteria 3522
314 Ga0207709_10076583 3300025935 Bacteria 2142
315 Ga0207709_10187642 3300025935 Bacteria 1466
316 Ga0207669_10019314 3300025937 Bacteria 3545
317 Ga0207704_10093011 3300025938 Bacteria 1986
318 Ga0207665_10020993 3300025939 Bacteria 4292
319 Ga0207691_10104145 3300025940 Bacteria 2529
320 Ga0207691_10134757 3300025940 Bacteria 2179
321 Ga0207691_10310177 3300025940 Bacteria 1354
322 Ga0207711_10095783 3300025941 Bacteria 2618
323 Ga0207711_10247117 3300025941 Bacteria 1637
324 Ga0207711_10249067 3300025941 Bacteria 1631
325 Ga0207711_10385422 3300025941 Bacteria 1301
326 Ga0207689_10034405 3300025942 Bacteria 4209
327 Ga0207689_10052325 3300025942 Bacteria 3365
328 Ga0207689_10121138 3300025942 Bacteria 2152
329 Ga0207661_10053145 3300025944 Bacteria 3240
330 Ga0207679_10121406 3300025945 Bacteria 2081
331 Ga0207667_10030873 3300025949 Bacteria 5791
332 Ga0207667_10156664 3300025949 Bacteria 2343
333 Ga0207667_10173680 3300025949 Bacteria 2214
334 Ga0207667_10191873 3300025949 Bacteria 2096
335 Ga0207667_10375981 3300025949 Bacteria 1448
336 Ga0207668_10010376 3300025972 Bacteria 5626
337 Ga0207668_10069453 3300025972 Bacteria 2508
338 Ga0207668_10184966 3300025972 Bacteria 1646
339 Ga0207668_10371940 3300025972 Bacteria 1200
340 Ga0207640_10151108 3300025981 Bacteria 1706
341 Ga0207640_10165474 3300025981 Bacteria 1642
342 Ga0207640_10256856 3300025981 Bacteria 1359
343 Ga0207658_10074032 3300025986 Bacteria 2587
344 Ga0207658_10286445 3300025986 Bacteria 1414
345 Ga0207677_10089757 3300026023 Bacteria 2232
346 Ga0207703_10067997 3300026035 Bacteria 2934
347 Ga0207703_10085526 3300026035 Bacteria 2639
348 Ga0207703_10085864 3300026035 Bacteria 2635
349 Ga0207703_10436856 3300026035 Bacteria 1220
350 Ga0207639_10014370 3300026041 Bacteria 5567
351 Ga0207678_10021377 3300026067 Bacteria 5674
352 Ga0207678_10028254 3300026067 Bacteria 4897
353 Ga0207678_10029595 3300026067 Bacteria 4781
354 Ga0207678_10030828 3300026067 Bacteria 4683
355 Ga0207678_10036237 3300026067 Bacteria 4294
356 Ga0207678_10081133 3300026067 Bacteria 2776
357 Ga0207678_10125393 3300026067 Bacteria 2191
358 Ga0207702_10109231 3300026078 Bacteria 2455
359 Ga0207702_10204650 3300026078 Bacteria 1832
360 Ga0207702_10431909 3300026078 Bacteria 1275
361 Ga0207702_10490602 3300026078 Bacteria 1196
362 Ga0207641_10329265 3300026088 Bacteria 1450
363 Ga0207648_10345973 3300026089 Bacteria 1339
364 Ga0207676_10039988 3300026095 Bacteria 3591
365 Ga0207674_10074759 3300026116 Bacteria 3399
366 Ga0207675_100042862 3300026118 Bacteria 4225
367 Ga0207675_100132002 3300026118 Bacteria 2368
368 Ga0207675_100169161 3300026118 Bacteria 2088
369 Ga0207675_100205614 3300026118 Bacteria 1892
370 Ga0207675_100312972 3300026118 Bacteria 1531
371 Ga0207683_10093042 3300026121 Bacteria 2686
372 Ga0207683_10113354 3300026121 Bacteria 2428
373 Ga0207683_10193808 3300026121 Bacteria 1846
374 Ga0207683_10712395 3300026121 Bacteria 931
375 Ga0207698_10060792 3300026142 Bacteria 2940
376 Ga0207698_10275838 3300026142 Bacteria 1552
377 Ga0207698_10372096 3300026142 Bacteria 1357
378 Ga0207698_10421970 3300026142 Bacteria 1280
379 Ga0209389_1000128 3300027296 Bacteria 67169
380 Ga0209389_1000178 3300027296 Bacteria 49951
381 Ga0209589_1000003 3300027357 Bacteria 629130
382 Ga0209589_1000180 3300027357 Bacteria 72900
383 Ga0209489_100003 3300027361 Bacteria 663105
384 Ga0209489_100031 3300027361 Bacteria 184074
385 Ga0209489_101761 3300027361 Bacteria 44490
386 Ga0209700_100003 3300027363 Bacteria 663105
387 Ga0209700_100010 3300027363 Bacteria 395269
388 Ga0209588_1049817 3300027671 Bacteria 1355
389 Ga0209813_10022991 3300027866 Bacteria 1769
390 Ga0207428_10051723 3300027907 Bacteria 3283
391 Ga0268266_10001640 3300028379 Bacteria 25958
392 Ga0268266_10007119 3300028379 Bacteria 10145
393 Ga0268266_10034322 3300028379 Bacteria 4315
394 Ga0268266_10145895 3300028379 Bacteria 2128
395 Ga0268266_10149534 3300028379 Bacteria 2103
396 Ga0268266_10202671 3300028379 Bacteria 1816
397 Ga0268266_10295623 3300028379 Bacteria 1509
398 Ga0268266_10452378 3300028379 Bacteria 1221
399 Ga0268265_10025802 3300028380 Bacteria 4175
400 Ga0268265_10080899 3300028380 Bacteria 2563
401 Ga0268265_10093124 3300028380 Bacteria 2413
402 Ga0268264_10046637 3300028381 Bacteria 3600
403 Ga0268264_10052992 3300028381 Bacteria 3384
404 Ga0268264_10468684 3300028381 Bacteria 1223
405 Ga0307517_10000053 3300028786 Bacteria 155723
406 Ga0307517_10161525 3300028786 Bacteria 1502
407 Ga0307515_10026351 3300028794 Bacteria 10013
408 Ga0307515_10118139 3300028794 Bacteria 3029
409 Ga0265325_10000126 3300031241 Bacteria 52410
410 Ga0265339_10085714 3300031249 Bacteria 1658
411 Ga0307513_10029449 3300031456 Bacteria 6259
412 Ga0307509_10273370 3300031507 Bacteria 1456
413 Ga0307408_100321774 3300031548 Bacteria 1303
414 Ga0307408_100487276 3300031548 Bacteria 1077
415 Ga0307408_100631066 3300031548 Bacteria 956
416 Ga0307508_10097004 3300031616 Bacteria 2540
417 Ga0307508_10097437 3300031616 Bacteria 2533
418 Ga0307508_10269467 3300031616 Bacteria 1297
419 Ga0265314_10008935 3300031711 Bacteria 8534
420 Ga0307516_10006636 3300031730 Bacteria 13526
421 Ga0307516_10006657 3300031730 Bacteria 13504
422 Ga0307405_10313624 3300031731 Bacteria 1195
423 Ga0307410_10171836 3300031852 Bacteria 1634
424 Ga0307407_10400961 3300031903 Bacteria 984
425 Ga0307412_10169806 3300031911 Bacteria 1630
426 Ga0307409_100272471 3300031995 Bacteria 1559
427 Ga0307415_100077142 3300032126 Bacteria 2365
428 Ga0307507_10207522 3300033179 Bacteria 1343
429 Ga0307510_10004835 3300033180 Bacteria 15927
430 Ga0307510_10022778 3300033180 Bacteria 7267
431 Ga0307510_10024452 3300033180 Bacteria 6978
432 Ga0315911_1000001 3300033442 Bacteria 1088602
433 Ga0373930_0011070 3300034816 Bacteria 1623
434 Ga0373926_0000472 3300035083 Bacteria 10609
435 Ga0373928_0005986 3300035084 Bacteria 2331
436 Ga0373934_0034905 3300035086 Bacteria 1977
437 Ga0373944_0007573 3300035089 Bacteria 2914
438 Ga0373923_0000912 3300035111 Bacteria 7883
439 Ga0373923_0067699 3300035111 Bacteria 1528
440 Ga0373932_0075339 3300035112 Bacteria 1055
441 Ga0373936_0020644 3300035113 Bacteria 2560
442 Ga0373953_0046512 3300035117 Bacteria 1742
443 Ga0373954_0010502 3300035118 Bacteria 4086
444 Ga0373954_0023710 3300035118 Bacteria 2793
445 Ga0373954_0119372 3300035118 Bacteria 1279
446 Ga0373956_0032430 3300035119 Bacteria 2292
447 Ga0373956_0063147 3300035119 Bacteria 1679
448 Ga0373957_0010926 3300035120 Bacteria 3017
449 Ga0373946_0010039 3300035171 Bacteria 3501
450 Ga0373955_0012670 3300035172 Bacteria 4057
451 Ga0373955_0085480 3300035172 Bacteria 1790
452 Ga0373924_0044816 3300035410 Bacteria 1818
453 Ga0373931_0002137 3300035691 Bacteria 8712
454 Ga0373935_0032612 3300035692 Bacteria 3237
455 Ga0373927_0021602 3300035695 Bacteria 4218
456 Ga0373927_0028111 3300035695 Bacteria 3670
457 Ga0373927_0033709 3300035695 Bacteria 3333
458 Ga0373927_0053158 3300035695 Bacteria 2619
459 Ga0373927_0165658 3300035695 Bacteria 1448
460 Ga0373933_0039329 3300035724 Bacteria 2782
461 Ga0373947_0004430 3300035725 Bacteria 8235
462 Ga0373947_0005252 3300035725 Bacteria 7568
463 Ga0373947_0027527 3300035725 Bacteria 3327
464 Ga0373947_0162528 3300035725 Bacteria 1445
465 Ga0373947_0243772 3300035725 Bacteria 1187
466 Ga0373937_0025215 3300036401 Bacteria 5368
467 Ga0373937_0067677 3300036401 Bacteria 3291
468 Ga0373937_0357191 3300036401 Bacteria 1384
469 Ga0373925_0003114 3300037068 Bacteria 13021
470 Ga0395899_0124858 3300037312 Bacteria 1841
471 Ga0395900_0087362 3300037418 Bacteria 3205
472 Ga0395900_0174996 3300037418 Bacteria 2183
473 Ga0395898_0048964 3300037466 Bacteria 4143
474 Ga0395898_0052583 3300037466 Bacteria 3980
475 Ga0395898_0211290 3300037466 Bacteria 1851
476 Ga0395898_0223014 3300037466 Bacteria 1798
477 Ga0395905_0023884 3300037471 Bacteria 5772
478 Ga0395905_0081159 3300037471 Bacteria 3039
479 Ga0395905_0138992 3300037471 Bacteria 2285
480 Ga0395901_0165219 3300038443 Bacteria 2324
481 Ga0395901_0261040 3300038443 Bacteria 1803
482 Ga0395901_0448830 3300038443 Bacteria 1319
483 Ga0395901_0519884 3300038443 Bacteria 1209
484 Ga0395901_0557779 3300038443 Bacteria 1160
485 Ga0436365_0902823 3300039437 Bacteria 17556
486 Ga0436363_1666451 3300039450 Bacteria 1057
487 Ga0439465_0051685 3300041413 Bacteria 1347
488 Ga0466972_0000194 3300044658 Bacteria 45661
489 Ga0466972_0011625 3300044658 Bacteria 4420
490 Ga0466961_0270383 3300044693 Bacteria 1041
491 Ga0466968_0133519 3300044735 Bacteria 1131
492 Ga0466959_0340570 3300045049 Bacteria 1023
493 Ga0466967_0294154 3300045976 Bacteria 1561
494 Ga0495627_030147 3300046453 Bacteria 1721
495 Ga0495592_0002783 3300046454 Bacteria 12396
496 Ga0495592_0019159 3300046454 Bacteria 5207
497 Ga0495603_0000307 3300046455 Bacteria 26123
498 Ga0495603_0011723 3300046455 Bacteria 5306
499 Ga0495603_0017347 3300046455 Bacteria 4358
500 Ga0495603_0018884 3300046455 Bacteria 4173
501 Ga0495603_0124495 3300046455 Bacteria 1502
502 Ga0495590_0017084 3300046457 Bacteria 2616
503 Ga0495629_0000861 3300046459 Bacteria 24506
504 Ga0495629_0014347 3300046459 Bacteria 5701
505 Ga0495629_0016618 3300046459 Bacteria 5282
506 Ga0495638_0033426 3300046460 Bacteria 3289
507 Ga0495638_0050883 3300046460 Bacteria 2586
508 Ga0495641_0034030 3300046461 Bacteria 2412
509 Ga0495651_0014453 3300046462 Bacteria 6103
510 Ga0495651_0080369 3300046462 Bacteria 2463
511 Ga0495651_0270150 3300046462 Bacteria 1153
512 Ga0495653_0075206 3300046463 Bacteria 2514
513 Ga0495650_0034690 3300046471 Bacteria 2230
514 Ga0495580_0098255 3300046472 Bacteria 2036
515 Ga0495580_0186993 3300046472 Bacteria 1429
516 Ga0495582_0000147 3300046473 Bacteria 38047
517 Ga0495582_0123411 3300046473 Bacteria 1461
518 Ga0495605_0038596 3300046474 Bacteria 2395
519 Ga0495605_0045457 3300046474 Bacteria 2164
520 Ga0495639_0000859 3300046475 Bacteria 13791
521 Ga0495639_0043145 3300046475 Bacteria 2036
522 Ga0495662_0000336 3300046476 Bacteria 20519
523 Ga0495664_0001521 3300046477 Bacteria 12275
524 Ga0495664_0012478 3300046477 Bacteria 4813
525 Ga0495664_0016976 3300046477 Bacteria 4157
526 Ga0495664_0042410 3300046477 Bacteria 2695
527 Ga0495664_0183075 3300046477 Bacteria 1270
528 Ga0495664_0184523 3300046477 Bacteria 1264
529 Ga0495584_0039447 3300046491 Bacteria 2385
530 Ga0495585_0073901 3300046492 Bacteria 1855
531 Ga0495594_0001322 3300046499 Bacteria 12893
532 Ga0495594_0032935 3300046499 Bacteria 2815
533 Ga0495596_0140990 3300046500 Bacteria 936
534 Ga0495583_0074415 3300046506 Bacteria 1487
535 Ga0495606_0108428 3300046507 Bacteria 1678
536 Ga0495606_0140645 3300046507 Bacteria 1426
537 Ga0495608_0193882 3300046511 Bacteria 1282
538 Ga0495610_0040037 3300046512 Bacteria 2365
539 Ga0495610_0140031 3300046512 Bacteria 1042
540 Ga0495616_0039881 3300046513 Bacteria 2402
541 Ga0495616_0050544 3300046513 Bacteria 2078
542 Ga0495618_0048071 3300046514 Bacteria 2693
543 Ga0495618_0375102 3300046514 Bacteria 873
544 Ga0495620_0115094 3300046515 Bacteria 1063
545 Ga0495620_0155557 3300046515 Bacteria 890
546 Ga0495628_0104287 3300046516 Bacteria 2185
547 Ga0495630_0031079 3300046517 Bacteria 3974
548 Ga0495630_0106553 3300046517 Bacteria 2123
549 Ga0495630_0234335 3300046517 Bacteria 1403
550 Ga0495631_0075131 3300046518 Bacteria 1458
551 Ga0495632_0039248 3300046519 Bacteria 2391
552 Ga0495632_0045264 3300046519 Bacteria 2192
553 Ga0495643_0047911 3300046522 Bacteria 2312
554 Ga0495643_0064591 3300046522 Bacteria 1933
555 Ga0495644_0023320 3300046523 Bacteria 2356
556 Ga0495644_0027455 3300046523 Bacteria 2156
557 Ga0495648_0031673 3300046524 Bacteria 3480
558 Ga0495648_0044017 3300046524 Bacteria 2790
559 Ga0495663_0020127 3300046525 Bacteria 1914
560 Ga0495666_0011724 3300046526 Bacteria 4370
561 Ga0495666_0054838 3300046526 Bacteria 1911
562 Ga0495652_0033352 3300046529 Bacteria 4495
563 Ga0495652_0080909 3300046529 Bacteria 2681
564 Ga0495652_0172649 3300046529 Bacteria 1667
565 Ga0495654_0060198 3300046530 Bacteria 1826
566 Ga0495654_0063347 3300046530 Bacteria 1770
567 Ga0495665_0000451 3300046531 Bacteria 20688
568 Ga0495665_0002906 3300046531 Bacteria 9257
569 Ga0495640_0008070 3300046533 Bacteria 8268
570 Ga0495640_0015546 3300046533 Bacteria 5725
571 Ga0495640_0045053 3300046533 Bacteria 3062
572 Ga0495587_0078247 3300046536 Bacteria 1919
573 Ga0495587_0123442 3300046536 Bacteria 1482
574 Ga0495587_0149797 3300046536 Bacteria 1330
575 Ga0495598_0005334 3300046537 Bacteria 2842
576 Ga0495609_0019055 3300046538 Bacteria 3176
577 Ga0495609_0137577 3300046538 Bacteria 1043
578 Ga0495597_0037295 3300046542 Bacteria 2183
579 Ga0495597_0105088 3300046542 Bacteria 1188
580 Ga0495645_0026504 3300046543 Bacteria 4208
581 Ga0495645_0082984 3300046543 Bacteria 2297
582 Ga0495633_0026103 3300046558 Bacteria 2869
583 Ga0495633_0107963 3300046558 Bacteria 1291
584 Ga0495667_0010280 3300046559 Bacteria 6330
585 Ga0495667_0019151 3300046559 Bacteria 4619
586 Ga0495667_0114351 3300046559 Bacteria 1744
587 Ga0495656_0012129 3300046615 Bacteria 3175
588 Ga0495656_0100656 3300046615 Bacteria 1336
589 Ga0495668_0066116 3300046616 Bacteria 1990
590 Ga0495668_0192136 3300046616 Bacteria 1118
591 Ga0495634_0003445 3300046642 Bacteria 12673
592 Ga0495634_0072360 3300046642 Bacteria 2267
593 Ga0495634_0094907 3300046642 Bacteria 1932
594 Ga0495634_0130633 3300046642 Bacteria 1601
595 Ga0495611_0032147 3300046648 Bacteria 2312
596 Ga0495625_0098561 3300046660 Bacteria 2010
597 Ga0495625_0197820 3300046660 Bacteria 1328
598 Ga0495625_0301182 3300046660 Bacteria 1026
599 Ga0495635_0000676 3300046663 Bacteria 21987
600 Ga0495635_0001465 3300046663 Bacteria 15777
601 Ga0495635_0020344 3300046663 Bacteria 4623
602 Ga0495659_0176584 3300046664 Bacteria 868
603 Ga0495661_0093395 3300046665 Bacteria 1707
604 Ga0495661_0143882 3300046665 Bacteria 1294
605 Ga0495661_0190914 3300046665 Bacteria 1079
606 Ga0495588_0032506 3300046674 Bacteria 2630
607 Ga0495657_0022346 3300046675 Bacteria 4532
608 Ga0495657_0083592 3300046675 Bacteria 2060
609 Ga0495599_0008614 3300046678 Bacteria 6209
610 Ga0495599_0102947 3300046678 Bacteria 1779
611 Ga0495623_0013959 3300046679 Bacteria 5205
612 Ga0495623_0197892 3300046679 Bacteria 1157
613 Ga0495646_0010772 3300046680 Bacteria 5809
614 Ga0495646_0262870 3300046680 Bacteria 921
615 Ga0495647_0013962 3300046681 Bacteria 2792
616 Ga0495658_0002190 3300046683 Bacteria 9885
617 Ga0495658_0009128 3300046683 Bacteria 4931
618 Ga0495669_0010132 3300046684 Bacteria 3980
619 Ga0495669_0068775 3300046684 Bacteria 1611
620 Ga0495669_0270088 3300046684 Bacteria 817
621 Ga0495613_0001450 3300046689 Bacteria 18091
622 Ga0495613_0104300 3300046689 Bacteria 2047
623 Ga0495613_0345178 3300046689 Bacteria 1023
624 Ga0495624_0013625 3300046690 Bacteria 5540
625 Ga0495624_0033773 3300046690 Bacteria 3312
626 Ga0495624_0064691 3300046690 Bacteria 2286
627 Ga0495624_0148048 3300046690 Bacteria 1437
628 Ga0495671_0061323 3300046692 Bacteria 1855
629 Ga0495589_0071683 3300046794 Bacteria 1693
630 Ga0495600_0004608 3300046809 Bacteria 8259
631 Ga0495600_0044544 3300046809 Bacteria 2894
632 Ga0495660_0031699 3300046810 Bacteria 2972
633 Ga0495581_0000616 3300047315 Bacteria 18651
634 Ga0495581_0175958 3300047315 Bacteria 1251
635 Ga0495604_0012023 3300047317 Bacteria 6880
636 Ga0495604_0013906 3300047317 Bacteria 6418
637 Ga0495604_0129689 3300047317 Bacteria 1814
638 Ga0495604_0202115 3300047317 Bacteria 1378
639 Ga0495674_0031182 3300047319 Bacteria 4844
640 Ga0495674_0062975 3300047319 Bacteria 3227
641 Ga0495674_0502937 3300047319 Bacteria 969
642 Ga0495672_0022784 3300047320 Bacteria 4064
643 Ga0495676_0075428 3300047321 Bacteria 2579
644 Ga0495676_0103839 3300047321 Bacteria 2097
645 Ga0495676_0167578 3300047321 Bacteria 1548
646 Ga0495680_0036813 3300047322 Bacteria 3924
647 Ga0495680_0126500 3300047322 Bacteria 1882
648 Ga0495683_0060907 3300047323 Bacteria 1869
649 Ga0495675_0056971 3300047444 Bacteria 2477
650 Ga0495677_0057668 3300047445 Bacteria 1436
651 Ga0495673_0036160 3300047469 Bacteria 2268
652 Ga0495684_0096336 3300047471 Bacteria 2239
653 Ga0495686_0048716 3300047472 Bacteria 2670
654 Ga0495593_0001840 3300047673 Bacteria 12620
655 Ga0495593_0034413 3300047673 Bacteria 2756
656 Ga0495593_0114470 3300047673 Bacteria 1375
657 Ga0495614_0032025 3300048089 Bacteria 2263
658 Ga0495615_0034721 3300048090 Bacteria 1229
659 Ga0496100_0006806 3300048903 Bacteria 6263
660 Ga0496100_0580214 3300048903 Bacteria 869
661 Ga0496101_0006165 3300048904 Bacteria 7702
662 Ga0496101_0358481 3300048904 Bacteria 1146
663 Ga0496101_0704687 3300048904 Bacteria 797
664 Ga0496102_0132973 3300048905 Bacteria 2330
665 Ga0496102_0144837 3300048905 Bacteria 2229
666 Ga0496102_0223965 3300048905 Bacteria 1773
667 Ga0496102_0448595 3300048905 Bacteria 1210
668 Ga0496103_0119999 3300048906 Bacteria 1674
669 Ga0496103_0229742 3300048906 Bacteria 1193
670 Ga0496104_0000910 3300048907 Bacteria 25353
671 Ga0496104_0012438 3300048907 Bacteria 7652
672 Ga0496104_0013493 3300048907 Bacteria 7361
673 Ga0496104_0091356 3300048907 Bacteria 2910
674 Ga0496105_0003128 3300048908 Bacteria 12181
675 Ga0496105_0016016 3300048908 Bacteria 5980
676 Ga0496105_0024676 3300048908 Bacteria 4886
677 Ga0496106_0094814 3300048909 Bacteria 2308
678 Ga0496106_0100272 3300048909 Bacteria 2245
679 Ga0496106_0260440 3300048909 Bacteria 1388
680 Ga0496106_0285766 3300048909 Bacteria 1322
681 Ga0496106_0694975 3300048909 Bacteria 811
682 Ga0496107_0006756 3300048910 Bacteria 7894
683 Ga0496107_0022617 3300048910 Bacteria 4442
684 Ga0496107_0234706 3300048910 Bacteria 1365
685 Ga0496108_0058427 3300048911 Bacteria 3242
686 Ga0496108_0080735 3300048911 Bacteria 2755
687 Ga0496108_0115360 3300048911 Bacteria 2300
688 Ga0496109_0012251 3300048912 Bacteria 7401
689 Ga0496109_0036766 3300048912 Bacteria 4421
690 Ga0496109_0183008 3300048912 Bacteria 1968
691 Ga0496110_0010966 3300048913 Bacteria 7393
692 Ga0496110_0085968 3300048913 Bacteria 2807
693 Ga0496110_0189940 3300048913 Bacteria 1865
694 Ga0496110_0233808 3300048913 Bacteria 1672
695 Ga0496110_0476377 3300048913 Bacteria 1137
696 Ga0496111_0001751 3300048914 Bacteria 12708
697 Ga0496111_0059882 3300048914 Bacteria 2759
698 Ga0496111_0062859 3300048914 Bacteria 2692
699 Ga0496111_0435186 3300048914 Bacteria 968
700 Ga0496112_0021056 3300048915 Bacteria 6194
701 Ga0496112_0067380 3300048915 Bacteria 3533
702 Ga0496112_0170569 3300048915 Bacteria 2141
703 Ga0496112_0238288 3300048915 Bacteria 1772
704 Ga0496113_0002276 3300048916 Bacteria 11077
705 Ga0496113_0004412 3300048916 Bacteria 8639
706 Ga0496113_0105391 3300048916 Bacteria 2189
707 Ga0496114_0010524 3300048917 Bacteria 7361
708 Ga0496114_0131636 3300048917 Bacteria 2160
709 Ga0496114_0281216 3300048917 Bacteria 1467
710 Ga0496115_0040869 3300048918 Bacteria 3689
711 Ga0496115_0125567 3300048918 Bacteria 2113
712 Ga0496115_0285721 3300048918 Bacteria 1354
713 Ga0496115_0442979 3300048918 Bacteria 1050
714 Ga0496116_0007166 3300048919 Bacteria 9966
715 Ga0496117_0010482 3300048920 Bacteria 8439
716 Ga0496117_0205457 3300048920 Bacteria 1109
717 Ga0496118_0012639 3300048921 Bacteria 8078
718 Ga0496118_0030456 3300048921 Bacteria 4502
719 Ga0496118_0057504 3300048921 Bacteria 2914
720 Ga0496118_0060167 3300048921 Bacteria 2822
721 Ga0496118_0063458 3300048921 Bacteria 2718
722 Ga0496118_0137899 3300048921 Bacteria 1553
723 Ga0496118_0188523 3300048921 Bacteria 1236
724 Ga0496119_0016794 3300048922 Bacteria 5543
725 Ga0496119_0131648 3300048922 Bacteria 1362
726 Ga0496121_0009821 3300048924 Bacteria 10925
727 Ga0496121_0029337 3300048924 Bacteria 5090
728 Ga0496121_0059339 3300048924 Bacteria 3155
729 Ga0496121_0060976 3300048924 Bacteria 3098
730 Ga0496121_0067720 3300048924 Bacteria 2892
731 Ga0496121_0071517 3300048924 Bacteria 2789
732 Ga0496121_0073226 3300048924 Bacteria 2746
733 Ga0496121_0077173 3300048924 Bacteria 2654
734 Ga0496121_0104194 3300048924 Bacteria 2180
735 Ga0496121_0147166 3300048924 Bacteria 1739
736 Ga0496121_0162358 3300048924 Bacteria 1632
737 Ga0496121_0182643 3300048924 Bacteria 1512
738 Ga0496121_0203003 3300048924 Bacteria 1411
739 Ga0496122_0020194 3300048925 Bacteria 6037
740 Ga0496122_0080310 3300048925 Bacteria 2275
741 Ga0496123_0097332 3300048926 Bacteria 1724
742 Ga0496124_0045957 3300048927 Bacteria 3741
743 Ga0496124_0166781 3300048927 Bacteria 1711
744 Ga0496125_0000193 3300048928 Bacteria 130315
745 Ga0496125_0002779 3300048928 Bacteria 22146
746 Ga0496125_0019119 3300048928 Bacteria 6476
747 Ga0496125_0019478 3300048928 Bacteria 6398
748 Ga0496125_0068128 3300048928 Bacteria 2801
749 Ga0496125_0117763 3300048928 Bacteria 1904
750 Ga0496125_0129759 3300048928 Bacteria 1777
751 Ga0496125_0167425 3300048928 Bacteria 1483
752 Ga0496126_0032255 3300048929 Bacteria 4936
753 Ga0496126_0036714 3300048929 Bacteria 4579
754 Ga0496126_0058700 3300048929 Bacteria 3467
755 Ga0496126_0103014 3300048929 Bacteria 2494
756 Ga0496126_0117962 3300048929 Bacteria 2304
757 Ga0496126_0183200 3300048929 Bacteria 1778
758 Ga0496126_0213270 3300048929 Bacteria 1624
759 Ga0496126_0221419 3300048929 Bacteria 1589
760 Ga0496126_0226709 3300048929 Bacteria 1567
761 Ga0496126_0237581 3300048929 Bacteria 1524
762 Ga0496126_0249872 3300048929 Bacteria 1478
763 Ga0495682_0027232 3300049460 Bacteria 2120
764 Ga0501031_0151703 3300049568 Bacteria 1514
765 Ga0501032_0000316 3300049569 Bacteria 40481
766 Ga0501032_0042912 3300049569 Bacteria 3066
767 Ga0501032_0058602 3300049569 Bacteria 2585
768 Ga0501033_0000025 3300049570 Bacteria 173634
769 Ga0501033_0038723 3300049570 Bacteria 3562
770 Ga0501034_0000656 3300049571 Bacteria 53197
771 Ga0501034_0173429 3300049571 Bacteria 2123
772 Ga0501034_0341578 3300049571 Unclassified 1427
773 Ga0501034_0812560 3300049571 Bacteria 827
774 Ga0501036_0000167 3300049572 Bacteria 43218
775 Ga0501036_0165165 3300049572 Bacteria 1866
776 Ga0501037_0000034 3300049573 Bacteria 126321
777 Ga0501038_0000286 3300049574 Bacteria 43041
778 Ga0501038_0018515 3300049574 Bacteria 6288
779 Ga0501038_0022817 3300049574 Bacteria 5602
780 Ga0501039_0000911 3300049575 Bacteria 21570
781 Ga0501042_0117816 3300049578 Bacteria 1912
782 Ga0501043_0000067 3300049579 Bacteria 93232
783 Ga0501043_0065318 3300049579 Bacteria 2857
784 Ga0501043_0219228 3300049579 Unclassified 1472
785 Ga0501046_0001334 3300049580 Bacteria 23903
786 Ga0501046_0087036 3300049580 Bacteria 2408
787 Ga0501047_0000061 3300049581 Bacteria 137341
788 Ga0501047_0047831 3300049581 Bacteria 4132
789 Ga0501048_0000009 3300049582 Bacteria 84404
790 Ga0501048_0342188 3300049582 Unclassified 1066
791 Ga0501067_0004841 3300049583 Bacteria 7467
792 Ga0501068_0000288 3300049584 Bacteria 25058
793 Ga0501069_0024696 3300049585 Bacteria 3279
794 Ga0501069_0233179 3300049585 Bacteria 1072
795 Ga0501069_0302076 3300049585 Bacteria 939
796 Ga0501070_0022187 3300049586 Bacteria 5317
797 Ga0501070_0056275 3300049586 Bacteria 3260
798 Ga0501070_0122393 3300049586 Bacteria 2150
799 Ga0501070_0434727 3300049586 Bacteria 1059
800 Ga0501070_0438037 3300049586 Bacteria 1054
801 Ga0501071_0414901 3300049587 Bacteria 1029
802 Ga0501072_0002191 3300049588 Bacteria 14598
803 Ga0501073_0001295 3300049589 Bacteria 18379
804 Ga0501074_0000087 3300049590 Bacteria 45234
805 Ga0501074_0453224 3300049590 Bacteria 909
806 Ga0501076_0180637 3300049592 Bacteria 1720
807 Ga0501079_0009245 3300049741 Bacteria 7466
808 Ga0501080_0005794 3300049742 Bacteria 11055
809 Ga0501080_0012943 3300049742 Bacteria 7659
810 Ga0501081_0173687 3300049743 Bacteria 1557
811 Ga0501083_0000296 3300049744 Bacteria 31346
812 Ga0501035_0000300 3300049822 Bacteria 58171
813 Ga0501035_0009838 3300049822 Bacteria 8882
814 Ga0501035_0029017 3300049822 Bacteria 5047
815 Ga0501035_0435841 3300049822 Bacteria 1086
816 Ga0501044_0000028 3300049823 Bacteria 179203
817 Ga0501044_0065656 3300049823 Bacteria 3700
818 Ga0501044_0086033 3300049823 Bacteria 3176
819 Ga0501044_0522834 3300049823 Bacteria 1086
820 Ga0501044_0534962 3300049823 Bacteria 1070
821 Ga0501045_0052327 3300049824 Bacteria 2981
822 nmdc:mga03n38_3620_c1 3300050490 Bacteria 4992
823 nmdc:mga03n38_76714_c1 3300050490 Bacteria 1560
824 nmdc:mga03n38_78915_c1 3300050490 Bacteria 1542
825 nmdc:mga00v17_95080_c1 3300050491 Bacteria 1875
826 nmdc:mga0yw44_1199_c1 3300050492 Bacteria 10137
827 nmdc:mga0yw44_121901_c1 3300050492 Bacteria 1680
828 nmdc:mga0yw44_2647_c1 3300050492 Bacteria 7714
829 nmdc:mga0yw44_46383_c1 3300050492 Bacteria 2609
830 nmdc:mga0k408_125944_c1 3300050493 Bacteria 1519
831 nmdc:mga0k408_313507_c1 3300050493 Bacteria 936
832 nmdc:mga06z11_156582_c1 3300050494 Bacteria 1299
833 nmdc:mga06z11_45687_c1 3300050494 Bacteria 2215
834 nmdc:mga06z11_53715_c1 3300050494 Bacteria 2073
835 nmdc:mga06z11_91961_c1 3300050494 Bacteria 1649
836 nmdc:mga04h51_88939_c1 3300050495 Bacteria 1108
837 nmdc:mga07m45_15311_c1 3300050496 Bacteria 4094
838 nmdc:mga07m45_18086_c1 3300050496 Bacteria 3797
839 nmdc:mga07m45_235550_c1 3300050496 Bacteria 1065
840 nmdc:mga07m45_25681_c1 3300050496 Bacteria 3232
841 nmdc:mga05p37_73875_c1 3300050507 Bacteria 4196
842 nmdc:mga08y16_44326_c1 3300050511 Bacteria 4660
843 nmdc:mga0sz30_101597_c1 3300050516 Bacteria 1256
844 nmdc:mga0sz30_35964_c1 3300050516 Bacteria 2069
845 nmdc:mga0sz30_68597_c1 3300050516 Bacteria 1524
846 Ga0495601_0021920 3300053077 Bacteria 3917
847 Ga0495601_0097602 3300053077 Bacteria 1896
848 Ga0495612_0022752 3300053078 Bacteria 2512
849 Ga0500635_0006885 3300053080 Bacteria 3055
850 Ga0495595_0006758 3300053084 Bacteria 4680
851 Ga0495619_0025581 3300053085 Bacteria 3792
852 Ga0500578_0174010 3300053086 Bacteria 1330
853 Ga0500578_0336986 3300053086 Bacteria 885
854 Ga0500643_004490 3300053087 Bacteria 6292
855 Ga0500643_005916 3300053087 Bacteria 5188
856 Ga0500646_0018011 3300053090 Bacteria 1857
857 Ga0500647_0009885 3300053091 Bacteria 4202
858 Ga0500583_0026675 3300053092 Bacteria 2484
859 Ga0500651_0032312 3300053093 Bacteria 3298
860 Ga0500566_0003707 3300053094 Bacteria 9127
861 Ga0500641_0067588 3300053096 Bacteria 1498
862 Ga0500641_0119778 3300053096 Bacteria 1134
863 Ga0500554_000783 3300053102 Bacteria 6345
864 Ga0500554_005946 3300053102 Bacteria 2705
865 Ga0500556_0000004 3300053104 Bacteria 666287
866 Ga0500556_0169430 3300053104 Bacteria 862
867 Ga0500557_000002 3300053105 Bacteria 234207
868 Ga0500572_001419 3300053111 Bacteria 6581
869 Ga0500592_004019 3300053116 Bacteria 2347
870 Ga0500593_065467 3300053117 Bacteria 1589
871 Ga0500593_149708 3300053117 Bacteria 907
872 Ga0500594_0005689 3300053118 Bacteria 2771
873 Ga0500595_002144 3300053119 Bacteria 10052
874 Ga0500595_005694 3300053119 Bacteria 5401
875 Ga0500595_007592 3300053119 Bacteria 4491
876 Ga0500595_008250 3300053119 Bacteria 4264
877 Ga0500608_001002 3300053122 Bacteria 10150
878 Ga0500618_002460 3300053125 Bacteria 6969
879 Ga0500642_0000010 3300053130 Bacteria 272552
880 Ga0500642_0093190 3300053130 Bacteria 1394
881 Ga0500652_002195 3300053131 Bacteria 5867
882 Ga0500658_0026316 3300053134 Bacteria 2240
883 Ga0500658_0030273 3300053134 Bacteria 2109
884 Ga0500559_0000270 3300053136 Bacteria 40435
885 Ga0500559_0000497 3300053136 Bacteria 27538
886 Ga0500559_0110199 3300053136 Bacteria 1275
887 Ga0500568_0001744 3300053139 Bacteria 13454
888 Ga0500577_0000093 3300053142 Bacteria 21381
889 Ga0500577_0068244 3300053142 Bacteria 1388
890 Ga0500588_0057052 3300053146 Bacteria 1238
891 Ga0500589_077909 3300053147 Bacteria 1484
892 Ga0500590_108884 3300053148 Bacteria 1318
893 Ga0500603_000344 3300053150 Bacteria 12152
894 Ga0500604_0004448 3300053151 Bacteria 3721
895 Ga0500616_0000014 3300053153 Bacteria 637918
896 Ga0500616_0000045 3300053153 Bacteria 339292
897 Ga0500622_0000760 3300053156 Bacteria 28124
898 Ga0500622_0031911 3300053156 Bacteria 2764
899 Ga0500627_0030797 3300053158 Bacteria 2248
900 Ga0500627_0109424 3300053158 Bacteria 1243
901 Ga0500634_0089296 3300053161 Bacteria 1568
902 Ga0500638_000061 3300053162 Bacteria 20033
903 Ga0500639_020444 3300053163 Bacteria 3494
904 Ga0500636_0001565 3300053177 Bacteria 12461
905 Ga0500636_0030800 3300053177 Bacteria 3175
906 Ga0500637_0000259 3300053178 Bacteria 19743
907 Ga0500637_0042034 3300053178 Bacteria 2583
908 Ga0500611_013638 3300053727 Bacteria 1400
909 Ga0500625_004286 3300053729 Bacteria 5801
910 Ga0500645_006318 3300053730 Bacteria 4246
911 Ga0500645_039669 3300053730 Bacteria 1394
912 Ga0500609_019591 3300053731 Bacteria 922
913 Ga0500596_006591 3300053735 Bacteria 1953
914 Ga0501084_0007246 3300054114 Bacteria 9144
915 Ga0501082_0117245 3300060353 Bacteria 2306
916 Ga0530510_0260690 3300061734 Bacteria 1293
917 2511394052 2511231028 Bacteria 8046582
918 2513625901 2513237092 Bacteria 8341956
919 2513639224 2513237094 Bacteria 8789602
920 2513654262 2513237096 Bacteria 8722461
921 2513676995 2513237098 Bacteria 9902361
922 2513692297 2513237101 Bacteria 7952346
923 2513699220 2513237102 Bacteria 7703324
924 2513858044 2513237137 Bacteria 9558895
925 2513872540 2513237139 Bacteria 8737671
926 2513894856 2513237141 Bacteria 8496279
927 2513915559 2513237145 Bacteria 8979722
928 2514012084 2513237161 Bacteria 8871253
929 2517892866 2517572143 Bacteria 9484767
930 2524442252 2524023205 Bacteria 8918781
931 2524464202 2524023210 Bacteria 9029266
932 2524540728 2524023228 Bacteria 10118060
933 2603859237 2602042107 Bacteria 6226103
934 2617348761 2617270735 Bacteria 9163226
935 2617376022 2617270741 Bacteria 8201522
936 2671117557 2667528175 Bacteria 7532676
937 2723845341 2721755755 Bacteria 8322773
938 2728751646 2728368998 Bacteria 8720350
939 2745080049 2744054633 Bacteria 8678936
940 2793064136 2791355196 Bacteria 7323613
941 2793068170 2791355197 Bacteria 8420563
942 2793083468
943 2805917873 2802429603 Bacteria 8777136
944 2824604735 2824600985 Bacteria 8488197
945 2824615226 2824609381 Bacteria 8672835
946 2824622708 2824617872 Bacteria 8814715
947 2824631843 2824626560 Bacteria 8813858
948 2824639062 2824635225 Bacteria 8785348
949 2824649391 2824644064 Bacteria 8743947
950 2824655937 2824653114 Bacteria 8493680
951 2824673895 2824671348 Bacteria 8369588
952 2824683211 2824679649 Bacteria 8248951
953 2824690470 2824687955 Bacteria 8360029
954 2824698249 2824696289 Bacteria 8335049
955 2824719205 2824714736 Bacteria 8717648
956 2824729658 2824723954 Bacteria 8758240
957 2824734768 2824732956 Bacteria 7810675
958 2824749357 2824746037 Bacteria 7911610
959 2824761189 2824753945 Bacteria 9787441
960 2824770180 2824763712 Bacteria 9792355
961 2824776544 2824773399 Bacteria 8360218
962 2838124010 2838122688 Bacteria 8803140
963 2841943862 2841941048 Bacteria 8688029
964 2841950111 2841949485 Bacteria 8680857
965 2841966504 2841966195 Bacteria 8673214
966 2841975239 2841974524 Bacteria 8931498
967 2841983191 2841983080 Bacteria 8395090
968 2842039318 2842038055 Bacteria 8002051
969 2842047736 2842045827 Bacteria 8006841
970 2844318852 2844315083 Bacteria 8138177
971 2847935906 2847930680 Bacteria 9342022
972 2847946313 2847939898 Bacteria 8606328
973 2849079548 2849076700 Bacteria 7039503
974 2857529355 2857524615 Bacteria 6615449
975 2874608761 2874604998 Bacteria 7834745
976 2874616058 2874612657 Bacteria 8252029
977 2874627368 2874620515 Bacteria 8290088
978 2874629889 2874628541 Bacteria 8630250
979 2876812201 2876808645 Bacteria 8824342
980 2879085292 2879083081 Bacteria 8587928
981 2879103782 2879099564 Bacteria 10442239
982 2879111451 2879110137 Bacteria 8907982
983 2881371662 2881364244 Bacteria 7710352
984 2881669446 2881665667 Bacteria 8175609
985 2885372261 2885366525 Bacteria 8326213
986 2885387534 2885383462 Bacteria 9473874
987 2885412524 2885409591 Bacteria 9235467
988 2888424246 2888419890 Bacteria 7857137
989 2889040089 2889033259 Bacteria 9099371
990 2893071479 2893066018 Bacteria 6158120
991 2903732589 2903727486 Bacteria 8281579
992 2903757829 2903748898 Bacteria 9972761
993 2903769219 2903768456 Bacteria 9749579
994 2904696180 2904690495 Bacteria 9412302
995 2904703054
996 2904720797 2904711408 Bacteria 9771557
997 2906610266 2906602504 Bacteria 8295279
998 2906618077
999 2906629966 2906626472 Bacteria 8826946
1000 2906639402 2906635258 Bacteria 8601019
1001 2906646762 2906643746 Bacteria 8722424
1002 2908743294 2908739725 Bacteria 8628932
1003 2908779899 2908775508 Bacteria 8092255
1004 2919079518 2919073203 Bacteria 6531949
1005 2922365120 2922361189 Bacteria 7436256
1006 2922374074
1007 2922397792 2922393267 Bacteria 8285685
1008 2922429996
1009 2929617803 2929615660 Bacteria 9193770
1010 2929627484 2929624759 Bacteria 9339455
1011 2932800578 2932794094 Bacteria 7915132
1012 2932803062 2932801729 Bacteria 7987968
1013 2932821421 2932818245 Bacteria 9955613
1014 2933579735 2933577622 Bacteria 9116884
1015 2935633562 2935630451 Bacteria 8169952
1016 2935707056 2935703347 Bacteria 10242284
1017 2935762823 2935760218 Bacteria 9817913
1018 2935775087 2935769743 Bacteria 7878163
1019 2935782721 2935777560 Bacteria 8077691
1020 2935791696 2935785616 Bacteria 7962367
1021 2935800072 2935793552 Bacteria 8012592
1022 2935885401 2935883170 Bacteria 7964738
1023 2935959886 2935959822 Bacteria 7869783
1024 2936009557 2936002035 Bacteria 9362176
1025 2941510453 2941507105 Bacteria 8166816
1026 2941517810 2941515067 Bacteria 8166720
1027 2941525826 2941523033 Bacteria 8169134
1028 2941538088 2941531003 Bacteria 7653939
1029 3005487109 3005483717 Bacteria 7877331
1030 3005590170 3005587118 Bacteria 7794411
1031 3005598994 3005594810 Bacteria 8716512
1032 3005722089 3005718088 Bacteria 8283608
1033 8006941370 8006933436 Bacteria 10410654
1034 8006965510 8006964411 Bacteria 8966052
1035 8006981008 8006973647 Bacteria 10679141
1036 8006993574 8006984368 Bacteria 9651211
1037 8007000548 8006994254 Bacteria 8309700
1038 8016529923 8016522445 Bacteria 8156687
1039 8016548365 8016539877 Bacteria 8155419
1040 8016553763 8016548790 Bacteria 8155074
1041 8016562139 8016557553 Bacteria 8154380
1042 8016592196 8016583857 Bacteria 10421953
1043 8016610849 8016603502 Bacteria 8731218
1044 8016614118 8016613128 Bacteria 8794220
1045 8016626938 8016622563 Bacteria 7999408
1046 8019534912 8019530166 Bacteria 8155624
1047 8019544560 8019538911 Bacteria 7872763
1048 8019554037 8019547302 Bacteria 7996444
1049 8019568015 8019565922 Bacteria 9639779
1050 8019658113 8019648815 Bacteria 10014479
1051 8055746606 8055742211 Bacteria 9226248
1052 8056674100 8056673599 Bacteria 7871253
1053 8056693722 8056689827 Bacteria 6712655
1054 8056973235 8056967851 Bacteria 9038162
1055 Ga0207683_10260014
1056 JGI25406J46586_10000004
1057 JGI25406J46586_10001469
1058 JGI25153J46596_10000463
1059 JGI25153J46596_10019947
1060 JGI25153J46596_10052453
1061 JGI25160J50197_1000944
1062 JGI25160J50197_1001153
1063 JGI25160J50197_1019480
1064 JGI25404J52841_10012581
1065 Ga0055526_1033155
1066 Ga0055531_10004647
1067 Ga0055543_1003106
1068 Ga0065165_1000827
1069 Ga0065165_1002442
1070 Ga0070658_10035233
1071 Ga0070658_10084881
1072 Ga0070683_100007459
1073 Ga0070683_100363172
1074 Ga0070683_100472771
1075 Ga0070690_100060133
1076 Ga0070690_100084577
1077 Ga0070670_100222630
1078 Ga0070670_100403609
1079 Ga0068869_100017742
1080 Ga0068869_100049759
1081 Ga0068869_100086456
1082 Ga0068869_100195972
1083 Ga0070680_100013470
1084 Ga0070680_100040467
1085 Ga0070680_100435326
1086 Ga0070682_100012251
1087 Ga0070682_100455676
1088 Ga0068868_100070436
1089 Ga0068868_100090424
1090 Ga0068868_100204814
1091 Ga0068868_100252213
1092 Ga0070660_100016544
1093 Ga0070660_100230002
1094 Ga0070691_10022588
1095 Ga0070668_100008017
1096 Ga0070668_100020107
1097 Ga0070668_100098269
1098 Ga0070669_100084511
1099 Ga0070674_100132152
1100 Ga0070673_100098113
1101 Ga0070688_100355937
1102 Ga0070659_100046983
1103 Ga0070667_100239226
1104 Ga0070709_10007867
1105 Ga0070714_100006414
1106 Ga0070714_100229953
1107 Ga0070713_100034134
1108 Ga0070713_100164729
1109 Ga0070710_10001599
1110 Ga0070711_100002859
1111 Ga0070700_100154114
1112 Ga0070663_100038501
1113 Ga0070663_100101796
1114 Ga0070663_100101922
1115 Ga0070663_100547016
1116 Ga0070678_100048432
1117 Ga0070678_100071013
1118 Ga0070678_100193321
1119 Ga0070662_100072628
1120 Ga0070662_100094935
1121 Ga0070681_10030820
1122 Ga0070681_10087520
1123 Ga0068867_100163683
1124 Ga0070698_100277447
1125 Ga0070698_100394669
1126 Ga0070679_100029787
1127 Ga0070679_100063963
1128 Ga0070679_100629936
1129 Ga0070684_100181901
1130 Ga0068853_100075347
1131 Ga0068853_100113730
1132 Ga0068853_100122034
1133 Ga0068853_100560707
1134 Ga0070672_100098199
1135 Ga0070696_100150358
1136 Ga0070693_100024115
1137 Ga0070665_100014274
1138 Ga0070665_100022844
1139 Ga0070665_100038210
1140 Ga0070665_100087098
1141 Ga0070665_100106474
1142 Ga0070665_100106784
1143 Ga0070665_100154626
1144 Ga0070665_100656993
1145 Ga0068855_100012380
1146 Ga0068855_100025899
1147 Ga0068855_100069359
1148 Ga0068855_100109901
1149 Ga0068855_100299582
1150 Ga0068855_100341218
1151 Ga0070664_100600058
1152 Ga0068857_100048805
1153 Ga0068856_100109797
1154 Ga0068856_100197926
1155 Ga0068856_100250053
1156 Ga0068856_100256162
1157 Ga0068856_100365537
1158 Ga0068852_100005825
1159 Ga0068852_100078635
1160 Ga0068852_100087601
1161 Ga0068859_100158578
1162 Ga0068859_100255646
1163 Ga0068859_100315251
1164 Ga0068859_100315975
1165 Ga0068864_100015373
1166 Ga0068861_100096843
1167 Ga0068861_100124590
1168 Ga0068861_100145597
1169 Ga0068851_10022519
1170 Ga0068870_10057800
1171 Ga0068870_10279201
1172 Ga0068863_100136826
1173 Ga0068858_100175907
1174 Ga0068858_100325823
1175 Ga0068858_100402352
1176 Ga0068860_100021469
1177 Ga0068862_100046654
1178 Ga0068862_100071298
1179 Ga0068862_100313727
1180 Ga0081455_10001830
1181 Ga0081455_10002668
1182 Ga0081455_10018581
1183 Ga0081540_1000972
1184 Ga0081540_1001974
1185 Ga0081540_1002258
1186 Ga0081540_1006693
1187 Ga0081540_1011616
1188 Ga0081540_1013186
1189 Ga0081540_1034122
1190 Ga0081540_1035077
1191 Ga0081539_10000080
1192 Ga0081539_10000258
1193 Ga0070717_10258175
1194 Ga0075365_10005896
1195 Ga0075365_10092352
1196 Ga0075365_10145967
1197 Ga0075365_10290388
1198 Ga0075368_10004517
1199 Ga0075363_100011482
1200 Ga0075363_100056983
1201 Ga0075363_100111360
1202 Ga0075364_10041807
1203 Ga0075364_10061945
1204 Ga0075364_10129592
1205 Ga0075364_10289799
1206 Ga0075432_10051891
1207 Ga0070716_100003186
1208 Ga0075367_10049645
1209 Ga0075367_10056939
1210 Ga0075367_10070969
1211 Ga0075367_10079211
1212 Ga0075367_10149116
1213 Ga0075367_10240766
1214 Ga0075367_10267912
1215 Ga0075369_10024802
1216 Ga0075369_10032539
1217 Ga0075366_10023669
1218 Ga0075366_10088393
1219 Ga0097621_100035680
1220 Ga0097621_100181450
1221 Ga0075370_10214280
1222 Ga0068871_100035610
1223 Ga0068871_100060406
1224 Ga0075428_100051246
1225 Ga0075431_100755130
1226 Ga0075434_100216753
1227 Ga0068865_100374307
1228 Ga0097620_100158568
1229 Ga0097620_100255626
1230 Ga0097620_100315266
1231 Ga0097620_100315999
1232 Ga0099825_1034265
1233 Ga0099824_1022323
1234 Ga0099823_1045384
1235 Ga0075435_100059291
1236 Ga0099794_10091128
1237 Ga0099795_10023245
1238 Ga0105240_10021770
1239 Ga0105240_10071789
1240 Ga0105240_10369259
1241 Ga0105240_10408789
1242 Ga0105240_10567438
1243 Ga0105245_10024107
1244 Ga0105245_10045829
1245 Ga0105247_10024859
1246 Ga0105247_10032207
1247 Ga0105247_10034493
1248 Ga0105247_10154672
1249 Ga0114129_10405345
1250 Ga0105243_10052397
1251 Ga0105243_10110292
1252 Ga0105243_10165898
1253 Ga0105241_10034659
1254 Ga0105241_10360080
1255 Ga0105242_10026888
1256 Ga0105248_10032697
1257 Ga0105248_10173110
1258 Ga0105248_10316805
1259 Ga0105248_10441997
1260 Ga0105248_11020153
1261 Ga0105237_10003509
1262 Ga0105237_10015328
1263 Ga0105237_10476001
1264 Ga0105238_10115791
1265 Ga0105238_10129316
1266 Ga0105238_10572134
1267 Ga0105249_10151212
1268 Ga0105249_10539080
1269 Ga0099796_10149101
1270 Ga0105239_10158550
1271 Ga0105239_10168078
1272 Ga0105239_10246110
1273 Ga0105246_10049309
1274 Ga0157370_10149402
1275 Ga0157370_10251364
1276 Ga0157369_10010002
1277 Ga0157369_10011845
1278 Ga0157369_10258842
1279 Ga0157369_10555062
1280 Ga0157374_10101959
1281 Ga0157378_10033821
1282 Ga0163162_10063107
1283 Ga0157372_10794743
1284 Ga0157375_10037811
1285 Ga0157375_10073870
1286 Ga0157375_10243208
1287 Ga0163163_10030215
1288 Ga0163163_10455911
1289 Ga0163163_10841012
1290 Ga0157377_10103187
1291 Ga0157379_10279345
1292 Ga0157379_10281907
1293 Ga0157379_10585832
1294 Ga0157376_10017507
1295 Ga0157376_10026485
1296 Ga0163161_10060641
1297 Ga0214544_1000002
1298 Ga0214542_1001264
1299 Ga0214545_1000018
1300 Ga0214543_1000001
1301 Ga0213873_10013166
1302 Ga0213876_10005326
1303 Ga0213876_10040946
1304 Ga0209148_1002137
1305 Ga0209148_1004590
1306 Ga0209233_1000762
1307 Ga0209233_1018116
1308 Ga0209455_1000765
1309 Ga0209564_1008133
1310 Ga0209758_1000021
1311 Ga0209758_1000872
1312 Ga0209758_1002408
1313 Ga0209256_1008459
1314 Ga0207426_1000143
1315 Ga0207426_1001632
1316 Ga0207426_1004444
1317 Ga0207426_1014679
1318 Ga0207426_1038939
1319 Ga0209257_1000455
1320 Ga0207697_10020260
1321 Ga0207697_10178552
1322 Ga0207656_10053596
1323 Ga0207692_10000379
1324 Ga0207710_10028257
1325 Ga0207710_10044276
1326 Ga0207710_10093738
1327 Ga0207688_10086641
1328 Ga0207680_10033270
1329 Ga0207699_10000287
1330 Ga0207645_10079549
1331 Ga0207705_10038383
1332 Ga0207705_10288391
1333 Ga0207654_10017381
1334 Ga0207707_10000501
1335 Ga0207707_10003471
1336 Ga0207707_10440317
1337 Ga0207695_10000015
1338 Ga0207695_10073452
1339 Ga0207671_10033502
1340 Ga0207671_10040790
1341 Ga0207671_10145723
1342 Ga0207671_10239363
1343 Ga0207671_10268601
1344 Ga0207671_10345675
1345 Ga0207693_10073242
1346 Ga0207663_10010587
1347 Ga0207660_10073774
1348 Ga0207662_10020015
1349 Ga0207657_10001475
1350 Ga0207657_10002963
1351 Ga0207652_10003834
1352 Ga0207652_10099140
1353 Ga0207652_10148678
1354 Ga0207652_10159934
1355 Ga0207681_10389105
1356 Ga0207694_10003249
1357 Ga0207694_10117247
1358 Ga0207650_10070039
1359 Ga0207687_10008902
1360 Ga0207687_10151058
1361 Ga0207700_10256766
1362 Ga0207700_10412640
1363 Ga0207664_10004282
1364 Ga0207690_10029436
1365 Ga0207706_10081026
1366 Ga0207706_10097002
1367 Ga0207709_10023303
1368 Ga0207709_10076583
1369 Ga0207709_10187642
1370 Ga0207669_10019314
1371 Ga0207704_10093011
1372 Ga0207665_10020993
1373 Ga0207691_10104145
1374 Ga0207691_10134757
1375 Ga0207691_10310177
1376 Ga0207711_10095783
1377 Ga0207711_10247117
1378 Ga0207711_10249067
1379 Ga0207711_10385422
1380 Ga0207689_10034405
1381 Ga0207689_10052325
1382 Ga0207689_10121138
1383 Ga0207661_10053145
1384 Ga0207679_10121406
1385 Ga0207667_10030873
1386 Ga0207667_10156664
1387 Ga0207667_10173680
1388 Ga0207667_10191873
1389 Ga0207667_10375981
1390 Ga0207668_10010376
1391 Ga0207668_10069453
1392 Ga0207668_10184966
1393 Ga0207668_10371940
1394 Ga0207640_10151108
1395 Ga0207640_10165474
1396 Ga0207640_10256856
1397 Ga0207658_10074032
1398 Ga0207658_10286445
1399 Ga0207677_10089757
1400 Ga0207703_10067997
1401 Ga0207703_10085526
1402 Ga0207703_10085864
1403 Ga0207703_10436856
1404 Ga0207639_10014370
1405 Ga0207678_10021377
1406 Ga0207678_10028254
1407 Ga0207678_10029595
1408 Ga0207678_10030828
1409 Ga0207678_10036237
1410 Ga0207678_10081133
1411 Ga0207678_10125393
1412 Ga0207702_10109231
1413 Ga0207702_10204650
1414 Ga0207702_10431909
1415 Ga0207702_10490602
1416 Ga0207641_10329265
1417 Ga0207648_10345973
1418 Ga0207676_10039988
1419 Ga0207674_10074759
1420 Ga0207675_100042862
1421 Ga0207675_100132002
1422 Ga0207675_100169161
1423 Ga0207675_100205614
1424 Ga0207675_100312972
1425 Ga0207683_10093042
1426 Ga0207683_10113354
1427 Ga0207683_10193808
1428 Ga0207683_10712395
1429 Ga0207698_10060792
1430 Ga0207698_10275838
1431 Ga0207698_10372096
1432 Ga0207698_10421970
1433 Ga0209389_1000128
1434 Ga0209389_1000178
1435 Ga0209589_1000003
1436 Ga0209589_1000180
1437 Ga0209489_100003
1438 Ga0209489_100031
1439 Ga0209489_101761
1440 Ga0209700_100003
1441 Ga0209700_100010
1442 Ga0209588_1049817
1443 Ga0209813_10022991
1444 Ga0207428_10051723
1445 Ga0268266_10001640
1446 Ga0268266_10007119
1447 Ga0268266_10034322
1448 Ga0268266_10145895
1449 Ga0268266_10149534
1450 Ga0268266_10202671
1451 Ga0268266_10295623
1452 Ga0268266_10452378
1453 Ga0268265_10025802
1454 Ga0268265_10080899
1455 Ga0268265_10093124
1456 Ga0268264_10046637
1457 Ga0268264_10052992
1458 Ga0268264_10468684
1459 Ga0307517_10000053
1460 Ga0307517_10161525
1461 Ga0307515_10026351
1462 Ga0307515_10118139
1463 Ga0265325_10000126
1464 Ga0265339_10085714
1465 Ga0307513_10029449
1466 Ga0307509_10273370
1467 Ga0307408_100321774
1468 Ga0307408_100487276
1469 Ga0307408_100631066
1470 Ga0307508_10097004
1471 Ga0307508_10097437
1472 Ga0307508_10269467
1473 Ga0265314_10008935
1474 Ga0307516_10006636
1475 Ga0307516_10006657
1476 Ga0307405_10313624
1477 Ga0307410_10171836
1478 Ga0307407_10400961
1479 Ga0307412_10169806
1480 Ga0307409_100272471
1481 Ga0307415_100077142
1482 Ga0307507_10207522
1483 Ga0307510_10004835
1484 Ga0307510_10022778
1485 Ga0307510_10024452
1486 Ga0315911_1000001
1487 Ga0373930_0011070
1488 Ga0373926_0000472
1489 Ga0373928_0005986
1490 Ga0373934_0034905
1491 Ga0373944_0007573
1492 Ga0373923_0000912
1493 Ga0373923_0067699
1494 Ga0373932_0075339
1495 Ga0373936_0020644
1496 Ga0373953_0046512
1497 Ga0373954_0010502
1498 Ga0373954_0023710
1499 Ga0373954_0119372
1500 Ga0373956_0032430
1501 Ga0373956_0063147
1502 Ga0373957_0010926
1503 Ga0373946_0010039
1504 Ga0373955_0012670
1505 Ga0373955_0085480
1506 Ga0373924_0044816
1507 Ga0373931_0002137
1508 Ga0373935_0032612
1509 Ga0373927_0021602
1510 Ga0373927_0028111
1511 Ga0373927_0033709
1512 Ga0373927_0053158
1513 Ga0373927_0165658
1514 Ga0373933_0039329
1515 Ga0373947_0004430
1516 Ga0373947_0005252
1517 Ga0373947_0027527
1518 Ga0373947_0162528
1519 Ga0373947_0243772
1520 Ga0373937_0025215
1521 Ga0373937_0067677
1522 Ga0373937_0357191
1523 Ga0373925_0003114
1524 Ga0395899_0124858
1525 Ga0395900_0087362
1526 Ga0395900_0174996
1527 Ga0395898_0048964
1528 Ga0395898_0052583
1529 Ga0395898_0211290
1530 Ga0395898_0223014
1531 Ga0395905_0023884
1532 Ga0395905_0081159
1533 Ga0395905_0138992
1534 Ga0395901_0165219
1535 Ga0395901_0261040
1536 Ga0395901_0448830
1537 Ga0395901_0519884
1538 Ga0395901_0557779
1539 Ga0436365_0902823
1540 Ga0436363_1666451
1541 Ga0439465_0051685
1542 Ga0466972_0000194
1543 Ga0466972_0011625
1544 Ga0466961_0270383
1545 Ga0466968_0133519
1546 Ga0466959_0340570
1547 Ga0466967_0294154
1548 Ga0495627_030147
1549 Ga0495592_0002783
1550 Ga0495592_0019159
1551 Ga0495603_0000307
1552 Ga0495603_0011723
1553 Ga0495603_0017347
1554 Ga0495603_0018884
1555 Ga0495603_0124495
1556 Ga0495590_0017084
1557 Ga0495629_0000861
1558 Ga0495629_0014347
1559 Ga0495629_0016618
1560 Ga0495638_0033426
1561 Ga0495638_0050883
1562 Ga0495641_0034030
1563 Ga0495651_0014453
1564 Ga0495651_0080369
1565 Ga0495651_0270150
1566 Ga0495653_0075206
1567 Ga0495650_0034690
1568 Ga0495580_0098255
1569 Ga0495580_0186993
1570 Ga0495582_0000147
1571 Ga0495582_0123411
1572 Ga0495605_0038596
1573 Ga0495605_0045457
1574 Ga0495639_0000859
1575 Ga0495639_0043145
1576 Ga0495662_0000336
1577 Ga0495664_0001521
1578 Ga0495664_0012478
1579 Ga0495664_0016976
1580 Ga0495664_0042410
1581 Ga0495664_0183075
1582 Ga0495664_0184523
1583 Ga0495584_0039447
1584 Ga0495585_0073901
1585 Ga0495594_0001322
1586 Ga0495594_0032935
1587 Ga0495596_0140990
1588 Ga0495583_0074415
1589 Ga0495606_0108428
1590 Ga0495606_0140645
1591 Ga0495608_0193882
1592 Ga0495610_0040037
1593 Ga0495610_0140031
1594 Ga0495616_0039881
1595 Ga0495616_0050544
1596 Ga0495618_0048071
1597 Ga0495618_0375102
1598 Ga0495620_0115094
1599 Ga0495620_0155557
1600 Ga0495628_0104287
1601 Ga0495630_0031079
1602 Ga0495630_0106553
1603 Ga0495630_0234335
1604 Ga0495631_0075131
1605 Ga0495632_0039248
1606 Ga0495632_0045264
1607 Ga0495643_0047911
1608 Ga0495643_0064591
1609 Ga0495644_0023320
1610 Ga0495644_0027455
1611 Ga0495648_0031673
1612 Ga0495648_0044017
1613 Ga0495663_0020127
1614 Ga0495666_0011724
1615 Ga0495666_0054838
1616 Ga0495652_0033352
1617 Ga0495652_0080909
1618 Ga0495652_0172649
1619 Ga0495654_0060198
1620 Ga0495654_0063347
1621 Ga0495665_0000451
1622 Ga0495665_0002906
1623 Ga0495640_0008070
1624 Ga0495640_0015546
1625 Ga0495640_0045053
1626 Ga0495587_0078247
1627 Ga0495587_0123442
1628 Ga0495587_0149797
1629 Ga0495598_0005334
1630 Ga0495609_0019055
1631 Ga0495609_0137577
1632 Ga0495597_0037295
1633 Ga0495597_0105088
1634 Ga0495645_0026504
1635 Ga0495645_0082984
1636 Ga0495633_0026103
1637 Ga0495633_0107963
1638 Ga0495667_0010280
1639 Ga0495667_0019151
1640 Ga0495667_0114351
1641 Ga0495656_0012129
1642 Ga0495656_0100656
1643 Ga0495668_0066116
1644 Ga0495668_0192136
1645 Ga0495634_0003445
1646 Ga0495634_0072360
1647 Ga0495634_0094907
1648 Ga0495634_0130633
1649 Ga0495611_0032147
1650 Ga0495625_0098561
1651 Ga0495625_0197820
1652 Ga0495625_0301182
1653 Ga0495635_0000676
1654 Ga0495635_0001465
1655 Ga0495635_0020344
1656 Ga0495659_0176584
1657 Ga0495661_0093395
1658 Ga0495661_0143882
1659 Ga0495661_0190914
1660 Ga0495588_0032506
1661 Ga0495657_0022346
1662 Ga0495657_0083592
1663 Ga0495599_0008614
1664 Ga0495599_0102947
1665 Ga0495623_0013959
1666 Ga0495623_0197892
1667 Ga0495646_0010772
1668 Ga0495646_0262870
1669 Ga0495647_0013962
1670 Ga0495658_0002190
1671 Ga0495658_0009128
1672 Ga0495669_0010132
1673 Ga0495669_0068775
1674 Ga0495669_0270088
1675 Ga0495613_0001450
1676 Ga0495613_0104300
1677 Ga0495613_0345178
1678 Ga0495624_0013625
1679 Ga0495624_0033773
1680 Ga0495624_0064691
1681 Ga0495624_0148048
1682 Ga0495671_0061323
1683 Ga0495589_0071683
1684 Ga0495600_0004608
1685 Ga0495600_0044544
1686 Ga0495660_0031699
1687 Ga0495581_0000616
1688 Ga0495581_0175958
1689 Ga0495604_0012023
1690 Ga0495604_0013906
1691 Ga0495604_0129689
1692 Ga0495604_0202115
1693 Ga0495674_0031182
1694 Ga0495674_0062975
1695 Ga0495674_0502937
1696 Ga0495672_0022784
1697 Ga0495676_0075428
1698 Ga0495676_0103839
1699 Ga0495676_0167578
1700 Ga0495680_0036813
1701 Ga0495680_0126500
1702 Ga0495683_0060907
1703 Ga0495675_0056971
1704 Ga0495677_0057668
1705 Ga0495673_0036160
1706 Ga0495684_0096336
1707 Ga0495686_0048716
1708 Ga0495593_0001840
1709 Ga0495593_0034413
1710 Ga0495593_0114470
1711 Ga0495614_0032025
1712 Ga0495615_0034721
1713 Ga0496100_0006806
1714 Ga0496100_0580214
1715 Ga0496101_0006165
1716 Ga0496101_0358481
1717 Ga0496101_0704687
1718 Ga0496102_0132973
1719 Ga0496102_0144837
1720 Ga0496102_0223965
1721 Ga0496102_0448595
1722 Ga0496103_0119999
1723 Ga0496103_0229742
1724 Ga0496104_0000910
1725 Ga0496104_0012438
1726 Ga0496104_0013493
1727 Ga0496104_0091356
1728 Ga0496105_0003128
1729 Ga0496105_0016016
1730 Ga0496105_0024676
1731 Ga0496106_0094814
1732 Ga0496106_0100272
1733 Ga0496106_0260440
1734 Ga0496106_0285766
1735 Ga0496106_0694975
1736 Ga0496107_0006756
1737 Ga0496107_0022617
1738 Ga0496107_0234706
1739 Ga0496108_0058427
1740 Ga0496108_0080735
1741 Ga0496108_0115360
1742 Ga0496109_0012251
1743 Ga0496109_0036766
1744 Ga0496109_0183008
1745 Ga0496110_0010966
1746 Ga0496110_0085968
1747 Ga0496110_0189940
1748 Ga0496110_0233808
1749 Ga0496110_0476377
1750 Ga0496111_0001751
1751 Ga0496111_0059882
1752 Ga0496111_0062859
1753 Ga0496111_0435186
1754 Ga0496112_0021056
1755 Ga0496112_0067380
1756 Ga0496112_0170569
1757 Ga0496112_0238288
1758 Ga0496113_0002276
1759 Ga0496113_0004412
1760 Ga0496113_0105391
1761 Ga0496114_0010524
1762 Ga0496114_0131636
1763 Ga0496114_0281216
1764 Ga0496115_0040869
1765 Ga0496115_0125567
1766 Ga0496115_0285721
1767 Ga0496115_0442979
1768 Ga0496116_0007166
1769 Ga0496117_0010482
1770 Ga0496117_0205457
1771 Ga0496118_0012639
1772 Ga0496118_0030456
1773 Ga0496118_0057504
1774 Ga0496118_0060167
1775 Ga0496118_0063458
1776 Ga0496118_0137899
1777 Ga0496118_0188523
1778 Ga0496119_0016794
1779 Ga0496119_0131648
1780 Ga0496121_0009821
1781 Ga0496121_0029337
1782 Ga0496121_0059339
1783 Ga0496121_0060976
1784 Ga0496121_0067720
1785 Ga0496121_0071517
1786 Ga0496121_0073226
1787 Ga0496121_0077173
1788 Ga0496121_0104194
1789 Ga0496121_0147166
1790 Ga0496121_0162358
1791 Ga0496121_0182643
1792 Ga0496121_0203003
1793 Ga0496122_0020194
1794 Ga0496122_0080310
1795 Ga0496123_0097332
1796 Ga0496124_0045957
1797 Ga0496124_0166781
1798 Ga0496125_0000193
1799 Ga0496125_0002779
1800 Ga0496125_0019119
1801 Ga0496125_0019478
1802 Ga0496125_0068128
1803 Ga0496125_0117763
1804 Ga0496125_0129759
1805 Ga0496125_0167425
1806 Ga0496126_0032255
1807 Ga0496126_0036714
1808 Ga0496126_0058700
1809 Ga0496126_0103014
1810 Ga0496126_0117962
1811 Ga0496126_0183200
1812 Ga0496126_0213270
1813 Ga0496126_0221419
1814 Ga0496126_0226709
1815 Ga0496126_0237581
1816 Ga0496126_0249872
1817 Ga0495682_0027232
1818 Ga0501031_0151703
1819 Ga0501032_0000316
1820 Ga0501032_0042912
1821 Ga0501032_0058602
1822 Ga0501033_0000025
1823 Ga0501033_0038723
1824 Ga0501034_0000656
1825 Ga0501034_0173429
1826 Ga0501034_0341578
1827 Ga0501034_0812560
1828 Ga0501036_0000167
1829 Ga0501036_0165165
1830 Ga0501037_0000034
1831 Ga0501038_0000286
1832 Ga0501038_0018515
1833 Ga0501038_0022817
1834 Ga0501039_0000911
1835 Ga0501042_0117816
1836 Ga0501043_0000067
1837 Ga0501043_0065318
1838 Ga0501043_0219228
1839 Ga0501046_0001334
1840 Ga0501046_0087036
1841 Ga0501047_0000061
1842 Ga0501047_0047831
1843 Ga0501048_0000009
1844 Ga0501048_0342188
1845 Ga0501067_0004841
1846 Ga0501068_0000288
1847 Ga0501069_0024696
1848 Ga0501069_0233179
1849 Ga0501069_0302076
1850 Ga0501070_0022187
1851 Ga0501070_0056275
1852 Ga0501070_0122393
1853 Ga0501070_0434727
1854 Ga0501070_0438037
1855 Ga0501071_0414901
1856 Ga0501072_0002191
1857 Ga0501073_0001295
1858 Ga0501074_0000087
1859 Ga0501074_0453224
1860 Ga0501076_0180637
1861 Ga0501079_0009245
1862 Ga0501080_0005794
1863 Ga0501080_0012943
1864 Ga0501081_0173687
1865 Ga0501083_0000296
1866 Ga0501035_0000300
1867 Ga0501035_0009838
1868 Ga0501035_0029017
1869 Ga0501035_0435841
1870 Ga0501044_0000028
1871 Ga0501044_0065656
1872 Ga0501044_0086033
1873 Ga0501044_0522834
1874 Ga0501044_0534962
1875 Ga0501045_0052327
1876 nmdc:mga03n38_3620_c1
1877 nmdc:mga03n38_76714_c1
1878 nmdc:mga03n38_78915_c1
1879 nmdc:mga00v17_95080_c1
1880 nmdc:mga0yw44_1199_c1
1881 nmdc:mga0yw44_121901_c1
1882 nmdc:mga0yw44_2647_c1
1883 nmdc:mga0yw44_46383_c1
1884 nmdc:mga0k408_125944_c1
1885 nmdc:mga0k408_313507_c1
1886 nmdc:mga06z11_156582_c1
1887 nmdc:mga06z11_45687_c1
1888 nmdc:mga06z11_53715_c1
1889 nmdc:mga06z11_91961_c1
1890 nmdc:mga04h51_88939_c1
1891 nmdc:mga07m45_15311_c1
1892 nmdc:mga07m45_18086_c1
1893 nmdc:mga07m45_235550_c1
1894 nmdc:mga07m45_25681_c1
1895 nmdc:mga05p37_73875_c1
1896 nmdc:mga08y16_44326_c1
1897 nmdc:mga0sz30_101597_c1
1898 nmdc:mga0sz30_35964_c1
1899 nmdc:mga0sz30_68597_c1
1900 Ga0495601_0021920
1901 Ga0495601_0097602
1902 Ga0495612_0022752
1903 Ga0500635_0006885
1904 Ga0495595_0006758
1905 Ga0495619_0025581
1906 Ga0500578_0174010
1907 Ga0500578_0336986
1908 Ga0500643_004490
1909 Ga0500643_005916
1910 Ga0500646_0018011
1911 Ga0500647_0009885
1912 Ga0500583_0026675
1913 Ga0500651_0032312
1914 Ga0500566_0003707
1915 Ga0500641_0067588
1916 Ga0500641_0119778
1917 Ga0500554_000783
1918 Ga0500554_005946
1919 Ga0500556_0000004
1920 Ga0500556_0169430
1921 Ga0500557_000002
1922 Ga0500572_001419
1923 Ga0500592_004019
1924 Ga0500593_065467
1925 Ga0500593_149708
1926 Ga0500594_0005689
1927 Ga0500595_002144
1928 Ga0500595_005694
1929 Ga0500595_007592
1930 Ga0500595_008250
1931 Ga0500608_001002
1932 Ga0500618_002460
1933 Ga0500642_0000010
1934 Ga0500642_0093190
1935 Ga0500652_002195
1936 Ga0500658_0026316
1937 Ga0500658_0030273
1938 Ga0500559_0000270
1939 Ga0500559_0000497
1940 Ga0500559_0110199
1941 Ga0500568_0001744
1942 Ga0500577_0000093
1943 Ga0500577_0068244
1944 Ga0500588_0057052
1945 Ga0500589_077909
1946 Ga0500590_108884
1947 Ga0500603_000344
1948 Ga0500604_0004448
1949 Ga0500616_0000014
1950 Ga0500616_0000045
1951 Ga0500622_0000760
1952 Ga0500622_0031911
1953 Ga0500627_0030797
1954 Ga0500627_0109424
1955 Ga0500634_0089296
1956 Ga0500638_000061
1957 Ga0500639_020444
1958 Ga0500636_0001565
1959 Ga0500636_0030800
1960 Ga0500637_0000259
1961 Ga0500637_0042034
1962 Ga0500611_013638
1963 Ga0500625_004286
1964 Ga0500645_006318
1965 Ga0500645_039669
1966 Ga0500609_019591
1967 Ga0500596_006591
1968 Ga0501084_0007246
1969 Ga0501082_0117245
1970 Ga0530510_0260690
1971 2511394052
1972 2513625901
1973 2513639224
1974 2513654262
1975 2513676995
1976 2513692297
1977 2513699220
1978 2513858044
1979 2513872540
1980 2513894856
1981 2513915559
1982 2514012084
1983 2517892866
1984 2524442252
1985 2524464202
1986 2524540728
1987 2603859237
1988 2617348761
1989 2617376022
1990 2671117557
1991 2723845341
1992 2728751646
1993 2745080049
1994 2793064136
1995 2793068170
1996 2793083468
1997 2805917873
1998 2824604735
1999 2824615226
2000 2824622708
2001 2824631843
2002 2824639062
2003 2824649391
2004 2824655937
2005 2824673895
2006 2824683211
2007 2824690470
2008 2824698249
2009 2824719205
2010 2824729658
2011 2824734768
2012 2824749357
2013 2824761189
2014 2824770180
2015 2824776544
2016 2838124010
2017 2841943862
2018 2841950111
2019 2841966504
2020 2841975239
2021 2841983191
2022 2842039318
2023 2842047736
2024 2844318852
2025 2847935906
2026 2847946313
2027 2849079548
2028 2857529355
2029 2874608761
2030 2874616058
2031 2874627368
2032 2874629889
2033 2876812201
2034 2879085292
2035 2879103782
2036 2879111451
2037 2881371662
2038 2881669446
2039 2885372261
2040 2885387534
2041 2885412524
2042 2888424246
2043 2889040089
2044 2893071479
2045 2903732589
2046 2903757829
2047 2903769219
2048 2904696180
2049 2904703054
2050 2904720797
2051 2906610266
2052 2906618077
2053 2906629966
2054 2906639402
2055 2906646762
2056 2908743294
2057 2908779899
2058 2919079518
2059 2922365120
2060 2922374074
2061 2922397792
2062 2922429996
2063 2929617803
2064 2929627484
2065 2932800578
2066 2932803062
2067 2932821421
2068 2933579735
2069 2935633562
2070 2935707056
2071 2935762823
2072 2935775087
2073 2935782721
2074 2935791696
2075 2935800072
2076 2935885401
2077 2935959886
2078 2936009557
2079 2941510453
2080 2941517810
2081 2941525826
2082 2941538088
2083 3005487109
2084 3005590170
2085 3005598994
2086 3005722089
2087 8006941370
2088 8006965510
2089 8006981008
2090 8006993574
2091 8007000548
2092 8016529923
2093 8016548365
2094 8016553763
2095 8016562139
2096 8016592196
2097 8016610849
2098 8016614118
2099 8016626938
2100 8019534912
2101 8019544560
2102 8019554037
2103 8019568015
2104 8019658113
2105 8055746606
2106 8056674100
2107 8056693722
2108 8056973235

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

52

215

0.91

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

49

180

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7932 11 232
5ekp-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.791 11 232
5ekp-assembly1.cif.gz_C structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (wt) 0.7806 11 232
5eke-assembly1.cif.gz_C structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7798 11 232
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7768 14 232
ID Description Score Start End Superfamily
af_A0A2R8QCE8_89_340_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8665 11 122 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8502 17 236 3.90.550.10
af_Q2G2T7_1_208_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8495 14 216 3.90.550.10
af_Q9VLQ1_42_326_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8407 12 242 3.90.550.10
af_A4ICW5_2_228_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8356 14 231 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4V1ZS11-F1-model_v4 Glycosyltransferase family 2 protein 0.9843 11 114 GO:0005886
GO:0099621
AF-F7S7D9-F1-model_v4 Dolichyl-phosphate beta-D-mannosyltransferase 0.9622 12 119 GO:0004582
GO:0009247
GO:0016020
AF-A0A7C5FNM4-F1-model_v4 Glycosyltransferase 0.9587 13 118 GO:0005886
GO:0016757
AF-A0A840AX79-F1-model_v4 Glycosyltransferase involved in cell wall biosynthesis 0.9498 8 123 GO:0004582
GO:0009247
GO:0016020
AF-A0A1X7MIX0-F1-model_v4 deleted 0.9428 10 113

Map