F489096
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1052 | 393 | 1025 | 338 |
Family's Representative Sequence
| Representative Sequence | 3300026089|Ga0207648_10110095|Ga0207648_101100953 |
| Length | 410 |
| Sequence | MRPEVNSHQTVRRRDCDVEDLRAPGRDLHGLGLEERIDGPVLLTVFDAPPLQSDDEYLDESLKPPVLDVRWRFVSNIYEVAKRAGVSTATVSRVLSQPNVVAPDTRRKVMAAVERLGYTPNAAATNLRTLRTKKLVVTVPDISNPFFSLILQGIEDAAQREGYSVLLGDTQHDEQREERYALMLRRKEADGLIFLGHRLPKEAAALVRSMPGRAPIVNGCEFSPRLGIPSVHIDNATAAADAMDHLYRLGHRRIGIVTGPLVSPLSRDRLRGATARAKKAGAERDFIVMNGDFSIESGAVAAERLLGRKEPPTAIFCFNDEMAIGVIDTARRRKLRIPNDLSLVGFDDIRFARYTDPPLTTVAQPMRQIGEGTVRLLLEILQGQGSPESVTLPHTLVVRSSTAPPGSLIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 4 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 5 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 6 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 7 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 8 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 9 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 10 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 11 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 12 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 13 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 14 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 15 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 16 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 17 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 18 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 19 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 20 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 21 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 22 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 23 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 24 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 25 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 26 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 27 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 28 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 29 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 30 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 31 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 32 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 33 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 36 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 37 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 39 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 41 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 42 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 43 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 44 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 46 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 47 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 48 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 49 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 50 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 52 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 58 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 61 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 73 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 80 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 84 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 88 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 96 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 97 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 98 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 102 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 103 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 104 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 105 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 106 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 107 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 108 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 109 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 112 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 113 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 114 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 115 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 116 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 117 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 118 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 119 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 120 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 123 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 124 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 125 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 126 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 127 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 128 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 129 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 130 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 131 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 133 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 156 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 159 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 160 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 163 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 165 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 167 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 172 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 225 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 229 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 230 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 231 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 232 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 233 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 234 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 235 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 236 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 237 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 238 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 240 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 241 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 242 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 243 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 246 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 247 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 248 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 249 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 251 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 253 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 254 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 256 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 257 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 258 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 262 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 263 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 264 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 265 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 266 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 267 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 268 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 269 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 270 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 271 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 272 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 273 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 274 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 275 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 276 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 277 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 278 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 279 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 280 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 281 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 361 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 362 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 363 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 365 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 378 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 379 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 380 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 381 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 382 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 383 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 384 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 385 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 386 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 387 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 388 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 391 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 392 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 393 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.34 |
| Metatranscriptomes | 0 |
| Isolates | 2.66 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.1 |
| Bulb | 0 |
| Endosphere | 10.93 |
| Nodule | 0 |
| Rhizoplane | 2.57 |
| Rhizosphere | 78.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1411923 | 2162886007 | Bacteria | 8737 |
| 2 | SwRhRL2b_contig_3539020 | 2162886007 | Bacteria | 24060 |
| 3 | JGI24739J22299_10010725 | 3300001989 | Bacteria | 3397 |
| 4 | JGI24735J21928_10019568 | 3300002067 | Bacteria | 2080 |
| 5 | JGI24738J21930_10000759 | 3300002075 | Bacteria | 9234 |
| 6 | JGI24749J21850_1000053 | 3300002076 | Bacteria | 22163 |
| 7 | JGI25150J39212_1000224 | 3300002774 | Bacteria | 30911 |
| 8 | JGI25150J39212_1000458 | 3300002774 | Bacteria | 17923 |
| 9 | JGI25151J46595_10000016 | 3300003187 | Bacteria | 249712 |
| 10 | JGI25151J46595_10000057 | 3300003187 | Bacteria | 151052 |
| 11 | JGI25406J46586_10005401 | 3300003203 | Bacteria | 5929 |
| 12 | JGI25153J46596_10000041 | 3300003215 | Bacteria | 162103 |
| 13 | JGI25153J46596_10000198 | 3300003215 | Bacteria | 56709 |
| 14 | rootL2_10081122 | 3300003322 | Bacteria | 7015 |
| 15 | rootL2_10145053 | 3300003322 | Bacteria | 4911 |
| 16 | rootH1_10033773 | 3300003316 | Bacteria | 2681 |
| 17 | rootH1_10033773 | 3300003323 | Bacteria | 4965 |
| 18 | Ga0055526_1000006 | 3300003771 | Bacteria | 330857 |
| 19 | Ga0055526_1005312 | 3300003771 | Bacteria | 7460 |
| 20 | Ga0055537_1000003 | 3300003773 | Bacteria | 220933 |
| 21 | Ga0055537_1000018 | 3300003773 | Bacteria | 123452 |
| 22 | Ga0055537_1000442 | 3300003773 | Bacteria | 26526 |
| 23 | Ga0055537_1000746 | 3300003773 | Bacteria | 16605 |
| 24 | Ga0055524_1000009 | 3300003775 | Bacteria | 295254 |
| 25 | Ga0055536_1006687 | 3300003781 | Bacteria | 5303 |
| 26 | Ga0055536_1007631 | 3300003781 | Bacteria | 4798 |
| 27 | Ga0055534_1000004 | 3300003784 | Bacteria | 295251 |
| 28 | Ga0055534_1001119 | 3300003784 | Bacteria | 11371 |
| 29 | Ga0055528_1000003 | 3300003790 | Bacteria | 330875 |
| 30 | Ga0055528_1000990 | 3300003790 | Bacteria | 18873 |
| 31 | Ga0055530_10000301 | 3300003791 | Bacteria | 44944 |
| 32 | Ga0055530_10007254 | 3300003791 | Bacteria | 4713 |
| 33 | Ga0055530_10009834 | 3300003791 | Bacteria | 3612 |
| 34 | Ga0055540_1001135 | 3300003792 | Bacteria | 16601 |
| 35 | Ga0055531_10004329 | 3300003794 | Bacteria | 8685 |
| 36 | Ga0055531_10007930 | 3300003794 | Bacteria | 5695 |
| 37 | Ga0055531_10007945 | 3300003794 | Bacteria | 5687 |
| 38 | Ga0055531_10008703 | 3300003794 | Bacteria | 5303 |
| 39 | Ga0055531_10009940 | 3300003794 | Bacteria | 4802 |
| 40 | Ga0055531_10022649 | 3300003794 | Bacteria | 2385 |
| 41 | Ga0058692_1000015 | 3300003856 | Bacteria | 295729 |
| 42 | Ga0058692_1000022 | 3300003856 | Bacteria | 237321 |
| 43 | Ga0065165_1002680 | 3300005262 | Bacteria | 14354 |
| 44 | Ga0065165_1004694 | 3300005262 | Bacteria | 8220 |
| 45 | Ga0065165_1006492 | 3300005262 | Bacteria | 6115 |
| 46 | Ga0065165_1016066 | 3300005262 | Bacteria | 2821 |
| 47 | Ga0065704_10000363 | 3300005289 | Bacteria | 43914 |
| 48 | Ga0065704_10070190 | 3300005289 | Bacteria | 113837 |
| 49 | Ga0065704_10105639 | 3300005289 | Bacteria | 2105 |
| 50 | Ga0065712_10000333 | 3300005290 | Bacteria | 13723 |
| 51 | Ga0065712_10106997 | 3300005290 | Bacteria | 1905 |
| 52 | Ga0065715_10004188 | 3300005293 | Bacteria | 3801 |
| 53 | Ga0065707_10003170 | 3300005295 | Bacteria | 4599 |
| 54 | Ga0065707_10082125 | 3300005295 | Bacteria | 21290 |
| 55 | Ga0065707_10092877 | 3300005295 | Bacteria | 3704 |
| 56 | Ga0065707_10198382 | 3300005295 | Bacteria | 1322 |
| 57 | Ga0070676_10004330 | 3300005328 | Bacteria | 7459 |
| 58 | Ga0070676_10257570 | 3300005328 | Bacteria | 1167 |
| 59 | Ga0070683_100013418 | 3300005329 | Bacteria | 7146 |
| 60 | Ga0070683_100160851 | 3300005329 | Bacteria | 2131 |
| 61 | Ga0070690_100006381 | 3300005330 | Bacteria | 6683 |
| 62 | Ga0070690_100218758 | 3300005330 | Bacteria | 1334 |
| 63 | Ga0070690_100289245 | 3300005330 | Bacteria | 1171 |
| 64 | Ga0070670_100001701 | 3300005331 | Bacteria | 17909 |
| 65 | Ga0070670_100004309 | 3300005331 | Bacteria | 11908 |
| 66 | Ga0070670_100022221 | 3300005331 | Bacteria | 5460 |
| 67 | Ga0070670_100023356 | 3300005331 | Bacteria | 5322 |
| 68 | Ga0070670_100085994 | 3300005331 | Bacteria | 2702 |
| 69 | Ga0070670_100164515 | 3300005331 | Bacteria | 1923 |
| 70 | Ga0070670_100179812 | 3300005331 | Bacteria | 1836 |
| 71 | Ga0070677_10050298 | 3300005333 | Bacteria | 1682 |
| 72 | Ga0068869_100003496 | 3300005334 | Bacteria | 9623 |
| 73 | Ga0068869_100136230 | 3300005334 | Bacteria | 1892 |
| 74 | Ga0068869_100248095 | 3300005334 | Bacteria | 1421 |
| 75 | Ga0070666_10043508 | 3300005335 | Bacteria | 3008 |
| 76 | Ga0070666_10068495 | 3300005335 | Bacteria | 2412 |
| 77 | Ga0070666_10070344 | 3300005335 | Bacteria | 2380 |
| 78 | Ga0070666_10115508 | 3300005335 | Bacteria | 1859 |
| 79 | Ga0070680_100368814 | 3300005336 | Bacteria | 1221 |
| 80 | Ga0068868_100297023 | 3300005338 | Bacteria | 1371 |
| 81 | Ga0070689_100032021 | 3300005340 | Bacteria | 3998 |
| 82 | Ga0070689_100032944 | 3300005340 | Bacteria | 3946 |
| 83 | Ga0070689_100038392 | 3300005340 | Bacteria | 3664 |
| 84 | Ga0070689_100039411 | 3300005340 | Bacteria | 3617 |
| 85 | Ga0070689_100074258 | 3300005340 | Bacteria | 2661 |
| 86 | Ga0070691_10003000 | 3300005341 | Bacteria | 7560 |
| 87 | Ga0070691_10010618 | 3300005341 | Bacteria | 4206 |
| 88 | Ga0070687_100012617 | 3300005343 | Bacteria | 3738 |
| 89 | Ga0070687_100013142 | 3300005343 | Bacteria | 3679 |
| 90 | Ga0070687_100090533 | 3300005343 | Bacteria | 1691 |
| 91 | Ga0070687_100152432 | 3300005343 | Bacteria | 1358 |
| 92 | Ga0070661_100012157 | 3300005344 | Bacteria | 6019 |
| 93 | Ga0070692_10056824 | 3300005345 | Bacteria | 2050 |
| 94 | Ga0070692_10071957 | 3300005345 | Bacteria | 1844 |
| 95 | Ga0070668_100017093 | 3300005347 | Bacteria | 5428 |
| 96 | Ga0070669_100001414 | 3300005353 | Bacteria | 17346 |
| 97 | Ga0070669_100017191 | 3300005353 | Bacteria | 5160 |
| 98 | Ga0070669_100027408 | 3300005353 | Bacteria | 4099 |
| 99 | Ga0070669_100029241 | 3300005353 | Bacteria | 3972 |
| 100 | Ga0070669_100058591 | 3300005353 | Bacteria | 2827 |
| 101 | Ga0070669_100082992 | 3300005353 | Bacteria | 2389 |
| 102 | Ga0070669_100374442 | 3300005353 | Bacteria | 1160 |
| 103 | Ga0070675_100001217 | 3300005354 | Bacteria | 18706 |
| 104 | Ga0070675_100001225 | 3300005354 | Bacteria | 18657 |
| 105 | Ga0070675_100002905 | 3300005354 | Bacteria | 12915 |
| 106 | Ga0070675_100008687 | 3300005354 | Bacteria | 7888 |
| 107 | Ga0070675_100019988 | 3300005354 | Bacteria | 5343 |
| 108 | Ga0070675_100039757 | 3300005354 | Bacteria | 3839 |
| 109 | Ga0070675_100052358 | 3300005354 | Bacteria | 3356 |
| 110 | Ga0070675_100076372 | 3300005354 | Bacteria | 2786 |
| 111 | Ga0070675_100162562 | 3300005354 | Bacteria | 1921 |
| 112 | Ga0070675_100442358 | 3300005354 | Bacteria | 1165 |
| 113 | Ga0070671_100000844 | 3300005355 | Bacteria | 22305 |
| 114 | Ga0070671_100005852 | 3300005355 | Bacteria | 9796 |
| 115 | Ga0070671_100009229 | 3300005355 | Bacteria | 7922 |
| 116 | Ga0070674_100002174 | 3300005356 | Bacteria | 10782 |
| 117 | Ga0070674_100190459 | 3300005356 | Bacteria | 1578 |
| 118 | Ga0070674_100312467 | 3300005356 | Bacteria | 1257 |
| 119 | Ga0070673_100091993 | 3300005364 | Bacteria | 2480 |
| 120 | Ga0070673_100148350 | 3300005364 | Bacteria | 1984 |
| 121 | Ga0070673_100179045 | 3300005364 | Bacteria | 1814 |
| 122 | Ga0070673_100342702 | 3300005364 | Bacteria | 1325 |
| 123 | Ga0070688_100002411 | 3300005365 | Bacteria | 9438 |
| 124 | Ga0070688_100003784 | 3300005365 | Bacteria | 7841 |
| 125 | Ga0070688_100031288 | 3300005365 | Bacteria | 3201 |
| 126 | Ga0070688_100050052 | 3300005365 | Bacteria | 2602 |
| 127 | Ga0070688_100180537 | 3300005365 | Bacteria | 1464 |
| 128 | Ga0070659_100113743 | 3300005366 | Bacteria | 2186 |
| 129 | Ga0070667_100061524 | 3300005367 | Bacteria | 3179 |
| 130 | Ga0070667_100307461 | 3300005367 | Unclassified | 1428 |
| 131 | Ga0070667_100409899 | 3300005367 | Bacteria | 1234 |
| 132 | Ga0070713_100027448 | 3300005436 | Bacteria | 4482 |
| 133 | Ga0070701_10012165 | 3300005438 | Bacteria | 3872 |
| 134 | Ga0070701_10141666 | 3300005438 | Bacteria | 1376 |
| 135 | Ga0070705_100000116 | 3300005440 | Bacteria | 45853 |
| 136 | Ga0070705_100003965 | 3300005440 | Bacteria | 7232 |
| 137 | Ga0070705_100032260 | 3300005440 | Bacteria | 2909 |
| 138 | Ga0070700_100005845 | 3300005441 | Bacteria | 6532 |
| 139 | Ga0070700_100072300 | 3300005441 | Bacteria | 2204 |
| 140 | Ga0070700_100176452 | 3300005441 | Bacteria | 1483 |
| 141 | Ga0070700_100256781 | 3300005441 | Bacteria | 1256 |
| 142 | Ga0070694_100011107 | 3300005444 | Bacteria | 5575 |
| 143 | Ga0070694_100073074 | 3300005444 | Bacteria | 2368 |
| 144 | Ga0070694_100084248 | 3300005444 | Bacteria | 2217 |
| 145 | Ga0070694_100264000 | 3300005444 | Bacteria | 1307 |
| 146 | Ga0070708_100333050 | 3300005445 | Bacteria | 1430 |
| 147 | Ga0070708_100419736 | 3300005445 | Bacteria | 1262 |
| 148 | Ga0070663_100185106 | 3300005455 | Bacteria | 1618 |
| 149 | Ga0070662_100023078 | 3300005457 | Bacteria | 4270 |
| 150 | Ga0070662_100083848 | 3300005457 | Bacteria | 2380 |
| 151 | Ga0070662_100093816 | 3300005457 | Bacteria | 2259 |
| 152 | Ga0068867_100038337 | 3300005459 | Bacteria | 3488 |
| 153 | Ga0068867_100039559 | 3300005459 | Bacteria | 3438 |
| 154 | Ga0068867_100053738 | 3300005459 | Bacteria | 2975 |
| 155 | Ga0068867_100061470 | 3300005459 | Bacteria | 2789 |
| 156 | Ga0070707_100147585 | 3300005468 | Bacteria | 2289 |
| 157 | Ga0070707_100209972 | 3300005468 | Bacteria | 1898 |
| 158 | Ga0070707_100432239 | 3300005468 | Bacteria | 1277 |
| 159 | Ga0070698_100008611 | 3300005471 | Bacteria | 10995 |
| 160 | Ga0070698_100074877 | 3300005471 | Bacteria | 3390 |
| 161 | Ga0070698_100094926 | 3300005471 | Bacteria | 2961 |
| 162 | Ga0070699_100013945 | 3300005518 | Bacteria | 6913 |
| 163 | Ga0070699_100106092 | 3300005518 | Bacteria | 2464 |
| 164 | Ga0070699_100130553 | 3300005518 | Bacteria | 2215 |
| 165 | Ga0070699_100464075 | 3300005518 | Bacteria | 1148 |
| 166 | Ga0070684_100000131 | 3300005535 | Bacteria | 49644 |
| 167 | Ga0070684_100094446 | 3300005535 | Bacteria | 2664 |
| 168 | Ga0070672_100011456 | 3300005543 | Bacteria | 6185 |
| 169 | Ga0070672_100116012 | 3300005543 | Bacteria | 2187 |
| 170 | Ga0070686_100001409 | 3300005544 | Bacteria | 13568 |
| 171 | Ga0070695_100001466 | 3300005545 | Bacteria | 13070 |
| 172 | Ga0070695_100003657 | 3300005545 | Bacteria | 8963 |
| 173 | Ga0070695_100006552 | 3300005545 | Bacteria | 6880 |
| 174 | Ga0070695_100195534 | 3300005545 | Bacteria | 1442 |
| 175 | Ga0070696_100000141 | 3300005546 | Bacteria | 39540 |
| 176 | Ga0070696_100008448 | 3300005546 | Bacteria | 6892 |
| 177 | Ga0070696_100010528 | 3300005546 | Bacteria | 6198 |
| 178 | Ga0070696_100017939 | 3300005546 | Bacteria | 4780 |
| 179 | Ga0070665_100005360 | 3300005548 | Bacteria | 13242 |
| 180 | Ga0070665_100311681 | 3300005548 | Bacteria | 1577 |
| 181 | Ga0070704_100003072 | 3300005549 | Bacteria | 9506 |
| 182 | Ga0070704_100252371 | 3300005549 | Bacteria | 1449 |
| 183 | Ga0070664_100013166 | 3300005564 | Bacteria | 6734 |
| 184 | Ga0070664_100180015 | 3300005564 | Bacteria | 1878 |
| 185 | Ga0068857_100006456 | 3300005577 | Bacteria | 10056 |
| 186 | Ga0068857_100265947 | 3300005577 | Bacteria | 1575 |
| 187 | Ga0068854_100007820 | 3300005578 | Bacteria | 6841 |
| 188 | Ga0068854_100082043 | 3300005578 | Bacteria | 2383 |
| 189 | Ga0068854_100084220 | 3300005578 | Bacteria | 2352 |
| 190 | Ga0068854_100087694 | 3300005578 | Bacteria | 2309 |
| 191 | Ga0068854_100146030 | 3300005578 | Bacteria | 1820 |
| 192 | Ga0068856_100522646 | 3300005614 | Bacteria | 1208 |
| 193 | Ga0070702_100005096 | 3300005615 | Bacteria | 6078 |
| 194 | Ga0070702_100021415 | 3300005615 | Bacteria | 3401 |
| 195 | Ga0068859_100000441 | 3300005617 | Bacteria | 41723 |
| 196 | Ga0068859_100001084 | 3300005617 | Bacteria | 27803 |
| 197 | Ga0068859_100008641 | 3300005617 | Bacteria | 10292 |
| 198 | Ga0068859_100114953 | 3300005617 | Unclassified | 2755 |
| 199 | Ga0068864_100000583 | 3300005618 | Bacteria | 31040 |
| 200 | Ga0068864_100043296 | 3300005618 | Bacteria | 3855 |
| 201 | Ga0068864_100081212 | 3300005618 | Bacteria | 2842 |
| 202 | Ga0068864_100371295 | 3300005618 | Bacteria | 1354 |
| 203 | Ga0068866_10018596 | 3300005718 | Bacteria | 3146 |
| 204 | Ga0068861_100005269 | 3300005719 | Bacteria | 8719 |
| 205 | Ga0068861_100010517 | 3300005719 | Bacteria | 6422 |
| 206 | Ga0068861_100055469 | 3300005719 | Bacteria | 3021 |
| 207 | Ga0068861_100057934 | 3300005719 | Bacteria | 2960 |
| 208 | Ga0068861_100151935 | 3300005719 | Bacteria | 1901 |
| 209 | Ga0068861_100159632 | 3300005719 | Bacteria | 1859 |
| 210 | Ga0068861_100295342 | 3300005719 | Bacteria | 1401 |
| 211 | Ga0068861_100351496 | 3300005719 | Bacteria | 1293 |
| 212 | Ga0068851_10065657 | 3300005834 | Unclassified | 1868 |
| 213 | Ga0068851_10154222 | 3300005834 | Bacteria | 1258 |
| 214 | Ga0068870_10105645 | 3300005840 | Bacteria | 1599 |
| 215 | Ga0068870_10162645 | 3300005840 | Bacteria | 1325 |
| 216 | Ga0068863_100000019 | 3300005841 | Bacteria | 205585 |
| 217 | Ga0068863_100008426 | 3300005841 | Bacteria | 10068 |
| 218 | Ga0068863_100033097 | 3300005841 | Bacteria | 4924 |
| 219 | Ga0068863_100081690 | 3300005841 | Bacteria | 3061 |
| 220 | Ga0068863_100291459 | 3300005841 | Bacteria | 1582 |
| 221 | Ga0068863_100350008 | 3300005841 | Bacteria | 1438 |
| 222 | Ga0068858_100000700 | 3300005842 | Bacteria | 35018 |
| 223 | Ga0068858_100012279 | 3300005842 | Bacteria | 8078 |
| 224 | Ga0068858_100016289 | 3300005842 | Bacteria | 6983 |
| 225 | Ga0068858_100024743 | 3300005842 | Bacteria | 5591 |
| 226 | Ga0068858_100099111 | 3300005842 | Bacteria | 2717 |
| 227 | Ga0068860_100013412 | 3300005843 | Bacteria | 8037 |
| 228 | Ga0068860_100015157 | 3300005843 | Bacteria | 7530 |
| 229 | Ga0068860_100179866 | 3300005843 | Bacteria | 2044 |
| 230 | Ga0068860_100250185 | 3300005843 | Unclassified | 1726 |
| 231 | Ga0068860_100348768 | 3300005843 | Bacteria | 1456 |
| 232 | Ga0068862_100029633 | 3300005844 | Bacteria | 4612 |
| 233 | Ga0068862_100054848 | 3300005844 | Bacteria | 3413 |
| 234 | Ga0068862_100158428 | 3300005844 | Bacteria | 2019 |
| 235 | Ga0068862_100182058 | 3300005844 | Bacteria | 1886 |
| 236 | Ga0068862_100278351 | 3300005844 | Bacteria | 1533 |
| 237 | Ga0081455_10000127 | 3300005937 | Bacteria | 88574 |
| 238 | Ga0081455_10035042 | 3300005937 | Bacteria | 4490 |
| 239 | Ga0081540_1076471 | 3300005983 | Bacteria | 1525 |
| 240 | Ga0081539_10000334 | 3300005985 | Bacteria | 104401 |
| 241 | Ga0081539_10000548 | 3300005985 | Bacteria | 77496 |
| 242 | Ga0081539_10000753 | 3300005985 | Bacteria | 64323 |
| 243 | Ga0075365_10053109 | 3300006038 | Bacteria | 2683 |
| 244 | Ga0075363_100001428 | 3300006048 | Bacteria | 9041 |
| 245 | Ga0075364_10007623 | 3300006051 | Bacteria | 6434 |
| 246 | Ga0075364_10017498 | 3300006051 | Bacteria | 4478 |
| 247 | Ga0075364_10259181 | 3300006051 | Bacteria | 1182 |
| 248 | Ga0070716_100101601 | 3300006173 | Bacteria | 1764 |
| 249 | Ga0070716_100171168 | 3300006173 | Bacteria | 1417 |
| 250 | Ga0075362_10000270 | 3300006177 | Bacteria | 14466 |
| 251 | Ga0075367_10008801 | 3300006178 | Bacteria | 5250 |
| 252 | Ga0075367_10049686 | 3300006178 | Bacteria | 2473 |
| 253 | Ga0075369_10007151 | 3300006186 | Bacteria | 4240 |
| 254 | Ga0075366_10000070 | 3300006195 | Bacteria | 39329 |
| 255 | Ga0075366_10056627 | 3300006195 | Bacteria | 2328 |
| 256 | Ga0097621_100024815 | 3300006237 | Bacteria | 4686 |
| 257 | Ga0097621_100180315 | 3300006237 | Bacteria | 1825 |
| 258 | Ga0075370_10000009 | 3300006353 | Bacteria | 97850 |
| 259 | Ga0075370_10070789 | 3300006353 | Bacteria | 1995 |
| 260 | Ga0068871_100006884 | 3300006358 | Bacteria | 8095 |
| 261 | Ga0068871_100141796 | 3300006358 | Bacteria | 2044 |
| 262 | Ga0068871_100253650 | 3300006358 | Bacteria | 1533 |
| 263 | Ga0075428_100001819 | 3300006844 | Bacteria | 22833 |
| 264 | Ga0075428_100020409 | 3300006844 | Bacteria | 7335 |
| 265 | Ga0075428_100057101 | 3300006844 | Bacteria | 4274 |
| 266 | Ga0075428_100079670 | 3300006844 | Bacteria | 3575 |
| 267 | Ga0075428_100080881 | 3300006844 | Bacteria | 3546 |
| 268 | Ga0075428_100108460 | 3300006844 | Unclassified | 3026 |
| 269 | Ga0075428_100160340 | 3300006844 | Bacteria | 2441 |
| 270 | Ga0075428_100399462 | 3300006844 | Bacteria | 1473 |
| 271 | Ga0075430_100001773 | 3300006846 | Bacteria | 17636 |
| 272 | Ga0075430_100016744 | 3300006846 | Bacteria | 6244 |
| 273 | Ga0075430_100026431 | 3300006846 | Bacteria | 4938 |
| 274 | Ga0075430_100041131 | 3300006846 | Bacteria | 3911 |
| 275 | Ga0075430_100114973 | 3300006846 | Bacteria | 2242 |
| 276 | Ga0075430_100180286 | 3300006846 | Bacteria | 1757 |
| 277 | Ga0075430_100204161 | 3300006846 | Bacteria | 1640 |
| 278 | Ga0075431_100029382 | 3300006847 | Bacteria | 5658 |
| 279 | Ga0075431_100059805 | 3300006847 | Bacteria | 3932 |
| 280 | Ga0075431_100071732 | 3300006847 | Bacteria | 3574 |
| 281 | Ga0075431_100085607 | 3300006847 | Bacteria | 3253 |
| 282 | Ga0075431_100229698 | 3300006847 | Bacteria | 1891 |
| 283 | Ga0075431_100237528 | 3300006847 | Bacteria | 1855 |
| 284 | Ga0075433_10018342 | 3300006852 | Bacteria | 5815 |
| 285 | Ga0075433_10034494 | 3300006852 | Bacteria | 4346 |
| 286 | Ga0075433_10035109 | 3300006852 | Bacteria | 4310 |
| 287 | Ga0075433_10046558 | 3300006852 | Bacteria | 3772 |
| 288 | Ga0075433_10049165 | 3300006852 | Bacteria | 3669 |
| 289 | Ga0075433_10088056 | 3300006852 | Bacteria | 2743 |
| 290 | Ga0075433_10155746 | 3300006852 | Bacteria | 2033 |
| 291 | Ga0075433_10159709 | 3300006852 | Bacteria | 2006 |
| 292 | Ga0075433_10211999 | 3300006852 | Bacteria | 1721 |
| 293 | Ga0075433_10241311 | 3300006852 | Bacteria | 1604 |
| 294 | Ga0075434_100009173 | 3300006871 | Bacteria | 9217 |
| 295 | Ga0075434_100016423 | 3300006871 | Bacteria | 7116 |
| 296 | Ga0075434_100024027 | 3300006871 | Bacteria | 5953 |
| 297 | Ga0075434_100037189 | 3300006871 | Bacteria | 4818 |
| 298 | Ga0075434_100100580 | 3300006871 | Bacteria | 2897 |
| 299 | Ga0075434_100117300 | 3300006871 | Bacteria | 2675 |
| 300 | Ga0075434_100118947 | 3300006871 | Bacteria | 2656 |
| 301 | Ga0075434_100126099 | 3300006871 | Bacteria | 2577 |
| 302 | Ga0075434_100131168 | 3300006871 | Bacteria | 2525 |
| 303 | Ga0075434_100514235 | 3300006871 | Unclassified | 1218 |
| 304 | Ga0075429_100058037 | 3300006880 | Unclassified | 3371 |
| 305 | Ga0075429_100070422 | 3300006880 | Bacteria | 3045 |
| 306 | Ga0075429_100087006 | 3300006880 | Bacteria | 2723 |
| 307 | Ga0075429_100098756 | 3300006880 | Bacteria | 2547 |
| 308 | Ga0075429_100201739 | 3300006880 | Bacteria | 1743 |
| 309 | Ga0075429_100295260 | 3300006880 | Bacteria | 1419 |
| 310 | Ga0068865_100000942 | 3300006881 | Bacteria | 16545 |
| 311 | Ga0068865_100006865 | 3300006881 | Bacteria | 6973 |
| 312 | Ga0068865_100065977 | 3300006881 | Bacteria | 2553 |
| 313 | Ga0075436_100059382 | 3300006914 | Bacteria | 2642 |
| 314 | Ga0097620_100000074 | 3300006931 | Bacteria | 92064 |
| 315 | Ga0097620_100000441 | 3300006931 | Bacteria | 41723 |
| 316 | Ga0097620_100001083 | 3300006931 | Bacteria | 27803 |
| 317 | Ga0097620_100008641 | 3300006931 | Bacteria | 10292 |
| 318 | Ga0097620_100114953 | 3300006931 | Unclassified | 2755 |
| 319 | Ga0075435_100000928 | 3300007076 | Bacteria | 18503 |
| 320 | Ga0075435_100003002 | 3300007076 | Bacteria | 11356 |
| 321 | Ga0075435_100005829 | 3300007076 | Bacteria | 8662 |
| 322 | Ga0075435_100094384 | 3300007076 | Unclassified | 2473 |
| 323 | Ga0075435_100109768 | 3300007076 | Bacteria | 2294 |
| 324 | Ga0075435_100139830 | 3300007076 | Bacteria | 2031 |
| 325 | Ga0075435_100143497 | 3300007076 | Bacteria | 2005 |
| 326 | Ga0075435_100188600 | 3300007076 | Bacteria | 1744 |
| 327 | Ga0105251_10000013 | 3300009011 | Bacteria | 163226 |
| 328 | Ga0105244_10043643 | 3300009036 | Bacteria | 2312 |
| 329 | Ga0105250_10001875 | 3300009092 | Bacteria | 10924 |
| 330 | Ga0105240_10013459 | 3300009093 | Bacteria | 11236 |
| 331 | Ga0105240_10111093 | 3300009093 | Bacteria | 3316 |
| 332 | Ga0105240_10337221 | 3300009093 | Bacteria | 1714 |
| 333 | Ga0111539_10000049 | 3300009094 | Bacteria | 119544 |
| 334 | Ga0111539_10006856 | 3300009094 | Bacteria | 14635 |
| 335 | Ga0111539_10007298 | 3300009094 | Bacteria | 14152 |
| 336 | Ga0111539_10008943 | 3300009094 | Bacteria | 12680 |
| 337 | Ga0111539_10019390 | 3300009094 | Bacteria | 8396 |
| 338 | Ga0111539_10039504 | 3300009094 | Bacteria | 5686 |
| 339 | Ga0111539_10054280 | 3300009094 | Bacteria | 4769 |
| 340 | Ga0111539_10063121 | 3300009094 | Bacteria | 4384 |
| 341 | Ga0111539_10086698 | 3300009094 | Bacteria | 3679 |
| 342 | Ga0111539_10159766 | 3300009094 | Bacteria | 2636 |
| 343 | Ga0111539_10234904 | 3300009094 | Bacteria | 2134 |
| 344 | Ga0111539_10294161 | 3300009094 | Bacteria | 1890 |
| 345 | Ga0111539_10326706 | 3300009094 | Bacteria | 1785 |
| 346 | Ga0105245_10022300 | 3300009098 | Bacteria | 5557 |
| 347 | Ga0105245_10145452 | 3300009098 | Bacteria | 2236 |
| 348 | Ga0105247_10000923 | 3300009101 | Bacteria | 22103 |
| 349 | Ga0105247_10172018 | 3300009101 | Bacteria | 1441 |
| 350 | Ga0114129_10001463 | 3300009147 | Bacteria | 31911 |
| 351 | Ga0114129_10002077 | 3300009147 | Bacteria | 27547 |
| 352 | Ga0114129_10012069 | 3300009147 | Bacteria | 12295 |
| 353 | Ga0114129_10015078 | 3300009147 | Bacteria | 11003 |
| 354 | Ga0114129_10017374 | 3300009147 | Bacteria | 10244 |
| 355 | Ga0114129_10017991 | 3300009147 | Bacteria | 10063 |
| 356 | Ga0114129_10021206 | 3300009147 | Bacteria | 9227 |
| 357 | Ga0114129_10021598 | 3300009147 | Bacteria | 9136 |
| 358 | Ga0114129_10021805 | 3300009147 | Bacteria | 9093 |
| 359 | Ga0114129_10027614 | 3300009147 | Bacteria | 8036 |
| 360 | Ga0114129_10037003 | 3300009147 | Bacteria | 6891 |
| 361 | Ga0114129_10039981 | 3300009147 | Bacteria | 6615 |
| 362 | Ga0114129_10055881 | 3300009147 | Bacteria | 5532 |
| 363 | Ga0114129_10063964 | 3300009147 | Bacteria | 5134 |
| 364 | Ga0114129_10092853 | 3300009147 | Bacteria | 4181 |
| 365 | Ga0114129_10097270 | 3300009147 | Bacteria | 4075 |
| 366 | Ga0114129_10105548 | 3300009147 | Bacteria | 3893 |
| 367 | Ga0114129_10168886 | 3300009147 | Bacteria | 2983 |
| 368 | Ga0114129_10188468 | 3300009147 | Bacteria | 2802 |
| 369 | Ga0114129_10303605 | 3300009147 | Bacteria | 2127 |
| 370 | Ga0114129_10314310 | 3300009147 | Bacteria | 2084 |
| 371 | Ga0114129_10427377 | 3300009147 | Bacteria | 1741 |
| 372 | Ga0114129_10469870 | 3300009147 | Bacteria | 1647 |
| 373 | Ga0105243_10012897 | 3300009148 | Bacteria | 6315 |
| 374 | Ga0105243_10040969 | 3300009148 | Bacteria | 3620 |
| 375 | Ga0105243_10491266 | 3300009148 | Bacteria | 1161 |
| 376 | Ga0105241_10048546 | 3300009174 | Bacteria | 3231 |
| 377 | Ga0105241_10134353 | 3300009174 | Bacteria | 2006 |
| 378 | Ga0105242_10008281 | 3300009176 | Bacteria | 7989 |
| 379 | Ga0105242_10071701 | 3300009176 | Bacteria | 2875 |
| 380 | Ga0105242_10075697 | 3300009176 | Bacteria | 2803 |
| 381 | Ga0105242_10179844 | 3300009176 | Bacteria | 1865 |
| 382 | Ga0105248_10001761 | 3300009177 | Bacteria | 24074 |
| 383 | Ga0105248_10004937 | 3300009177 | Bacteria | 14734 |
| 384 | Ga0105248_10010781 | 3300009177 | Bacteria | 10090 |
| 385 | Ga0105248_10013157 | 3300009177 | Bacteria | 9111 |
| 386 | Ga0105248_10030345 | 3300009177 | Bacteria | 6036 |
| 387 | Ga0105248_10126609 | 3300009177 | Bacteria | 2881 |
| 388 | Ga0105248_10142693 | 3300009177 | Bacteria | 2702 |
| 389 | Ga0105237_10006300 | 3300009545 | Bacteria | 13194 |
| 390 | Ga0105237_10014363 | 3300009545 | Bacteria | 8285 |
| 391 | Ga0105237_10085870 | 3300009545 | Bacteria | 3136 |
| 392 | Ga0105237_10110467 | 3300009545 | Bacteria | 2741 |
| 393 | Ga0105249_10000654 | 3300009553 | Bacteria | 31467 |
| 394 | Ga0105249_10002700 | 3300009553 | Bacteria | 15340 |
| 395 | Ga0105249_10012954 | 3300009553 | Bacteria | 7359 |
| 396 | Ga0105249_10028928 | 3300009553 | Bacteria | 5002 |
| 397 | Ga0105249_10107619 | 3300009553 | Bacteria | 2631 |
| 398 | Ga0105249_10198420 | 3300009553 | Bacteria | 1963 |
| 399 | Ga0105249_10219105 | 3300009553 | Bacteria | 1872 |
| 400 | Ga0105249_10326727 | 3300009553 | Bacteria | 1546 |
| 401 | Ga0105239_10125251 | 3300010375 | Bacteria | 2855 |
| 402 | Ga0105239_10246529 | 3300010375 | Bacteria | 2006 |
| 403 | Ga0105239_10363989 | 3300010375 | Bacteria | 1634 |
| 404 | Ga0157374_10041093 | 3300013296 | Bacteria | 4259 |
| 405 | Ga0157374_10053818 | 3300013296 | Bacteria | 3753 |
| 406 | Ga0157374_10194629 | 3300013296 | Bacteria | 1984 |
| 407 | Ga0157374_10216424 | 3300013296 | Bacteria | 1879 |
| 408 | Ga0157378_10008708 | 3300013297 | Bacteria | 8831 |
| 409 | Ga0163162_10046655 | 3300013306 | Bacteria | 4343 |
| 410 | Ga0163162_10071234 | 3300013306 | Bacteria | 3529 |
| 411 | Ga0163162_10078015 | 3300013306 | Bacteria | 3377 |
| 412 | Ga0157372_10207269 | 3300013307 | Bacteria | 2271 |
| 413 | Ga0157375_10019096 | 3300013308 | Bacteria | 6226 |
| 414 | Ga0163163_10004894 | 3300014325 | Bacteria | 11518 |
| 415 | Ga0163163_10010247 | 3300014325 | Bacteria | 8418 |
| 416 | Ga0163163_10024873 | 3300014325 | Bacteria | 5701 |
| 417 | Ga0163163_10050639 | 3300014325 | Bacteria | 4090 |
| 418 | Ga0163163_10123269 | 3300014325 | Bacteria | 2627 |
| 419 | Ga0163163_10209284 | 3300014325 | Bacteria | 1999 |
| 420 | Ga0163163_10447815 | 3300014325 | Bacteria | 1351 |
| 421 | Ga0157380_10013953 | 3300014326 | Bacteria | 5867 |
| 422 | Ga0157380_10055011 | 3300014326 | Bacteria | 3159 |
| 423 | Ga0157380_10074853 | 3300014326 | Bacteria | 2750 |
| 424 | Ga0157380_10292640 | 3300014326 | Bacteria | 1496 |
| 425 | Ga0182008_10000187 | 3300014497 | Bacteria | 48971 |
| 426 | Ga0182008_10019950 | 3300014497 | Bacteria | 3454 |
| 427 | Ga0157377_10017156 | 3300014745 | Bacteria | 3741 |
| 428 | Ga0157377_10045165 | 3300014745 | Bacteria | 2460 |
| 429 | Ga0157377_10050727 | 3300014745 | Bacteria | 2338 |
| 430 | Ga0157377_10179063 | 3300014745 | Bacteria | 1332 |
| 431 | Ga0157379_10243492 | 3300014968 | Bacteria | 1631 |
| 432 | Ga0157379_10261773 | 3300014968 | Bacteria | 1572 |
| 433 | Ga0157379_10288227 | 3300014968 | Bacteria | 1495 |
| 434 | Ga0157379_10435620 | 3300014968 | Bacteria | 1208 |
| 435 | Ga0182005_1001455 | 3300015265 | Bacteria | 9536 |
| 436 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 437 | Ga0163161_10002965 | 3300017792 | Bacteria | 12025 |
| 438 | Ga0207425_1000016 | 3300025245 | Bacteria | 428169 |
| 439 | Ga0207425_1000044 | 3300025245 | Bacteria | 195202 |
| 440 | Ga0207425_1000388 | 3300025245 | Bacteria | 29705 |
| 441 | Ga0209026_1002380 | 3300025250 | Bacteria | 7097 |
| 442 | Ga0209129_1000044 | 3300025258 | Bacteria | 298971 |
| 443 | Ga0209129_1001083 | 3300025258 | Bacteria | 16006 |
| 444 | Ga0209565_1000001 | 3300025263 | Bacteria | 2950419 |
| 445 | Ga0209565_1000031 | 3300025263 | Bacteria | 320341 |
| 446 | Ga0209565_1000206 | 3300025263 | Bacteria | 68867 |
| 447 | Ga0209673_1000001 | 3300025273 | Bacteria | 3176258 |
| 448 | Ga0209673_1000674 | 3300025273 | Bacteria | 49444 |
| 449 | Ga0209673_1015571 | 3300025273 | Bacteria | 2880 |
| 450 | Ga0209675_1000001 | 3300025291 | Bacteria | 2950293 |
| 451 | Ga0209675_1000015 | 3300025291 | Bacteria | 403517 |
| 452 | Ga0209676_1000570 | 3300025292 | Bacteria | 55557 |
| 453 | Ga0209676_1000998 | 3300025292 | Bacteria | 33231 |
| 454 | Ga0209676_1001784 | 3300025292 | Bacteria | 18110 |
| 455 | Ga0209676_1039475 | 3300025292 | Bacteria | 1341 |
| 456 | Ga0209025_1000006 | 3300025294 | Bacteria | 1153444 |
| 457 | Ga0209025_1000012 | 3300025294 | Bacteria | 924362 |
| 458 | Ga0209025_1000475 | 3300025294 | Bacteria | 77876 |
| 459 | Ga0209564_1000001 | 3300025295 | Bacteria | 3176258 |
| 460 | Ga0209564_1000037 | 3300025295 | Bacteria | 414794 |
| 461 | Ga0209564_1000996 | 3300025295 | Bacteria | 35381 |
| 462 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 463 | Ga0209758_1000018 | 3300025297 | Bacteria | 753320 |
| 464 | Ga0209758_1000736 | 3300025297 | Bacteria | 47860 |
| 465 | Ga0209758_1031300 | 3300025297 | Bacteria | 2185 |
| 466 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 467 | Ga0209050_1000029 | 3300025298 | Bacteria | 465801 |
| 468 | Ga0209050_1000201 | 3300025298 | Bacteria | 134028 |
| 469 | Ga0209050_1000709 | 3300025298 | Bacteria | 49201 |
| 470 | Ga0209050_1005225 | 3300025298 | Bacteria | 8289 |
| 471 | Ga0209050_1016542 | 3300025298 | Bacteria | 3009 |
| 472 | Ga0209050_1030006 | 3300025298 | Bacteria | 1724 |
| 473 | Ga0209256_1000002 | 3300025299 | Bacteria | 1906740 |
| 474 | Ga0209256_1002877 | 3300025299 | Bacteria | 13057 |
| 475 | Ga0209051_1000100 | 3300025303 | Bacteria | 165053 |
| 476 | Ga0209051_1000798 | 3300025303 | Bacteria | 33097 |
| 477 | Ga0209257_1000208 | 3300025304 | Bacteria | 141393 |
| 478 | Ga0209257_1000273 | 3300025304 | Bacteria | 117663 |
| 479 | Ga0209257_1000493 | 3300025304 | Bacteria | 71002 |
| 480 | Ga0209257_1000896 | 3300025304 | Bacteria | 41831 |
| 481 | Ga0209257_1001045 | 3300025304 | Bacteria | 36833 |
| 482 | Ga0209257_1001168 | 3300025304 | Bacteria | 33231 |
| 483 | Ga0209257_1002196 | 3300025304 | Bacteria | 20183 |
| 484 | Ga0207697_10007900 | 3300025315 | Bacteria | 4701 |
| 485 | Ga0207697_10075189 | 3300025315 | Bacteria | 1419 |
| 486 | Ga0207696_1016053 | 3300025711 | Bacteria | 2517 |
| 487 | Ga0207713_1000445 | 3300025735 | Bacteria | 43504 |
| 488 | Ga0207642_10039477 | 3300025899 | Bacteria | 2051 |
| 489 | Ga0207710_10001276 | 3300025900 | Bacteria | 12714 |
| 490 | Ga0207710_10089290 | 3300025900 | Bacteria | 1440 |
| 491 | Ga0207680_10077036 | 3300025903 | Bacteria | 2084 |
| 492 | Ga0207680_10077737 | 3300025903 | Bacteria | 2077 |
| 493 | Ga0207680_10112898 | 3300025903 | Bacteria | 1766 |
| 494 | Ga0207647_10008924 | 3300025904 | Bacteria | 7150 |
| 495 | Ga0207645_10005050 | 3300025907 | Bacteria | 9668 |
| 496 | Ga0207645_10009707 | 3300025907 | Bacteria | 6649 |
| 497 | Ga0207643_10001752 | 3300025908 | Bacteria | 12121 |
| 498 | Ga0207654_10252755 | 3300025911 | Unclassified | 1182 |
| 499 | Ga0207695_10040313 | 3300025913 | Bacteria | 5010 |
| 500 | Ga0207695_10197319 | 3300025913 | Bacteria | 1928 |
| 501 | Ga0207695_10209490 | 3300025913 | Bacteria | 1860 |
| 502 | Ga0207671_10197129 | 3300025914 | Bacteria | 1571 |
| 503 | Ga0207671_10201936 | 3300025914 | Bacteria | 1553 |
| 504 | Ga0207662_10007677 | 3300025918 | Bacteria | 5876 |
| 505 | Ga0207662_10010309 | 3300025918 | Bacteria | 5159 |
| 506 | Ga0207662_10015467 | 3300025918 | Bacteria | 4293 |
| 507 | Ga0207662_10023443 | 3300025918 | Bacteria | 3546 |
| 508 | Ga0207646_10093154 | 3300025922 | Bacteria | 2697 |
| 509 | Ga0207646_10101801 | 3300025922 | Bacteria | 2575 |
| 510 | Ga0207646_10243182 | 3300025922 | Bacteria | 1626 |
| 511 | Ga0207681_10006282 | 3300025923 | Bacteria | 7295 |
| 512 | Ga0207681_10042902 | 3300025923 | Bacteria | 3024 |
| 513 | Ga0207694_10111187 | 3300025924 | Bacteria | 2179 |
| 514 | Ga0207650_10001485 | 3300025925 | Bacteria | 16814 |
| 515 | Ga0207650_10007102 | 3300025925 | Bacteria | 7629 |
| 516 | Ga0207650_10015962 | 3300025925 | Bacteria | 5239 |
| 517 | Ga0207650_10097529 | 3300025925 | Bacteria | 2257 |
| 518 | Ga0207650_10117377 | 3300025925 | Bacteria | 2068 |
| 519 | Ga0207650_10136821 | 3300025925 | Bacteria | 1922 |
| 520 | Ga0207650_10138597 | 3300025925 | Bacteria | 1911 |
| 521 | Ga0207650_10335452 | 3300025925 | Bacteria | 1241 |
| 522 | Ga0207659_10000110 | 3300025926 | Bacteria | 48302 |
| 523 | Ga0207659_10002884 | 3300025926 | Bacteria | 10231 |
| 524 | Ga0207659_10005234 | 3300025926 | Bacteria | 7858 |
| 525 | Ga0207659_10005455 | 3300025926 | Bacteria | 7711 |
| 526 | Ga0207659_10009646 | 3300025926 | Bacteria | 6039 |
| 527 | Ga0207659_10025939 | 3300025926 | Bacteria | 3947 |
| 528 | Ga0207659_10099132 | 3300025926 | Bacteria | 2193 |
| 529 | Ga0207659_10212906 | 3300025926 | Bacteria | 1550 |
| 530 | Ga0207687_10125483 | 3300025927 | Bacteria | 1926 |
| 531 | Ga0207644_10007549 | 3300025931 | Bacteria | 7090 |
| 532 | Ga0207644_10011367 | 3300025931 | Bacteria | 5889 |
| 533 | Ga0207644_10041929 | 3300025931 | Bacteria | 3240 |
| 534 | Ga0207644_10088751 | 3300025931 | Bacteria | 2300 |
| 535 | Ga0207706_10046751 | 3300025933 | Bacteria | 3831 |
| 536 | Ga0207706_10065021 | 3300025933 | Bacteria | 3212 |
| 537 | Ga0207706_10118701 | 3300025933 | Bacteria | 2326 |
| 538 | Ga0207706_10136090 | 3300025933 | Bacteria | 2161 |
| 539 | Ga0207706_10174814 | 3300025933 | Bacteria | 1886 |
| 540 | Ga0207706_10244336 | 3300025933 | Bacteria | 1569 |
| 541 | Ga0207686_10002104 | 3300025934 | Bacteria | 10966 |
| 542 | Ga0207686_10005442 | 3300025934 | Bacteria | 6836 |
| 543 | Ga0207686_10006277 | 3300025934 | Bacteria | 6396 |
| 544 | Ga0207686_10275402 | 3300025934 | Bacteria | 1240 |
| 545 | Ga0207709_10008442 | 3300025935 | Bacteria | 5697 |
| 546 | Ga0207709_10020870 | 3300025935 | Bacteria | 3701 |
| 547 | Ga0207709_10058163 | 3300025935 | Bacteria | 2401 |
| 548 | Ga0207670_10011792 | 3300025936 | Bacteria | 5087 |
| 549 | Ga0207670_10061176 | 3300025936 | Bacteria | 2569 |
| 550 | Ga0207670_10144790 | 3300025936 | Bacteria | 1756 |
| 551 | Ga0207669_10000758 | 3300025937 | Bacteria | 13943 |
| 552 | Ga0207704_10001200 | 3300025938 | Bacteria | 11545 |
| 553 | Ga0207704_10230296 | 3300025938 | Bacteria | 1377 |
| 554 | Ga0207665_10227534 | 3300025939 | Bacteria | 1369 |
| 555 | Ga0207691_10010734 | 3300025940 | Bacteria | 8793 |
| 556 | Ga0207691_10017127 | 3300025940 | Bacteria | 6874 |
| 557 | Ga0207691_10041774 | 3300025940 | Bacteria | 4231 |
| 558 | Ga0207691_10083538 | 3300025940 | Bacteria | 2867 |
| 559 | Ga0207691_10145049 | 3300025940 | Bacteria | 2090 |
| 560 | Ga0207691_10149499 | 3300025940 | Bacteria | 2054 |
| 561 | Ga0207691_10202520 | 3300025940 | Bacteria | 1727 |
| 562 | Ga0207711_10002106 | 3300025941 | Bacteria | 17974 |
| 563 | Ga0207711_10003658 | 3300025941 | Bacteria | 13289 |
| 564 | Ga0207711_10109413 | 3300025941 | Bacteria | 2456 |
| 565 | Ga0207711_10169430 | 3300025941 | Bacteria | 1981 |
| 566 | Ga0207711_10217721 | 3300025941 | Unclassified | 1745 |
| 567 | Ga0207711_10232479 | 3300025941 | Bacteria | 1689 |
| 568 | Ga0207689_10004598 | 3300025942 | Bacteria | 12488 |
| 569 | Ga0207689_10181233 | 3300025942 | Bacteria | 1737 |
| 570 | Ga0207661_10001850 | 3300025944 | Bacteria | 14484 |
| 571 | Ga0207661_10076664 | 3300025944 | Bacteria | 2746 |
| 572 | Ga0207679_10007781 | 3300025945 | Bacteria | 6810 |
| 573 | Ga0207679_10065127 | 3300025945 | Bacteria | 2726 |
| 574 | Ga0207679_10168876 | 3300025945 | Bacteria | 1799 |
| 575 | Ga0207651_10007650 | 3300025960 | Bacteria | 5769 |
| 576 | Ga0207651_10023309 | 3300025960 | Bacteria | 3804 |
| 577 | Ga0207651_10125745 | 3300025960 | Bacteria | 1953 |
| 578 | Ga0207651_10246909 | 3300025960 | Bacteria | 1458 |
| 579 | Ga0207651_10294267 | 3300025960 | Bacteria | 1347 |
| 580 | Ga0207651_10310162 | 3300025960 | Bacteria | 1315 |
| 581 | Ga0207712_10007112 | 3300025961 | Bacteria | 7056 |
| 582 | Ga0207712_10044185 | 3300025961 | Bacteria | 3078 |
| 583 | Ga0207712_10180717 | 3300025961 | Bacteria | 1657 |
| 584 | Ga0207712_10232366 | 3300025961 | Bacteria | 1481 |
| 585 | Ga0207640_10038990 | 3300025981 | Bacteria | 3003 |
| 586 | Ga0207640_10058860 | 3300025981 | Bacteria | 2533 |
| 587 | Ga0207640_10072245 | 3300025981 | Bacteria | 2327 |
| 588 | Ga0207640_10181997 | 3300025981 | Bacteria | 1577 |
| 589 | Ga0207658_10017674 | 3300025986 | Bacteria | 4917 |
| 590 | Ga0207658_10056542 | 3300025986 | Bacteria | 2912 |
| 591 | Ga0207658_10165239 | 3300025986 | Bacteria | 1817 |
| 592 | Ga0207658_10216821 | 3300025986 | Bacteria | 1607 |
| 593 | Ga0207703_10001472 | 3300026035 | Bacteria | 21466 |
| 594 | Ga0207703_10001628 | 3300026035 | Bacteria | 20230 |
| 595 | Ga0207703_10001635 | 3300026035 | Bacteria | 20195 |
| 596 | Ga0207703_10090140 | 3300026035 | Bacteria | 2576 |
| 597 | Ga0207703_10124888 | 3300026035 | Bacteria | 2214 |
| 598 | Ga0207639_10332689 | 3300026041 | Bacteria | 1352 |
| 599 | Ga0207678_10038324 | 3300026067 | Bacteria | 4165 |
| 600 | Ga0207678_10093256 | 3300026067 | Bacteria | 2573 |
| 601 | Ga0207678_10363542 | 3300026067 | Bacteria | 1249 |
| 602 | Ga0207708_10009619 | 3300026075 | Bacteria | 7168 |
| 603 | Ga0207708_10020509 | 3300026075 | Bacteria | 4985 |
| 604 | Ga0207708_10214961 | 3300026075 | Bacteria | 1538 |
| 605 | Ga0207702_10445246 | 3300026078 | Bacteria | 1256 |
| 606 | Ga0207641_10000005 | 3300026088 | Bacteria | 470841 |
| 607 | Ga0207641_10028560 | 3300026088 | Bacteria | 4609 |
| 608 | Ga0207641_10037410 | 3300026088 | Bacteria | 4052 |
| 609 | Ga0207641_10093846 | 3300026088 | Bacteria | 2631 |
| 610 | Ga0207641_10121503 | 3300026088 | Bacteria | 2332 |
| 611 | Ga0207648_10006060 | 3300026089 | Bacteria | 12057 |
| 612 | Ga0207648_10010861 | 3300026089 | Bacteria | 8608 |
| 613 | Ga0207648_10071064 | 3300026089 | Bacteria | 3034 |
| 614 | Ga0207648_10110095 | 3300026089 | Bacteria | 2418 |
| 615 | Ga0207648_10206383 | 3300026089 | Bacteria | 1744 |
| 616 | Ga0207676_10002609 | 3300026095 | Bacteria | 12852 |
| 617 | Ga0207676_10020241 | 3300026095 | Bacteria | 4865 |
| 618 | Ga0207676_10194997 | 3300026095 | Bacteria | 1785 |
| 619 | Ga0207676_10212861 | 3300026095 | Bacteria | 1716 |
| 620 | Ga0207676_10411425 | 3300026095 | Bacteria | 1266 |
| 621 | Ga0207674_10032779 | 3300026116 | Bacteria | 5446 |
| 622 | Ga0207674_10078540 | 3300026116 | Bacteria | 3305 |
| 623 | Ga0207674_10095302 | 3300026116 | Bacteria | 2962 |
| 624 | Ga0207674_10229405 | 3300026116 | Bacteria | 1804 |
| 625 | Ga0207675_100004144 | 3300026118 | Bacteria | 14034 |
| 626 | Ga0207675_100004655 | 3300026118 | Bacteria | 13215 |
| 627 | Ga0207675_100039417 | 3300026118 | Bacteria | 4409 |
| 628 | Ga0207675_100089543 | 3300026118 | Bacteria | 2892 |
| 629 | Ga0207675_100117617 | 3300026118 | Bacteria | 2513 |
| 630 | Ga0207675_100131679 | 3300026118 | Bacteria | 2372 |
| 631 | Ga0207675_100232526 | 3300026118 | Bacteria | 1779 |
| 632 | Ga0207675_100355489 | 3300026118 | Unclassified | 1436 |
| 633 | Ga0207683_10253076 | 3300026121 | Bacteria | 1608 |
| 634 | Ga0207698_10142204 | 3300026142 | Bacteria | 2069 |
| 635 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 636 | Ga0209371_1000011 | 3300027312 | Bacteria | 848456 |
| 637 | Ga0207428_10000331 | 3300027907 | Bacteria | 61372 |
| 638 | Ga0207428_10000814 | 3300027907 | Bacteria | 35226 |
| 639 | Ga0207428_10023480 | 3300027907 | Bacteria | 5187 |
| 640 | Ga0207428_10023677 | 3300027907 | Bacteria | 5160 |
| 641 | Ga0207428_10089873 | 3300027907 | Bacteria | 2386 |
| 642 | Ga0207428_10109115 | 3300027907 | Unclassified | 2131 |
| 643 | Ga0207428_10145544 | 3300027907 | Bacteria | 1806 |
| 644 | Ga0207428_10151620 | 3300027907 | Bacteria | 1764 |
| 645 | Ga0268266_10007235 | 3300028379 | Bacteria | 10038 |
| 646 | Ga0268266_10037406 | 3300028379 | Bacteria | 4135 |
| 647 | Ga0268265_10024226 | 3300028380 | Bacteria | 4291 |
| 648 | Ga0268265_10073703 | 3300028380 | Bacteria | 2667 |
| 649 | Ga0268265_10100210 | 3300028380 | Bacteria | 2337 |
| 650 | Ga0268265_10130797 | 3300028380 | Bacteria | 2085 |
| 651 | Ga0268265_10341374 | 3300028380 | Bacteria | 1364 |
| 652 | Ga0268264_10000100 | 3300028381 | Bacteria | 227852 |
| 653 | Ga0268264_10044990 | 3300028381 | Bacteria | 3664 |
| 654 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 655 | Ga0268256_1000011 | 3300030500 | Bacteria | 848625 |
| 656 | Ga0307511_10000260 | 3300030521 | Bacteria | 54540 |
| 657 | Ga0307511_10017236 | 3300030521 | Bacteria | 6936 |
| 658 | Ga0307511_10018661 | 3300030521 | Bacteria | 6618 |
| 659 | Ga0316176_1017131 | 3300030732 | Bacteria | 3060 |
| 660 | Ga0316183_1083776 | 3300030742 | Bacteria | 2371 |
| 661 | Ga0307513_10055717 | 3300031456 | Bacteria | 4228 |
| 662 | Ga0307508_10251272 | 3300031616 | Bacteria | 1364 |
| 663 | Ga0307516_10000034 | 3300031730 | Bacteria | 155251 |
| 664 | Ga0307413_10010611 | 3300031824 | Bacteria | 4482 |
| 665 | Ga0307410_10024217 | 3300031852 | Bacteria | 3790 |
| 666 | Ga0307406_10129684 | 3300031901 | Bacteria | 1768 |
| 667 | Ga0307412_10001045 | 3300031911 | Bacteria | 15821 |
| 668 | Ga0307412_10003164 | 3300031911 | Bacteria | 9146 |
| 669 | Ga0307409_100013022 | 3300031995 | Bacteria | 5330 |
| 670 | Ga0307409_100018478 | 3300031995 | Bacteria | 4689 |
| 671 | Ga0307409_100293851 | 3300031995 | Bacteria | 1508 |
| 672 | Ga0307416_100086564 | 3300032002 | Bacteria | 2671 |
| 673 | Ga0307414_10276437 | 3300032004 | Bacteria | 1409 |
| 674 | Ga0307411_10121049 | 3300032005 | Bacteria | 1893 |
| 675 | Ga0307415_100104302 | 3300032126 | Bacteria | 2088 |
| 676 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 677 | Ga0307510_10008818 | 3300033180 | Bacteria | 12020 |
| 678 | Ga0373948_0008419 | 3300034817 | Bacteria | 1755 |
| 679 | Ga0373950_0006066 | 3300034818 | Bacteria | 1827 |
| 680 | Ga0373959_0002412 | 3300034820 | Bacteria | 2973 |
| 681 | Ga0373938_0000534 | 3300034957 | Bacteria | 6149 |
| 682 | Ga0373928_0002510 | 3300035084 | Bacteria | 3553 |
| 683 | Ga0373929_0000719 | 3300035085 | Bacteria | 6404 |
| 684 | Ga0373940_0000338 | 3300035088 | Bacteria | 6940 |
| 685 | Ga0373949_0002015 | 3300035090 | Bacteria | 5419 |
| 686 | Ga0373951_0000760 | 3300035091 | Bacteria | 8821 |
| 687 | Ga0373932_0002231 | 3300035112 | Bacteria | 4978 |
| 688 | Ga0373932_0049668 | 3300035112 | Bacteria | 1241 |
| 689 | Ga0373936_0004159 | 3300035113 | Bacteria | 5454 |
| 690 | Ga0373939_0000610 | 3300035114 | Bacteria | 8857 |
| 691 | Ga0373941_0000441 | 3300035115 | Bacteria | 8235 |
| 692 | Ga0373960_0000099 | 3300035121 | Bacteria | 13644 |
| 693 | Ga0373942_0000501 | 3300035207 | Bacteria | 11054 |
| 694 | Ga0373961_0001461 | 3300035241 | Bacteria | 6948 |
| 695 | Ga0373962_0002767 | 3300035242 | Bacteria | 4183 |
| 696 | Ga0373931_0004832 | 3300035691 | Bacteria | 6189 |
| 697 | Ga0373935_0223138 | 3300035692 | Bacteria | 1310 |
| 698 | Ga0373947_0297085 | 3300035725 | Bacteria | 1076 |
| 699 | Ga0373925_0121611 | 3300037068 | Bacteria | 2027 |
| 700 | Ga0395905_0000174 | 3300037471 | Bacteria | 104301 |
| 701 | Ga0395905_0234766 | 3300037471 | Bacteria | 1714 |
| 702 | Ga0237819_00014 | 3300038705 | Bacteria | 59581 |
| 703 | Ga0439436_0000046 | 3300041404 | Bacteria | 36987 |
| 704 | Ga0439447_002290 | 3300041407 | Bacteria | 7019 |
| 705 | Ga0439465_0000157 | 3300041413 | Bacteria | 16967 |
| 706 | Ga0439448_0000557 | 3300042005 | Bacteria | 8732 |
| 707 | Ga0439448_0006523 | 3300042005 | Bacteria | 3359 |
| 708 | Ga0439432_032812 | 3300042006 | Bacteria | 1673 |
| 709 | Ga0439446_0072737 | 3300042156 | Bacteria | 1054 |
| 710 | Ga0439458_0001347 | 3300042157 | Bacteria | 6192 |
| 711 | Ga0439458_0002817 | 3300042157 | Bacteria | 4185 |
| 712 | Ga0450908_000067 | 3300042184 | Bacteria | 20606 |
| 713 | Ga0439434_0021324 | 3300042435 | Bacteria | 1947 |
| 714 | Ga0439434_0037382 | 3300042435 | Bacteria | 1487 |
| 715 | Ga0439464_0053343 | 3300042439 | Unclassified | 1173 |
| 716 | Ga0439460_0014263 | 3300042461 | Bacteria | 2088 |
| 717 | Ga0466969_0005283 | 3300044656 | Bacteria | 6873 |
| 718 | Ga0451576_0038031 | 3300045051 | Bacteria | 5095 |
| 719 | Ga0451576_0055575 | 3300045051 | Bacteria | 4141 |
| 720 | Ga0451576_0559693 | 3300045051 | Bacteria | 1201 |
| 721 | Ga0495603_0204627 | 3300046455 | Bacteria | 1141 |
| 722 | Ga0495638_0000523 | 3300046460 | Bacteria | 44816 |
| 723 | Ga0495638_0000642 | 3300046460 | Bacteria | 38350 |
| 724 | Ga0495594_0144900 | 3300046499 | Bacteria | 1348 |
| 725 | Ga0495607_0002111 | 3300046501 | Bacteria | 16600 |
| 726 | Ga0495607_0027190 | 3300046501 | Bacteria | 3541 |
| 727 | Ga0495583_0092854 | 3300046506 | Unclassified | 1297 |
| 728 | Ga0495606_0014574 | 3300046507 | Bacteria | 6119 |
| 729 | Ga0495610_0000184 | 3300046512 | Bacteria | 69871 |
| 730 | Ga0495643_0000767 | 3300046522 | Bacteria | 35872 |
| 731 | Ga0495648_0079689 | 3300046524 | Bacteria | 1868 |
| 732 | Ga0495663_0011295 | 3300046525 | Bacteria | 2486 |
| 733 | Ga0495609_0143298 | 3300046538 | Bacteria | 1019 |
| 734 | Ga0495621_0045606 | 3300046539 | Bacteria | 1553 |
| 735 | Ga0495633_0005263 | 3300046558 | Bacteria | 7968 |
| 736 | Ga0495668_0000024 | 3300046616 | Bacteria | 359469 |
| 737 | Ga0495668_0005888 | 3300046616 | Bacteria | 8163 |
| 738 | Ga0495625_0000153 | 3300046660 | Bacteria | 105123 |
| 739 | Ga0495625_0020533 | 3300046660 | Bacteria | 5097 |
| 740 | Ga0495659_0009276 | 3300046664 | Bacteria | 3138 |
| 741 | Ga0495659_0012961 | 3300046664 | Bacteria | 2709 |
| 742 | Ga0495659_0067026 | 3300046664 | Bacteria | 1338 |
| 743 | Ga0495659_0085380 | 3300046664 | Bacteria | 1204 |
| 744 | Ga0495647_0026822 | 3300046681 | Bacteria | 2114 |
| 745 | Ga0495658_0198613 | 3300046683 | Bacteria | 1249 |
| 746 | Ga0495669_0007859 | 3300046684 | Bacteria | 4475 |
| 747 | Ga0495669_0053541 | 3300046684 | Bacteria | 1815 |
| 748 | Ga0495613_0255125 | 3300046689 | Bacteria | 1223 |
| 749 | Ga0495670_0000002 | 3300046691 | Bacteria | 601814 |
| 750 | Ga0495670_0005324 | 3300046691 | Bacteria | 6332 |
| 751 | Ga0495671_0065859 | 3300046692 | Bacteria | 1783 |
| 752 | Ga0495671_0074127 | 3300046692 | Bacteria | 1670 |
| 753 | Ga0495636_0020569 | 3300047318 | Unclassified | 2660 |
| 754 | Ga0495672_0000230 | 3300047320 | Bacteria | 79829 |
| 755 | Ga0495686_0012441 | 3300047472 | Bacteria | 5950 |
| 756 | Ga0495686_0034422 | 3300047472 | Bacteria | 3263 |
| 757 | Ga0495686_0057275 | 3300047472 | Bacteria | 2433 |
| 758 | Ga0496100_0102951 | 3300048903 | Bacteria | 1971 |
| 759 | Ga0496102_0015105 | 3300048905 | Bacteria | 6722 |
| 760 | Ga0496102_0015973 | 3300048905 | Bacteria | 6551 |
| 761 | Ga0496102_0123104 | 3300048905 | Bacteria | 2423 |
| 762 | Ga0496102_0287319 | 3300048905 | Bacteria | 1550 |
| 763 | Ga0496104_0003434 | 3300048907 | Bacteria | 13662 |
| 764 | Ga0496104_0056292 | 3300048907 | Bacteria | 3718 |
| 765 | Ga0496105_0023194 | 3300048908 | Bacteria | 5031 |
| 766 | Ga0496106_0019449 | 3300048909 | Bacteria | 5037 |
| 767 | Ga0496106_0082458 | 3300048909 | Bacteria | 2472 |
| 768 | Ga0496106_0304668 | 3300048909 | Bacteria | 1278 |
| 769 | Ga0496108_0002594 | 3300048911 | Bacteria | 14473 |
| 770 | Ga0496108_0004453 | 3300048911 | Bacteria | 11277 |
| 771 | Ga0496109_0003044 | 3300048912 | Bacteria | 13976 |
| 772 | Ga0496109_0181430 | 3300048912 | Bacteria | 1977 |
| 773 | Ga0496109_0246009 | 3300048912 | Bacteria | 1684 |
| 774 | Ga0496109_0678982 | 3300048912 | Unclassified | 967 |
| 775 | Ga0496110_0004462 | 3300048913 | Bacteria | 10853 |
| 776 | Ga0496112_0002100 | 3300048915 | Bacteria | 15812 |
| 777 | Ga0496112_0008114 | 3300048915 | Bacteria | 9378 |
| 778 | Ga0496112_0096532 | 3300048915 | Unclassified | 2926 |
| 779 | Ga0496113_0010492 | 3300048916 | Bacteria | 6125 |
| 780 | Ga0496113_0254245 | 3300048916 | Bacteria | 1403 |
| 781 | Ga0496114_0045076 | 3300048917 | Bacteria | 3662 |
| 782 | Ga0496114_0476538 | 3300048917 | Bacteria | 1104 |
| 783 | Ga0496115_0008535 | 3300048918 | Bacteria | 7582 |
| 784 | Ga0496116_0050858 | 3300048919 | Bacteria | 2757 |
| 785 | Ga0496116_0127826 | 3300048919 | Bacteria | 1455 |
| 786 | Ga0496117_0000035 | 3300048920 | Bacteria | 326449 |
| 787 | Ga0496117_0002617 | 3300048920 | Bacteria | 22352 |
| 788 | Ga0496117_0003560 | 3300048920 | Bacteria | 17974 |
| 789 | Ga0496117_0009832 | 3300048920 | Bacteria | 8809 |
| 790 | Ga0496117_0172962 | 3300048920 | Bacteria | 1251 |
| 791 | Ga0496118_0000038 | 3300048921 | Bacteria | 315464 |
| 792 | Ga0496118_0000944 | 3300048921 | Bacteria | 45453 |
| 793 | Ga0496118_0001666 | 3300048921 | Bacteria | 32615 |
| 794 | Ga0496118_0019847 | 3300048921 | Bacteria | 5990 |
| 795 | Ga0496118_0061323 | 3300048921 | Bacteria | 2785 |
| 796 | Ga0496119_0000596 | 3300048922 | Bacteria | 48957 |
| 797 | Ga0496119_0003923 | 3300048922 | Bacteria | 15086 |
| 798 | Ga0496119_0020625 | 3300048922 | Bacteria | 4799 |
| 799 | Ga0496119_0045327 | 3300048922 | Bacteria | 2757 |
| 800 | Ga0496120_0000591 | 3300048923 | Bacteria | 54957 |
| 801 | Ga0496120_0002725 | 3300048923 | Bacteria | 17263 |
| 802 | Ga0496120_0010224 | 3300048923 | Bacteria | 6569 |
| 803 | Ga0496120_0012981 | 3300048923 | Bacteria | 5635 |
| 804 | Ga0496120_0040421 | 3300048923 | Bacteria | 2740 |
| 805 | Ga0496121_0000036 | 3300048924 | Bacteria | 362643 |
| 806 | Ga0496121_0000332 | 3300048924 | Bacteria | 98654 |
| 807 | Ga0496121_0004638 | 3300048924 | Bacteria | 18274 |
| 808 | Ga0496121_0004643 | 3300048924 | Bacteria | 18264 |
| 809 | Ga0496121_0016951 | 3300048924 | Bacteria | 7484 |
| 810 | Ga0496122_0003813 | 3300048925 | Bacteria | 19401 |
| 811 | Ga0496122_0003919 | 3300048925 | Bacteria | 19038 |
| 812 | Ga0496122_0004805 | 3300048925 | Bacteria | 16507 |
| 813 | Ga0496122_0008759 | 3300048925 | Bacteria | 10821 |
| 814 | Ga0496122_0027450 | 3300048925 | Bacteria | 4866 |
| 815 | Ga0496122_0136023 | 3300048925 | Bacteria | 1548 |
| 816 | Ga0496123_0003419 | 3300048926 | Bacteria | 17867 |
| 817 | Ga0496123_0007270 | 3300048926 | Bacteria | 10508 |
| 818 | Ga0496123_0013647 | 3300048926 | Bacteria | 6797 |
| 819 | Ga0496123_0051832 | 3300048926 | Bacteria | 2729 |
| 820 | Ga0496123_0065000 | 3300048926 | Bacteria | 2321 |
| 821 | Ga0496123_0065191 | 3300048926 | Bacteria | 2317 |
| 822 | Ga0496124_0000071 | 3300048927 | Bacteria | 220642 |
| 823 | Ga0496124_0002463 | 3300048927 | Bacteria | 24200 |
| 824 | Ga0496124_0007392 | 3300048927 | Bacteria | 11684 |
| 825 | Ga0496124_0027703 | 3300048927 | Bacteria | 5078 |
| 826 | Ga0496124_0067845 | 3300048927 | Bacteria | 2966 |
| 827 | Ga0496124_0082468 | 3300048927 | Bacteria | 2639 |
| 828 | Ga0496124_0087772 | 3300048927 | Bacteria | 2543 |
| 829 | Ga0496125_0003007 | 3300048928 | Bacteria | 21093 |
| 830 | Ga0496125_0010198 | 3300048928 | Bacteria | 9524 |
| 831 | Ga0496125_0031098 | 3300048928 | Bacteria | 4764 |
| 832 | Ga0496125_0033625 | 3300048928 | Bacteria | 4534 |
| 833 | Ga0496125_0138338 | 3300048928 | Bacteria | 1698 |
| 834 | Ga0496125_0172989 | 3300048928 | Bacteria | 1449 |
| 835 | Ga0496125_0177087 | 3300048928 | Bacteria | 1425 |
| 836 | Ga0496126_0013261 | 3300048929 | Bacteria | 8397 |
| 837 | Ga0501031_0207395 | 3300049568 | Bacteria | 1278 |
| 838 | Ga0501032_0006519 | 3300049569 | Bacteria | 8576 |
| 839 | Ga0501032_0054984 | 3300049569 | Bacteria | 2678 |
| 840 | Ga0501034_0009602 | 3300049571 | Bacteria | 10122 |
| 841 | Ga0501034_0021706 | 3300049571 | Bacteria | 6541 |
| 842 | Ga0501036_0047615 | 3300049572 | Bacteria | 3630 |
| 843 | Ga0501036_0095789 | 3300049572 | Bacteria | 2509 |
| 844 | Ga0501036_0295012 | 3300049572 | Bacteria | 1356 |
| 845 | Ga0501037_0117345 | 3300049573 | Bacteria | 1915 |
| 846 | Ga0501038_0009816 | 3300049574 | Bacteria | 8764 |
| 847 | Ga0501038_0080664 | 3300049574 | Bacteria | 2742 |
| 848 | Ga0501038_0107195 | 3300049574 | Unclassified | 2318 |
| 849 | Ga0501039_0014224 | 3300049575 | Bacteria | 6093 |
| 850 | Ga0501039_0030770 | 3300049575 | Bacteria | 4139 |
| 851 | Ga0501039_0048953 | 3300049575 | Bacteria | 3267 |
| 852 | Ga0501039_0299277 | 3300049575 | Bacteria | 1265 |
| 853 | Ga0501040_0023710 | 3300049576 | Bacteria | 4115 |
| 854 | Ga0501040_0111501 | 3300049576 | Bacteria | 1913 |
| 855 | Ga0501040_0204608 | 3300049576 | Bacteria | 1402 |
| 856 | Ga0501041_0068088 | 3300049577 | Bacteria | 2182 |
| 857 | Ga0501041_0071871 | 3300049577 | Unclassified | 2124 |
| 858 | Ga0501042_0039490 | 3300049578 | Bacteria | 3354 |
| 859 | Ga0501043_0003083 | 3300049579 | Bacteria | 13841 |
| 860 | Ga0501043_0034044 | 3300049579 | Bacteria | 4007 |
| 861 | Ga0501043_0146341 | 3300049579 | Bacteria | 1850 |
| 862 | Ga0501046_0013245 | 3300049580 | Bacteria | 6988 |
| 863 | Ga0501046_0145509 | 3300049580 | Bacteria | 1790 |
| 864 | Ga0501046_0164993 | 3300049580 | Bacteria | 1664 |
| 865 | Ga0501047_0000090 | 3300049581 | Bacteria | 116416 |
| 866 | Ga0501047_0038513 | 3300049581 | Bacteria | 4625 |
| 867 | Ga0501047_0047353 | 3300049581 | Bacteria | 4154 |
| 868 | Ga0501047_0060947 | 3300049581 | Bacteria | 3640 |
| 869 | Ga0501048_0044212 | 3300049582 | Bacteria | 3186 |
| 870 | Ga0501048_0115898 | 3300049582 | Bacteria | 1893 |
| 871 | Ga0501048_0168900 | 3300049582 | Bacteria | 1549 |
| 872 | Ga0501067_0025768 | 3300049583 | Bacteria | 3259 |
| 873 | Ga0501067_0053450 | 3300049583 | Bacteria | 2238 |
| 874 | Ga0501068_0045583 | 3300049584 | Bacteria | 2642 |
| 875 | Ga0501068_0093923 | 3300049584 | Bacteria | 1853 |
| 876 | Ga0501070_0074157 | 3300049586 | Bacteria | 2817 |
| 877 | Ga0501071_0141297 | 3300049587 | Bacteria | 1793 |
| 878 | Ga0501071_0152577 | 3300049587 | Bacteria | 1724 |
| 879 | Ga0501072_0037550 | 3300049588 | Bacteria | 3799 |
| 880 | Ga0501072_0052135 | 3300049588 | Bacteria | 3221 |
| 881 | Ga0501073_0018115 | 3300049589 | Bacteria | 5091 |
| 882 | Ga0501073_0070581 | 3300049589 | Bacteria | 2433 |
| 883 | Ga0501073_0094712 | 3300049589 | Bacteria | 2074 |
| 884 | Ga0501074_0101980 | 3300049590 | Bacteria | 2054 |
| 885 | Ga0501074_0180195 | 3300049590 | Bacteria | 1507 |
| 886 | Ga0501074_0207311 | 3300049590 | Bacteria | 1397 |
| 887 | Ga0501075_0043745 | 3300049591 | Bacteria | 3359 |
| 888 | Ga0501075_0115351 | 3300049591 | Unclassified | 2042 |
| 889 | Ga0501075_0163329 | 3300049591 | Bacteria | 1699 |
| 890 | Ga0501076_0055252 | 3300049592 | Bacteria | 3149 |
| 891 | Ga0501076_0089822 | 3300049592 | Bacteria | 2470 |
| 892 | Ga0501076_0116632 | 3300049592 | Bacteria | 2161 |
| 893 | Ga0501077_0024880 | 3300049593 | Bacteria | 3802 |
| 894 | Ga0501079_0007223 | 3300049741 | Bacteria | 8386 |
| 895 | Ga0501079_0008840 | 3300049741 | Bacteria | 7627 |
| 896 | Ga0501079_0064166 | 3300049741 | Bacteria | 2833 |
| 897 | Ga0501080_0009143 | 3300049742 | Bacteria | 9022 |
| 898 | Ga0501080_0136327 | 3300049742 | Bacteria | 2271 |
| 899 | Ga0501080_0241661 | 3300049742 | Bacteria | 1648 |
| 900 | Ga0501081_0045427 | 3300049743 | Bacteria | 3016 |
| 901 | Ga0501081_0103222 | 3300049743 | Bacteria | 2017 |
| 902 | Ga0501083_0014694 | 3300049744 | Bacteria | 5472 |
| 903 | Ga0501035_0016181 | 3300049822 | Bacteria | 6882 |
| 904 | Ga0501044_0002228 | 3300049823 | Bacteria | 22202 |
| 905 | Ga0501044_0014647 | 3300049823 | Bacteria | 8456 |
| 906 | Ga0501044_0104326 | 3300049823 | Bacteria | 2849 |
| 907 | Ga0501045_0018516 | 3300049824 | Bacteria | 4955 |
| 908 | Ga0501045_0032318 | 3300049824 | Bacteria | 3792 |
| 909 | nmdc:mga03683_51_c1 | 3300050489 | Bacteria | 50013 |
| 910 | nmdc:mga03683_8724_c1 | 3300050489 | Bacteria | 3576 |
| 911 | nmdc:mga03n38_172_c1 | 3300050490 | Bacteria | 14385 |
| 912 | nmdc:mga00v17_3776_c1 | 3300050491 | Bacteria | 7824 |
| 913 | nmdc:mga00v17_61120_c1 | 3300050491 | Bacteria | 2315 |
| 914 | nmdc:mga00v17_64538_c1 | 3300050491 | Bacteria | 2257 |
| 915 | nmdc:mga0yw44_32028_c1 | 3300050492 | Bacteria | 3061 |
| 916 | nmdc:mga0k408_3210_c2 | 3300050493 | Bacteria | 5327 |
| 917 | nmdc:mga0k408_3_c1 | 3300050493 | Bacteria | 243777 |
| 918 | nmdc:mga06z11_6749_c1 | 3300050494 | Bacteria | 4690 |
| 919 | nmdc:mga07m45_63713_c1 | 3300050496 | Bacteria | 2091 |
| 920 | nmdc:mga07m45_6_c1 | 3300050496 | Bacteria | 260521 |
| 921 | nmdc:mga05p37_113658_c1 | 3300050507 | Bacteria | 3329 |
| 922 | nmdc:mga05p37_114217_c1 | 3300050507 | Bacteria | 3319 |
| 923 | nmdc:mga05p37_14429_c1 | 3300050507 | Bacteria | 9483 |
| 924 | nmdc:mga05p37_14951_c1 | 3300050507 | Bacteria | 9317 |
| 925 | nmdc:mga05p37_17170_c1 | 3300050507 | Bacteria | 8732 |
| 926 | nmdc:mga05p37_173268_c1 | 3300050507 | Bacteria | 2630 |
| 927 | nmdc:mga05p37_17374_c1 | 3300050507 | Bacteria | 8680 |
| 928 | nmdc:mga05p37_195680_c1 | 3300050507 | Bacteria | 2451 |
| 929 | nmdc:mga05p37_20417_c1 | 3300050507 | Bacteria | 8013 |
| 930 | nmdc:mga05p37_26138_c1 | 3300050507 | Bacteria | 7098 |
| 931 | nmdc:mga05p37_38418_c1 | 3300050507 | Bacteria | 5872 |
| 932 | nmdc:mga05p37_5461_c1 | 3300050507 | Bacteria | 14920 |
| 933 | nmdc:mga05p37_56964_c1 | 3300050507 | Bacteria | 4813 |
| 934 | nmdc:mga05p37_5779_c1 | 3300050507 | Bacteria | 14547 |
| 935 | nmdc:mga05p37_64255_c1 | 3300050507 | Bacteria | 4516 |
| 936 | nmdc:mga05p37_86332_c1 | 3300050507 | Bacteria | 3867 |
| 937 | nmdc:mga09592_235295_c1 | 3300050508 | Bacteria | 1587 |
| 938 | nmdc:mga09592_241463_c1 | 3300050508 | Unclassified | 1565 |
| 939 | nmdc:mga09592_479822_c1 | 3300050508 | Bacteria | 1071 |
| 940 | nmdc:mga09592_74670_c1 | 3300050508 | Bacteria | 2881 |
| 941 | nmdc:mga09592_75144_c1 | 3300050508 | Bacteria | 2872 |
| 942 | nmdc:mga0qj67_107382_c1 | 3300050509 | Bacteria | 2252 |
| 943 | nmdc:mga0qj67_2660_c1 | 3300050509 | Bacteria | 12799 |
| 944 | nmdc:mga0qj67_278522_c1 | 3300050509 | Bacteria | 1356 |
| 945 | nmdc:mga0qj67_66995_c1 | 3300050509 | Bacteria | 2860 |
| 946 | nmdc:mga0qj67_82798_c1 | 3300050509 | Bacteria | 2573 |
| 947 | nmdc:mga06r32_173540_c1 | 3300050510 | Unclassified | 2140 |
| 948 | nmdc:mga06r32_225664_c1 | 3300050510 | Unclassified | 1862 |
| 949 | nmdc:mga06r32_29624_c1 | 3300050510 | Bacteria | 5132 |
| 950 | nmdc:mga06r32_50480_c1 | 3300050510 | Bacteria | 3979 |
| 951 | nmdc:mga06r32_58760_c1 | 3300050510 | Bacteria | 3696 |
| 952 | nmdc:mga06r32_9095_c1 | 3300050510 | Bacteria | 8956 |
| 953 | nmdc:mga06r32_91728_c1 | 3300050510 | Bacteria | 2969 |
| 954 | nmdc:mga08y16_102855_c1 | 3300050511 | Bacteria | 2974 |
| 955 | nmdc:mga08y16_13609_c1 | 3300050511 | Bacteria | 8563 |
| 956 | nmdc:mga08y16_295858_c1 | 3300050511 | Unclassified | 1669 |
| 957 | nmdc:mga08y16_39_c1 | 3300050511 | Bacteria | 131064 |
| 958 | nmdc:mga08y16_416437_c1 | 3300050511 | Bacteria | 1374 |
| 959 | nmdc:mga08y16_6402_c1 | 3300050511 | Bacteria | 12343 |
| 960 | nmdc:mga08y16_6676_c1 | 3300050511 | Bacteria | 12101 |
| 961 | nmdc:mga08y16_70504_c1 | 3300050511 | Bacteria | 3643 |
| 962 | nmdc:mga08y16_88590_c1 | 3300050511 | Bacteria | 3225 |
| 963 | nmdc:mga0n895_10029_c1 | 3300050512 | Bacteria | 8336 |
| 964 | nmdc:mga0n895_104824_c1 | 3300050512 | Bacteria | 2840 |
| 965 | nmdc:mga0n895_125962_c1 | 3300050512 | Unclassified | 2585 |
| 966 | nmdc:mga0n895_16181_c1 | 3300050512 | Bacteria | 6838 |
| 967 | nmdc:mga0n895_16737_c1 | 3300050512 | Bacteria | 6737 |
| 968 | nmdc:mga0n895_168210_c1 | 3300050512 | Bacteria | 2224 |
| 969 | nmdc:mga0n895_19263_c1 | 3300050512 | Bacteria | 6338 |
| 970 | nmdc:mga0n895_240200_c1 | 3300050512 | Bacteria | 1838 |
| 971 | nmdc:mga0n895_412145_c1 | 3300050512 | Bacteria | 1366 |
| 972 | nmdc:mga0n895_4246_c1 | 3300050512 | Bacteria | 11718 |
| 973 | nmdc:mga0n895_4336_c1 | 3300050512 | Bacteria | 11626 |
| 974 | nmdc:mga0n895_44683_c1 | 3300050512 | Bacteria | 4320 |
| 975 | nmdc:mga0n895_57949_c1 | 3300050512 | Bacteria | 3819 |
| 976 | nmdc:mga0n895_81032_c1 | 3300050512 | Bacteria | 3234 |
| 977 | nmdc:mga0n895_84598_c1 | 3300050512 | Bacteria | 3165 |
| 978 | nmdc:mga0rr50_1067_c1 | 3300050513 | Bacteria | 14898 |
| 979 | nmdc:mga0rr50_124699_c1 | 3300050513 | Bacteria | 2055 |
| 980 | nmdc:mga0rr50_127921_c1 | 3300050513 | Bacteria | 2030 |
| 981 | nmdc:mga0rr50_22805_c1 | 3300050513 | Unclassified | 4303 |
| 982 | nmdc:mga0rr50_4416_c1 | 3300050513 | Bacteria | 8266 |
| 983 | nmdc:mga0rr50_46935_c1 | 3300050513 | Bacteria | 3182 |
| 984 | nmdc:mga0rr50_58034_c1 | 3300050513 | Bacteria | 2899 |
| 985 | nmdc:mga0rr50_64007_c1 | 3300050513 | Bacteria | 2780 |
| 986 | nmdc:mga0rr50_73754_c1 | 3300050513 | Bacteria | 2610 |
| 987 | nmdc:mga08x19_169313_c1 | 3300050514 | Bacteria | 1487 |
| 988 | nmdc:mga08x19_23227_c1 | 3300050514 | Bacteria | 3846 |
| 989 | nmdc:mga08x19_53223_c1 | 3300050514 | Bacteria | 2604 |
| 990 | nmdc:mga08x19_56685_c1 | 3300050514 | Bacteria | 2530 |
| 991 | nmdc:mga0a205_103351_c1 | 3300050515 | Bacteria | 2748 |
| 992 | nmdc:mga0a205_112872_c1 | 3300050515 | Bacteria | 2616 |
| 993 | nmdc:mga0a205_178200_c1 | 3300050515 | Bacteria | 2020 |
| 994 | nmdc:mga0a205_28284_c1 | 3300050515 | Bacteria | 5359 |
| 995 | nmdc:mga0a205_286497_c1 | 3300050515 | Bacteria | 1522 |
| 996 | nmdc:mga0a205_43385_c1 | 3300050515 | Bacteria | 4336 |
| 997 | nmdc:mga0a205_6227_c1 | 3300050515 | Bacteria | 4229 |
| 998 | nmdc:mga0a205_64123_c1 | 3300050515 | Bacteria | 3549 |
| 999 | nmdc:mga0a205_8596_c1 | 3300050515 | Bacteria | 9291 |
| 1000 | nmdc:mga0a205_9730_c1 | 3300050515 | Bacteria | 8805 |
| 1001 | nmdc:mga0sz30_329_c1 | 3300050516 | Bacteria | 7754 |
| 1002 | Ga0500583_0067790 | 3300053092 | Unclassified | 1700 |
| 1003 | Ga0500651_0119011 | 3300053093 | Bacteria | 1605 |
| 1004 | Ga0500556_0000578 | 3300053104 | Bacteria | 24347 |
| 1005 | Ga0500594_0002617 | 3300053118 | Bacteria | 3909 |
| 1006 | Ga0500595_009000 | 3300053119 | Bacteria | 4055 |
| 1007 | Ga0500618_003364 | 3300053125 | Bacteria | 5522 |
| 1008 | Ga0500658_0000707 | 3300053134 | Bacteria | 13800 |
| 1009 | Ga0500590_086676 | 3300053148 | Bacteria | 1527 |
| 1010 | Ga0500624_023235 | 3300053157 | Unclassified | 1015 |
| 1011 | Ga0500637_0004718 | 3300053178 | Bacteria | 6515 |
| 1012 | Ga0500645_005168 | 3300053730 | Bacteria | 4862 |
| 1013 | Ga0501084_0004174 | 3300054114 | Bacteria | 11784 |
| 1014 | Ga0501084_0031351 | 3300054114 | Bacteria | 4445 |
| 1015 | Ga0501084_0041677 | 3300054114 | Bacteria | 3841 |
| 1016 | Ga0501084_0057571 | 3300054114 | Unclassified | 3252 |
| 1017 | Ga0501084_0396586 | 3300054114 | Bacteria | 1166 |
| 1018 | Ga0501082_0001523 | 3300060353 | Bacteria | 20382 |
| 1019 | Ga0501082_0007454 | 3300060353 | Bacteria | 9440 |
| 1020 | Ga0501082_0023709 | 3300060353 | Bacteria | 5292 |
| 1021 | Ga0501082_0042059 | 3300060353 | Bacteria | 3940 |
| 1022 | Ga0501082_0073883 | 3300060353 | Unclassified | 2936 |
| 1023 | Ga0501082_0359885 | 3300060353 | Bacteria | 1269 |
| 1024 | Ga0530510_0004917 | 3300061734 | Bacteria | 9232 |
| 1025 | Ga0530510_0051507 | 3300061734 | Bacteria | 2975 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042439 | Ga0439464_0053343 | Ga0439464_0053343_98_961 | 267 |
| 2 | 3300025941 | Ga0207711_10217721 | Ga0207711_102177212 | 290 |
| 3 | 3300005290 | Ga0065712_10000333 | Ga0065712_100003336 | 294 |
| 4 | 3300005356 | Ga0070674_100002174 | Ga0070674_1000021743 | 294 |
| 5 | 3300006852 | Ga0075433_10035109 | Ga0075433_100351093 | 294 |
| 6 | 3300025937 | Ga0207669_10000758 | Ga0207669_100007583 | 294 |
| 7 | 3300026095 | Ga0207676_10212861 | Ga0207676_102128612 | 294 |
| 8 | 3300049568 | Ga0501031_0207395 | Ga0501031_0207395_89_991 | 294 |
| 9 | 3300050510 | nmdc:mga06r32_29624_c1 | nmdc:mga06r32_29624_c1_3465_4379 | 294 |
| 10 | 3300005436 | Ga0070713_100027448 | Ga0070713_1000274485 | 295 |
| 11 | 3300009094 | Ga0111539_10063121 | Ga0111539_100631213 | 295 |
| 12 | 3300009147 | Ga0114129_10002077 | Ga0114129_100020772 | 295 |
| 13 | 3300009147 | Ga0114129_10012069 | Ga0114129_1001206911 | 295 |
| 14 | 3300009147 | Ga0114129_10303605 | Ga0114129_103036052 | 295 |
| 15 | 3300009177 | Ga0105248_10126609 | Ga0105248_101266093 | 295 |
| 16 | 3300046684 | Ga0495669_0053541 | Ga0495669_0053541_814_1722 | 295 |
| 17 | 3300050507 | nmdc:mga05p37_17170_c1 | nmdc:mga05p37_17170_c1_2114_3016 | 295 |
| 18 | 3300050507 | nmdc:mga05p37_38418_c1 | nmdc:mga05p37_38418_c1_4851_5759 | 295 |
| 19 | 3300050507 | nmdc:mga05p37_5779_c1 | nmdc:mga05p37_5779_c1_13168_14070 | 295 |
| 20 | 3300050508 | nmdc:mga09592_479822_c1 | nmdc:mga09592_479822_c1_38_946 | 295 |
| 21 | 3300050510 | nmdc:mga06r32_173540_c1 | nmdc:mga06r32_173540_c1_47_952 | 295 |
| 22 | 3300050511 | nmdc:mga08y16_13609_c1 | nmdc:mga08y16_13609_c1_5914_6816 | 295 |
| 23 | 3300050511 | nmdc:mga08y16_88590_c1 | nmdc:mga08y16_88590_c1_1940_2842 | 295 |
| 24 | 3300050512 | nmdc:mga0n895_10029_c1 | nmdc:mga0n895_10029_c1_5482_6384 | 295 |
| 25 | 3300050512 | nmdc:mga0n895_44683_c1 | nmdc:mga0n895_44683_c1_1590_2492 | 295 |
| 26 | 3300050513 | nmdc:mga0rr50_22805_c1 | nmdc:mga0rr50_22805_c1_1758_2660 | 295 |
| 27 | 3300050513 | nmdc:mga0rr50_46935_c1 | nmdc:mga0rr50_46935_c1_1706_2608 | 295 |
| 28 | 3300009177 | Ga0105248_10010781 | Ga0105248_100107818 | 296 |
| 29 | 3300014325 | Ga0163163_10010247 | Ga0163163_100102478 | 296 |
| 30 | 3300014968 | Ga0157379_10261773 | Ga0157379_102617732 | 296 |
| 31 | 3300042156 | Ga0439446_0072737 | Ga0439446_0072737_111_1022 | 296 |
| 32 | 3300046689 | Ga0495613_0255125 | Ga0495613_0255125_236_1147 | 296 |
| 33 | 3300048907 | Ga0496104_0056292 | Ga0496104_0056292_726_1637 | 296 |
| 34 | 3300048911 | Ga0496108_0004453 | Ga0496108_0004453_5918_6829 | 296 |
| 35 | 3300048912 | Ga0496109_0678982 | Ga0496109_0678982_32_943 | 296 |
| 36 | 3300048915 | Ga0496112_0002100 | Ga0496112_0002100_13217_14128 | 296 |
| 37 | 3300049584 | Ga0501068_0045583 | Ga0501068_0045583_1700_2608 | 296 |
| 38 | 3300050514 | nmdc:mga08x19_23227_c1 | nmdc:mga08x19_23227_c1_12_920 | 297 |
| 39 | 3300042435 | Ga0439434_0037382 | Ga0439434_0037382_517_1476 | 305 |
| 40 | 3300045051 | Ga0451576_0559693 | Ga0451576_0559693_217_1164 | 305 |
| 41 | 3300050509 | nmdc:mga0qj67_278522_c1 | nmdc:mga0qj67_278522_c1_17_964 | 305 |
| 42 | 3300053157 | Ga0500624_023235 | Ga0500624_023235_25_984 | 309 |
| 43 | 3300048917 | Ga0496114_0476538 | Ga0496114_0476538_50_997 | 310 |
| 44 | 3300003323 | rootH1_10033773 | rootH1_100337734 | 311 |
| 45 | 3300046538 | Ga0495609_0143298 | Ga0495609_0143298_15_968 | 311 |
| 46 | 3300025913 | Ga0207695_10209490 | Ga0207695_102094902 | 312 |
| 47 | 3300006358 | Ga0068871_100253650 | Ga0068871_1002536502 | 313 |
| 48 | 3300009093 | Ga0105240_10337221 | Ga0105240_103372211 | 313 |
| 49 | 3300009147 | Ga0114129_10188468 | Ga0114129_101884681 | 313 |
| 50 | 3300006051 | Ga0075364_10017498 | Ga0075364_100174983 | 314 |
| 51 | 3300006173 | Ga0070716_100101601 | Ga0070716_1001016012 | 314 |
| 52 | 3300006178 | Ga0075367_10008801 | Ga0075367_100088012 | 314 |
| 53 | 3300006195 | Ga0075366_10056627 | Ga0075366_100566273 | 314 |
| 54 | 3300050489 | nmdc:mga03683_8724_c1 | nmdc:mga03683_8724_c1_1459_2475 | 314 |
| 55 | 3300050491 | nmdc:mga00v17_3776_c1 | nmdc:mga00v17_3776_c1_5384_6400 | 314 |
| 56 | 3300050493 | nmdc:mga0k408_3210_c2 | nmdc:mga0k408_3210_c2_352_1368 | 314 |
| 57 | 3300050494 | nmdc:mga06z11_6749_c1 | nmdc:mga06z11_6749_c1_1341_2357 | 314 |
| 58 | 3300009147 | Ga0114129_10314310 | Ga0114129_103143102 | 316 |
| 59 | 3300006852 | Ga0075433_10241311 | Ga0075433_102413112 | 317 |
| 60 | 3300009147 | Ga0114129_10001463 | Ga0114129_1000146316 | 317 |
| 61 | 3300005367 | Ga0070667_100409899 | Ga0070667_1004098991 | 319 |
| 62 | 3300005441 | Ga0070700_100256781 | Ga0070700_1002567811 | 319 |
| 63 | 3300006237 | Ga0097621_100180315 | Ga0097621_1001803152 | 319 |
| 64 | 3300006844 | Ga0075428_100020409 | Ga0075428_1000204094 | 319 |
| 65 | 3300006847 | Ga0075431_100237528 | Ga0075431_1002375282 | 319 |
| 66 | 3300009147 | Ga0114129_10021598 | Ga0114129_100215986 | 319 |
| 67 | 3300025926 | Ga0207659_10099132 | Ga0207659_100991322 | 319 |
| 68 | 3300025931 | Ga0207644_10041929 | Ga0207644_100419294 | 319 |
| 69 | 3300025933 | Ga0207706_10118701 | Ga0207706_101187011 | 319 |
| 70 | 3300025936 | Ga0207670_10144790 | Ga0207670_101447902 | 319 |
| 71 | 3300026088 | Ga0207641_10037410 | Ga0207641_100374103 | 319 |
| 72 | 3300027907 | Ga0207428_10151620 | Ga0207428_101516202 | 319 |
| 73 | 3300028380 | Ga0268265_10024226 | Ga0268265_100242263 | 319 |
| 74 | 3300050507 | nmdc:mga05p37_26138_c1 | nmdc:mga05p37_26138_c1_4650_5663 | 319 |
| 75 | 3300050510 | nmdc:mga06r32_9095_c1 | nmdc:mga06r32_9095_c1_7448_8461 | 319 |
| 76 | 3300050511 | nmdc:mga08y16_70504_c1 | nmdc:mga08y16_70504_c1_1673_2686 | 319 |
| 77 | 3300005444 | Ga0070694_100073074 | Ga0070694_1000730742 | 320 |
| 78 | 3300005546 | Ga0070696_100017939 | Ga0070696_1000179392 | 320 |
| 79 | 3300035725 | Ga0373947_0297085 | Ga0373947_0297085_10_1029 | 320 |
| 80 | 3300005347 | Ga0070668_100017093 | Ga0070668_1000170934 | 322 |
| 81 | 3300009553 | Ga0105249_10219105 | Ga0105249_102191052 | 322 |
| 82 | 3300014326 | Ga0157380_10292640 | Ga0157380_102926402 | 322 |
| 83 | 3300025961 | Ga0207712_10232366 | Ga0207712_102323662 | 322 |
| 84 | 3300005614 | Ga0068856_100522646 | Ga0068856_1005226461 | 323 |
| 85 | 3300005719 | Ga0068861_100159632 | Ga0068861_1001596322 | 323 |
| 86 | 3300009093 | Ga0105240_10111093 | Ga0105240_101110932 | 323 |
| 87 | 3300025913 | Ga0207695_10197319 | Ga0207695_101973192 | 323 |
| 88 | 3300026078 | Ga0207702_10445246 | Ga0207702_104452462 | 323 |
| 89 | 3300049576 | Ga0501040_0111501 | Ga0501040_0111501_678_1688 | 323 |
| 90 | 3300049590 | Ga0501074_0101980 | Ga0501074_0101980_549_1559 | 323 |
| 91 | 3300049591 | Ga0501075_0043745 | Ga0501075_0043745_727_1737 | 323 |
| 92 | 3300049592 | Ga0501076_0089822 | Ga0501076_0089822_637_1647 | 323 |
| 93 | 3300049593 | Ga0501077_0024880 | Ga0501077_0024880_611_1621 | 323 |
| 94 | 3300049741 | Ga0501079_0064166 | Ga0501079_0064166_1276_2286 | 323 |
| 95 | 3300050514 | nmdc:mga08x19_169313_c1 | nmdc:mga08x19_169313_c1_133_1191 | 323 |
| 96 | 3300060353 | Ga0501082_0359885 | Ga0501082_0359885_129_1139 | 323 |
| 97 | 3300049580 | Ga0501046_0145509 | Ga0501046_0145509_785_1780 | 325 |
| 98 | iso_pu_bacteria | 2599185359 | 2600225387 | 325 |
| 99 | iso_pu_bacteria | 2818991466 | 2819713688 | 325 |
| 100 | iso_pu_bacteria | 2879163058 | 2879163651 | 325 |
| 101 | iso_pu_bacteria | 2928526807 | 2928528262 | 325 |
| 102 | iso_pu_bacteria | 2928968154 | 2928969852 | 325 |
| 103 | 3300006048 | Ga0075363_100001428 | Ga0075363_1000014286 | 326 |
| 104 | 3300006177 | Ga0075362_10000270 | Ga0075362_1000027013 | 326 |
| 105 | 3300006186 | Ga0075369_10007151 | Ga0075369_100071513 | 326 |
| 106 | 3300006195 | Ga0075366_10000070 | Ga0075366_1000007010 | 326 |
| 107 | 3300006353 | Ga0075370_10000009 | Ga0075370_1000000924 | 326 |
| 108 | 3300050489 | nmdc:mga03683_51_c1 | nmdc:mga03683_51_c1_12626_13624 | 326 |
| 109 | 3300050490 | nmdc:mga03n38_172_c1 | nmdc:mga03n38_172_c1_938_1936 | 326 |
| 110 | 3300050493 | nmdc:mga0k408_3_c1 | nmdc:mga0k408_3_c1_12847_13845 | 326 |
| 111 | 3300050496 | nmdc:mga07m45_6_c1 | nmdc:mga07m45_6_c1_238714_239712 | 326 |
| 112 | 3300050516 | nmdc:mga0sz30_329_c1 | nmdc:mga0sz30_329_c1_4176_5174 | 326 |
| 113 | 3300053104 | Ga0500556_0000578 | Ga0500556_0000578_15887_16897 | 326 |
| 114 | 3300030521 | Ga0307511_10018661 | Ga0307511_100186616 | 327 |
| 115 | 3300046499 | Ga0495594_0144900 | Ga0495594_0144900_106_1125 | 327 |
| 116 | 3300053119 | Ga0500595_009000 | Ga0500595_009000_2922_3920 | 327 |
| 117 | 3300002774 | JGI25150J39212_1000224 | JGI25150J39212_100022412 | 328 |
| 118 | 3300003215 | JGI25153J46596_10000198 | JGI25153J46596_1000019826 | 328 |
| 119 | 3300003771 | Ga0055526_1005312 | Ga0055526_10053123 | 328 |
| 120 | 3300003773 | Ga0055537_1000746 | Ga0055537_100074616 | 328 |
| 121 | 3300003791 | Ga0055530_10007254 | Ga0055530_100072542 | 328 |
| 122 | 3300003791 | Ga0055530_10009834 | Ga0055530_100098344 | 328 |
| 123 | 3300003792 | Ga0055540_1001135 | Ga0055540_100113511 | 328 |
| 124 | 3300003794 | Ga0055531_10007930 | Ga0055531_100079302 | 328 |
| 125 | 3300003794 | Ga0055531_10007945 | Ga0055531_100079452 | 328 |
| 126 | 3300005262 | Ga0065165_1006492 | Ga0065165_10064924 | 328 |
| 127 | 3300005335 | Ga0070666_10068495 | Ga0070666_100684951 | 328 |
| 128 | 3300005844 | Ga0068862_100029633 | Ga0068862_1000296334 | 328 |
| 129 | 3300005937 | Ga0081455_10000127 | Ga0081455_1000012713 | 328 |
| 130 | 3300005985 | Ga0081539_10000753 | Ga0081539_1000075336 | 328 |
| 131 | 3300009553 | Ga0105249_10002700 | Ga0105249_100027004 | 328 |
| 132 | 3300025245 | Ga0207425_1000016 | Ga0207425_1000016100 | 328 |
| 133 | 3300025258 | Ga0209129_1001083 | Ga0209129_10010834 | 328 |
| 134 | 3300025263 | Ga0209565_1000206 | Ga0209565_100020615 | 328 |
| 135 | 3300025273 | Ga0209673_1015571 | Ga0209673_10155712 | 328 |
| 136 | 3300025292 | Ga0209676_1001784 | Ga0209676_10017844 | 328 |
| 137 | 3300025292 | Ga0209676_1039475 | Ga0209676_10394751 | 328 |
| 138 | 3300025294 | Ga0209025_1000475 | Ga0209025_100047544 | 328 |
| 139 | 3300025295 | Ga0209564_1000996 | Ga0209564_100099610 | 328 |
| 140 | 3300025297 | Ga0209758_1000009 | Ga0209758_1000009341 | 328 |
| 141 | 3300025298 | Ga0209050_1000005 | Ga0209050_1000005828 | 328 |
| 142 | 3300025298 | Ga0209050_1005225 | Ga0209050_10052252 | 328 |
| 143 | 3300025298 | Ga0209050_1016542 | Ga0209050_10165422 | 328 |
| 144 | 3300025303 | Ga0209051_1000100 | Ga0209051_1000100110 | 328 |
| 145 | 3300025304 | Ga0209257_1000896 | Ga0209257_100089615 | 328 |
| 146 | 3300025304 | Ga0209257_1001045 | Ga0209257_100104511 | 328 |
| 147 | 3300025961 | Ga0207712_10007112 | Ga0207712_100071124 | 328 |
| 148 | 3300028379 | Ga0268266_10007235 | Ga0268266_100072359 | 328 |
| 149 | 3300028380 | Ga0268265_10073703 | Ga0268265_100737033 | 328 |
| 150 | 3300031456 | Ga0307513_10055717 | Ga0307513_100557173 | 328 |
| 151 | 3300048924 | Ga0496121_0000332 | Ga0496121_0000332_21778_22818 | 328 |
| 152 | 3300049573 | Ga0501037_0117345 | Ga0501037_0117345_178_1179 | 328 |
| 153 | 3300049581 | Ga0501047_0060947 | Ga0501047_0060947_1004_2005 | 328 |
| 154 | 3300049587 | Ga0501071_0141297 | Ga0501071_0141297_562_1578 | 328 |
| 155 | 3300049823 | Ga0501044_0014647 | Ga0501044_0014647_6896_7897 | 328 |
| 156 | iso_pu_bacteria | 2643221579 | 2643908402 | 328 |
| 157 | 3300001989 | JGI24739J22299_10010725 | JGI24739J22299_100107253 | 329 |
| 158 | 3300002067 | JGI24735J21928_10019568 | JGI24735J21928_100195682 | 329 |
| 159 | 3300002076 | JGI24749J21850_1000053 | JGI24749J21850_100005311 | 329 |
| 160 | 3300003794 | Ga0055531_10004329 | Ga0055531_100043296 | 329 |
| 161 | 3300003794 | Ga0055531_10022649 | Ga0055531_100226492 | 329 |
| 162 | 3300005262 | Ga0065165_1002680 | Ga0065165_10026801 | 329 |
| 163 | 3300005262 | Ga0065165_1004694 | Ga0065165_10046944 | 329 |
| 164 | 3300005262 | Ga0065165_1016066 | Ga0065165_10160663 | 329 |
| 165 | 3300005295 | Ga0065707_10082125 | Ga0065707_1008212510 | 329 |
| 166 | 3300005330 | Ga0070690_100218758 | Ga0070690_1002187581 | 329 |
| 167 | 3300005335 | Ga0070666_10070344 | Ga0070666_100703442 | 329 |
| 168 | 3300005353 | Ga0070669_100082992 | Ga0070669_1000829922 | 329 |
| 169 | 3300005354 | Ga0070675_100002905 | Ga0070675_10000290511 | 329 |
| 170 | 3300005355 | Ga0070671_100000844 | Ga0070671_10000084415 | 329 |
| 171 | 3300005365 | Ga0070688_100031288 | Ga0070688_1000312881 | 329 |
| 172 | 3300005367 | Ga0070667_100307461 | Ga0070667_1003074611 | 329 |
| 173 | 3300005457 | Ga0070662_100023078 | Ga0070662_1000230784 | 329 |
| 174 | 3300005577 | Ga0068857_100265947 | Ga0068857_1002659472 | 329 |
| 175 | 3300005578 | Ga0068854_100087694 | Ga0068854_1000876942 | 329 |
| 176 | 3300005617 | Ga0068859_100000441 | Ga0068859_1000004413 | 329 |
| 177 | 3300005617 | Ga0068859_100008641 | Ga0068859_1000086412 | 329 |
| 178 | 3300005834 | Ga0068851_10154222 | Ga0068851_101542222 | 329 |
| 179 | 3300005840 | Ga0068870_10162645 | Ga0068870_101626452 | 329 |
| 180 | 3300005841 | Ga0068863_100008426 | Ga0068863_1000084268 | 329 |
| 181 | 3300005841 | Ga0068863_100291459 | Ga0068863_1002914591 | 329 |
| 182 | 3300005842 | Ga0068858_100000700 | Ga0068858_10000070037 | 329 |
| 183 | 3300005842 | Ga0068858_100016289 | Ga0068858_1000162893 | 329 |
| 184 | 3300005843 | Ga0068860_100013412 | Ga0068860_1000134125 | 329 |
| 185 | 3300005843 | Ga0068860_100015157 | Ga0068860_10001515711 | 329 |
| 186 | 3300005983 | Ga0081540_1076471 | Ga0081540_10764711 | 329 |
| 187 | 3300006846 | Ga0075430_100026431 | Ga0075430_1000264311 | 329 |
| 188 | 3300006847 | Ga0075431_100229698 | Ga0075431_1002296981 | 329 |
| 189 | 3300006931 | Ga0097620_100000074 | Ga0097620_10000007450 | 329 |
| 190 | 3300006931 | Ga0097620_100000441 | Ga0097620_10000044132 | 329 |
| 191 | 3300006931 | Ga0097620_100008641 | Ga0097620_10000864110 | 329 |
| 192 | 3300009101 | Ga0105247_10000923 | Ga0105247_100009233 | 329 |
| 193 | 3300009147 | Ga0114129_10015078 | Ga0114129_100150785 | 329 |
| 194 | 3300009177 | Ga0105248_10001761 | Ga0105248_1000176111 | 329 |
| 195 | 3300009545 | Ga0105237_10014363 | Ga0105237_100143637 | 329 |
| 196 | 3300009545 | Ga0105237_10110467 | Ga0105237_101104671 | 329 |
| 197 | 3300009553 | Ga0105249_10028928 | Ga0105249_100289283 | 329 |
| 198 | 3300010375 | Ga0105239_10125251 | Ga0105239_101252512 | 329 |
| 199 | 3300010375 | Ga0105239_10363989 | Ga0105239_103639892 | 329 |
| 200 | 3300013296 | Ga0157374_10216424 | Ga0157374_102164242 | 329 |
| 201 | 3300013306 | Ga0163162_10046655 | Ga0163162_100466554 | 329 |
| 202 | 3300013306 | Ga0163162_10071234 | Ga0163162_100712342 | 329 |
| 203 | 3300014745 | Ga0157377_10179063 | Ga0157377_101790631 | 329 |
| 204 | 3300014968 | Ga0157379_10243492 | Ga0157379_102434922 | 329 |
| 205 | 3300014968 | Ga0157379_10288227 | Ga0157379_102882272 | 329 |
| 206 | 3300025250 | Ga0209026_1002380 | Ga0209026_10023802 | 329 |
| 207 | 3300025297 | Ga0209758_1000736 | Ga0209758_100073619 | 329 |
| 208 | 3300025298 | Ga0209050_1000029 | Ga0209050_1000029429 | 329 |
| 209 | 3300025304 | Ga0209257_1000493 | Ga0209257_100049333 | 329 |
| 210 | 3300025304 | Ga0209257_1002196 | Ga0209257_100219610 | 329 |
| 211 | 3300025900 | Ga0207710_10001276 | Ga0207710_1000127612 | 329 |
| 212 | 3300025903 | Ga0207680_10112898 | Ga0207680_101128982 | 329 |
| 213 | 3300025904 | Ga0207647_10008924 | Ga0207647_100089247 | 329 |
| 214 | 3300025913 | Ga0207695_10040313 | Ga0207695_100403135 | 329 |
| 215 | 3300025914 | Ga0207671_10197129 | Ga0207671_101971291 | 329 |
| 216 | 3300025914 | Ga0207671_10201936 | Ga0207671_102019362 | 329 |
| 217 | 3300025924 | Ga0207694_10111187 | Ga0207694_101111872 | 329 |
| 218 | 3300025925 | Ga0207650_10117377 | Ga0207650_101173772 | 329 |
| 219 | 3300025926 | Ga0207659_10002884 | Ga0207659_100028849 | 329 |
| 220 | 3300025931 | Ga0207644_10007549 | Ga0207644_100075493 | 329 |
| 221 | 3300025933 | Ga0207706_10065021 | Ga0207706_100650212 | 329 |
| 222 | 3300025933 | Ga0207706_10174814 | Ga0207706_101748142 | 329 |
| 223 | 3300025940 | Ga0207691_10083538 | Ga0207691_100835382 | 329 |
| 224 | 3300025941 | Ga0207711_10003658 | Ga0207711_1000365812 | 329 |
| 225 | 3300025961 | Ga0207712_10180717 | Ga0207712_101807172 | 329 |
| 226 | 3300025981 | Ga0207640_10072245 | Ga0207640_100722452 | 329 |
| 227 | 3300025986 | Ga0207658_10017674 | Ga0207658_100176747 | 329 |
| 228 | 3300025986 | Ga0207658_10165239 | Ga0207658_101652392 | 329 |
| 229 | 3300026035 | Ga0207703_10001628 | Ga0207703_1000162822 | 329 |
| 230 | 3300026035 | Ga0207703_10001635 | Ga0207703_1000163515 | 329 |
| 231 | 3300026067 | Ga0207678_10038324 | Ga0207678_100383243 | 329 |
| 232 | 3300026088 | Ga0207641_10028560 | Ga0207641_100285604 | 329 |
| 233 | 3300026089 | Ga0207648_10110095 | Ga0207648_101100953 | 329 |
| 234 | 3300026116 | Ga0207674_10229405 | Ga0207674_102294052 | 329 |
| 235 | 3300026121 | Ga0207683_10253076 | Ga0207683_102530762 | 329 |
| 236 | 3300028379 | Ga0268266_10037406 | Ga0268266_100374062 | 329 |
| 237 | 3300028381 | Ga0268264_10000100 | Ga0268264_10000100155 | 329 |
| 238 | 3300030521 | Ga0307511_10000260 | Ga0307511_1000026032 | 329 |
| 239 | 3300030521 | Ga0307511_10017236 | Ga0307511_100172366 | 329 |
| 240 | 3300031616 | Ga0307508_10251272 | Ga0307508_102512721 | 329 |
| 241 | 3300031911 | Ga0307412_10003164 | Ga0307412_100031647 | 329 |
| 242 | 3300032004 | Ga0307414_10276437 | Ga0307414_102764371 | 329 |
| 243 | 3300033180 | Ga0307510_10000001 | Ga0307510_10000001432 | 329 |
| 244 | 3300033180 | Ga0307510_10008818 | Ga0307510_100088186 | 329 |
| 245 | 3300035113 | Ga0373936_0004159 | Ga0373936_0004159_1402_2421 | 329 |
| 246 | 3300037471 | Ga0395905_0234766 | Ga0395905_0234766_110_1114 | 329 |
| 247 | 3300042005 | Ga0439448_0000557 | Ga0439448_0000557_7599_8642 | 329 |
| 248 | 3300042005 | Ga0439448_0006523 | Ga0439448_0006523_2083_3102 | 329 |
| 249 | 3300042157 | Ga0439458_0001347 | Ga0439458_0001347_293_1312 | 329 |
| 250 | 3300042157 | Ga0439458_0002817 | Ga0439458_0002817_968_2011 | 329 |
| 251 | 3300046460 | Ga0495638_0000523 | Ga0495638_0000523_30359_31372 | 329 |
| 252 | 3300046506 | Ga0495583_0092854 | Ga0495583_0092854_282_1286 | 329 |
| 253 | 3300046660 | Ga0495625_0000153 | Ga0495625_0000153_72076_73089 | 329 |
| 254 | 3300046691 | Ga0495670_0000002 | Ga0495670_0000002_371863_372915 | 329 |
| 255 | 3300047472 | Ga0495686_0012441 | Ga0495686_0012441_4408_5412 | 329 |
| 256 | 3300047472 | Ga0495686_0057275 | Ga0495686_0057275_616_1629 | 329 |
| 257 | 3300048905 | Ga0496102_0015105 | Ga0496102_0015105_3193_4212 | 329 |
| 258 | 3300048905 | Ga0496102_0015973 | Ga0496102_0015973_2079_3092 | 329 |
| 259 | 3300048909 | Ga0496106_0082458 | Ga0496106_0082458_920_1939 | 329 |
| 260 | 3300048915 | Ga0496112_0096532 | Ga0496112_0096532_1786_2805 | 329 |
| 261 | 3300048920 | Ga0496117_0000035 | Ga0496117_0000035_290747_291760 | 329 |
| 262 | 3300048920 | Ga0496117_0172962 | Ga0496117_0172962_211_1218 | 329 |
| 263 | 3300048921 | Ga0496118_0000038 | Ga0496118_0000038_67816_68829 | 329 |
| 264 | 3300048922 | Ga0496119_0003923 | Ga0496119_0003923_4439_5452 | 329 |
| 265 | 3300048922 | Ga0496119_0020625 | Ga0496119_0020625_234_1247 | 329 |
| 266 | 3300048923 | Ga0496120_0000591 | Ga0496120_0000591_45979_46992 | 329 |
| 267 | 3300048923 | Ga0496120_0010224 | Ga0496120_0010224_737_1750 | 329 |
| 268 | 3300048924 | Ga0496121_0004643 | Ga0496121_0004643_1612_2631 | 329 |
| 269 | 3300048924 | Ga0496121_0016951 | Ga0496121_0016951_1084_2097 | 329 |
| 270 | 3300048925 | Ga0496122_0027450 | Ga0496122_0027450_1524_2531 | 329 |
| 271 | 3300048926 | Ga0496123_0007270 | Ga0496123_0007270_5174_6181 | 329 |
| 272 | 3300048927 | Ga0496124_0000071 | Ga0496124_0000071_66031_67038 | 329 |
| 273 | 3300048927 | Ga0496124_0002463 | Ga0496124_0002463_18336_19343 | 329 |
| 274 | 3300048927 | Ga0496124_0027703 | Ga0496124_0027703_3823_4830 | 329 |
| 275 | 3300048927 | Ga0496124_0087772 | Ga0496124_0087772_1148_2161 | 329 |
| 276 | 3300048928 | Ga0496125_0010198 | Ga0496125_0010198_477_1496 | 329 |
| 277 | 3300048928 | Ga0496125_0031098 | Ga0496125_0031098_3084_4097 | 329 |
| 278 | 3300048928 | Ga0496125_0033625 | Ga0496125_0033625_2030_3046 | 329 |
| 279 | 3300048928 | Ga0496125_0172989 | Ga0496125_0172989_163_1170 | 329 |
| 280 | 3300050507 | nmdc:mga05p37_14429_c1 | nmdc:mga05p37_14429_c1_7609_8616 | 329 |
| 281 | 3300050508 | nmdc:mga09592_75144_c1 | nmdc:mga09592_75144_c1_951_1961 | 329 |
| 282 | 3300050511 | nmdc:mga08y16_6676_c1 | nmdc:mga08y16_6676_c1_9847_10854 | 329 |
| 283 | 3300053125 | Ga0500618_003364 | Ga0500618_003364_909_1961 | 329 |
| 284 | 3300053134 | Ga0500658_0000707 | Ga0500658_0000707_2006_3019 | 329 |
| 285 | 3300053148 | Ga0500590_086676 | Ga0500590_086676_45_1058 | 329 |
| 286 | 3300053178 | Ga0500637_0004718 | Ga0500637_0004718_2202_3227 | 329 |
| 287 | 3300053730 | Ga0500645_005168 | Ga0500645_005168_1457_2461 | 329 |
| 288 | iso_pu_bacteria | 2842918807 | 2842921120 | 329 |
| 289 | iso_pu_bacteria | 2939589442 | 2939592146 | 329 |
| 290 | iso_pu_bacteria | 2953994433 | 2953996396 | 329 |
| 291 | 3300003322 | rootL2_10081122 | rootL2_100811223 | 330 |
| 292 | 3300005295 | Ga0065707_10092877 | Ga0065707_100928772 | 330 |
| 293 | 3300005329 | Ga0070683_100013418 | Ga0070683_1000134185 | 330 |
| 294 | 3300005330 | Ga0070690_100006381 | Ga0070690_1000063813 | 330 |
| 295 | 3300005331 | Ga0070670_100085994 | Ga0070670_1000859942 | 330 |
| 296 | 3300005334 | Ga0068869_100003496 | Ga0068869_1000034962 | 330 |
| 297 | 3300005336 | Ga0070680_100368814 | Ga0070680_1003688141 | 330 |
| 298 | 3300005338 | Ga0068868_100297023 | Ga0068868_1002970232 | 330 |
| 299 | 3300005353 | Ga0070669_100017191 | Ga0070669_1000171914 | 330 |
| 300 | 3300005354 | Ga0070675_100052358 | Ga0070675_1000523582 | 330 |
| 301 | 3300005356 | Ga0070674_100190459 | Ga0070674_1001904591 | 330 |
| 302 | 3300005364 | Ga0070673_100091993 | Ga0070673_1000919932 | 330 |
| 303 | 3300005438 | Ga0070701_10141666 | Ga0070701_101416661 | 330 |
| 304 | 3300005441 | Ga0070700_100005845 | Ga0070700_1000058452 | 330 |
| 305 | 3300005459 | Ga0068867_100038337 | Ga0068867_1000383372 | 330 |
| 306 | 3300005535 | Ga0070684_100094446 | Ga0070684_1000944463 | 330 |
| 307 | 3300005545 | Ga0070695_100195534 | Ga0070695_1001955342 | 330 |
| 308 | 3300005578 | Ga0068854_100146030 | Ga0068854_1001460302 | 330 |
| 309 | 3300005719 | Ga0068861_100055469 | Ga0068861_1000554692 | 330 |
| 310 | 3300005719 | Ga0068861_100295342 | Ga0068861_1002953422 | 330 |
| 311 | 3300005840 | Ga0068870_10105645 | Ga0068870_101056452 | 330 |
| 312 | 3300005842 | Ga0068858_100099111 | Ga0068858_1000991112 | 330 |
| 313 | 3300006038 | Ga0075365_10053109 | Ga0075365_100531093 | 330 |
| 314 | 3300006051 | Ga0075364_10007623 | Ga0075364_100076234 | 330 |
| 315 | 3300006173 | Ga0070716_100171168 | Ga0070716_1001711681 | 330 |
| 316 | 3300006178 | Ga0075367_10049686 | Ga0075367_100496862 | 330 |
| 317 | 3300006353 | Ga0075370_10070789 | Ga0075370_100707891 | 330 |
| 318 | 3300006844 | Ga0075428_100399462 | Ga0075428_1003994621 | 330 |
| 319 | 3300006846 | Ga0075430_100041131 | Ga0075430_1000411314 | 330 |
| 320 | 3300006846 | Ga0075430_100204161 | Ga0075430_1002041612 | 330 |
| 321 | 3300006847 | Ga0075431_100085607 | Ga0075431_1000856072 | 330 |
| 322 | 3300006852 | Ga0075433_10034494 | Ga0075433_100344942 | 330 |
| 323 | 3300006852 | Ga0075433_10088056 | Ga0075433_100880562 | 330 |
| 324 | 3300006871 | Ga0075434_100100580 | Ga0075434_1001005802 | 330 |
| 325 | 3300006880 | Ga0075429_100098756 | Ga0075429_1000987562 | 330 |
| 326 | 3300006881 | Ga0068865_100006865 | Ga0068865_1000068652 | 330 |
| 327 | 3300009094 | Ga0111539_10000049 | Ga0111539_1000004933 | 330 |
| 328 | 3300009094 | Ga0111539_10008943 | Ga0111539_1000894313 | 330 |
| 329 | 3300009094 | Ga0111539_10054280 | Ga0111539_100542806 | 330 |
| 330 | 3300009094 | Ga0111539_10159766 | Ga0111539_101597662 | 330 |
| 331 | 3300009094 | Ga0111539_10234904 | Ga0111539_102349042 | 330 |
| 332 | 3300009098 | Ga0105245_10145452 | Ga0105245_101454522 | 330 |
| 333 | 3300009147 | Ga0114129_10021805 | Ga0114129_100218053 | 330 |
| 334 | 3300009147 | Ga0114129_10168886 | Ga0114129_101688863 | 330 |
| 335 | 3300009148 | Ga0105243_10040969 | Ga0105243_100409692 | 330 |
| 336 | 3300009176 | Ga0105242_10071701 | Ga0105242_100717012 | 330 |
| 337 | 3300009177 | Ga0105248_10142693 | Ga0105248_101426932 | 330 |
| 338 | 3300014325 | Ga0163163_10024873 | Ga0163163_100248734 | 330 |
| 339 | 3300014326 | Ga0157380_10074853 | Ga0157380_100748532 | 330 |
| 340 | 3300014745 | Ga0157377_10050727 | Ga0157377_100507271 | 330 |
| 341 | 3300025899 | Ga0207642_10039477 | Ga0207642_100394772 | 330 |
| 342 | 3300025907 | Ga0207645_10009707 | Ga0207645_100097076 | 330 |
| 343 | 3300025923 | Ga0207681_10042902 | Ga0207681_100429022 | 330 |
| 344 | 3300025925 | Ga0207650_10097529 | Ga0207650_100975292 | 330 |
| 345 | 3300025926 | Ga0207659_10005234 | Ga0207659_100052348 | 330 |
| 346 | 3300025934 | Ga0207686_10005442 | Ga0207686_100054424 | 330 |
| 347 | 3300025935 | Ga0207709_10058163 | Ga0207709_100581632 | 330 |
| 348 | 3300025939 | Ga0207665_10227534 | Ga0207665_102275342 | 330 |
| 349 | 3300025940 | Ga0207691_10041774 | Ga0207691_100417744 | 330 |
| 350 | 3300025941 | Ga0207711_10232479 | Ga0207711_102324792 | 330 |
| 351 | 3300025942 | Ga0207689_10004598 | Ga0207689_100045989 | 330 |
| 352 | 3300025944 | Ga0207661_10076664 | Ga0207661_100766642 | 330 |
| 353 | 3300025945 | Ga0207679_10168876 | Ga0207679_101688761 | 330 |
| 354 | 3300025960 | Ga0207651_10023309 | Ga0207651_100233092 | 330 |
| 355 | 3300025960 | Ga0207651_10246909 | Ga0207651_102469091 | 330 |
| 356 | 3300026075 | Ga0207708_10009619 | Ga0207708_100096194 | 330 |
| 357 | 3300026075 | Ga0207708_10214961 | Ga0207708_102149611 | 330 |
| 358 | 3300026089 | Ga0207648_10006060 | Ga0207648_100060603 | 330 |
| 359 | 3300026118 | Ga0207675_100089543 | Ga0207675_1000895432 | 330 |
| 360 | 3300027907 | Ga0207428_10000331 | Ga0207428_1000033115 | 330 |
| 361 | 3300027907 | Ga0207428_10089873 | Ga0207428_100898732 | 330 |
| 362 | 3300031730 | Ga0307516_10000034 | Ga0307516_1000003437 | 330 |
| 363 | 3300031995 | Ga0307409_100293851 | Ga0307409_1002938511 | 330 |
| 364 | 3300037471 | Ga0395905_0000174 | Ga0395905_0000174_78152_79159 | 330 |
| 365 | 3300046455 | Ga0495603_0204627 | Ga0495603_0204627_13_1041 | 330 |
| 366 | 3300046524 | Ga0495648_0079689 | Ga0495648_0079689_722_1747 | 330 |
| 367 | 3300046692 | Ga0495671_0065859 | Ga0495671_0065859_606_1631 | 330 |
| 368 | 3300046692 | Ga0495671_0074127 | Ga0495671_0074127_40_1044 | 330 |
| 369 | 3300048912 | Ga0496109_0181430 | Ga0496109_0181430_224_1240 | 330 |
| 370 | 3300048916 | Ga0496113_0254245 | Ga0496113_0254245_215_1225 | 330 |
| 371 | 3300049572 | Ga0501036_0295012 | Ga0501036_0295012_220_1230 | 330 |
| 372 | 3300049574 | Ga0501038_0107195 | Ga0501038_0107195_1216_2226 | 330 |
| 373 | 3300049576 | Ga0501040_0204608 | Ga0501040_0204608_257_1267 | 330 |
| 374 | 3300049577 | Ga0501041_0071871 | Ga0501041_0071871_306_1316 | 330 |
| 375 | 3300049578 | Ga0501042_0039490 | Ga0501042_0039490_2125_3135 | 330 |
| 376 | 3300049579 | Ga0501043_0003083 | Ga0501043_0003083_9696_10706 | 330 |
| 377 | 3300049581 | Ga0501047_0000090 | Ga0501047_0000090_79520_80530 | 330 |
| 378 | 3300049582 | Ga0501048_0115898 | Ga0501048_0115898_835_1866 | 330 |
| 379 | 3300049582 | Ga0501048_0168900 | Ga0501048_0168900_315_1325 | 330 |
| 380 | 3300049587 | Ga0501071_0152577 | Ga0501071_0152577_549_1559 | 330 |
| 381 | 3300049588 | Ga0501072_0052135 | Ga0501072_0052135_809_1840 | 330 |
| 382 | 3300049589 | Ga0501073_0070581 | Ga0501073_0070581_886_1896 | 330 |
| 383 | 3300049590 | Ga0501074_0180195 | Ga0501074_0180195_325_1335 | 330 |
| 384 | 3300049590 | Ga0501074_0207311 | Ga0501074_0207311_11_1042 | 330 |
| 385 | 3300049591 | Ga0501075_0115351 | Ga0501075_0115351_56_1066 | 330 |
| 386 | 3300049591 | Ga0501075_0163329 | Ga0501075_0163329_404_1435 | 330 |
| 387 | 3300049741 | Ga0501079_0007223 | Ga0501079_0007223_2470_3480 | 330 |
| 388 | 3300049742 | Ga0501080_0241661 | Ga0501080_0241661_98_1129 | 330 |
| 389 | 3300049743 | Ga0501081_0045427 | Ga0501081_0045427_157_1167 | 330 |
| 390 | 3300049744 | Ga0501083_0014694 | Ga0501083_0014694_3361_4371 | 330 |
| 391 | 3300049824 | Ga0501045_0018516 | Ga0501045_0018516_3920_4930 | 330 |
| 392 | 3300050491 | nmdc:mga00v17_64538_c1 | nmdc:mga00v17_64538_c1_1088_2104 | 330 |
| 393 | 3300050492 | nmdc:mga0yw44_32028_c1 | nmdc:mga0yw44_32028_c1_1476_2492 | 330 |
| 394 | 3300050496 | nmdc:mga07m45_63713_c1 | nmdc:mga07m45_63713_c1_47_1063 | 330 |
| 395 | 3300050507 | nmdc:mga05p37_195680_c1 | nmdc:mga05p37_195680_c1_759_1781 | 330 |
| 396 | 3300050509 | nmdc:mga0qj67_66995_c1 | nmdc:mga0qj67_66995_c1_1032_2042 | 330 |
| 397 | 3300050510 | nmdc:mga06r32_91728_c1 | nmdc:mga06r32_91728_c1_1711_2721 | 330 |
| 398 | 3300050511 | nmdc:mga08y16_102855_c1 | nmdc:mga08y16_102855_c1_707_1717 | 330 |
| 399 | 3300050511 | nmdc:mga08y16_295858_c1 | nmdc:mga08y16_295858_c1_108_1217 | 330 |
| 400 | 3300050511 | nmdc:mga08y16_39_c1 | nmdc:mga08y16_39_c1_63741_64751 | 330 |
| 401 | 3300050512 | nmdc:mga0n895_81032_c1 | nmdc:mga0n895_81032_c1_1447_2463 | 330 |
| 402 | 3300050515 | nmdc:mga0a205_103351_c1 | nmdc:mga0a205_103351_c1_316_1329 | 330 |
| 403 | 3300050515 | nmdc:mga0a205_43385_c1 | nmdc:mga0a205_43385_c1_1935_2951 | 330 |
| 404 | 3300050515 | nmdc:mga0a205_8596_c1 | nmdc:mga0a205_8596_c1_2462_3472 | 330 |
| 405 | 3300053092 | Ga0500583_0067790 | Ga0500583_0067790_540_1547 | 330 |
| 406 | 3300053118 | Ga0500594_0002617 | Ga0500594_0002617_2592_3596 | 330 |
| 407 | 3300054114 | Ga0501084_0004174 | Ga0501084_0004174_557_1567 | 330 |
| 408 | 3300054114 | Ga0501084_0041677 | Ga0501084_0041677_2531_3562 | 330 |
| 409 | 3300054114 | Ga0501084_0057571 | Ga0501084_0057571_1768_2778 | 330 |
| 410 | 3300060353 | Ga0501082_0023709 | Ga0501082_0023709_506_1516 | 330 |
| 411 | 3300060353 | Ga0501082_0073883 | Ga0501082_0073883_494_1504 | 330 |
| 412 | 3300061734 | Ga0530510_0051507 | Ga0530510_0051507_174_1184 | 330 |
| 413 | iso_pu_bacteria | 2643221593 | 2643973606 | 330 |
| 414 | iso_pu_bacteria | 2852684882 | 2852686487 | 330 |
| 415 | iso_pu_bacteria | 2974307012 | 2974309678 | 330 |
| 416 | iso_pu_bacteria | 2977247770 | 2977250426 | 330 |
| 417 | iso_pu_bacteria | 2984514374 | 2984515109 | 330 |
| 418 | iso_pu_bacteria | 2995948881 | 2995951649 | 330 |
| 419 | 3300003203 | JGI25406J46586_10005401 | JGI25406J46586_100054012 | 331 |
| 420 | 3300005290 | Ga0065712_10106997 | Ga0065712_101069972 | 331 |
| 421 | 3300005293 | Ga0065715_10004188 | Ga0065715_100041881 | 331 |
| 422 | 3300005295 | Ga0065707_10003170 | Ga0065707_100031703 | 331 |
| 423 | 3300005295 | Ga0065707_10198382 | Ga0065707_101983821 | 331 |
| 424 | 3300005328 | Ga0070676_10257570 | Ga0070676_102575701 | 331 |
| 425 | 3300005329 | Ga0070683_100160851 | Ga0070683_1001608512 | 331 |
| 426 | 3300005330 | Ga0070690_100289245 | Ga0070690_1002892451 | 331 |
| 427 | 3300005331 | Ga0070670_100004309 | Ga0070670_1000043094 | 331 |
| 428 | 3300005331 | Ga0070670_100022221 | Ga0070670_1000222212 | 331 |
| 429 | 3300005331 | Ga0070670_100023356 | Ga0070670_1000233562 | 331 |
| 430 | 3300005331 | Ga0070670_100164515 | Ga0070670_1001645152 | 331 |
| 431 | 3300005331 | Ga0070670_100179812 | Ga0070670_1001798122 | 331 |
| 432 | 3300005334 | Ga0068869_100136230 | Ga0068869_1001362301 | 331 |
| 433 | 3300005334 | Ga0068869_100248095 | Ga0068869_1002480952 | 331 |
| 434 | 3300005335 | Ga0070666_10115508 | Ga0070666_101155082 | 331 |
| 435 | 3300005340 | Ga0070689_100032021 | Ga0070689_1000320213 | 331 |
| 436 | 3300005340 | Ga0070689_100032944 | Ga0070689_1000329441 | 331 |
| 437 | 3300005340 | Ga0070689_100038392 | Ga0070689_1000383922 | 331 |
| 438 | 3300005340 | Ga0070689_100039411 | Ga0070689_1000394113 | 331 |
| 439 | 3300005340 | Ga0070689_100074258 | Ga0070689_1000742583 | 331 |
| 440 | 3300005341 | Ga0070691_10010618 | Ga0070691_100106183 | 331 |
| 441 | 3300005343 | Ga0070687_100012617 | Ga0070687_1000126174 | 331 |
| 442 | 3300005343 | Ga0070687_100152432 | Ga0070687_1001524322 | 331 |
| 443 | 3300005344 | Ga0070661_100012157 | Ga0070661_1000121572 | 331 |
| 444 | 3300005345 | Ga0070692_10071957 | Ga0070692_100719572 | 331 |
| 445 | 3300005353 | Ga0070669_100001414 | Ga0070669_1000014147 | 331 |
| 446 | 3300005353 | Ga0070669_100027408 | Ga0070669_1000274081 | 331 |
| 447 | 3300005353 | Ga0070669_100058591 | Ga0070669_1000585912 | 331 |
| 448 | 3300005353 | Ga0070669_100374442 | Ga0070669_1003744421 | 331 |
| 449 | 3300005354 | Ga0070675_100001217 | Ga0070675_1000012174 | 331 |
| 450 | 3300005354 | Ga0070675_100001225 | Ga0070675_1000012255 | 331 |
| 451 | 3300005354 | Ga0070675_100008687 | Ga0070675_1000086875 | 331 |
| 452 | 3300005354 | Ga0070675_100039757 | Ga0070675_1000397572 | 331 |
| 453 | 3300005354 | Ga0070675_100076372 | Ga0070675_1000763721 | 331 |
| 454 | 3300005354 | Ga0070675_100162562 | Ga0070675_1001625622 | 331 |
| 455 | 3300005355 | Ga0070671_100005852 | Ga0070671_1000058528 | 331 |
| 456 | 3300005355 | Ga0070671_100009229 | Ga0070671_1000092292 | 331 |
| 457 | 3300005356 | Ga0070674_100312467 | Ga0070674_1003124671 | 331 |
| 458 | 3300005364 | Ga0070673_100148350 | Ga0070673_1001483502 | 331 |
| 459 | 3300005364 | Ga0070673_100179045 | Ga0070673_1001790452 | 331 |
| 460 | 3300005364 | Ga0070673_100342702 | Ga0070673_1003427021 | 331 |
| 461 | 3300005365 | Ga0070688_100002411 | Ga0070688_1000024113 | 331 |
| 462 | 3300005365 | Ga0070688_100003784 | Ga0070688_1000037848 | 331 |
| 463 | 3300005365 | Ga0070688_100050052 | Ga0070688_1000500523 | 331 |
| 464 | 3300005365 | Ga0070688_100180537 | Ga0070688_1001805371 | 331 |
| 465 | 3300005366 | Ga0070659_100113743 | Ga0070659_1001137432 | 331 |
| 466 | 3300005367 | Ga0070667_100061524 | Ga0070667_1000615242 | 331 |
| 467 | 3300005440 | Ga0070705_100000116 | Ga0070705_10000011629 | 331 |
| 468 | 3300005440 | Ga0070705_100032260 | Ga0070705_1000322603 | 331 |
| 469 | 3300005441 | Ga0070700_100072300 | Ga0070700_1000723002 | 331 |
| 470 | 3300005441 | Ga0070700_100176452 | Ga0070700_1001764522 | 331 |
| 471 | 3300005444 | Ga0070694_100084248 | Ga0070694_1000842483 | 331 |
| 472 | 3300005444 | Ga0070694_100264000 | Ga0070694_1002640002 | 331 |
| 473 | 3300005445 | Ga0070708_100333050 | Ga0070708_1003330501 | 331 |
| 474 | 3300005445 | Ga0070708_100419736 | Ga0070708_1004197361 | 331 |
| 475 | 3300005455 | Ga0070663_100185106 | Ga0070663_1001851062 | 331 |
| 476 | 3300005457 | Ga0070662_100083848 | Ga0070662_1000838482 | 331 |
| 477 | 3300005457 | Ga0070662_100093816 | Ga0070662_1000938162 | 331 |
| 478 | 3300005459 | Ga0068867_100039559 | Ga0068867_1000395592 | 331 |
| 479 | 3300005468 | Ga0070707_100432239 | Ga0070707_1004322392 | 331 |
| 480 | 3300005471 | Ga0070698_100008611 | Ga0070698_1000086114 | 331 |
| 481 | 3300005471 | Ga0070698_100074877 | Ga0070698_1000748772 | 331 |
| 482 | 3300005471 | Ga0070698_100094926 | Ga0070698_1000949263 | 331 |
| 483 | 3300005518 | Ga0070699_100013945 | Ga0070699_1000139453 | 331 |
| 484 | 3300005518 | Ga0070699_100106092 | Ga0070699_1001060922 | 331 |
| 485 | 3300005518 | Ga0070699_100130553 | Ga0070699_1001305532 | 331 |
| 486 | 3300005535 | Ga0070684_100000131 | Ga0070684_1000001318 | 331 |
| 487 | 3300005543 | Ga0070672_100011456 | Ga0070672_1000114564 | 331 |
| 488 | 3300005543 | Ga0070672_100116012 | Ga0070672_1001160122 | 331 |
| 489 | 3300005545 | Ga0070695_100001466 | Ga0070695_1000014666 | 331 |
| 490 | 3300005546 | Ga0070696_100000141 | Ga0070696_10000014113 | 331 |
| 491 | 3300005546 | Ga0070696_100010528 | Ga0070696_1000105283 | 331 |
| 492 | 3300005549 | Ga0070704_100252371 | Ga0070704_1002523711 | 331 |
| 493 | 3300005564 | Ga0070664_100013166 | Ga0070664_1000131664 | 331 |
| 494 | 3300005564 | Ga0070664_100180015 | Ga0070664_1001800152 | 331 |
| 495 | 3300005577 | Ga0068857_100006456 | Ga0068857_1000064567 | 331 |
| 496 | 3300005578 | Ga0068854_100084220 | Ga0068854_1000842202 | 331 |
| 497 | 3300005615 | Ga0070702_100005096 | Ga0070702_1000050965 | 331 |
| 498 | 3300005615 | Ga0070702_100021415 | Ga0070702_1000214152 | 331 |
| 499 | 3300005617 | Ga0068859_100001084 | Ga0068859_1000010843 | 331 |
| 500 | 3300005617 | Ga0068859_100114953 | Ga0068859_1001149532 | 331 |
| 501 | 3300005618 | Ga0068864_100000583 | Ga0068864_10000058316 | 331 |
| 502 | 3300005618 | Ga0068864_100043296 | Ga0068864_1000432963 | 331 |
| 503 | 3300005618 | Ga0068864_100081212 | Ga0068864_1000812122 | 331 |
| 504 | 3300005719 | Ga0068861_100010517 | Ga0068861_1000105176 | 331 |
| 505 | 3300005719 | Ga0068861_100057934 | Ga0068861_1000579343 | 331 |
| 506 | 3300005719 | Ga0068861_100351496 | Ga0068861_1003514961 | 331 |
| 507 | 3300005841 | Ga0068863_100000019 | Ga0068863_100000019202 | 331 |
| 508 | 3300005841 | Ga0068863_100033097 | Ga0068863_1000330973 | 331 |
| 509 | 3300005841 | Ga0068863_100081690 | Ga0068863_1000816902 | 331 |
| 510 | 3300005843 | Ga0068860_100179866 | Ga0068860_1001798662 | 331 |
| 511 | 3300005843 | Ga0068860_100250185 | Ga0068860_1002501852 | 331 |
| 512 | 3300005843 | Ga0068860_100348768 | Ga0068860_1003487682 | 331 |
| 513 | 3300005844 | Ga0068862_100054848 | Ga0068862_1000548482 | 331 |
| 514 | 3300005844 | Ga0068862_100182058 | Ga0068862_1001820582 | 331 |
| 515 | 3300005844 | Ga0068862_100278351 | Ga0068862_1002783512 | 331 |
| 516 | 3300005937 | Ga0081455_10035042 | Ga0081455_100350421 | 331 |
| 517 | 3300005985 | Ga0081539_10000334 | Ga0081539_1000033472 | 331 |
| 518 | 3300005985 | Ga0081539_10000548 | Ga0081539_1000054828 | 331 |
| 519 | 3300006051 | Ga0075364_10259181 | Ga0075364_102591812 | 331 |
| 520 | 3300006358 | Ga0068871_100141796 | Ga0068871_1001417961 | 331 |
| 521 | 3300006844 | Ga0075428_100001819 | Ga0075428_1000018195 | 331 |
| 522 | 3300006844 | Ga0075428_100057101 | Ga0075428_1000571013 | 331 |
| 523 | 3300006844 | Ga0075428_100079670 | Ga0075428_1000796702 | 331 |
| 524 | 3300006844 | Ga0075428_100080881 | Ga0075428_1000808812 | 331 |
| 525 | 3300006844 | Ga0075428_100108460 | Ga0075428_1001084602 | 331 |
| 526 | 3300006844 | Ga0075428_100160340 | Ga0075428_1001603402 | 331 |
| 527 | 3300006846 | Ga0075430_100016744 | Ga0075430_1000167442 | 331 |
| 528 | 3300006846 | Ga0075430_100114973 | Ga0075430_1001149732 | 331 |
| 529 | 3300006846 | Ga0075430_100180286 | Ga0075430_1001802862 | 331 |
| 530 | 3300006847 | Ga0075431_100059805 | Ga0075431_1000598052 | 331 |
| 531 | 3300006847 | Ga0075431_100071732 | Ga0075431_1000717322 | 331 |
| 532 | 3300006852 | Ga0075433_10046558 | Ga0075433_100465582 | 331 |
| 533 | 3300006852 | Ga0075433_10049165 | Ga0075433_100491652 | 331 |
| 534 | 3300006852 | Ga0075433_10155746 | Ga0075433_101557461 | 331 |
| 535 | 3300006852 | Ga0075433_10159709 | Ga0075433_101597092 | 331 |
| 536 | 3300006852 | Ga0075433_10211999 | Ga0075433_102119992 | 331 |
| 537 | 3300006871 | Ga0075434_100016423 | Ga0075434_1000164235 | 331 |
| 538 | 3300006871 | Ga0075434_100024027 | Ga0075434_1000240274 | 331 |
| 539 | 3300006871 | Ga0075434_100037189 | Ga0075434_1000371895 | 331 |
| 540 | 3300006871 | Ga0075434_100118947 | Ga0075434_1001189471 | 331 |
| 541 | 3300006871 | Ga0075434_100126099 | Ga0075434_1001260992 | 331 |
| 542 | 3300006871 | Ga0075434_100131168 | Ga0075434_1001311682 | 331 |
| 543 | 3300006871 | Ga0075434_100514235 | Ga0075434_1005142351 | 331 |
| 544 | 3300006880 | Ga0075429_100058037 | Ga0075429_1000580371 | 331 |
| 545 | 3300006880 | Ga0075429_100070422 | Ga0075429_1000704222 | 331 |
| 546 | 3300006880 | Ga0075429_100201739 | Ga0075429_1002017392 | 331 |
| 547 | 3300006880 | Ga0075429_100295260 | Ga0075429_1002952601 | 331 |
| 548 | 3300006931 | Ga0097620_100001083 | Ga0097620_1000010833 | 331 |
| 549 | 3300006931 | Ga0097620_100114953 | Ga0097620_1001149532 | 331 |
| 550 | 3300007076 | Ga0075435_100005829 | Ga0075435_1000058296 | 331 |
| 551 | 3300007076 | Ga0075435_100094384 | Ga0075435_1000943842 | 331 |
| 552 | 3300007076 | Ga0075435_100143497 | Ga0075435_1001434971 | 331 |
| 553 | 3300007076 | Ga0075435_100188600 | Ga0075435_1001886001 | 331 |
| 554 | 3300009092 | Ga0105250_10001875 | Ga0105250_1000187513 | 331 |
| 555 | 3300009094 | Ga0111539_10006856 | Ga0111539_100068569 | 331 |
| 556 | 3300009094 | Ga0111539_10007298 | Ga0111539_100072985 | 331 |
| 557 | 3300009094 | Ga0111539_10019390 | Ga0111539_100193903 | 331 |
| 558 | 3300009094 | Ga0111539_10086698 | Ga0111539_100866981 | 331 |
| 559 | 3300009094 | Ga0111539_10294161 | Ga0111539_102941612 | 331 |
| 560 | 3300009094 | Ga0111539_10326706 | Ga0111539_103267061 | 331 |
| 561 | 3300009147 | Ga0114129_10017991 | Ga0114129_100179917 | 331 |
| 562 | 3300009147 | Ga0114129_10021206 | Ga0114129_100212066 | 331 |
| 563 | 3300009147 | Ga0114129_10027614 | Ga0114129_100276146 | 331 |
| 564 | 3300009147 | Ga0114129_10037003 | Ga0114129_100370036 | 331 |
| 565 | 3300009147 | Ga0114129_10039981 | Ga0114129_100399813 | 331 |
| 566 | 3300009147 | Ga0114129_10092853 | Ga0114129_100928533 | 331 |
| 567 | 3300009147 | Ga0114129_10097270 | Ga0114129_100972703 | 331 |
| 568 | 3300009147 | Ga0114129_10105548 | Ga0114129_101055482 | 331 |
| 569 | 3300009147 | Ga0114129_10427377 | Ga0114129_104273772 | 331 |
| 570 | 3300009148 | Ga0105243_10491266 | Ga0105243_104912662 | 331 |
| 571 | 3300009174 | Ga0105241_10048546 | Ga0105241_100485462 | 331 |
| 572 | 3300009176 | Ga0105242_10075697 | Ga0105242_100756972 | 331 |
| 573 | 3300009177 | Ga0105248_10004937 | Ga0105248_1000493711 | 331 |
| 574 | 3300009177 | Ga0105248_10030345 | Ga0105248_100303453 | 331 |
| 575 | 3300009545 | Ga0105237_10085870 | Ga0105237_100858703 | 331 |
| 576 | 3300009553 | Ga0105249_10000654 | Ga0105249_100006548 | 331 |
| 577 | 3300009553 | Ga0105249_10107619 | Ga0105249_101076193 | 331 |
| 578 | 3300009553 | Ga0105249_10198420 | Ga0105249_101984202 | 331 |
| 579 | 3300009553 | Ga0105249_10326727 | Ga0105249_103267272 | 331 |
| 580 | 3300010375 | Ga0105239_10246529 | Ga0105239_102465292 | 331 |
| 581 | 3300013296 | Ga0157374_10041093 | Ga0157374_100410931 | 331 |
| 582 | 3300013296 | Ga0157374_10194629 | Ga0157374_101946292 | 331 |
| 583 | 3300013308 | Ga0157375_10019096 | Ga0157375_100190963 | 331 |
| 584 | 3300014325 | Ga0163163_10004894 | Ga0163163_100048943 | 331 |
| 585 | 3300014325 | Ga0163163_10050639 | Ga0163163_100506392 | 331 |
| 586 | 3300014325 | Ga0163163_10447815 | Ga0163163_104478151 | 331 |
| 587 | 3300014326 | Ga0157380_10055011 | Ga0157380_100550113 | 331 |
| 588 | 3300014745 | Ga0157377_10017156 | Ga0157377_100171564 | 331 |
| 589 | 3300014745 | Ga0157377_10045165 | Ga0157377_100451652 | 331 |
| 590 | 3300014968 | Ga0157379_10435620 | Ga0157379_104356202 | 331 |
| 591 | 3300025315 | Ga0207697_10007900 | Ga0207697_100079002 | 331 |
| 592 | 3300025315 | Ga0207697_10075189 | Ga0207697_100751892 | 331 |
| 593 | 3300025711 | Ga0207696_1016053 | Ga0207696_10160532 | 331 |
| 594 | 3300025903 | Ga0207680_10077036 | Ga0207680_100770361 | 331 |
| 595 | 3300025908 | Ga0207643_10001752 | Ga0207643_100017528 | 331 |
| 596 | 3300025918 | Ga0207662_10007677 | Ga0207662_100076772 | 331 |
| 597 | 3300025918 | Ga0207662_10023443 | Ga0207662_100234432 | 331 |
| 598 | 3300025925 | Ga0207650_10007102 | Ga0207650_100071025 | 331 |
| 599 | 3300025925 | Ga0207650_10015962 | Ga0207650_100159621 | 331 |
| 600 | 3300025925 | Ga0207650_10136821 | Ga0207650_101368212 | 331 |
| 601 | 3300025925 | Ga0207650_10138597 | Ga0207650_101385972 | 331 |
| 602 | 3300025926 | Ga0207659_10000110 | Ga0207659_1000011032 | 331 |
| 603 | 3300025926 | Ga0207659_10005455 | Ga0207659_100054555 | 331 |
| 604 | 3300025926 | Ga0207659_10009646 | Ga0207659_100096462 | 331 |
| 605 | 3300025926 | Ga0207659_10025939 | Ga0207659_100259393 | 331 |
| 606 | 3300025926 | Ga0207659_10212906 | Ga0207659_102129062 | 331 |
| 607 | 3300025927 | Ga0207687_10125483 | Ga0207687_101254832 | 331 |
| 608 | 3300025931 | Ga0207644_10011367 | Ga0207644_100113672 | 331 |
| 609 | 3300025931 | Ga0207644_10088751 | Ga0207644_100887512 | 331 |
| 610 | 3300025933 | Ga0207706_10046751 | Ga0207706_100467512 | 331 |
| 611 | 3300025933 | Ga0207706_10136090 | Ga0207706_101360902 | 331 |
| 612 | 3300025933 | Ga0207706_10244336 | Ga0207706_102443362 | 331 |
| 613 | 3300025934 | Ga0207686_10275402 | Ga0207686_102754022 | 331 |
| 614 | 3300025936 | Ga0207670_10011792 | Ga0207670_100117923 | 331 |
| 615 | 3300025936 | Ga0207670_10061176 | Ga0207670_100611762 | 331 |
| 616 | 3300025938 | Ga0207704_10230296 | Ga0207704_102302962 | 331 |
| 617 | 3300025940 | Ga0207691_10010734 | Ga0207691_100107343 | 331 |
| 618 | 3300025940 | Ga0207691_10017127 | Ga0207691_100171273 | 331 |
| 619 | 3300025940 | Ga0207691_10145049 | Ga0207691_101450492 | 331 |
| 620 | 3300025940 | Ga0207691_10149499 | Ga0207691_101494992 | 331 |
| 621 | 3300025940 | Ga0207691_10202520 | Ga0207691_102025202 | 331 |
| 622 | 3300025941 | Ga0207711_10109413 | Ga0207711_101094133 | 331 |
| 623 | 3300025942 | Ga0207689_10181233 | Ga0207689_101812332 | 331 |
| 624 | 3300025944 | Ga0207661_10001850 | Ga0207661_100018504 | 331 |
| 625 | 3300025945 | Ga0207679_10007781 | Ga0207679_100077812 | 331 |
| 626 | 3300025945 | Ga0207679_10065127 | Ga0207679_100651272 | 331 |
| 627 | 3300025960 | Ga0207651_10125745 | Ga0207651_101257452 | 331 |
| 628 | 3300025960 | Ga0207651_10294267 | Ga0207651_102942671 | 331 |
| 629 | 3300025960 | Ga0207651_10310162 | Ga0207651_103101621 | 331 |
| 630 | 3300025981 | Ga0207640_10181997 | Ga0207640_101819971 | 331 |
| 631 | 3300025986 | Ga0207658_10056542 | Ga0207658_100565422 | 331 |
| 632 | 3300025986 | Ga0207658_10216821 | Ga0207658_102168212 | 331 |
| 633 | 3300026035 | Ga0207703_10001472 | Ga0207703_100014729 | 331 |
| 634 | 3300026035 | Ga0207703_10124888 | Ga0207703_101248882 | 331 |
| 635 | 3300026041 | Ga0207639_10332689 | Ga0207639_103326891 | 331 |
| 636 | 3300026067 | Ga0207678_10093256 | Ga0207678_100932562 | 331 |
| 637 | 3300026067 | Ga0207678_10363542 | Ga0207678_103635422 | 331 |
| 638 | 3300026075 | Ga0207708_10020509 | Ga0207708_100205093 | 331 |
| 639 | 3300026088 | Ga0207641_10000005 | Ga0207641_1000000520 | 331 |
| 640 | 3300026088 | Ga0207641_10121503 | Ga0207641_101215032 | 331 |
| 641 | 3300026089 | Ga0207648_10010861 | Ga0207648_100108614 | 331 |
| 642 | 3300026095 | Ga0207676_10002609 | Ga0207676_1000260915 | 331 |
| 643 | 3300026095 | Ga0207676_10020241 | Ga0207676_100202412 | 331 |
| 644 | 3300026095 | Ga0207676_10194997 | Ga0207676_101949972 | 331 |
| 645 | 3300026116 | Ga0207674_10032779 | Ga0207674_100327794 | 331 |
| 646 | 3300026116 | Ga0207674_10078540 | Ga0207674_100785403 | 331 |
| 647 | 3300026116 | Ga0207674_10095302 | Ga0207674_100953022 | 331 |
| 648 | 3300026118 | Ga0207675_100004144 | Ga0207675_1000041447 | 331 |
| 649 | 3300026118 | Ga0207675_100039417 | Ga0207675_1000394172 | 331 |
| 650 | 3300026118 | Ga0207675_100131679 | Ga0207675_1001316792 | 331 |
| 651 | 3300026118 | Ga0207675_100355489 | Ga0207675_1003554892 | 331 |
| 652 | 3300026142 | Ga0207698_10142204 | Ga0207698_101422041 | 331 |
| 653 | 3300027907 | Ga0207428_10000814 | Ga0207428_1000081425 | 331 |
| 654 | 3300027907 | Ga0207428_10023480 | Ga0207428_100234802 | 331 |
| 655 | 3300027907 | Ga0207428_10023677 | Ga0207428_100236773 | 331 |
| 656 | 3300027907 | Ga0207428_10109115 | Ga0207428_101091152 | 331 |
| 657 | 3300027907 | Ga0207428_10145544 | Ga0207428_101455441 | 331 |
| 658 | 3300028380 | Ga0268265_10100210 | Ga0268265_101002101 | 331 |
| 659 | 3300028380 | Ga0268265_10130797 | Ga0268265_101307971 | 331 |
| 660 | 3300028380 | Ga0268265_10341374 | Ga0268265_103413741 | 331 |
| 661 | 3300028381 | Ga0268264_10044990 | Ga0268264_100449902 | 331 |
| 662 | 3300031824 | Ga0307413_10010611 | Ga0307413_100106112 | 331 |
| 663 | 3300031852 | Ga0307410_10024217 | Ga0307410_100242173 | 331 |
| 664 | 3300031901 | Ga0307406_10129684 | Ga0307406_101296841 | 331 |
| 665 | 3300031995 | Ga0307409_100013022 | Ga0307409_1000130222 | 331 |
| 666 | 3300031995 | Ga0307409_100018478 | Ga0307409_1000184783 | 331 |
| 667 | 3300032002 | Ga0307416_100086564 | Ga0307416_1000865642 | 331 |
| 668 | 3300032005 | Ga0307411_10121049 | Ga0307411_101210492 | 331 |
| 669 | 3300032126 | Ga0307415_100104302 | Ga0307415_1001043022 | 331 |
| 670 | 3300035112 | Ga0373932_0049668 | Ga0373932_0049668_40_1050 | 331 |
| 671 | 3300037068 | Ga0373925_0121611 | Ga0373925_0121611_794_1810 | 331 |
| 672 | 3300042435 | Ga0439434_0021324 | Ga0439434_0021324_844_1875 | 331 |
| 673 | 3300042461 | Ga0439460_0014263 | Ga0439460_0014263_823_1878 | 331 |
| 674 | 3300044656 | Ga0466969_0005283 | Ga0466969_0005283_3167_4180 | 331 |
| 675 | 3300045051 | Ga0451576_0038031 | Ga0451576_0038031_1005_2021 | 331 |
| 676 | 3300045051 | Ga0451576_0055575 | Ga0451576_0055575_1488_2504 | 331 |
| 677 | 3300046539 | Ga0495621_0045606 | Ga0495621_0045606_230_1246 | 331 |
| 678 | 3300046616 | Ga0495668_0000024 | Ga0495668_0000024_346472_347500 | 331 |
| 679 | 3300046664 | Ga0495659_0009276 | Ga0495659_0009276_1415_2431 | 331 |
| 680 | 3300046664 | Ga0495659_0012961 | Ga0495659_0012961_26_1042 | 331 |
| 681 | 3300046664 | Ga0495659_0067026 | Ga0495659_0067026_247_1260 | 331 |
| 682 | 3300046664 | Ga0495659_0085380 | Ga0495659_0085380_36_1052 | 331 |
| 683 | 3300046683 | Ga0495658_0198613 | Ga0495658_0198613_141_1157 | 331 |
| 684 | 3300046684 | Ga0495669_0007859 | Ga0495669_0007859_2765_3781 | 331 |
| 685 | 3300047318 | Ga0495636_0020569 | Ga0495636_0020569_1510_2523 | 331 |
| 686 | 3300048903 | Ga0496100_0102951 | Ga0496100_0102951_770_1780 | 331 |
| 687 | 3300048905 | Ga0496102_0287319 | Ga0496102_0287319_309_1319 | 331 |
| 688 | 3300048907 | Ga0496104_0003434 | Ga0496104_0003434_12164_13174 | 331 |
| 689 | 3300048908 | Ga0496105_0023194 | Ga0496105_0023194_731_1741 | 331 |
| 690 | 3300048909 | Ga0496106_0304668 | Ga0496106_0304668_168_1184 | 331 |
| 691 | 3300048911 | Ga0496108_0002594 | Ga0496108_0002594_9544_10554 | 331 |
| 692 | 3300048912 | Ga0496109_0003044 | Ga0496109_0003044_11532_12542 | 331 |
| 693 | 3300048912 | Ga0496109_0246009 | Ga0496109_0246009_116_1126 | 331 |
| 694 | 3300048913 | Ga0496110_0004462 | Ga0496110_0004462_8815_9825 | 331 |
| 695 | 3300048915 | Ga0496112_0008114 | Ga0496112_0008114_4656_5666 | 331 |
| 696 | 3300048916 | Ga0496113_0010492 | Ga0496113_0010492_1024_2034 | 331 |
| 697 | 3300048917 | Ga0496114_0045076 | Ga0496114_0045076_853_1878 | 331 |
| 698 | 3300049569 | Ga0501032_0006519 | Ga0501032_0006519_1261_2277 | 331 |
| 699 | 3300049569 | Ga0501032_0054984 | Ga0501032_0054984_354_1373 | 331 |
| 700 | 3300049571 | Ga0501034_0009602 | Ga0501034_0009602_2948_3967 | 331 |
| 701 | 3300049571 | Ga0501034_0021706 | Ga0501034_0021706_2897_3913 | 331 |
| 702 | 3300049572 | Ga0501036_0047615 | Ga0501036_0047615_2083_3102 | 331 |
| 703 | 3300049572 | Ga0501036_0095789 | Ga0501036_0095789_1433_2452 | 331 |
| 704 | 3300049574 | Ga0501038_0009816 | Ga0501038_0009816_1455_2471 | 331 |
| 705 | 3300049574 | Ga0501038_0080664 | Ga0501038_0080664_1710_2729 | 331 |
| 706 | 3300049575 | Ga0501039_0014224 | Ga0501039_0014224_2635_3651 | 331 |
| 707 | 3300049575 | Ga0501039_0048953 | Ga0501039_0048953_138_1157 | 331 |
| 708 | 3300049575 | Ga0501039_0299277 | Ga0501039_0299277_34_1047 | 331 |
| 709 | 3300049576 | Ga0501040_0023710 | Ga0501040_0023710_389_1402 | 331 |
| 710 | 3300049579 | Ga0501043_0034044 | Ga0501043_0034044_1892_2911 | 331 |
| 711 | 3300049580 | Ga0501046_0013245 | Ga0501046_0013245_3649_4665 | 331 |
| 712 | 3300049581 | Ga0501047_0038513 | Ga0501047_0038513_1993_3009 | 331 |
| 713 | 3300049581 | Ga0501047_0047353 | Ga0501047_0047353_2882_3901 | 331 |
| 714 | 3300049582 | Ga0501048_0044212 | Ga0501048_0044212_1432_2448 | 331 |
| 715 | 3300049583 | Ga0501067_0025768 | Ga0501067_0025768_789_1808 | 331 |
| 716 | 3300049583 | Ga0501067_0053450 | Ga0501067_0053450_537_1553 | 331 |
| 717 | 3300049584 | Ga0501068_0093923 | Ga0501068_0093923_791_1810 | 331 |
| 718 | 3300049586 | Ga0501070_0074157 | Ga0501070_0074157_330_1349 | 331 |
| 719 | 3300049589 | Ga0501073_0018115 | Ga0501073_0018115_3208_4227 | 331 |
| 720 | 3300049589 | Ga0501073_0094712 | Ga0501073_0094712_343_1356 | 331 |
| 721 | 3300049592 | Ga0501076_0116632 | Ga0501076_0116632_610_1629 | 331 |
| 722 | 3300049742 | Ga0501080_0009143 | Ga0501080_0009143_4260_5276 | 331 |
| 723 | 3300049742 | Ga0501080_0136327 | Ga0501080_0136327_67_1086 | 331 |
| 724 | 3300049822 | Ga0501035_0016181 | Ga0501035_0016181_2872_3888 | 331 |
| 725 | 3300049823 | Ga0501044_0002228 | Ga0501044_0002228_1338_2354 | 331 |
| 726 | 3300049823 | Ga0501044_0104326 | Ga0501044_0104326_1651_2670 | 331 |
| 727 | 3300050491 | nmdc:mga00v17_61120_c1 | nmdc:mga00v17_61120_c1_1244_2254 | 331 |
| 728 | 3300050507 | nmdc:mga05p37_113658_c1 | nmdc:mga05p37_113658_c1_1399_2427 | 331 |
| 729 | 3300050507 | nmdc:mga05p37_114217_c1 | nmdc:mga05p37_114217_c1_137_1147 | 331 |
| 730 | 3300050507 | nmdc:mga05p37_14951_c1 | nmdc:mga05p37_14951_c1_7852_8883 | 331 |
| 731 | 3300050507 | nmdc:mga05p37_20417_c1 | nmdc:mga05p37_20417_c1_1692_2708 | 331 |
| 732 | 3300050507 | nmdc:mga05p37_56964_c1 | nmdc:mga05p37_56964_c1_2860_3876 | 331 |
| 733 | 3300050507 | nmdc:mga05p37_64255_c1 | nmdc:mga05p37_64255_c1_1379_2464 | 331 |
| 734 | 3300050508 | nmdc:mga09592_235295_c1 | nmdc:mga09592_235295_c1_29_1045 | 331 |
| 735 | 3300050508 | nmdc:mga09592_241463_c1 | nmdc:mga09592_241463_c1_417_1502 | 331 |
| 736 | 3300050508 | nmdc:mga09592_74670_c1 | nmdc:mga09592_74670_c1_387_1427 | 331 |
| 737 | 3300050509 | nmdc:mga0qj67_107382_c1 | nmdc:mga0qj67_107382_c1_520_1593 | 331 |
| 738 | 3300050509 | nmdc:mga0qj67_82798_c1 | nmdc:mga0qj67_82798_c1_74_1105 | 331 |
| 739 | 3300050510 | nmdc:mga06r32_225664_c1 | nmdc:mga06r32_225664_c1_483_1499 | 331 |
| 740 | 3300050510 | nmdc:mga06r32_58760_c1 | nmdc:mga06r32_58760_c1_1485_2558 | 331 |
| 741 | 3300050511 | nmdc:mga08y16_416437_c1 | nmdc:mga08y16_416437_c1_298_1314 | 331 |
| 742 | 3300050511 | nmdc:mga08y16_6402_c1 | nmdc:mga08y16_6402_c1_2148_3188 | 331 |
| 743 | 3300050512 | nmdc:mga0n895_125962_c1 | nmdc:mga0n895_125962_c1_109_1122 | 331 |
| 744 | 3300050512 | nmdc:mga0n895_16737_c1 | nmdc:mga0n895_16737_c1_2060_3076 | 331 |
| 745 | 3300050512 | nmdc:mga0n895_168210_c1 | nmdc:mga0n895_168210_c1_549_1559 | 331 |
| 746 | 3300050512 | nmdc:mga0n895_19263_c1 | nmdc:mga0n895_19263_c1_571_1587 | 331 |
| 747 | 3300050512 | nmdc:mga0n895_412145_c1 | nmdc:mga0n895_412145_c1_153_1169 | 331 |
| 748 | 3300050512 | nmdc:mga0n895_4246_c1 | nmdc:mga0n895_4246_c1_1481_2524 | 331 |
| 749 | 3300050512 | nmdc:mga0n895_57949_c1 | nmdc:mga0n895_57949_c1_2480_3508 | 331 |
| 750 | 3300050512 | nmdc:mga0n895_84598_c1 | nmdc:mga0n895_84598_c1_283_1293 | 331 |
| 751 | 3300050513 | nmdc:mga0rr50_4416_c1 | nmdc:mga0rr50_4416_c1_3884_4900 | 331 |
| 752 | 3300050513 | nmdc:mga0rr50_64007_c1 | nmdc:mga0rr50_64007_c1_1481_2491 | 331 |
| 753 | 3300050515 | nmdc:mga0a205_112872_c1 | nmdc:mga0a205_112872_c1_149_1282 | 331 |
| 754 | 3300050515 | nmdc:mga0a205_178200_c1 | nmdc:mga0a205_178200_c1_636_1652 | 331 |
| 755 | 3300050515 | nmdc:mga0a205_28284_c1 | nmdc:mga0a205_28284_c1_2207_3223 | 331 |
| 756 | 3300050515 | nmdc:mga0a205_6227_c1 | nmdc:mga0a205_6227_c1_2494_3507 | 331 |
| 757 | 3300053093 | Ga0500651_0119011 | Ga0500651_0119011_87_1097 | 331 |
| 758 | 3300054114 | Ga0501084_0031351 | Ga0501084_0031351_390_1403 | 331 |
| 759 | 3300054114 | Ga0501084_0396586 | Ga0501084_0396586_59_1075 | 331 |
| 760 | 3300060353 | Ga0501082_0001523 | Ga0501082_0001523_3747_4760 | 331 |
| 761 | 3300060353 | Ga0501082_0007454 | Ga0501082_0007454_1540_2559 | 331 |
| 762 | iso_pu_bacteria | 2547132130 | 2547500771 | 331 |
| 763 | iso_pu_bacteria | 2576861471 | 2578459248 | 331 |
| 764 | iso_pu_bacteria | 2816332141 | 2816516134 | 331 |
| 765 | iso_pu_bacteria | 2852649853 | 2852651579 | 331 |
| 766 | iso_pu_bacteria | 2919130084 | 2919132765 | 331 |
| 767 | iso_pu_bacteria | 2919134579 | 2919134617 | 331 |
| 768 | iso_pu_bacteria | 2929195423 | 2929196933 | 331 |
| 769 | iso_pu_bacteria | 2939622612 | 2939625156 | 331 |
| 770 | iso_pu_bacteria | 2941475908 | 2941477006 | 331 |
| 771 | iso_pu_bacteria | 2941489479 | 2941490344 | 331 |
| 772 | iso_pu_bacteria | 8002869464 | 8002872092 | 331 |
| 773 | iso_pu_bacteria | 8021622325 | 8021625261 | 331 |
| 774 | iso_pu_bacteria | 8021648035 | 8021649726 | 331 |
| 775 | 2162886007 | SwRhRL2b_contig_3539020 | SwRhRL2b_0314.00005670 | 332 |
| 776 | 3300005289 | Ga0065704_10070190 | Ga0065704_1007019064 | 332 |
| 777 | 3300005328 | Ga0070676_10004330 | Ga0070676_100043302 | 332 |
| 778 | 3300005335 | Ga0070666_10043508 | Ga0070666_100435083 | 332 |
| 779 | 3300005341 | Ga0070691_10003000 | Ga0070691_100030007 | 332 |
| 780 | 3300005343 | Ga0070687_100013142 | Ga0070687_1000131422 | 332 |
| 781 | 3300005343 | Ga0070687_100090533 | Ga0070687_1000905332 | 332 |
| 782 | 3300005345 | Ga0070692_10056824 | Ga0070692_100568242 | 332 |
| 783 | 3300005353 | Ga0070669_100029241 | Ga0070669_1000292412 | 332 |
| 784 | 3300005354 | Ga0070675_100442358 | Ga0070675_1004423581 | 332 |
| 785 | 3300005438 | Ga0070701_10012165 | Ga0070701_100121652 | 332 |
| 786 | 3300005440 | Ga0070705_100003965 | Ga0070705_1000039652 | 332 |
| 787 | 3300005444 | Ga0070694_100011107 | Ga0070694_1000111073 | 332 |
| 788 | 3300005459 | Ga0068867_100053738 | Ga0068867_1000537382 | 332 |
| 789 | 3300005459 | Ga0068867_100061470 | Ga0068867_1000614701 | 332 |
| 790 | 3300005468 | Ga0070707_100147585 | Ga0070707_1001475853 | 332 |
| 791 | 3300005468 | Ga0070707_100209972 | Ga0070707_1002099722 | 332 |
| 792 | 3300005518 | Ga0070699_100464075 | Ga0070699_1004640751 | 332 |
| 793 | 3300005544 | Ga0070686_100001409 | Ga0070686_1000014099 | 332 |
| 794 | 3300005545 | Ga0070695_100003657 | Ga0070695_1000036572 | 332 |
| 795 | 3300005545 | Ga0070695_100006552 | Ga0070695_1000065522 | 332 |
| 796 | 3300005546 | Ga0070696_100008448 | Ga0070696_1000084482 | 332 |
| 797 | 3300005548 | Ga0070665_100005360 | Ga0070665_1000053606 | 332 |
| 798 | 3300005549 | Ga0070704_100003072 | Ga0070704_1000030723 | 332 |
| 799 | 3300005578 | Ga0068854_100007820 | Ga0068854_1000078203 | 332 |
| 800 | 3300005578 | Ga0068854_100082043 | Ga0068854_1000820432 | 332 |
| 801 | 3300005618 | Ga0068864_100371295 | Ga0068864_1003712951 | 332 |
| 802 | 3300005718 | Ga0068866_10018596 | Ga0068866_100185963 | 332 |
| 803 | 3300005719 | Ga0068861_100005269 | Ga0068861_1000052691 | 332 |
| 804 | 3300005719 | Ga0068861_100151935 | Ga0068861_1001519352 | 332 |
| 805 | 3300005834 | Ga0068851_10065657 | Ga0068851_100656572 | 332 |
| 806 | 3300005841 | Ga0068863_100350008 | Ga0068863_1003500081 | 332 |
| 807 | 3300005842 | Ga0068858_100012279 | Ga0068858_1000122793 | 332 |
| 808 | 3300005842 | Ga0068858_100024743 | Ga0068858_1000247432 | 332 |
| 809 | 3300005844 | Ga0068862_100158428 | Ga0068862_1001584282 | 332 |
| 810 | 3300006237 | Ga0097621_100024815 | Ga0097621_1000248151 | 332 |
| 811 | 3300006358 | Ga0068871_100006884 | Ga0068871_1000068846 | 332 |
| 812 | 3300006846 | Ga0075430_100001773 | Ga0075430_10000177311 | 332 |
| 813 | 3300006847 | Ga0075431_100029382 | Ga0075431_1000293822 | 332 |
| 814 | 3300006852 | Ga0075433_10018342 | Ga0075433_100183422 | 332 |
| 815 | 3300006871 | Ga0075434_100009173 | Ga0075434_1000091733 | 332 |
| 816 | 3300006871 | Ga0075434_100117300 | Ga0075434_1001173002 | 332 |
| 817 | 3300006880 | Ga0075429_100087006 | Ga0075429_1000870062 | 332 |
| 818 | 3300006881 | Ga0068865_100000942 | Ga0068865_10000094213 | 332 |
| 819 | 3300006881 | Ga0068865_100065977 | Ga0068865_1000659771 | 332 |
| 820 | 3300006914 | Ga0075436_100059382 | Ga0075436_1000593822 | 332 |
| 821 | 3300007076 | Ga0075435_100000928 | Ga0075435_1000009282 | 332 |
| 822 | 3300007076 | Ga0075435_100003002 | Ga0075435_1000030027 | 332 |
| 823 | 3300007076 | Ga0075435_100109768 | Ga0075435_1001097682 | 332 |
| 824 | 3300007076 | Ga0075435_100139830 | Ga0075435_1001398302 | 332 |
| 825 | 3300009093 | Ga0105240_10013459 | Ga0105240_100134595 | 332 |
| 826 | 3300009094 | Ga0111539_10039504 | Ga0111539_100395042 | 332 |
| 827 | 3300009098 | Ga0105245_10022300 | Ga0105245_100223003 | 332 |
| 828 | 3300009101 | Ga0105247_10172018 | Ga0105247_101720181 | 332 |
| 829 | 3300009147 | Ga0114129_10017374 | Ga0114129_100173745 | 332 |
| 830 | 3300009147 | Ga0114129_10055881 | Ga0114129_100558812 | 332 |
| 831 | 3300009147 | Ga0114129_10063964 | Ga0114129_100639643 | 332 |
| 832 | 3300009147 | Ga0114129_10469870 | Ga0114129_104698703 | 332 |
| 833 | 3300009148 | Ga0105243_10012897 | Ga0105243_100128976 | 332 |
| 834 | 3300009174 | Ga0105241_10134353 | Ga0105241_101343532 | 332 |
| 835 | 3300009176 | Ga0105242_10008281 | Ga0105242_100082816 | 332 |
| 836 | 3300009176 | Ga0105242_10179844 | Ga0105242_101798442 | 332 |
| 837 | 3300009177 | Ga0105248_10013157 | Ga0105248_100131576 | 332 |
| 838 | 3300009545 | Ga0105237_10006300 | Ga0105237_100063003 | 332 |
| 839 | 3300009553 | Ga0105249_10012954 | Ga0105249_100129544 | 332 |
| 840 | 3300013296 | Ga0157374_10053818 | Ga0157374_100538182 | 332 |
| 841 | 3300013297 | Ga0157378_10008708 | Ga0157378_100087082 | 332 |
| 842 | 3300013306 | Ga0163162_10078015 | Ga0163162_100780152 | 332 |
| 843 | 3300013307 | Ga0157372_10207269 | Ga0157372_102072692 | 332 |
| 844 | 3300014325 | Ga0163163_10123269 | Ga0163163_101232692 | 332 |
| 845 | 3300014325 | Ga0163163_10209284 | Ga0163163_102092842 | 332 |
| 846 | 3300014326 | Ga0157380_10013953 | Ga0157380_100139533 | 332 |
| 847 | 3300025900 | Ga0207710_10089290 | Ga0207710_100892901 | 332 |
| 848 | 3300025903 | Ga0207680_10077737 | Ga0207680_100777372 | 332 |
| 849 | 3300025907 | Ga0207645_10005050 | Ga0207645_100050504 | 332 |
| 850 | 3300025911 | Ga0207654_10252755 | Ga0207654_102527551 | 332 |
| 851 | 3300025918 | Ga0207662_10010309 | Ga0207662_100103094 | 332 |
| 852 | 3300025918 | Ga0207662_10015467 | Ga0207662_100154671 | 332 |
| 853 | 3300025922 | Ga0207646_10093154 | Ga0207646_100931543 | 332 |
| 854 | 3300025922 | Ga0207646_10101801 | Ga0207646_101018013 | 332 |
| 855 | 3300025922 | Ga0207646_10243182 | Ga0207646_102431821 | 332 |
| 856 | 3300025923 | Ga0207681_10006282 | Ga0207681_100062827 | 332 |
| 857 | 3300025925 | Ga0207650_10335452 | Ga0207650_103354521 | 332 |
| 858 | 3300025934 | Ga0207686_10002104 | Ga0207686_100021044 | 332 |
| 859 | 3300025934 | Ga0207686_10006277 | Ga0207686_100062773 | 332 |
| 860 | 3300025935 | Ga0207709_10008442 | Ga0207709_100084422 | 332 |
| 861 | 3300025938 | Ga0207704_10001200 | Ga0207704_100012002 | 332 |
| 862 | 3300025941 | Ga0207711_10002106 | Ga0207711_100021063 | 332 |
| 863 | 3300025941 | Ga0207711_10169430 | Ga0207711_101694301 | 332 |
| 864 | 3300025960 | Ga0207651_10007650 | Ga0207651_100076503 | 332 |
| 865 | 3300025961 | Ga0207712_10044185 | Ga0207712_100441852 | 332 |
| 866 | 3300025981 | Ga0207640_10038990 | Ga0207640_100389903 | 332 |
| 867 | 3300025981 | Ga0207640_10058860 | Ga0207640_100588602 | 332 |
| 868 | 3300026035 | Ga0207703_10090140 | Ga0207703_100901403 | 332 |
| 869 | 3300026088 | Ga0207641_10093846 | Ga0207641_100938462 | 332 |
| 870 | 3300026089 | Ga0207648_10071064 | Ga0207648_100710642 | 332 |
| 871 | 3300026089 | Ga0207648_10206383 | Ga0207648_102063832 | 332 |
| 872 | 3300026095 | Ga0207676_10411425 | Ga0207676_104114251 | 332 |
| 873 | 3300026118 | Ga0207675_100004655 | Ga0207675_1000046556 | 332 |
| 874 | 3300026118 | Ga0207675_100117617 | Ga0207675_1001176172 | 332 |
| 875 | 3300026118 | Ga0207675_100232526 | Ga0207675_1002325262 | 332 |
| 876 | 3300034817 | Ga0373948_0008419 | Ga0373948_0008419_554_1579 | 332 |
| 877 | 3300034818 | Ga0373950_0006066 | Ga0373950_0006066_316_1341 | 332 |
| 878 | 3300034820 | Ga0373959_0002412 | Ga0373959_0002412_1756_2781 | 332 |
| 879 | 3300034957 | Ga0373938_0000534 | Ga0373938_0000534_4480_5505 | 332 |
| 880 | 3300035084 | Ga0373928_0002510 | Ga0373928_0002510_1261_2286 | 332 |
| 881 | 3300035085 | Ga0373929_0000719 | Ga0373929_0000719_3714_4739 | 332 |
| 882 | 3300035088 | Ga0373940_0000338 | Ga0373940_0000338_5610_6635 | 332 |
| 883 | 3300035090 | Ga0373949_0002015 | Ga0373949_0002015_1759_2784 | 332 |
| 884 | 3300035091 | Ga0373951_0000760 | Ga0373951_0000760_2633_3658 | 332 |
| 885 | 3300035112 | Ga0373932_0002231 | Ga0373932_0002231_3553_4578 | 332 |
| 886 | 3300035114 | Ga0373939_0000610 | Ga0373939_0000610_858_1883 | 332 |
| 887 | 3300035115 | Ga0373941_0000441 | Ga0373941_0000441_4277_5302 | 332 |
| 888 | 3300035121 | Ga0373960_0000099 | Ga0373960_0000099_10336_11361 | 332 |
| 889 | 3300035207 | Ga0373942_0000501 | Ga0373942_0000501_7875_8900 | 332 |
| 890 | 3300035241 | Ga0373961_0001461 | Ga0373961_0001461_3463_4488 | 332 |
| 891 | 3300035242 | Ga0373962_0002767 | Ga0373962_0002767_573_1598 | 332 |
| 892 | 3300035691 | Ga0373931_0004832 | Ga0373931_0004832_3228_4253 | 332 |
| 893 | 3300035692 | Ga0373935_0223138 | Ga0373935_0223138_30_1049 | 332 |
| 894 | 3300046681 | Ga0495647_0026822 | Ga0495647_0026822_986_2005 | 332 |
| 895 | 3300048905 | Ga0496102_0123104 | Ga0496102_0123104_958_1992 | 332 |
| 896 | 3300048909 | Ga0496106_0019449 | Ga0496106_0019449_2344_3378 | 332 |
| 897 | 3300048918 | Ga0496115_0008535 | Ga0496115_0008535_531_1550 | 332 |
| 898 | 3300049575 | Ga0501039_0030770 | Ga0501039_0030770_875_1924 | 332 |
| 899 | 3300049577 | Ga0501041_0068088 | Ga0501041_0068088_239_1288 | 332 |
| 900 | 3300049579 | Ga0501043_0146341 | Ga0501043_0146341_477_1526 | 332 |
| 901 | 3300049580 | Ga0501046_0164993 | Ga0501046_0164993_152_1201 | 332 |
| 902 | 3300049588 | Ga0501072_0037550 | Ga0501072_0037550_1598_2647 | 332 |
| 903 | 3300049592 | Ga0501076_0055252 | Ga0501076_0055252_1680_2729 | 332 |
| 904 | 3300049741 | Ga0501079_0008840 | Ga0501079_0008840_706_1755 | 332 |
| 905 | 3300049743 | Ga0501081_0103222 | Ga0501081_0103222_930_1979 | 332 |
| 906 | 3300049824 | Ga0501045_0032318 | Ga0501045_0032318_1989_3038 | 332 |
| 907 | 3300050507 | nmdc:mga05p37_173268_c1 | nmdc:mga05p37_173268_c1_1377_2390 | 332 |
| 908 | 3300050507 | nmdc:mga05p37_17374_c1 | nmdc:mga05p37_17374_c1_2838_3875 | 332 |
| 909 | 3300050507 | nmdc:mga05p37_5461_c1 | nmdc:mga05p37_5461_c1_5231_6253 | 332 |
| 910 | 3300050507 | nmdc:mga05p37_86332_c1 | nmdc:mga05p37_86332_c1_2695_3717 | 332 |
| 911 | 3300050509 | nmdc:mga0qj67_2660_c1 | nmdc:mga0qj67_2660_c1_1195_2244 | 332 |
| 912 | 3300050510 | nmdc:mga06r32_50480_c1 | nmdc:mga06r32_50480_c1_128_1165 | 332 |
| 913 | 3300050512 | nmdc:mga0n895_104824_c1 | nmdc:mga0n895_104824_c1_1006_2040 | 332 |
| 914 | 3300050512 | nmdc:mga0n895_16181_c1 | nmdc:mga0n895_16181_c1_1991_3019 | 332 |
| 915 | 3300050512 | nmdc:mga0n895_240200_c1 | nmdc:mga0n895_240200_c1_296_1318 | 332 |
| 916 | 3300050512 | nmdc:mga0n895_4336_c1 | nmdc:mga0n895_4336_c1_214_1227 | 332 |
| 917 | 3300050513 | nmdc:mga0rr50_1067_c1 | nmdc:mga0rr50_1067_c1_8423_9457 | 332 |
| 918 | 3300050513 | nmdc:mga0rr50_124699_c1 | nmdc:mga0rr50_124699_c1_748_1773 | 332 |
| 919 | 3300050513 | nmdc:mga0rr50_127921_c1 | nmdc:mga0rr50_127921_c1_35_1057 | 332 |
| 920 | 3300050513 | nmdc:mga0rr50_58034_c1 | nmdc:mga0rr50_58034_c1_1662_2690 | 332 |
| 921 | 3300050513 | nmdc:mga0rr50_73754_c1 | nmdc:mga0rr50_73754_c1_1434_2495 | 332 |
| 922 | 3300050514 | nmdc:mga08x19_53223_c1 | nmdc:mga08x19_53223_c1_837_1865 | 332 |
| 923 | 3300050514 | nmdc:mga08x19_56685_c1 | nmdc:mga08x19_56685_c1_347_1372 | 332 |
| 924 | 3300050515 | nmdc:mga0a205_286497_c1 | nmdc:mga0a205_286497_c1_473_1510 | 332 |
| 925 | 3300050515 | nmdc:mga0a205_64123_c1 | nmdc:mga0a205_64123_c1_1570_2598 | 332 |
| 926 | 3300050515 | nmdc:mga0a205_9730_c1 | nmdc:mga0a205_9730_c1_5560_6573 | 332 |
| 927 | 3300060353 | Ga0501082_0042059 | Ga0501082_0042059_1268_2317 | 332 |
| 928 | 3300061734 | Ga0530510_0004917 | Ga0530510_0004917_660_1709 | 332 |
| 929 | 3300002075 | JGI24738J21930_10000759 | JGI24738J21930_100007593 | 333 |
| 930 | 3300014497 | Ga0182008_10019950 | Ga0182008_100199503 | 333 |
| 931 | 3300015265 | Ga0182005_1001455 | Ga0182005_10014558 | 333 |
| 932 | 3300030742 | Ga0316183_1083776 | Ga0316183_10837762 | 333 |
| 933 | 3300031911 | Ga0307412_10001045 | Ga0307412_100010459 | 333 |
| 934 | 3300041404 | Ga0439436_0000046 | Ga0439436_0000046_32531_33532 | 333 |
| 935 | 3300041413 | Ga0439465_0000157 | Ga0439465_0000157_1220_2221 | 333 |
| 936 | 3300046512 | Ga0495610_0000184 | Ga0495610_0000184_5650_6651 | 333 |
| 937 | 3300046522 | Ga0495643_0000767 | Ga0495643_0000767_32773_33774 | 333 |
| 938 | 3300046660 | Ga0495625_0020533 | Ga0495625_0020533_432_1433 | 333 |
| 939 | 3300046691 | Ga0495670_0005324 | Ga0495670_0005324_1841_2842 | 333 |
| 940 | 3300047320 | Ga0495672_0000230 | Ga0495672_0000230_76814_77815 | 333 |
| 941 | 3300048927 | Ga0496124_0067845 | Ga0496124_0067845_458_1459 | 333 |
| 942 | 3300002774 | JGI25150J39212_1000458 | JGI25150J39212_100045817 | 334 |
| 943 | 3300003187 | JGI25151J46595_10000016 | JGI25151J46595_10000016125 | 334 |
| 944 | 3300003187 | JGI25151J46595_10000057 | JGI25151J46595_100000571 | 334 |
| 945 | 3300003215 | JGI25153J46596_10000041 | JGI25153J46596_100000418 | 334 |
| 946 | 3300003322 | rootL2_10145053 | rootL2_101450534 | 334 |
| 947 | 3300003771 | Ga0055526_1000006 | Ga0055526_100000675 | 334 |
| 948 | 3300003773 | Ga0055537_1000003 | Ga0055537_1000003151 | 334 |
| 949 | 3300003773 | Ga0055537_1000018 | Ga0055537_100001875 | 334 |
| 950 | 3300003773 | Ga0055537_1000442 | Ga0055537_100044224 | 334 |
| 951 | 3300003775 | Ga0055524_1000009 | Ga0055524_1000009151 | 334 |
| 952 | 3300003784 | Ga0055534_1000004 | Ga0055534_1000004151 | 334 |
| 953 | 3300003784 | Ga0055534_1001119 | Ga0055534_100111913 | 334 |
| 954 | 3300003790 | Ga0055528_1000003 | Ga0055528_1000003184 | 334 |
| 955 | 3300003790 | Ga0055528_1000990 | Ga0055528_100099014 | 334 |
| 956 | 3300003856 | Ga0058692_1000015 | Ga0058692_100001533 | 334 |
| 957 | 3300005289 | Ga0065704_10105639 | Ga0065704_101056392 | 334 |
| 958 | 3300005354 | Ga0070675_100019988 | Ga0070675_1000199884 | 334 |
| 959 | 3300005548 | Ga0070665_100311681 | Ga0070665_1003116812 | 334 |
| 960 | 3300015689 | Ga0183360_10001 | Ga0183360_100011496 | 334 |
| 961 | 3300025245 | Ga0207425_1000044 | Ga0207425_1000044178 | 334 |
| 962 | 3300025245 | Ga0207425_1000388 | Ga0207425_100038819 | 334 |
| 963 | 3300025258 | Ga0209129_1000044 | Ga0209129_100004498 | 334 |
| 964 | 3300025263 | Ga0209565_1000001 | Ga0209565_10000012240 | 334 |
| 965 | 3300025263 | Ga0209565_1000031 | Ga0209565_1000031239 | 334 |
| 966 | 3300025273 | Ga0209673_1000001 | Ga0209673_10000012240 | 334 |
| 967 | 3300025273 | Ga0209673_1000674 | Ga0209673_100067420 | 334 |
| 968 | 3300025291 | Ga0209675_1000001 | Ga0209675_1000001292 | 334 |
| 969 | 3300025291 | Ga0209675_1000015 | Ga0209675_1000015338 | 334 |
| 970 | 3300025294 | Ga0209025_1000006 | Ga0209025_1000006879 | 334 |
| 971 | 3300025294 | Ga0209025_1000012 | Ga0209025_1000012402 | 334 |
| 972 | 3300025295 | Ga0209564_1000001 | Ga0209564_1000001454 | 334 |
| 973 | 3300025295 | Ga0209564_1000037 | Ga0209564_100003731 | 334 |
| 974 | 3300025297 | Ga0209758_1000018 | Ga0209758_1000018255 | 334 |
| 975 | 3300025297 | Ga0209758_1031300 | Ga0209758_10313001 | 334 |
| 976 | 3300025299 | Ga0209256_1000002 | Ga0209256_10000021098 | 334 |
| 977 | 3300025935 | Ga0207709_10020870 | Ga0207709_100208703 | 334 |
| 978 | 3300027312 | Ga0209371_1000011 | Ga0209371_1000011517 | 334 |
| 979 | 3300030500 | Ga0268256_1000011 | Ga0268256_1000011517 | 334 |
| 980 | 3300041407 | Ga0439447_002290 | Ga0439447_002290_2540_3544 | 334 |
| 981 | 3300042006 | Ga0439432_032812 | Ga0439432_032812_545_1600 | 334 |
| 982 | 3300042184 | Ga0450908_000067 | Ga0450908_000067_6003_7007 | 334 |
| 983 | 3300046501 | Ga0495607_0027190 | Ga0495607_0027190_428_1432 | 334 |
| 984 | 3300046507 | Ga0495606_0014574 | Ga0495606_0014574_1411_2415 | 334 |
| 985 | 3300046525 | Ga0495663_0011295 | Ga0495663_0011295_726_1730 | 334 |
| 986 | 3300046558 | Ga0495633_0005263 | Ga0495633_0005263_3261_4274 | 334 |
| 987 | 3300046616 | Ga0495668_0005888 | Ga0495668_0005888_5776_6780 | 334 |
| 988 | 3300047472 | Ga0495686_0034422 | Ga0495686_0034422_1300_2304 | 334 |
| 989 | 3300048920 | Ga0496117_0002617 | Ga0496117_0002617_21167_22222 | 334 |
| 990 | 3300048921 | Ga0496118_0001666 | Ga0496118_0001666_6406_7461 | 334 |
| 991 | 3300048926 | Ga0496123_0065191 | Ga0496123_0065191_911_1966 | 334 |
| 992 | 3300048928 | Ga0496125_0138338 | Ga0496125_0138338_50_1105 | 334 |
| 993 | 2162886007 | SwRhRL2b_contig_1411923 | SwRhRL2b_0740.00006040 | 335 |
| 994 | 3300003781 | Ga0055536_1006687 | Ga0055536_10066873 | 335 |
| 995 | 3300003781 | Ga0055536_1007631 | Ga0055536_10076313 | 335 |
| 996 | 3300003791 | Ga0055530_10000301 | Ga0055530_1000030115 | 335 |
| 997 | 3300003794 | Ga0055531_10008703 | Ga0055531_100087033 | 335 |
| 998 | 3300003794 | Ga0055531_10009940 | Ga0055531_100099403 | 335 |
| 999 | 3300003856 | Ga0058692_1000022 | Ga0058692_1000022158 | 335 |
| 1000 | 3300005289 | Ga0065704_10000363 | Ga0065704_100003639 | 335 |
| 1001 | 3300005331 | Ga0070670_100001701 | Ga0070670_1000017018 | 335 |
| 1002 | 3300005333 | Ga0070677_10050298 | Ga0070677_100502982 | 335 |
| 1003 | 3300009011 | Ga0105251_10000013 | Ga0105251_1000001326 | 335 |
| 1004 | 3300009036 | Ga0105244_10043643 | Ga0105244_100436433 | 335 |
| 1005 | 3300014497 | Ga0182008_10000187 | Ga0182008_100001873 | 335 |
| 1006 | 3300017792 | Ga0163161_10002965 | Ga0163161_100029653 | 335 |
| 1007 | 3300025292 | Ga0209676_1000570 | Ga0209676_100057023 | 335 |
| 1008 | 3300025292 | Ga0209676_1000998 | Ga0209676_100099823 | 335 |
| 1009 | 3300025298 | Ga0209050_1000201 | Ga0209050_100020125 | 335 |
| 1010 | 3300025298 | Ga0209050_1000709 | Ga0209050_100070919 | 335 |
| 1011 | 3300025298 | Ga0209050_1030006 | Ga0209050_10300062 | 335 |
| 1012 | 3300025299 | Ga0209256_1002877 | Ga0209256_10028772 | 335 |
| 1013 | 3300025303 | Ga0209051_1000798 | Ga0209051_10007983 | 335 |
| 1014 | 3300025304 | Ga0209257_1000208 | Ga0209257_100020828 | 335 |
| 1015 | 3300025304 | Ga0209257_1000273 | Ga0209257_100027388 | 335 |
| 1016 | 3300025304 | Ga0209257_1001168 | Ga0209257_100116823 | 335 |
| 1017 | 3300025735 | Ga0207713_1000445 | Ga0207713_100044513 | 335 |
| 1018 | 3300025925 | Ga0207650_10001485 | Ga0207650_100014858 | 335 |
| 1019 | 3300027312 | Ga0209371_1000004 | Ga0209371_1000004770 | 335 |
| 1020 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005277 | 335 |
| 1021 | 3300030732 | Ga0316176_1017131 | Ga0316176_10171313 | 335 |
| 1022 | 3300038705 | Ga0237819_00014 | Ga0237819_00014_39795_40802 | 335 |
| 1023 | 3300046460 | Ga0495638_0000642 | Ga0495638_0000642_2897_3904 | 335 |
| 1024 | 3300046501 | Ga0495607_0002111 | Ga0495607_0002111_7806_8849 | 335 |
| 1025 | 3300048919 | Ga0496116_0050858 | Ga0496116_0050858_98_1105 | 335 |
| 1026 | 3300048919 | Ga0496116_0127826 | Ga0496116_0127826_61_1110 | 335 |
| 1027 | 3300048920 | Ga0496117_0003560 | Ga0496117_0003560_582_1589 | 335 |
| 1028 | 3300048920 | Ga0496117_0009832 | Ga0496117_0009832_272_1279 | 335 |
| 1029 | 3300048921 | Ga0496118_0000944 | Ga0496118_0000944_1712_2719 | 335 |
| 1030 | 3300048921 | Ga0496118_0019847 | Ga0496118_0019847_4244_5251 | 335 |
| 1031 | 3300048921 | Ga0496118_0061323 | Ga0496118_0061323_143_1150 | 335 |
| 1032 | 3300048922 | Ga0496119_0000596 | Ga0496119_0000596_46831_47883 | 335 |
| 1033 | 3300048922 | Ga0496119_0045327 | Ga0496119_0045327_1663_2670 | 335 |
| 1034 | 3300048923 | Ga0496120_0002725 | Ga0496120_0002725_14479_15486 | 335 |
| 1035 | 3300048923 | Ga0496120_0012981 | Ga0496120_0012981_1652_2704 | 335 |
| 1036 | 3300048923 | Ga0496120_0040421 | Ga0496120_0040421_81_1088 | 335 |
| 1037 | 3300048924 | Ga0496121_0000036 | Ga0496121_0000036_314011_315033 | 335 |
| 1038 | 3300048924 | Ga0496121_0004638 | Ga0496121_0004638_167_1174 | 335 |
| 1039 | 3300048925 | Ga0496122_0003813 | Ga0496122_0003813_16594_17601 | 335 |
| 1040 | 3300048925 | Ga0496122_0003919 | Ga0496122_0003919_17939_18946 | 335 |
| 1041 | 3300048925 | Ga0496122_0004805 | Ga0496122_0004805_810_1820 | 335 |
| 1042 | 3300048925 | Ga0496122_0008759 | Ga0496122_0008759_9357_10364 | 335 |
| 1043 | 3300048925 | Ga0496122_0136023 | Ga0496122_0136023_85_1092 | 335 |
| 1044 | 3300048926 | Ga0496123_0003419 | Ga0496123_0003419_14697_15704 | 335 |
| 1045 | 3300048926 | Ga0496123_0013647 | Ga0496123_0013647_722_1732 | 335 |
| 1046 | 3300048926 | Ga0496123_0051832 | Ga0496123_0051832_1655_2662 | 335 |
| 1047 | 3300048926 | Ga0496123_0065000 | Ga0496123_0065000_1124_2131 | 335 |
| 1048 | 3300048927 | Ga0496124_0007392 | Ga0496124_0007392_9834_10886 | 335 |
| 1049 | 3300048927 | Ga0496124_0082468 | Ga0496124_0082468_1561_2568 | 335 |
| 1050 | 3300048928 | Ga0496125_0003007 | Ga0496125_0003007_18552_19559 | 335 |
| 1051 | 3300048928 | Ga0496125_0177087 | Ga0496125_0177087_81_1088 | 335 |
| 1052 | 3300048929 | Ga0496126_0013261 | Ga0496126_0013261_7138_8190 | 335 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00532
Peripla_BP_1
Periplasmic binding proteins and sugar binding domain of LacI family
132
400
0.87
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c3k-assembly1.cif.gz_A | crystal structure of an uncharacterized protein from actinobacillus succinogenes | 0.9229 | 58 | 329 |
| 1sxg-assembly3.cif.gz_F | structural studies on the apo transcription factor form b. megaterium | 0.9175 | 61 | 329 |
| 3c3k-assembly1.cif.gz_A | crystal structure of an uncharacterized protein from actinobacillus succinogenes | 0.9162 | 58 | 329 |
| 2fep-assembly1.cif.gz_A-2 | structure of truncated ccpa in complex with p-ser-hpr and sulfate ions | 0.9154 | 60 | 329 |
| 4o5a-assembly1.cif.gz_A-2 | the crystal structure of a laci family transcriptional regulator from bifidobacterium animalis subsp. lactis dsm 10140 | 0.9123 | 58 | 332 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2rgyA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9485 | 161 | 288 | 3.40.50.2300 |
| 3kkeB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9439 | 163 | 288 | 3.40.50.2300 |
| 3c3kB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.941 | 163 | 288 | 3.40.50.2300 |
| 3h5tA01 | Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains | 0.9336 | 4 | 45 | 1.10.260.40 |
| 2pafA02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.924 | 162 | 329 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3DKY9-F1-model_v4 | Uncharacterized protein | 0.9686 | 161 | 267 |
GO:0000976
GO:0003700 GO:0016798 |
| AF-A0A7I0J546-F1-model_v4 | LacI family transcriptional regulator | 0.9676 | 167 | 269 |
GO:0000976
GO:0003700 |
| AF-A0A660QII2-F1-model_v4 | LacI family transcriptional regulator | 0.9611 | 158 | 331 |
GO:0000976
GO:0003700 |
| AF-A0A4Q6DTD8-F1-model_v4 | deleted | 0.9578 | 176 | 331 |
|
| AF-A0A7H4P3Q3-F1-model_v4 | Regulatory protein | 0.9524 | 155 | 331 |
GO:0000976
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar