F489096

General Info

Members Datasets Scaffolds Average Seq Length
1052 393 1025 338

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10110095|Ga0207648_101100953
Length 410
Sequence MRPEVNSHQTVRRRDCDVEDLRAPGRDLHGLGLEERIDGPVLLTVFDAPPLQSDDEYLDESLKPPVLDVRWRFVSNIYEVAKRAGVSTATVSRVLSQPNVVAPDTRRKVMAAVERLGYTPNAAATNLRTLRTKKLVVTVPDISNPFFSLILQGIEDAAQREGYSVLLGDTQHDEQREERYALMLRRKEADGLIFLGHRLPKEAAALVRSMPGRAPIVNGCEFSPRLGIPSVHIDNATAAADAMDHLYRLGHRRIGIVTGPLVSPLSRDRLRGATARAKKAGAERDFIVMNGDFSIESGAVAAERLLGRKEPPTAIFCFNDEMAIGVIDTARRRKLRIPNDLSLVGFDDIRFARYTDPPLTTVAQPMRQIGEGTVRLLLEILQGQGSPESVTLPHTLVVRSSTAPPGSLIK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
5 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
6 2643221593 Lysobacter sp. Root690 Isolate Unclassified
7 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
8 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
9 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
10 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
11 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
12 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
13 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
14 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
15 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
16 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
17 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
18 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
19 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
20 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
21 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
22 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
23 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
24 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
25 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
26 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
27 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
28 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
29 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
30 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
31 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
42 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
45 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
46 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
47 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
57 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
58 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
59 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
60 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
63 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
68 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
69 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
70 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
73 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
74 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
75 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
76 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
77 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
78 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
79 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
80 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
81 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
82 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
83 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
84 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
85 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
86 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
91 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
92 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
93 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
94 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
95 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
96 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
97 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
98 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
99 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
102 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
105 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
106 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
107 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
108 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
109 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
113 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
114 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
115 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
116 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
136 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
140 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
145 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
149 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
154 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
155 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
156 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
157 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
158 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
159 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
162 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
163 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
164 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
167 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
169 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
170 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
171 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
229 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
230 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
231 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
232 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
235 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
236 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
237 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
238 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
239 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
240 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
241 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
246 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
247 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
248 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
249 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
250 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
251 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
252 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
253 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
256 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
257 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
258 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
259 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
260 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
261 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
262 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
263 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
264 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
265 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
268 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
269 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
270 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
271 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
272 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
273 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
274 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
275 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
276 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
277 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
278 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
279 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
280 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
283 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
284 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
285 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
286 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
287 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
288 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
289 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
290 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
293 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
294 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
295 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
296 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
297 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
298 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
299 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
346 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
347 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
348 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
349 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
350 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
351 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
352 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
360 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
361 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
362 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
363 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
364 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
365 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
373 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
378 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
379 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
380 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
381 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
382 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
383 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
384 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
385 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
386 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
387 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
391 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
392 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
393 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.34
Metatranscriptomes 0
Isolates 2.66

Biome Distribution

Category Percentage (%)
Aerial Root 0.1
Bulb 0
Endosphere 10.93
Nodule 0
Rhizoplane 2.57
Rhizosphere 78.99
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1411923 2162886007 Bacteria 8737
2 SwRhRL2b_contig_3539020 2162886007 Bacteria 24060
3 JGI24739J22299_10010725 3300001989 Bacteria 3397
4 JGI24735J21928_10019568 3300002067 Bacteria 2080
5 JGI24738J21930_10000759 3300002075 Bacteria 9234
6 JGI24749J21850_1000053 3300002076 Bacteria 22163
7 JGI25150J39212_1000224 3300002774 Bacteria 30911
8 JGI25150J39212_1000458 3300002774 Bacteria 17923
9 JGI25151J46595_10000016 3300003187 Bacteria 249712
10 JGI25151J46595_10000057 3300003187 Bacteria 151052
11 JGI25406J46586_10005401 3300003203 Bacteria 5929
12 JGI25153J46596_10000041 3300003215 Bacteria 162103
13 JGI25153J46596_10000198 3300003215 Bacteria 56709
14 rootL2_10081122 3300003322 Bacteria 7015
15 rootL2_10145053 3300003322 Bacteria 4911
16 rootH1_10033773 3300003316 Bacteria 2681
17 rootH1_10033773 3300003323 Bacteria 4965
18 Ga0055526_1000006 3300003771 Bacteria 330857
19 Ga0055526_1005312 3300003771 Bacteria 7460
20 Ga0055537_1000003 3300003773 Bacteria 220933
21 Ga0055537_1000018 3300003773 Bacteria 123452
22 Ga0055537_1000442 3300003773 Bacteria 26526
23 Ga0055537_1000746 3300003773 Bacteria 16605
24 Ga0055524_1000009 3300003775 Bacteria 295254
25 Ga0055536_1006687 3300003781 Bacteria 5303
26 Ga0055536_1007631 3300003781 Bacteria 4798
27 Ga0055534_1000004 3300003784 Bacteria 295251
28 Ga0055534_1001119 3300003784 Bacteria 11371
29 Ga0055528_1000003 3300003790 Bacteria 330875
30 Ga0055528_1000990 3300003790 Bacteria 18873
31 Ga0055530_10000301 3300003791 Bacteria 44944
32 Ga0055530_10007254 3300003791 Bacteria 4713
33 Ga0055530_10009834 3300003791 Bacteria 3612
34 Ga0055540_1001135 3300003792 Bacteria 16601
35 Ga0055531_10004329 3300003794 Bacteria 8685
36 Ga0055531_10007930 3300003794 Bacteria 5695
37 Ga0055531_10007945 3300003794 Bacteria 5687
38 Ga0055531_10008703 3300003794 Bacteria 5303
39 Ga0055531_10009940 3300003794 Bacteria 4802
40 Ga0055531_10022649 3300003794 Bacteria 2385
41 Ga0058692_1000015 3300003856 Bacteria 295729
42 Ga0058692_1000022 3300003856 Bacteria 237321
43 Ga0065165_1002680 3300005262 Bacteria 14354
44 Ga0065165_1004694 3300005262 Bacteria 8220
45 Ga0065165_1006492 3300005262 Bacteria 6115
46 Ga0065165_1016066 3300005262 Bacteria 2821
47 Ga0065704_10000363 3300005289 Bacteria 43914
48 Ga0065704_10070190 3300005289 Bacteria 113837
49 Ga0065704_10105639 3300005289 Bacteria 2105
50 Ga0065712_10000333 3300005290 Bacteria 13723
51 Ga0065712_10106997 3300005290 Bacteria 1905
52 Ga0065715_10004188 3300005293 Bacteria 3801
53 Ga0065707_10003170 3300005295 Bacteria 4599
54 Ga0065707_10082125 3300005295 Bacteria 21290
55 Ga0065707_10092877 3300005295 Bacteria 3704
56 Ga0065707_10198382 3300005295 Bacteria 1322
57 Ga0070676_10004330 3300005328 Bacteria 7459
58 Ga0070676_10257570 3300005328 Bacteria 1167
59 Ga0070683_100013418 3300005329 Bacteria 7146
60 Ga0070683_100160851 3300005329 Bacteria 2131
61 Ga0070690_100006381 3300005330 Bacteria 6683
62 Ga0070690_100218758 3300005330 Bacteria 1334
63 Ga0070690_100289245 3300005330 Bacteria 1171
64 Ga0070670_100001701 3300005331 Bacteria 17909
65 Ga0070670_100004309 3300005331 Bacteria 11908
66 Ga0070670_100022221 3300005331 Bacteria 5460
67 Ga0070670_100023356 3300005331 Bacteria 5322
68 Ga0070670_100085994 3300005331 Bacteria 2702
69 Ga0070670_100164515 3300005331 Bacteria 1923
70 Ga0070670_100179812 3300005331 Bacteria 1836
71 Ga0070677_10050298 3300005333 Bacteria 1682
72 Ga0068869_100003496 3300005334 Bacteria 9623
73 Ga0068869_100136230 3300005334 Bacteria 1892
74 Ga0068869_100248095 3300005334 Bacteria 1421
75 Ga0070666_10043508 3300005335 Bacteria 3008
76 Ga0070666_10068495 3300005335 Bacteria 2412
77 Ga0070666_10070344 3300005335 Bacteria 2380
78 Ga0070666_10115508 3300005335 Bacteria 1859
79 Ga0070680_100368814 3300005336 Bacteria 1221
80 Ga0068868_100297023 3300005338 Bacteria 1371
81 Ga0070689_100032021 3300005340 Bacteria 3998
82 Ga0070689_100032944 3300005340 Bacteria 3946
83 Ga0070689_100038392 3300005340 Bacteria 3664
84 Ga0070689_100039411 3300005340 Bacteria 3617
85 Ga0070689_100074258 3300005340 Bacteria 2661
86 Ga0070691_10003000 3300005341 Bacteria 7560
87 Ga0070691_10010618 3300005341 Bacteria 4206
88 Ga0070687_100012617 3300005343 Bacteria 3738
89 Ga0070687_100013142 3300005343 Bacteria 3679
90 Ga0070687_100090533 3300005343 Bacteria 1691
91 Ga0070687_100152432 3300005343 Bacteria 1358
92 Ga0070661_100012157 3300005344 Bacteria 6019
93 Ga0070692_10056824 3300005345 Bacteria 2050
94 Ga0070692_10071957 3300005345 Bacteria 1844
95 Ga0070668_100017093 3300005347 Bacteria 5428
96 Ga0070669_100001414 3300005353 Bacteria 17346
97 Ga0070669_100017191 3300005353 Bacteria 5160
98 Ga0070669_100027408 3300005353 Bacteria 4099
99 Ga0070669_100029241 3300005353 Bacteria 3972
100 Ga0070669_100058591 3300005353 Bacteria 2827
101 Ga0070669_100082992 3300005353 Bacteria 2389
102 Ga0070669_100374442 3300005353 Bacteria 1160
103 Ga0070675_100001217 3300005354 Bacteria 18706
104 Ga0070675_100001225 3300005354 Bacteria 18657
105 Ga0070675_100002905 3300005354 Bacteria 12915
106 Ga0070675_100008687 3300005354 Bacteria 7888
107 Ga0070675_100019988 3300005354 Bacteria 5343
108 Ga0070675_100039757 3300005354 Bacteria 3839
109 Ga0070675_100052358 3300005354 Bacteria 3356
110 Ga0070675_100076372 3300005354 Bacteria 2786
111 Ga0070675_100162562 3300005354 Bacteria 1921
112 Ga0070675_100442358 3300005354 Bacteria 1165
113 Ga0070671_100000844 3300005355 Bacteria 22305
114 Ga0070671_100005852 3300005355 Bacteria 9796
115 Ga0070671_100009229 3300005355 Bacteria 7922
116 Ga0070674_100002174 3300005356 Bacteria 10782
117 Ga0070674_100190459 3300005356 Bacteria 1578
118 Ga0070674_100312467 3300005356 Bacteria 1257
119 Ga0070673_100091993 3300005364 Bacteria 2480
120 Ga0070673_100148350 3300005364 Bacteria 1984
121 Ga0070673_100179045 3300005364 Bacteria 1814
122 Ga0070673_100342702 3300005364 Bacteria 1325
123 Ga0070688_100002411 3300005365 Bacteria 9438
124 Ga0070688_100003784 3300005365 Bacteria 7841
125 Ga0070688_100031288 3300005365 Bacteria 3201
126 Ga0070688_100050052 3300005365 Bacteria 2602
127 Ga0070688_100180537 3300005365 Bacteria 1464
128 Ga0070659_100113743 3300005366 Bacteria 2186
129 Ga0070667_100061524 3300005367 Bacteria 3179
130 Ga0070667_100307461 3300005367 Unclassified 1428
131 Ga0070667_100409899 3300005367 Bacteria 1234
132 Ga0070713_100027448 3300005436 Bacteria 4482
133 Ga0070701_10012165 3300005438 Bacteria 3872
134 Ga0070701_10141666 3300005438 Bacteria 1376
135 Ga0070705_100000116 3300005440 Bacteria 45853
136 Ga0070705_100003965 3300005440 Bacteria 7232
137 Ga0070705_100032260 3300005440 Bacteria 2909
138 Ga0070700_100005845 3300005441 Bacteria 6532
139 Ga0070700_100072300 3300005441 Bacteria 2204
140 Ga0070700_100176452 3300005441 Bacteria 1483
141 Ga0070700_100256781 3300005441 Bacteria 1256
142 Ga0070694_100011107 3300005444 Bacteria 5575
143 Ga0070694_100073074 3300005444 Bacteria 2368
144 Ga0070694_100084248 3300005444 Bacteria 2217
145 Ga0070694_100264000 3300005444 Bacteria 1307
146 Ga0070708_100333050 3300005445 Bacteria 1430
147 Ga0070708_100419736 3300005445 Bacteria 1262
148 Ga0070663_100185106 3300005455 Bacteria 1618
149 Ga0070662_100023078 3300005457 Bacteria 4270
150 Ga0070662_100083848 3300005457 Bacteria 2380
151 Ga0070662_100093816 3300005457 Bacteria 2259
152 Ga0068867_100038337 3300005459 Bacteria 3488
153 Ga0068867_100039559 3300005459 Bacteria 3438
154 Ga0068867_100053738 3300005459 Bacteria 2975
155 Ga0068867_100061470 3300005459 Bacteria 2789
156 Ga0070707_100147585 3300005468 Bacteria 2289
157 Ga0070707_100209972 3300005468 Bacteria 1898
158 Ga0070707_100432239 3300005468 Bacteria 1277
159 Ga0070698_100008611 3300005471 Bacteria 10995
160 Ga0070698_100074877 3300005471 Bacteria 3390
161 Ga0070698_100094926 3300005471 Bacteria 2961
162 Ga0070699_100013945 3300005518 Bacteria 6913
163 Ga0070699_100106092 3300005518 Bacteria 2464
164 Ga0070699_100130553 3300005518 Bacteria 2215
165 Ga0070699_100464075 3300005518 Bacteria 1148
166 Ga0070684_100000131 3300005535 Bacteria 49644
167 Ga0070684_100094446 3300005535 Bacteria 2664
168 Ga0070672_100011456 3300005543 Bacteria 6185
169 Ga0070672_100116012 3300005543 Bacteria 2187
170 Ga0070686_100001409 3300005544 Bacteria 13568
171 Ga0070695_100001466 3300005545 Bacteria 13070
172 Ga0070695_100003657 3300005545 Bacteria 8963
173 Ga0070695_100006552 3300005545 Bacteria 6880
174 Ga0070695_100195534 3300005545 Bacteria 1442
175 Ga0070696_100000141 3300005546 Bacteria 39540
176 Ga0070696_100008448 3300005546 Bacteria 6892
177 Ga0070696_100010528 3300005546 Bacteria 6198
178 Ga0070696_100017939 3300005546 Bacteria 4780
179 Ga0070665_100005360 3300005548 Bacteria 13242
180 Ga0070665_100311681 3300005548 Bacteria 1577
181 Ga0070704_100003072 3300005549 Bacteria 9506
182 Ga0070704_100252371 3300005549 Bacteria 1449
183 Ga0070664_100013166 3300005564 Bacteria 6734
184 Ga0070664_100180015 3300005564 Bacteria 1878
185 Ga0068857_100006456 3300005577 Bacteria 10056
186 Ga0068857_100265947 3300005577 Bacteria 1575
187 Ga0068854_100007820 3300005578 Bacteria 6841
188 Ga0068854_100082043 3300005578 Bacteria 2383
189 Ga0068854_100084220 3300005578 Bacteria 2352
190 Ga0068854_100087694 3300005578 Bacteria 2309
191 Ga0068854_100146030 3300005578 Bacteria 1820
192 Ga0068856_100522646 3300005614 Bacteria 1208
193 Ga0070702_100005096 3300005615 Bacteria 6078
194 Ga0070702_100021415 3300005615 Bacteria 3401
195 Ga0068859_100000441 3300005617 Bacteria 41723
196 Ga0068859_100001084 3300005617 Bacteria 27803
197 Ga0068859_100008641 3300005617 Bacteria 10292
198 Ga0068859_100114953 3300005617 Unclassified 2755
199 Ga0068864_100000583 3300005618 Bacteria 31040
200 Ga0068864_100043296 3300005618 Bacteria 3855
201 Ga0068864_100081212 3300005618 Bacteria 2842
202 Ga0068864_100371295 3300005618 Bacteria 1354
203 Ga0068866_10018596 3300005718 Bacteria 3146
204 Ga0068861_100005269 3300005719 Bacteria 8719
205 Ga0068861_100010517 3300005719 Bacteria 6422
206 Ga0068861_100055469 3300005719 Bacteria 3021
207 Ga0068861_100057934 3300005719 Bacteria 2960
208 Ga0068861_100151935 3300005719 Bacteria 1901
209 Ga0068861_100159632 3300005719 Bacteria 1859
210 Ga0068861_100295342 3300005719 Bacteria 1401
211 Ga0068861_100351496 3300005719 Bacteria 1293
212 Ga0068851_10065657 3300005834 Unclassified 1868
213 Ga0068851_10154222 3300005834 Bacteria 1258
214 Ga0068870_10105645 3300005840 Bacteria 1599
215 Ga0068870_10162645 3300005840 Bacteria 1325
216 Ga0068863_100000019 3300005841 Bacteria 205585
217 Ga0068863_100008426 3300005841 Bacteria 10068
218 Ga0068863_100033097 3300005841 Bacteria 4924
219 Ga0068863_100081690 3300005841 Bacteria 3061
220 Ga0068863_100291459 3300005841 Bacteria 1582
221 Ga0068863_100350008 3300005841 Bacteria 1438
222 Ga0068858_100000700 3300005842 Bacteria 35018
223 Ga0068858_100012279 3300005842 Bacteria 8078
224 Ga0068858_100016289 3300005842 Bacteria 6983
225 Ga0068858_100024743 3300005842 Bacteria 5591
226 Ga0068858_100099111 3300005842 Bacteria 2717
227 Ga0068860_100013412 3300005843 Bacteria 8037
228 Ga0068860_100015157 3300005843 Bacteria 7530
229 Ga0068860_100179866 3300005843 Bacteria 2044
230 Ga0068860_100250185 3300005843 Unclassified 1726
231 Ga0068860_100348768 3300005843 Bacteria 1456
232 Ga0068862_100029633 3300005844 Bacteria 4612
233 Ga0068862_100054848 3300005844 Bacteria 3413
234 Ga0068862_100158428 3300005844 Bacteria 2019
235 Ga0068862_100182058 3300005844 Bacteria 1886
236 Ga0068862_100278351 3300005844 Bacteria 1533
237 Ga0081455_10000127 3300005937 Bacteria 88574
238 Ga0081455_10035042 3300005937 Bacteria 4490
239 Ga0081540_1076471 3300005983 Bacteria 1525
240 Ga0081539_10000334 3300005985 Bacteria 104401
241 Ga0081539_10000548 3300005985 Bacteria 77496
242 Ga0081539_10000753 3300005985 Bacteria 64323
243 Ga0075365_10053109 3300006038 Bacteria 2683
244 Ga0075363_100001428 3300006048 Bacteria 9041
245 Ga0075364_10007623 3300006051 Bacteria 6434
246 Ga0075364_10017498 3300006051 Bacteria 4478
247 Ga0075364_10259181 3300006051 Bacteria 1182
248 Ga0070716_100101601 3300006173 Bacteria 1764
249 Ga0070716_100171168 3300006173 Bacteria 1417
250 Ga0075362_10000270 3300006177 Bacteria 14466
251 Ga0075367_10008801 3300006178 Bacteria 5250
252 Ga0075367_10049686 3300006178 Bacteria 2473
253 Ga0075369_10007151 3300006186 Bacteria 4240
254 Ga0075366_10000070 3300006195 Bacteria 39329
255 Ga0075366_10056627 3300006195 Bacteria 2328
256 Ga0097621_100024815 3300006237 Bacteria 4686
257 Ga0097621_100180315 3300006237 Bacteria 1825
258 Ga0075370_10000009 3300006353 Bacteria 97850
259 Ga0075370_10070789 3300006353 Bacteria 1995
260 Ga0068871_100006884 3300006358 Bacteria 8095
261 Ga0068871_100141796 3300006358 Bacteria 2044
262 Ga0068871_100253650 3300006358 Bacteria 1533
263 Ga0075428_100001819 3300006844 Bacteria 22833
264 Ga0075428_100020409 3300006844 Bacteria 7335
265 Ga0075428_100057101 3300006844 Bacteria 4274
266 Ga0075428_100079670 3300006844 Bacteria 3575
267 Ga0075428_100080881 3300006844 Bacteria 3546
268 Ga0075428_100108460 3300006844 Unclassified 3026
269 Ga0075428_100160340 3300006844 Bacteria 2441
270 Ga0075428_100399462 3300006844 Bacteria 1473
271 Ga0075430_100001773 3300006846 Bacteria 17636
272 Ga0075430_100016744 3300006846 Bacteria 6244
273 Ga0075430_100026431 3300006846 Bacteria 4938
274 Ga0075430_100041131 3300006846 Bacteria 3911
275 Ga0075430_100114973 3300006846 Bacteria 2242
276 Ga0075430_100180286 3300006846 Bacteria 1757
277 Ga0075430_100204161 3300006846 Bacteria 1640
278 Ga0075431_100029382 3300006847 Bacteria 5658
279 Ga0075431_100059805 3300006847 Bacteria 3932
280 Ga0075431_100071732 3300006847 Bacteria 3574
281 Ga0075431_100085607 3300006847 Bacteria 3253
282 Ga0075431_100229698 3300006847 Bacteria 1891
283 Ga0075431_100237528 3300006847 Bacteria 1855
284 Ga0075433_10018342 3300006852 Bacteria 5815
285 Ga0075433_10034494 3300006852 Bacteria 4346
286 Ga0075433_10035109 3300006852 Bacteria 4310
287 Ga0075433_10046558 3300006852 Bacteria 3772
288 Ga0075433_10049165 3300006852 Bacteria 3669
289 Ga0075433_10088056 3300006852 Bacteria 2743
290 Ga0075433_10155746 3300006852 Bacteria 2033
291 Ga0075433_10159709 3300006852 Bacteria 2006
292 Ga0075433_10211999 3300006852 Bacteria 1721
293 Ga0075433_10241311 3300006852 Bacteria 1604
294 Ga0075434_100009173 3300006871 Bacteria 9217
295 Ga0075434_100016423 3300006871 Bacteria 7116
296 Ga0075434_100024027 3300006871 Bacteria 5953
297 Ga0075434_100037189 3300006871 Bacteria 4818
298 Ga0075434_100100580 3300006871 Bacteria 2897
299 Ga0075434_100117300 3300006871 Bacteria 2675
300 Ga0075434_100118947 3300006871 Bacteria 2656
301 Ga0075434_100126099 3300006871 Bacteria 2577
302 Ga0075434_100131168 3300006871 Bacteria 2525
303 Ga0075434_100514235 3300006871 Unclassified 1218
304 Ga0075429_100058037 3300006880 Unclassified 3371
305 Ga0075429_100070422 3300006880 Bacteria 3045
306 Ga0075429_100087006 3300006880 Bacteria 2723
307 Ga0075429_100098756 3300006880 Bacteria 2547
308 Ga0075429_100201739 3300006880 Bacteria 1743
309 Ga0075429_100295260 3300006880 Bacteria 1419
310 Ga0068865_100000942 3300006881 Bacteria 16545
311 Ga0068865_100006865 3300006881 Bacteria 6973
312 Ga0068865_100065977 3300006881 Bacteria 2553
313 Ga0075436_100059382 3300006914 Bacteria 2642
314 Ga0097620_100000074 3300006931 Bacteria 92064
315 Ga0097620_100000441 3300006931 Bacteria 41723
316 Ga0097620_100001083 3300006931 Bacteria 27803
317 Ga0097620_100008641 3300006931 Bacteria 10292
318 Ga0097620_100114953 3300006931 Unclassified 2755
319 Ga0075435_100000928 3300007076 Bacteria 18503
320 Ga0075435_100003002 3300007076 Bacteria 11356
321 Ga0075435_100005829 3300007076 Bacteria 8662
322 Ga0075435_100094384 3300007076 Unclassified 2473
323 Ga0075435_100109768 3300007076 Bacteria 2294
324 Ga0075435_100139830 3300007076 Bacteria 2031
325 Ga0075435_100143497 3300007076 Bacteria 2005
326 Ga0075435_100188600 3300007076 Bacteria 1744
327 Ga0105251_10000013 3300009011 Bacteria 163226
328 Ga0105244_10043643 3300009036 Bacteria 2312
329 Ga0105250_10001875 3300009092 Bacteria 10924
330 Ga0105240_10013459 3300009093 Bacteria 11236
331 Ga0105240_10111093 3300009093 Bacteria 3316
332 Ga0105240_10337221 3300009093 Bacteria 1714
333 Ga0111539_10000049 3300009094 Bacteria 119544
334 Ga0111539_10006856 3300009094 Bacteria 14635
335 Ga0111539_10007298 3300009094 Bacteria 14152
336 Ga0111539_10008943 3300009094 Bacteria 12680
337 Ga0111539_10019390 3300009094 Bacteria 8396
338 Ga0111539_10039504 3300009094 Bacteria 5686
339 Ga0111539_10054280 3300009094 Bacteria 4769
340 Ga0111539_10063121 3300009094 Bacteria 4384
341 Ga0111539_10086698 3300009094 Bacteria 3679
342 Ga0111539_10159766 3300009094 Bacteria 2636
343 Ga0111539_10234904 3300009094 Bacteria 2134
344 Ga0111539_10294161 3300009094 Bacteria 1890
345 Ga0111539_10326706 3300009094 Bacteria 1785
346 Ga0105245_10022300 3300009098 Bacteria 5557
347 Ga0105245_10145452 3300009098 Bacteria 2236
348 Ga0105247_10000923 3300009101 Bacteria 22103
349 Ga0105247_10172018 3300009101 Bacteria 1441
350 Ga0114129_10001463 3300009147 Bacteria 31911
351 Ga0114129_10002077 3300009147 Bacteria 27547
352 Ga0114129_10012069 3300009147 Bacteria 12295
353 Ga0114129_10015078 3300009147 Bacteria 11003
354 Ga0114129_10017374 3300009147 Bacteria 10244
355 Ga0114129_10017991 3300009147 Bacteria 10063
356 Ga0114129_10021206 3300009147 Bacteria 9227
357 Ga0114129_10021598 3300009147 Bacteria 9136
358 Ga0114129_10021805 3300009147 Bacteria 9093
359 Ga0114129_10027614 3300009147 Bacteria 8036
360 Ga0114129_10037003 3300009147 Bacteria 6891
361 Ga0114129_10039981 3300009147 Bacteria 6615
362 Ga0114129_10055881 3300009147 Bacteria 5532
363 Ga0114129_10063964 3300009147 Bacteria 5134
364 Ga0114129_10092853 3300009147 Bacteria 4181
365 Ga0114129_10097270 3300009147 Bacteria 4075
366 Ga0114129_10105548 3300009147 Bacteria 3893
367 Ga0114129_10168886 3300009147 Bacteria 2983
368 Ga0114129_10188468 3300009147 Bacteria 2802
369 Ga0114129_10303605 3300009147 Bacteria 2127
370 Ga0114129_10314310 3300009147 Bacteria 2084
371 Ga0114129_10427377 3300009147 Bacteria 1741
372 Ga0114129_10469870 3300009147 Bacteria 1647
373 Ga0105243_10012897 3300009148 Bacteria 6315
374 Ga0105243_10040969 3300009148 Bacteria 3620
375 Ga0105243_10491266 3300009148 Bacteria 1161
376 Ga0105241_10048546 3300009174 Bacteria 3231
377 Ga0105241_10134353 3300009174 Bacteria 2006
378 Ga0105242_10008281 3300009176 Bacteria 7989
379 Ga0105242_10071701 3300009176 Bacteria 2875
380 Ga0105242_10075697 3300009176 Bacteria 2803
381 Ga0105242_10179844 3300009176 Bacteria 1865
382 Ga0105248_10001761 3300009177 Bacteria 24074
383 Ga0105248_10004937 3300009177 Bacteria 14734
384 Ga0105248_10010781 3300009177 Bacteria 10090
385 Ga0105248_10013157 3300009177 Bacteria 9111
386 Ga0105248_10030345 3300009177 Bacteria 6036
387 Ga0105248_10126609 3300009177 Bacteria 2881
388 Ga0105248_10142693 3300009177 Bacteria 2702
389 Ga0105237_10006300 3300009545 Bacteria 13194
390 Ga0105237_10014363 3300009545 Bacteria 8285
391 Ga0105237_10085870 3300009545 Bacteria 3136
392 Ga0105237_10110467 3300009545 Bacteria 2741
393 Ga0105249_10000654 3300009553 Bacteria 31467
394 Ga0105249_10002700 3300009553 Bacteria 15340
395 Ga0105249_10012954 3300009553 Bacteria 7359
396 Ga0105249_10028928 3300009553 Bacteria 5002
397 Ga0105249_10107619 3300009553 Bacteria 2631
398 Ga0105249_10198420 3300009553 Bacteria 1963
399 Ga0105249_10219105 3300009553 Bacteria 1872
400 Ga0105249_10326727 3300009553 Bacteria 1546
401 Ga0105239_10125251 3300010375 Bacteria 2855
402 Ga0105239_10246529 3300010375 Bacteria 2006
403 Ga0105239_10363989 3300010375 Bacteria 1634
404 Ga0157374_10041093 3300013296 Bacteria 4259
405 Ga0157374_10053818 3300013296 Bacteria 3753
406 Ga0157374_10194629 3300013296 Bacteria 1984
407 Ga0157374_10216424 3300013296 Bacteria 1879
408 Ga0157378_10008708 3300013297 Bacteria 8831
409 Ga0163162_10046655 3300013306 Bacteria 4343
410 Ga0163162_10071234 3300013306 Bacteria 3529
411 Ga0163162_10078015 3300013306 Bacteria 3377
412 Ga0157372_10207269 3300013307 Bacteria 2271
413 Ga0157375_10019096 3300013308 Bacteria 6226
414 Ga0163163_10004894 3300014325 Bacteria 11518
415 Ga0163163_10010247 3300014325 Bacteria 8418
416 Ga0163163_10024873 3300014325 Bacteria 5701
417 Ga0163163_10050639 3300014325 Bacteria 4090
418 Ga0163163_10123269 3300014325 Bacteria 2627
419 Ga0163163_10209284 3300014325 Bacteria 1999
420 Ga0163163_10447815 3300014325 Bacteria 1351
421 Ga0157380_10013953 3300014326 Bacteria 5867
422 Ga0157380_10055011 3300014326 Bacteria 3159
423 Ga0157380_10074853 3300014326 Bacteria 2750
424 Ga0157380_10292640 3300014326 Bacteria 1496
425 Ga0182008_10000187 3300014497 Bacteria 48971
426 Ga0182008_10019950 3300014497 Bacteria 3454
427 Ga0157377_10017156 3300014745 Bacteria 3741
428 Ga0157377_10045165 3300014745 Bacteria 2460
429 Ga0157377_10050727 3300014745 Bacteria 2338
430 Ga0157377_10179063 3300014745 Bacteria 1332
431 Ga0157379_10243492 3300014968 Bacteria 1631
432 Ga0157379_10261773 3300014968 Bacteria 1572
433 Ga0157379_10288227 3300014968 Bacteria 1495
434 Ga0157379_10435620 3300014968 Bacteria 1208
435 Ga0182005_1001455 3300015265 Bacteria 9536
436 Ga0183360_10001 3300015689 Bacteria 3943671
437 Ga0163161_10002965 3300017792 Bacteria 12025
438 Ga0207425_1000016 3300025245 Bacteria 428169
439 Ga0207425_1000044 3300025245 Bacteria 195202
440 Ga0207425_1000388 3300025245 Bacteria 29705
441 Ga0209026_1002380 3300025250 Bacteria 7097
442 Ga0209129_1000044 3300025258 Bacteria 298971
443 Ga0209129_1001083 3300025258 Bacteria 16006
444 Ga0209565_1000001 3300025263 Bacteria 2950419
445 Ga0209565_1000031 3300025263 Bacteria 320341
446 Ga0209565_1000206 3300025263 Bacteria 68867
447 Ga0209673_1000001 3300025273 Bacteria 3176258
448 Ga0209673_1000674 3300025273 Bacteria 49444
449 Ga0209673_1015571 3300025273 Bacteria 2880
450 Ga0209675_1000001 3300025291 Bacteria 2950293
451 Ga0209675_1000015 3300025291 Bacteria 403517
452 Ga0209676_1000570 3300025292 Bacteria 55557
453 Ga0209676_1000998 3300025292 Bacteria 33231
454 Ga0209676_1001784 3300025292 Bacteria 18110
455 Ga0209676_1039475 3300025292 Bacteria 1341
456 Ga0209025_1000006 3300025294 Bacteria 1153444
457 Ga0209025_1000012 3300025294 Bacteria 924362
458 Ga0209025_1000475 3300025294 Bacteria 77876
459 Ga0209564_1000001 3300025295 Bacteria 3176258
460 Ga0209564_1000037 3300025295 Bacteria 414794
461 Ga0209564_1000996 3300025295 Bacteria 35381
462 Ga0209758_1000009 3300025297 Bacteria 1123483
463 Ga0209758_1000018 3300025297 Bacteria 753320
464 Ga0209758_1000736 3300025297 Bacteria 47860
465 Ga0209758_1031300 3300025297 Bacteria 2185
466 Ga0209050_1000005 3300025298 Bacteria 1557793
467 Ga0209050_1000029 3300025298 Bacteria 465801
468 Ga0209050_1000201 3300025298 Bacteria 134028
469 Ga0209050_1000709 3300025298 Bacteria 49201
470 Ga0209050_1005225 3300025298 Bacteria 8289
471 Ga0209050_1016542 3300025298 Bacteria 3009
472 Ga0209050_1030006 3300025298 Bacteria 1724
473 Ga0209256_1000002 3300025299 Bacteria 1906740
474 Ga0209256_1002877 3300025299 Bacteria 13057
475 Ga0209051_1000100 3300025303 Bacteria 165053
476 Ga0209051_1000798 3300025303 Bacteria 33097
477 Ga0209257_1000208 3300025304 Bacteria 141393
478 Ga0209257_1000273 3300025304 Bacteria 117663
479 Ga0209257_1000493 3300025304 Bacteria 71002
480 Ga0209257_1000896 3300025304 Bacteria 41831
481 Ga0209257_1001045 3300025304 Bacteria 36833
482 Ga0209257_1001168 3300025304 Bacteria 33231
483 Ga0209257_1002196 3300025304 Bacteria 20183
484 Ga0207697_10007900 3300025315 Bacteria 4701
485 Ga0207697_10075189 3300025315 Bacteria 1419
486 Ga0207696_1016053 3300025711 Bacteria 2517
487 Ga0207713_1000445 3300025735 Bacteria 43504
488 Ga0207642_10039477 3300025899 Bacteria 2051
489 Ga0207710_10001276 3300025900 Bacteria 12714
490 Ga0207710_10089290 3300025900 Bacteria 1440
491 Ga0207680_10077036 3300025903 Bacteria 2084
492 Ga0207680_10077737 3300025903 Bacteria 2077
493 Ga0207680_10112898 3300025903 Bacteria 1766
494 Ga0207647_10008924 3300025904 Bacteria 7150
495 Ga0207645_10005050 3300025907 Bacteria 9668
496 Ga0207645_10009707 3300025907 Bacteria 6649
497 Ga0207643_10001752 3300025908 Bacteria 12121
498 Ga0207654_10252755 3300025911 Unclassified 1182
499 Ga0207695_10040313 3300025913 Bacteria 5010
500 Ga0207695_10197319 3300025913 Bacteria 1928
501 Ga0207695_10209490 3300025913 Bacteria 1860
502 Ga0207671_10197129 3300025914 Bacteria 1571
503 Ga0207671_10201936 3300025914 Bacteria 1553
504 Ga0207662_10007677 3300025918 Bacteria 5876
505 Ga0207662_10010309 3300025918 Bacteria 5159
506 Ga0207662_10015467 3300025918 Bacteria 4293
507 Ga0207662_10023443 3300025918 Bacteria 3546
508 Ga0207646_10093154 3300025922 Bacteria 2697
509 Ga0207646_10101801 3300025922 Bacteria 2575
510 Ga0207646_10243182 3300025922 Bacteria 1626
511 Ga0207681_10006282 3300025923 Bacteria 7295
512 Ga0207681_10042902 3300025923 Bacteria 3024
513 Ga0207694_10111187 3300025924 Bacteria 2179
514 Ga0207650_10001485 3300025925 Bacteria 16814
515 Ga0207650_10007102 3300025925 Bacteria 7629
516 Ga0207650_10015962 3300025925 Bacteria 5239
517 Ga0207650_10097529 3300025925 Bacteria 2257
518 Ga0207650_10117377 3300025925 Bacteria 2068
519 Ga0207650_10136821 3300025925 Bacteria 1922
520 Ga0207650_10138597 3300025925 Bacteria 1911
521 Ga0207650_10335452 3300025925 Bacteria 1241
522 Ga0207659_10000110 3300025926 Bacteria 48302
523 Ga0207659_10002884 3300025926 Bacteria 10231
524 Ga0207659_10005234 3300025926 Bacteria 7858
525 Ga0207659_10005455 3300025926 Bacteria 7711
526 Ga0207659_10009646 3300025926 Bacteria 6039
527 Ga0207659_10025939 3300025926 Bacteria 3947
528 Ga0207659_10099132 3300025926 Bacteria 2193
529 Ga0207659_10212906 3300025926 Bacteria 1550
530 Ga0207687_10125483 3300025927 Bacteria 1926
531 Ga0207644_10007549 3300025931 Bacteria 7090
532 Ga0207644_10011367 3300025931 Bacteria 5889
533 Ga0207644_10041929 3300025931 Bacteria 3240
534 Ga0207644_10088751 3300025931 Bacteria 2300
535 Ga0207706_10046751 3300025933 Bacteria 3831
536 Ga0207706_10065021 3300025933 Bacteria 3212
537 Ga0207706_10118701 3300025933 Bacteria 2326
538 Ga0207706_10136090 3300025933 Bacteria 2161
539 Ga0207706_10174814 3300025933 Bacteria 1886
540 Ga0207706_10244336 3300025933 Bacteria 1569
541 Ga0207686_10002104 3300025934 Bacteria 10966
542 Ga0207686_10005442 3300025934 Bacteria 6836
543 Ga0207686_10006277 3300025934 Bacteria 6396
544 Ga0207686_10275402 3300025934 Bacteria 1240
545 Ga0207709_10008442 3300025935 Bacteria 5697
546 Ga0207709_10020870 3300025935 Bacteria 3701
547 Ga0207709_10058163 3300025935 Bacteria 2401
548 Ga0207670_10011792 3300025936 Bacteria 5087
549 Ga0207670_10061176 3300025936 Bacteria 2569
550 Ga0207670_10144790 3300025936 Bacteria 1756
551 Ga0207669_10000758 3300025937 Bacteria 13943
552 Ga0207704_10001200 3300025938 Bacteria 11545
553 Ga0207704_10230296 3300025938 Bacteria 1377
554 Ga0207665_10227534 3300025939 Bacteria 1369
555 Ga0207691_10010734 3300025940 Bacteria 8793
556 Ga0207691_10017127 3300025940 Bacteria 6874
557 Ga0207691_10041774 3300025940 Bacteria 4231
558 Ga0207691_10083538 3300025940 Bacteria 2867
559 Ga0207691_10145049 3300025940 Bacteria 2090
560 Ga0207691_10149499 3300025940 Bacteria 2054
561 Ga0207691_10202520 3300025940 Bacteria 1727
562 Ga0207711_10002106 3300025941 Bacteria 17974
563 Ga0207711_10003658 3300025941 Bacteria 13289
564 Ga0207711_10109413 3300025941 Bacteria 2456
565 Ga0207711_10169430 3300025941 Bacteria 1981
566 Ga0207711_10217721 3300025941 Unclassified 1745
567 Ga0207711_10232479 3300025941 Bacteria 1689
568 Ga0207689_10004598 3300025942 Bacteria 12488
569 Ga0207689_10181233 3300025942 Bacteria 1737
570 Ga0207661_10001850 3300025944 Bacteria 14484
571 Ga0207661_10076664 3300025944 Bacteria 2746
572 Ga0207679_10007781 3300025945 Bacteria 6810
573 Ga0207679_10065127 3300025945 Bacteria 2726
574 Ga0207679_10168876 3300025945 Bacteria 1799
575 Ga0207651_10007650 3300025960 Bacteria 5769
576 Ga0207651_10023309 3300025960 Bacteria 3804
577 Ga0207651_10125745 3300025960 Bacteria 1953
578 Ga0207651_10246909 3300025960 Bacteria 1458
579 Ga0207651_10294267 3300025960 Bacteria 1347
580 Ga0207651_10310162 3300025960 Bacteria 1315
581 Ga0207712_10007112 3300025961 Bacteria 7056
582 Ga0207712_10044185 3300025961 Bacteria 3078
583 Ga0207712_10180717 3300025961 Bacteria 1657
584 Ga0207712_10232366 3300025961 Bacteria 1481
585 Ga0207640_10038990 3300025981 Bacteria 3003
586 Ga0207640_10058860 3300025981 Bacteria 2533
587 Ga0207640_10072245 3300025981 Bacteria 2327
588 Ga0207640_10181997 3300025981 Bacteria 1577
589 Ga0207658_10017674 3300025986 Bacteria 4917
590 Ga0207658_10056542 3300025986 Bacteria 2912
591 Ga0207658_10165239 3300025986 Bacteria 1817
592 Ga0207658_10216821 3300025986 Bacteria 1607
593 Ga0207703_10001472 3300026035 Bacteria 21466
594 Ga0207703_10001628 3300026035 Bacteria 20230
595 Ga0207703_10001635 3300026035 Bacteria 20195
596 Ga0207703_10090140 3300026035 Bacteria 2576
597 Ga0207703_10124888 3300026035 Bacteria 2214
598 Ga0207639_10332689 3300026041 Bacteria 1352
599 Ga0207678_10038324 3300026067 Bacteria 4165
600 Ga0207678_10093256 3300026067 Bacteria 2573
601 Ga0207678_10363542 3300026067 Bacteria 1249
602 Ga0207708_10009619 3300026075 Bacteria 7168
603 Ga0207708_10020509 3300026075 Bacteria 4985
604 Ga0207708_10214961 3300026075 Bacteria 1538
605 Ga0207702_10445246 3300026078 Bacteria 1256
606 Ga0207641_10000005 3300026088 Bacteria 470841
607 Ga0207641_10028560 3300026088 Bacteria 4609
608 Ga0207641_10037410 3300026088 Bacteria 4052
609 Ga0207641_10093846 3300026088 Bacteria 2631
610 Ga0207641_10121503 3300026088 Bacteria 2332
611 Ga0207648_10006060 3300026089 Bacteria 12057
612 Ga0207648_10010861 3300026089 Bacteria 8608
613 Ga0207648_10071064 3300026089 Bacteria 3034
614 Ga0207648_10110095 3300026089 Bacteria 2418
615 Ga0207648_10206383 3300026089 Bacteria 1744
616 Ga0207676_10002609 3300026095 Bacteria 12852
617 Ga0207676_10020241 3300026095 Bacteria 4865
618 Ga0207676_10194997 3300026095 Bacteria 1785
619 Ga0207676_10212861 3300026095 Bacteria 1716
620 Ga0207676_10411425 3300026095 Bacteria 1266
621 Ga0207674_10032779 3300026116 Bacteria 5446
622 Ga0207674_10078540 3300026116 Bacteria 3305
623 Ga0207674_10095302 3300026116 Bacteria 2962
624 Ga0207674_10229405 3300026116 Bacteria 1804
625 Ga0207675_100004144 3300026118 Bacteria 14034
626 Ga0207675_100004655 3300026118 Bacteria 13215
627 Ga0207675_100039417 3300026118 Bacteria 4409
628 Ga0207675_100089543 3300026118 Bacteria 2892
629 Ga0207675_100117617 3300026118 Bacteria 2513
630 Ga0207675_100131679 3300026118 Bacteria 2372
631 Ga0207675_100232526 3300026118 Bacteria 1779
632 Ga0207675_100355489 3300026118 Unclassified 1436
633 Ga0207683_10253076 3300026121 Bacteria 1608
634 Ga0207698_10142204 3300026142 Bacteria 2069
635 Ga0209371_1000004 3300027312 Bacteria 1098197
636 Ga0209371_1000011 3300027312 Bacteria 848456
637 Ga0207428_10000331 3300027907 Bacteria 61372
638 Ga0207428_10000814 3300027907 Bacteria 35226
639 Ga0207428_10023480 3300027907 Bacteria 5187
640 Ga0207428_10023677 3300027907 Bacteria 5160
641 Ga0207428_10089873 3300027907 Bacteria 2386
642 Ga0207428_10109115 3300027907 Unclassified 2131
643 Ga0207428_10145544 3300027907 Bacteria 1806
644 Ga0207428_10151620 3300027907 Bacteria 1764
645 Ga0268266_10007235 3300028379 Bacteria 10038
646 Ga0268266_10037406 3300028379 Bacteria 4135
647 Ga0268265_10024226 3300028380 Bacteria 4291
648 Ga0268265_10073703 3300028380 Bacteria 2667
649 Ga0268265_10100210 3300028380 Bacteria 2337
650 Ga0268265_10130797 3300028380 Bacteria 2085
651 Ga0268265_10341374 3300028380 Bacteria 1364
652 Ga0268264_10000100 3300028381 Bacteria 227852
653 Ga0268264_10044990 3300028381 Bacteria 3664
654 Ga0268256_1000005 3300030500 Bacteria 1082342
655 Ga0268256_1000011 3300030500 Bacteria 848625
656 Ga0307511_10000260 3300030521 Bacteria 54540
657 Ga0307511_10017236 3300030521 Bacteria 6936
658 Ga0307511_10018661 3300030521 Bacteria 6618
659 Ga0316176_1017131 3300030732 Bacteria 3060
660 Ga0316183_1083776 3300030742 Bacteria 2371
661 Ga0307513_10055717 3300031456 Bacteria 4228
662 Ga0307508_10251272 3300031616 Bacteria 1364
663 Ga0307516_10000034 3300031730 Bacteria 155251
664 Ga0307413_10010611 3300031824 Bacteria 4482
665 Ga0307410_10024217 3300031852 Bacteria 3790
666 Ga0307406_10129684 3300031901 Bacteria 1768
667 Ga0307412_10001045 3300031911 Bacteria 15821
668 Ga0307412_10003164 3300031911 Bacteria 9146
669 Ga0307409_100013022 3300031995 Bacteria 5330
670 Ga0307409_100018478 3300031995 Bacteria 4689
671 Ga0307409_100293851 3300031995 Bacteria 1508
672 Ga0307416_100086564 3300032002 Bacteria 2671
673 Ga0307414_10276437 3300032004 Bacteria 1409
674 Ga0307411_10121049 3300032005 Bacteria 1893
675 Ga0307415_100104302 3300032126 Bacteria 2088
676 Ga0307510_10000001 3300033180 Bacteria 1172244
677 Ga0307510_10008818 3300033180 Bacteria 12020
678 Ga0373948_0008419 3300034817 Bacteria 1755
679 Ga0373950_0006066 3300034818 Bacteria 1827
680 Ga0373959_0002412 3300034820 Bacteria 2973
681 Ga0373938_0000534 3300034957 Bacteria 6149
682 Ga0373928_0002510 3300035084 Bacteria 3553
683 Ga0373929_0000719 3300035085 Bacteria 6404
684 Ga0373940_0000338 3300035088 Bacteria 6940
685 Ga0373949_0002015 3300035090 Bacteria 5419
686 Ga0373951_0000760 3300035091 Bacteria 8821
687 Ga0373932_0002231 3300035112 Bacteria 4978
688 Ga0373932_0049668 3300035112 Bacteria 1241
689 Ga0373936_0004159 3300035113 Bacteria 5454
690 Ga0373939_0000610 3300035114 Bacteria 8857
691 Ga0373941_0000441 3300035115 Bacteria 8235
692 Ga0373960_0000099 3300035121 Bacteria 13644
693 Ga0373942_0000501 3300035207 Bacteria 11054
694 Ga0373961_0001461 3300035241 Bacteria 6948
695 Ga0373962_0002767 3300035242 Bacteria 4183
696 Ga0373931_0004832 3300035691 Bacteria 6189
697 Ga0373935_0223138 3300035692 Bacteria 1310
698 Ga0373947_0297085 3300035725 Bacteria 1076
699 Ga0373925_0121611 3300037068 Bacteria 2027
700 Ga0395905_0000174 3300037471 Bacteria 104301
701 Ga0395905_0234766 3300037471 Bacteria 1714
702 Ga0237819_00014 3300038705 Bacteria 59581
703 Ga0439436_0000046 3300041404 Bacteria 36987
704 Ga0439447_002290 3300041407 Bacteria 7019
705 Ga0439465_0000157 3300041413 Bacteria 16967
706 Ga0439448_0000557 3300042005 Bacteria 8732
707 Ga0439448_0006523 3300042005 Bacteria 3359
708 Ga0439432_032812 3300042006 Bacteria 1673
709 Ga0439446_0072737 3300042156 Bacteria 1054
710 Ga0439458_0001347 3300042157 Bacteria 6192
711 Ga0439458_0002817 3300042157 Bacteria 4185
712 Ga0450908_000067 3300042184 Bacteria 20606
713 Ga0439434_0021324 3300042435 Bacteria 1947
714 Ga0439434_0037382 3300042435 Bacteria 1487
715 Ga0439464_0053343 3300042439 Unclassified 1173
716 Ga0439460_0014263 3300042461 Bacteria 2088
717 Ga0466969_0005283 3300044656 Bacteria 6873
718 Ga0451576_0038031 3300045051 Bacteria 5095
719 Ga0451576_0055575 3300045051 Bacteria 4141
720 Ga0451576_0559693 3300045051 Bacteria 1201
721 Ga0495603_0204627 3300046455 Bacteria 1141
722 Ga0495638_0000523 3300046460 Bacteria 44816
723 Ga0495638_0000642 3300046460 Bacteria 38350
724 Ga0495594_0144900 3300046499 Bacteria 1348
725 Ga0495607_0002111 3300046501 Bacteria 16600
726 Ga0495607_0027190 3300046501 Bacteria 3541
727 Ga0495583_0092854 3300046506 Unclassified 1297
728 Ga0495606_0014574 3300046507 Bacteria 6119
729 Ga0495610_0000184 3300046512 Bacteria 69871
730 Ga0495643_0000767 3300046522 Bacteria 35872
731 Ga0495648_0079689 3300046524 Bacteria 1868
732 Ga0495663_0011295 3300046525 Bacteria 2486
733 Ga0495609_0143298 3300046538 Bacteria 1019
734 Ga0495621_0045606 3300046539 Bacteria 1553
735 Ga0495633_0005263 3300046558 Bacteria 7968
736 Ga0495668_0000024 3300046616 Bacteria 359469
737 Ga0495668_0005888 3300046616 Bacteria 8163
738 Ga0495625_0000153 3300046660 Bacteria 105123
739 Ga0495625_0020533 3300046660 Bacteria 5097
740 Ga0495659_0009276 3300046664 Bacteria 3138
741 Ga0495659_0012961 3300046664 Bacteria 2709
742 Ga0495659_0067026 3300046664 Bacteria 1338
743 Ga0495659_0085380 3300046664 Bacteria 1204
744 Ga0495647_0026822 3300046681 Bacteria 2114
745 Ga0495658_0198613 3300046683 Bacteria 1249
746 Ga0495669_0007859 3300046684 Bacteria 4475
747 Ga0495669_0053541 3300046684 Bacteria 1815
748 Ga0495613_0255125 3300046689 Bacteria 1223
749 Ga0495670_0000002 3300046691 Bacteria 601814
750 Ga0495670_0005324 3300046691 Bacteria 6332
751 Ga0495671_0065859 3300046692 Bacteria 1783
752 Ga0495671_0074127 3300046692 Bacteria 1670
753 Ga0495636_0020569 3300047318 Unclassified 2660
754 Ga0495672_0000230 3300047320 Bacteria 79829
755 Ga0495686_0012441 3300047472 Bacteria 5950
756 Ga0495686_0034422 3300047472 Bacteria 3263
757 Ga0495686_0057275 3300047472 Bacteria 2433
758 Ga0496100_0102951 3300048903 Bacteria 1971
759 Ga0496102_0015105 3300048905 Bacteria 6722
760 Ga0496102_0015973 3300048905 Bacteria 6551
761 Ga0496102_0123104 3300048905 Bacteria 2423
762 Ga0496102_0287319 3300048905 Bacteria 1550
763 Ga0496104_0003434 3300048907 Bacteria 13662
764 Ga0496104_0056292 3300048907 Bacteria 3718
765 Ga0496105_0023194 3300048908 Bacteria 5031
766 Ga0496106_0019449 3300048909 Bacteria 5037
767 Ga0496106_0082458 3300048909 Bacteria 2472
768 Ga0496106_0304668 3300048909 Bacteria 1278
769 Ga0496108_0002594 3300048911 Bacteria 14473
770 Ga0496108_0004453 3300048911 Bacteria 11277
771 Ga0496109_0003044 3300048912 Bacteria 13976
772 Ga0496109_0181430 3300048912 Bacteria 1977
773 Ga0496109_0246009 3300048912 Bacteria 1684
774 Ga0496109_0678982 3300048912 Unclassified 967
775 Ga0496110_0004462 3300048913 Bacteria 10853
776 Ga0496112_0002100 3300048915 Bacteria 15812
777 Ga0496112_0008114 3300048915 Bacteria 9378
778 Ga0496112_0096532 3300048915 Unclassified 2926
779 Ga0496113_0010492 3300048916 Bacteria 6125
780 Ga0496113_0254245 3300048916 Bacteria 1403
781 Ga0496114_0045076 3300048917 Bacteria 3662
782 Ga0496114_0476538 3300048917 Bacteria 1104
783 Ga0496115_0008535 3300048918 Bacteria 7582
784 Ga0496116_0050858 3300048919 Bacteria 2757
785 Ga0496116_0127826 3300048919 Bacteria 1455
786 Ga0496117_0000035 3300048920 Bacteria 326449
787 Ga0496117_0002617 3300048920 Bacteria 22352
788 Ga0496117_0003560 3300048920 Bacteria 17974
789 Ga0496117_0009832 3300048920 Bacteria 8809
790 Ga0496117_0172962 3300048920 Bacteria 1251
791 Ga0496118_0000038 3300048921 Bacteria 315464
792 Ga0496118_0000944 3300048921 Bacteria 45453
793 Ga0496118_0001666 3300048921 Bacteria 32615
794 Ga0496118_0019847 3300048921 Bacteria 5990
795 Ga0496118_0061323 3300048921 Bacteria 2785
796 Ga0496119_0000596 3300048922 Bacteria 48957
797 Ga0496119_0003923 3300048922 Bacteria 15086
798 Ga0496119_0020625 3300048922 Bacteria 4799
799 Ga0496119_0045327 3300048922 Bacteria 2757
800 Ga0496120_0000591 3300048923 Bacteria 54957
801 Ga0496120_0002725 3300048923 Bacteria 17263
802 Ga0496120_0010224 3300048923 Bacteria 6569
803 Ga0496120_0012981 3300048923 Bacteria 5635
804 Ga0496120_0040421 3300048923 Bacteria 2740
805 Ga0496121_0000036 3300048924 Bacteria 362643
806 Ga0496121_0000332 3300048924 Bacteria 98654
807 Ga0496121_0004638 3300048924 Bacteria 18274
808 Ga0496121_0004643 3300048924 Bacteria 18264
809 Ga0496121_0016951 3300048924 Bacteria 7484
810 Ga0496122_0003813 3300048925 Bacteria 19401
811 Ga0496122_0003919 3300048925 Bacteria 19038
812 Ga0496122_0004805 3300048925 Bacteria 16507
813 Ga0496122_0008759 3300048925 Bacteria 10821
814 Ga0496122_0027450 3300048925 Bacteria 4866
815 Ga0496122_0136023 3300048925 Bacteria 1548
816 Ga0496123_0003419 3300048926 Bacteria 17867
817 Ga0496123_0007270 3300048926 Bacteria 10508
818 Ga0496123_0013647 3300048926 Bacteria 6797
819 Ga0496123_0051832 3300048926 Bacteria 2729
820 Ga0496123_0065000 3300048926 Bacteria 2321
821 Ga0496123_0065191 3300048926 Bacteria 2317
822 Ga0496124_0000071 3300048927 Bacteria 220642
823 Ga0496124_0002463 3300048927 Bacteria 24200
824 Ga0496124_0007392 3300048927 Bacteria 11684
825 Ga0496124_0027703 3300048927 Bacteria 5078
826 Ga0496124_0067845 3300048927 Bacteria 2966
827 Ga0496124_0082468 3300048927 Bacteria 2639
828 Ga0496124_0087772 3300048927 Bacteria 2543
829 Ga0496125_0003007 3300048928 Bacteria 21093
830 Ga0496125_0010198 3300048928 Bacteria 9524
831 Ga0496125_0031098 3300048928 Bacteria 4764
832 Ga0496125_0033625 3300048928 Bacteria 4534
833 Ga0496125_0138338 3300048928 Bacteria 1698
834 Ga0496125_0172989 3300048928 Bacteria 1449
835 Ga0496125_0177087 3300048928 Bacteria 1425
836 Ga0496126_0013261 3300048929 Bacteria 8397
837 Ga0501031_0207395 3300049568 Bacteria 1278
838 Ga0501032_0006519 3300049569 Bacteria 8576
839 Ga0501032_0054984 3300049569 Bacteria 2678
840 Ga0501034_0009602 3300049571 Bacteria 10122
841 Ga0501034_0021706 3300049571 Bacteria 6541
842 Ga0501036_0047615 3300049572 Bacteria 3630
843 Ga0501036_0095789 3300049572 Bacteria 2509
844 Ga0501036_0295012 3300049572 Bacteria 1356
845 Ga0501037_0117345 3300049573 Bacteria 1915
846 Ga0501038_0009816 3300049574 Bacteria 8764
847 Ga0501038_0080664 3300049574 Bacteria 2742
848 Ga0501038_0107195 3300049574 Unclassified 2318
849 Ga0501039_0014224 3300049575 Bacteria 6093
850 Ga0501039_0030770 3300049575 Bacteria 4139
851 Ga0501039_0048953 3300049575 Bacteria 3267
852 Ga0501039_0299277 3300049575 Bacteria 1265
853 Ga0501040_0023710 3300049576 Bacteria 4115
854 Ga0501040_0111501 3300049576 Bacteria 1913
855 Ga0501040_0204608 3300049576 Bacteria 1402
856 Ga0501041_0068088 3300049577 Bacteria 2182
857 Ga0501041_0071871 3300049577 Unclassified 2124
858 Ga0501042_0039490 3300049578 Bacteria 3354
859 Ga0501043_0003083 3300049579 Bacteria 13841
860 Ga0501043_0034044 3300049579 Bacteria 4007
861 Ga0501043_0146341 3300049579 Bacteria 1850
862 Ga0501046_0013245 3300049580 Bacteria 6988
863 Ga0501046_0145509 3300049580 Bacteria 1790
864 Ga0501046_0164993 3300049580 Bacteria 1664
865 Ga0501047_0000090 3300049581 Bacteria 116416
866 Ga0501047_0038513 3300049581 Bacteria 4625
867 Ga0501047_0047353 3300049581 Bacteria 4154
868 Ga0501047_0060947 3300049581 Bacteria 3640
869 Ga0501048_0044212 3300049582 Bacteria 3186
870 Ga0501048_0115898 3300049582 Bacteria 1893
871 Ga0501048_0168900 3300049582 Bacteria 1549
872 Ga0501067_0025768 3300049583 Bacteria 3259
873 Ga0501067_0053450 3300049583 Bacteria 2238
874 Ga0501068_0045583 3300049584 Bacteria 2642
875 Ga0501068_0093923 3300049584 Bacteria 1853
876 Ga0501070_0074157 3300049586 Bacteria 2817
877 Ga0501071_0141297 3300049587 Bacteria 1793
878 Ga0501071_0152577 3300049587 Bacteria 1724
879 Ga0501072_0037550 3300049588 Bacteria 3799
880 Ga0501072_0052135 3300049588 Bacteria 3221
881 Ga0501073_0018115 3300049589 Bacteria 5091
882 Ga0501073_0070581 3300049589 Bacteria 2433
883 Ga0501073_0094712 3300049589 Bacteria 2074
884 Ga0501074_0101980 3300049590 Bacteria 2054
885 Ga0501074_0180195 3300049590 Bacteria 1507
886 Ga0501074_0207311 3300049590 Bacteria 1397
887 Ga0501075_0043745 3300049591 Bacteria 3359
888 Ga0501075_0115351 3300049591 Unclassified 2042
889 Ga0501075_0163329 3300049591 Bacteria 1699
890 Ga0501076_0055252 3300049592 Bacteria 3149
891 Ga0501076_0089822 3300049592 Bacteria 2470
892 Ga0501076_0116632 3300049592 Bacteria 2161
893 Ga0501077_0024880 3300049593 Bacteria 3802
894 Ga0501079_0007223 3300049741 Bacteria 8386
895 Ga0501079_0008840 3300049741 Bacteria 7627
896 Ga0501079_0064166 3300049741 Bacteria 2833
897 Ga0501080_0009143 3300049742 Bacteria 9022
898 Ga0501080_0136327 3300049742 Bacteria 2271
899 Ga0501080_0241661 3300049742 Bacteria 1648
900 Ga0501081_0045427 3300049743 Bacteria 3016
901 Ga0501081_0103222 3300049743 Bacteria 2017
902 Ga0501083_0014694 3300049744 Bacteria 5472
903 Ga0501035_0016181 3300049822 Bacteria 6882
904 Ga0501044_0002228 3300049823 Bacteria 22202
905 Ga0501044_0014647 3300049823 Bacteria 8456
906 Ga0501044_0104326 3300049823 Bacteria 2849
907 Ga0501045_0018516 3300049824 Bacteria 4955
908 Ga0501045_0032318 3300049824 Bacteria 3792
909 nmdc:mga03683_51_c1 3300050489 Bacteria 50013
910 nmdc:mga03683_8724_c1 3300050489 Bacteria 3576
911 nmdc:mga03n38_172_c1 3300050490 Bacteria 14385
912 nmdc:mga00v17_3776_c1 3300050491 Bacteria 7824
913 nmdc:mga00v17_61120_c1 3300050491 Bacteria 2315
914 nmdc:mga00v17_64538_c1 3300050491 Bacteria 2257
915 nmdc:mga0yw44_32028_c1 3300050492 Bacteria 3061
916 nmdc:mga0k408_3210_c2 3300050493 Bacteria 5327
917 nmdc:mga0k408_3_c1 3300050493 Bacteria 243777
918 nmdc:mga06z11_6749_c1 3300050494 Bacteria 4690
919 nmdc:mga07m45_63713_c1 3300050496 Bacteria 2091
920 nmdc:mga07m45_6_c1 3300050496 Bacteria 260521
921 nmdc:mga05p37_113658_c1 3300050507 Bacteria 3329
922 nmdc:mga05p37_114217_c1 3300050507 Bacteria 3319
923 nmdc:mga05p37_14429_c1 3300050507 Bacteria 9483
924 nmdc:mga05p37_14951_c1 3300050507 Bacteria 9317
925 nmdc:mga05p37_17170_c1 3300050507 Bacteria 8732
926 nmdc:mga05p37_173268_c1 3300050507 Bacteria 2630
927 nmdc:mga05p37_17374_c1 3300050507 Bacteria 8680
928 nmdc:mga05p37_195680_c1 3300050507 Bacteria 2451
929 nmdc:mga05p37_20417_c1 3300050507 Bacteria 8013
930 nmdc:mga05p37_26138_c1 3300050507 Bacteria 7098
931 nmdc:mga05p37_38418_c1 3300050507 Bacteria 5872
932 nmdc:mga05p37_5461_c1 3300050507 Bacteria 14920
933 nmdc:mga05p37_56964_c1 3300050507 Bacteria 4813
934 nmdc:mga05p37_5779_c1 3300050507 Bacteria 14547
935 nmdc:mga05p37_64255_c1 3300050507 Bacteria 4516
936 nmdc:mga05p37_86332_c1 3300050507 Bacteria 3867
937 nmdc:mga09592_235295_c1 3300050508 Bacteria 1587
938 nmdc:mga09592_241463_c1 3300050508 Unclassified 1565
939 nmdc:mga09592_479822_c1 3300050508 Bacteria 1071
940 nmdc:mga09592_74670_c1 3300050508 Bacteria 2881
941 nmdc:mga09592_75144_c1 3300050508 Bacteria 2872
942 nmdc:mga0qj67_107382_c1 3300050509 Bacteria 2252
943 nmdc:mga0qj67_2660_c1 3300050509 Bacteria 12799
944 nmdc:mga0qj67_278522_c1 3300050509 Bacteria 1356
945 nmdc:mga0qj67_66995_c1 3300050509 Bacteria 2860
946 nmdc:mga0qj67_82798_c1 3300050509 Bacteria 2573
947 nmdc:mga06r32_173540_c1 3300050510 Unclassified 2140
948 nmdc:mga06r32_225664_c1 3300050510 Unclassified 1862
949 nmdc:mga06r32_29624_c1 3300050510 Bacteria 5132
950 nmdc:mga06r32_50480_c1 3300050510 Bacteria 3979
951 nmdc:mga06r32_58760_c1 3300050510 Bacteria 3696
952 nmdc:mga06r32_9095_c1 3300050510 Bacteria 8956
953 nmdc:mga06r32_91728_c1 3300050510 Bacteria 2969
954 nmdc:mga08y16_102855_c1 3300050511 Bacteria 2974
955 nmdc:mga08y16_13609_c1 3300050511 Bacteria 8563
956 nmdc:mga08y16_295858_c1 3300050511 Unclassified 1669
957 nmdc:mga08y16_39_c1 3300050511 Bacteria 131064
958 nmdc:mga08y16_416437_c1 3300050511 Bacteria 1374
959 nmdc:mga08y16_6402_c1 3300050511 Bacteria 12343
960 nmdc:mga08y16_6676_c1 3300050511 Bacteria 12101
961 nmdc:mga08y16_70504_c1 3300050511 Bacteria 3643
962 nmdc:mga08y16_88590_c1 3300050511 Bacteria 3225
963 nmdc:mga0n895_10029_c1 3300050512 Bacteria 8336
964 nmdc:mga0n895_104824_c1 3300050512 Bacteria 2840
965 nmdc:mga0n895_125962_c1 3300050512 Unclassified 2585
966 nmdc:mga0n895_16181_c1 3300050512 Bacteria 6838
967 nmdc:mga0n895_16737_c1 3300050512 Bacteria 6737
968 nmdc:mga0n895_168210_c1 3300050512 Bacteria 2224
969 nmdc:mga0n895_19263_c1 3300050512 Bacteria 6338
970 nmdc:mga0n895_240200_c1 3300050512 Bacteria 1838
971 nmdc:mga0n895_412145_c1 3300050512 Bacteria 1366
972 nmdc:mga0n895_4246_c1 3300050512 Bacteria 11718
973 nmdc:mga0n895_4336_c1 3300050512 Bacteria 11626
974 nmdc:mga0n895_44683_c1 3300050512 Bacteria 4320
975 nmdc:mga0n895_57949_c1 3300050512 Bacteria 3819
976 nmdc:mga0n895_81032_c1 3300050512 Bacteria 3234
977 nmdc:mga0n895_84598_c1 3300050512 Bacteria 3165
978 nmdc:mga0rr50_1067_c1 3300050513 Bacteria 14898
979 nmdc:mga0rr50_124699_c1 3300050513 Bacteria 2055
980 nmdc:mga0rr50_127921_c1 3300050513 Bacteria 2030
981 nmdc:mga0rr50_22805_c1 3300050513 Unclassified 4303
982 nmdc:mga0rr50_4416_c1 3300050513 Bacteria 8266
983 nmdc:mga0rr50_46935_c1 3300050513 Bacteria 3182
984 nmdc:mga0rr50_58034_c1 3300050513 Bacteria 2899
985 nmdc:mga0rr50_64007_c1 3300050513 Bacteria 2780
986 nmdc:mga0rr50_73754_c1 3300050513 Bacteria 2610
987 nmdc:mga08x19_169313_c1 3300050514 Bacteria 1487
988 nmdc:mga08x19_23227_c1 3300050514 Bacteria 3846
989 nmdc:mga08x19_53223_c1 3300050514 Bacteria 2604
990 nmdc:mga08x19_56685_c1 3300050514 Bacteria 2530
991 nmdc:mga0a205_103351_c1 3300050515 Bacteria 2748
992 nmdc:mga0a205_112872_c1 3300050515 Bacteria 2616
993 nmdc:mga0a205_178200_c1 3300050515 Bacteria 2020
994 nmdc:mga0a205_28284_c1 3300050515 Bacteria 5359
995 nmdc:mga0a205_286497_c1 3300050515 Bacteria 1522
996 nmdc:mga0a205_43385_c1 3300050515 Bacteria 4336
997 nmdc:mga0a205_6227_c1 3300050515 Bacteria 4229
998 nmdc:mga0a205_64123_c1 3300050515 Bacteria 3549
999 nmdc:mga0a205_8596_c1 3300050515 Bacteria 9291
1000 nmdc:mga0a205_9730_c1 3300050515 Bacteria 8805
1001 nmdc:mga0sz30_329_c1 3300050516 Bacteria 7754
1002 Ga0500583_0067790 3300053092 Unclassified 1700
1003 Ga0500651_0119011 3300053093 Bacteria 1605
1004 Ga0500556_0000578 3300053104 Bacteria 24347
1005 Ga0500594_0002617 3300053118 Bacteria 3909
1006 Ga0500595_009000 3300053119 Bacteria 4055
1007 Ga0500618_003364 3300053125 Bacteria 5522
1008 Ga0500658_0000707 3300053134 Bacteria 13800
1009 Ga0500590_086676 3300053148 Bacteria 1527
1010 Ga0500624_023235 3300053157 Unclassified 1015
1011 Ga0500637_0004718 3300053178 Bacteria 6515
1012 Ga0500645_005168 3300053730 Bacteria 4862
1013 Ga0501084_0004174 3300054114 Bacteria 11784
1014 Ga0501084_0031351 3300054114 Bacteria 4445
1015 Ga0501084_0041677 3300054114 Bacteria 3841
1016 Ga0501084_0057571 3300054114 Unclassified 3252
1017 Ga0501084_0396586 3300054114 Bacteria 1166
1018 Ga0501082_0001523 3300060353 Bacteria 20382
1019 Ga0501082_0007454 3300060353 Bacteria 9440
1020 Ga0501082_0023709 3300060353 Bacteria 5292
1021 Ga0501082_0042059 3300060353 Bacteria 3940
1022 Ga0501082_0073883 3300060353 Unclassified 2936
1023 Ga0501082_0359885 3300060353 Bacteria 1269
1024 Ga0530510_0004917 3300061734 Bacteria 9232
1025 Ga0530510_0051507 3300061734 Bacteria 2975

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042439 Ga0439464_0053343 Ga0439464_0053343_98_961 267
2 3300025941 Ga0207711_10217721 Ga0207711_102177212 290
3 3300005290 Ga0065712_10000333 Ga0065712_100003336 294
4 3300005356 Ga0070674_100002174 Ga0070674_1000021743 294
5 3300006852 Ga0075433_10035109 Ga0075433_100351093 294
6 3300025937 Ga0207669_10000758 Ga0207669_100007583 294
7 3300026095 Ga0207676_10212861 Ga0207676_102128612 294
8 3300049568 Ga0501031_0207395 Ga0501031_0207395_89_991 294
9 3300050510 nmdc:mga06r32_29624_c1 nmdc:mga06r32_29624_c1_3465_4379 294
10 3300005436 Ga0070713_100027448 Ga0070713_1000274485 295
11 3300009094 Ga0111539_10063121 Ga0111539_100631213 295
12 3300009147 Ga0114129_10002077 Ga0114129_100020772 295
13 3300009147 Ga0114129_10012069 Ga0114129_1001206911 295
14 3300009147 Ga0114129_10303605 Ga0114129_103036052 295
15 3300009177 Ga0105248_10126609 Ga0105248_101266093 295
16 3300046684 Ga0495669_0053541 Ga0495669_0053541_814_1722 295
17 3300050507 nmdc:mga05p37_17170_c1 nmdc:mga05p37_17170_c1_2114_3016 295
18 3300050507 nmdc:mga05p37_38418_c1 nmdc:mga05p37_38418_c1_4851_5759 295
19 3300050507 nmdc:mga05p37_5779_c1 nmdc:mga05p37_5779_c1_13168_14070 295
20 3300050508 nmdc:mga09592_479822_c1 nmdc:mga09592_479822_c1_38_946 295
21 3300050510 nmdc:mga06r32_173540_c1 nmdc:mga06r32_173540_c1_47_952 295
22 3300050511 nmdc:mga08y16_13609_c1 nmdc:mga08y16_13609_c1_5914_6816 295
23 3300050511 nmdc:mga08y16_88590_c1 nmdc:mga08y16_88590_c1_1940_2842 295
24 3300050512 nmdc:mga0n895_10029_c1 nmdc:mga0n895_10029_c1_5482_6384 295
25 3300050512 nmdc:mga0n895_44683_c1 nmdc:mga0n895_44683_c1_1590_2492 295
26 3300050513 nmdc:mga0rr50_22805_c1 nmdc:mga0rr50_22805_c1_1758_2660 295
27 3300050513 nmdc:mga0rr50_46935_c1 nmdc:mga0rr50_46935_c1_1706_2608 295
28 3300009177 Ga0105248_10010781 Ga0105248_100107818 296
29 3300014325 Ga0163163_10010247 Ga0163163_100102478 296
30 3300014968 Ga0157379_10261773 Ga0157379_102617732 296
31 3300042156 Ga0439446_0072737 Ga0439446_0072737_111_1022 296
32 3300046689 Ga0495613_0255125 Ga0495613_0255125_236_1147 296
33 3300048907 Ga0496104_0056292 Ga0496104_0056292_726_1637 296
34 3300048911 Ga0496108_0004453 Ga0496108_0004453_5918_6829 296
35 3300048912 Ga0496109_0678982 Ga0496109_0678982_32_943 296
36 3300048915 Ga0496112_0002100 Ga0496112_0002100_13217_14128 296
37 3300049584 Ga0501068_0045583 Ga0501068_0045583_1700_2608 296
38 3300050514 nmdc:mga08x19_23227_c1 nmdc:mga08x19_23227_c1_12_920 297
39 3300042435 Ga0439434_0037382 Ga0439434_0037382_517_1476 305
40 3300045051 Ga0451576_0559693 Ga0451576_0559693_217_1164 305
41 3300050509 nmdc:mga0qj67_278522_c1 nmdc:mga0qj67_278522_c1_17_964 305
42 3300053157 Ga0500624_023235 Ga0500624_023235_25_984 309
43 3300048917 Ga0496114_0476538 Ga0496114_0476538_50_997 310
44 3300003323 rootH1_10033773 rootH1_100337734 311
45 3300046538 Ga0495609_0143298 Ga0495609_0143298_15_968 311
46 3300025913 Ga0207695_10209490 Ga0207695_102094902 312
47 3300006358 Ga0068871_100253650 Ga0068871_1002536502 313
48 3300009093 Ga0105240_10337221 Ga0105240_103372211 313
49 3300009147 Ga0114129_10188468 Ga0114129_101884681 313
50 3300006051 Ga0075364_10017498 Ga0075364_100174983 314
51 3300006173 Ga0070716_100101601 Ga0070716_1001016012 314
52 3300006178 Ga0075367_10008801 Ga0075367_100088012 314
53 3300006195 Ga0075366_10056627 Ga0075366_100566273 314
54 3300050489 nmdc:mga03683_8724_c1 nmdc:mga03683_8724_c1_1459_2475 314
55 3300050491 nmdc:mga00v17_3776_c1 nmdc:mga00v17_3776_c1_5384_6400 314
56 3300050493 nmdc:mga0k408_3210_c2 nmdc:mga0k408_3210_c2_352_1368 314
57 3300050494 nmdc:mga06z11_6749_c1 nmdc:mga06z11_6749_c1_1341_2357 314
58 3300009147 Ga0114129_10314310 Ga0114129_103143102 316
59 3300006852 Ga0075433_10241311 Ga0075433_102413112 317
60 3300009147 Ga0114129_10001463 Ga0114129_1000146316 317
61 3300005367 Ga0070667_100409899 Ga0070667_1004098991 319
62 3300005441 Ga0070700_100256781 Ga0070700_1002567811 319
63 3300006237 Ga0097621_100180315 Ga0097621_1001803152 319
64 3300006844 Ga0075428_100020409 Ga0075428_1000204094 319
65 3300006847 Ga0075431_100237528 Ga0075431_1002375282 319
66 3300009147 Ga0114129_10021598 Ga0114129_100215986 319
67 3300025926 Ga0207659_10099132 Ga0207659_100991322 319
68 3300025931 Ga0207644_10041929 Ga0207644_100419294 319
69 3300025933 Ga0207706_10118701 Ga0207706_101187011 319
70 3300025936 Ga0207670_10144790 Ga0207670_101447902 319
71 3300026088 Ga0207641_10037410 Ga0207641_100374103 319
72 3300027907 Ga0207428_10151620 Ga0207428_101516202 319
73 3300028380 Ga0268265_10024226 Ga0268265_100242263 319
74 3300050507 nmdc:mga05p37_26138_c1 nmdc:mga05p37_26138_c1_4650_5663 319
75 3300050510 nmdc:mga06r32_9095_c1 nmdc:mga06r32_9095_c1_7448_8461 319
76 3300050511 nmdc:mga08y16_70504_c1 nmdc:mga08y16_70504_c1_1673_2686 319
77 3300005444 Ga0070694_100073074 Ga0070694_1000730742 320
78 3300005546 Ga0070696_100017939 Ga0070696_1000179392 320
79 3300035725 Ga0373947_0297085 Ga0373947_0297085_10_1029 320
80 3300005347 Ga0070668_100017093 Ga0070668_1000170934 322
81 3300009553 Ga0105249_10219105 Ga0105249_102191052 322
82 3300014326 Ga0157380_10292640 Ga0157380_102926402 322
83 3300025961 Ga0207712_10232366 Ga0207712_102323662 322
84 3300005614 Ga0068856_100522646 Ga0068856_1005226461 323
85 3300005719 Ga0068861_100159632 Ga0068861_1001596322 323
86 3300009093 Ga0105240_10111093 Ga0105240_101110932 323
87 3300025913 Ga0207695_10197319 Ga0207695_101973192 323
88 3300026078 Ga0207702_10445246 Ga0207702_104452462 323
89 3300049576 Ga0501040_0111501 Ga0501040_0111501_678_1688 323
90 3300049590 Ga0501074_0101980 Ga0501074_0101980_549_1559 323
91 3300049591 Ga0501075_0043745 Ga0501075_0043745_727_1737 323
92 3300049592 Ga0501076_0089822 Ga0501076_0089822_637_1647 323
93 3300049593 Ga0501077_0024880 Ga0501077_0024880_611_1621 323
94 3300049741 Ga0501079_0064166 Ga0501079_0064166_1276_2286 323
95 3300050514 nmdc:mga08x19_169313_c1 nmdc:mga08x19_169313_c1_133_1191 323
96 3300060353 Ga0501082_0359885 Ga0501082_0359885_129_1139 323
97 3300049580 Ga0501046_0145509 Ga0501046_0145509_785_1780 325
98 iso_pu_bacteria 2599185359 2600225387 325
99 iso_pu_bacteria 2818991466 2819713688 325
100 iso_pu_bacteria 2879163058 2879163651 325
101 iso_pu_bacteria 2928526807 2928528262 325
102 iso_pu_bacteria 2928968154 2928969852 325
103 3300006048 Ga0075363_100001428 Ga0075363_1000014286 326
104 3300006177 Ga0075362_10000270 Ga0075362_1000027013 326
105 3300006186 Ga0075369_10007151 Ga0075369_100071513 326
106 3300006195 Ga0075366_10000070 Ga0075366_1000007010 326
107 3300006353 Ga0075370_10000009 Ga0075370_1000000924 326
108 3300050489 nmdc:mga03683_51_c1 nmdc:mga03683_51_c1_12626_13624 326
109 3300050490 nmdc:mga03n38_172_c1 nmdc:mga03n38_172_c1_938_1936 326
110 3300050493 nmdc:mga0k408_3_c1 nmdc:mga0k408_3_c1_12847_13845 326
111 3300050496 nmdc:mga07m45_6_c1 nmdc:mga07m45_6_c1_238714_239712 326
112 3300050516 nmdc:mga0sz30_329_c1 nmdc:mga0sz30_329_c1_4176_5174 326
113 3300053104 Ga0500556_0000578 Ga0500556_0000578_15887_16897 326
114 3300030521 Ga0307511_10018661 Ga0307511_100186616 327
115 3300046499 Ga0495594_0144900 Ga0495594_0144900_106_1125 327
116 3300053119 Ga0500595_009000 Ga0500595_009000_2922_3920 327
117 3300002774 JGI25150J39212_1000224 JGI25150J39212_100022412 328
118 3300003215 JGI25153J46596_10000198 JGI25153J46596_1000019826 328
119 3300003771 Ga0055526_1005312 Ga0055526_10053123 328
120 3300003773 Ga0055537_1000746 Ga0055537_100074616 328
121 3300003791 Ga0055530_10007254 Ga0055530_100072542 328
122 3300003791 Ga0055530_10009834 Ga0055530_100098344 328
123 3300003792 Ga0055540_1001135 Ga0055540_100113511 328
124 3300003794 Ga0055531_10007930 Ga0055531_100079302 328
125 3300003794 Ga0055531_10007945 Ga0055531_100079452 328
126 3300005262 Ga0065165_1006492 Ga0065165_10064924 328
127 3300005335 Ga0070666_10068495 Ga0070666_100684951 328
128 3300005844 Ga0068862_100029633 Ga0068862_1000296334 328
129 3300005937 Ga0081455_10000127 Ga0081455_1000012713 328
130 3300005985 Ga0081539_10000753 Ga0081539_1000075336 328
131 3300009553 Ga0105249_10002700 Ga0105249_100027004 328
132 3300025245 Ga0207425_1000016 Ga0207425_1000016100 328
133 3300025258 Ga0209129_1001083 Ga0209129_10010834 328
134 3300025263 Ga0209565_1000206 Ga0209565_100020615 328
135 3300025273 Ga0209673_1015571 Ga0209673_10155712 328
136 3300025292 Ga0209676_1001784 Ga0209676_10017844 328
137 3300025292 Ga0209676_1039475 Ga0209676_10394751 328
138 3300025294 Ga0209025_1000475 Ga0209025_100047544 328
139 3300025295 Ga0209564_1000996 Ga0209564_100099610 328
140 3300025297 Ga0209758_1000009 Ga0209758_1000009341 328
141 3300025298 Ga0209050_1000005 Ga0209050_1000005828 328
142 3300025298 Ga0209050_1005225 Ga0209050_10052252 328
143 3300025298 Ga0209050_1016542 Ga0209050_10165422 328
144 3300025303 Ga0209051_1000100 Ga0209051_1000100110 328
145 3300025304 Ga0209257_1000896 Ga0209257_100089615 328
146 3300025304 Ga0209257_1001045 Ga0209257_100104511 328
147 3300025961 Ga0207712_10007112 Ga0207712_100071124 328
148 3300028379 Ga0268266_10007235 Ga0268266_100072359 328
149 3300028380 Ga0268265_10073703 Ga0268265_100737033 328
150 3300031456 Ga0307513_10055717 Ga0307513_100557173 328
151 3300048924 Ga0496121_0000332 Ga0496121_0000332_21778_22818 328
152 3300049573 Ga0501037_0117345 Ga0501037_0117345_178_1179 328
153 3300049581 Ga0501047_0060947 Ga0501047_0060947_1004_2005 328
154 3300049587 Ga0501071_0141297 Ga0501071_0141297_562_1578 328
155 3300049823 Ga0501044_0014647 Ga0501044_0014647_6896_7897 328
156 iso_pu_bacteria 2643221579 2643908402 328
157 3300001989 JGI24739J22299_10010725 JGI24739J22299_100107253 329
158 3300002067 JGI24735J21928_10019568 JGI24735J21928_100195682 329
159 3300002076 JGI24749J21850_1000053 JGI24749J21850_100005311 329
160 3300003794 Ga0055531_10004329 Ga0055531_100043296 329
161 3300003794 Ga0055531_10022649 Ga0055531_100226492 329
162 3300005262 Ga0065165_1002680 Ga0065165_10026801 329
163 3300005262 Ga0065165_1004694 Ga0065165_10046944 329
164 3300005262 Ga0065165_1016066 Ga0065165_10160663 329
165 3300005295 Ga0065707_10082125 Ga0065707_1008212510 329
166 3300005330 Ga0070690_100218758 Ga0070690_1002187581 329
167 3300005335 Ga0070666_10070344 Ga0070666_100703442 329
168 3300005353 Ga0070669_100082992 Ga0070669_1000829922 329
169 3300005354 Ga0070675_100002905 Ga0070675_10000290511 329
170 3300005355 Ga0070671_100000844 Ga0070671_10000084415 329
171 3300005365 Ga0070688_100031288 Ga0070688_1000312881 329
172 3300005367 Ga0070667_100307461 Ga0070667_1003074611 329
173 3300005457 Ga0070662_100023078 Ga0070662_1000230784 329
174 3300005577 Ga0068857_100265947 Ga0068857_1002659472 329
175 3300005578 Ga0068854_100087694 Ga0068854_1000876942 329
176 3300005617 Ga0068859_100000441 Ga0068859_1000004413 329
177 3300005617 Ga0068859_100008641 Ga0068859_1000086412 329
178 3300005834 Ga0068851_10154222 Ga0068851_101542222 329
179 3300005840 Ga0068870_10162645 Ga0068870_101626452 329
180 3300005841 Ga0068863_100008426 Ga0068863_1000084268 329
181 3300005841 Ga0068863_100291459 Ga0068863_1002914591 329
182 3300005842 Ga0068858_100000700 Ga0068858_10000070037 329
183 3300005842 Ga0068858_100016289 Ga0068858_1000162893 329
184 3300005843 Ga0068860_100013412 Ga0068860_1000134125 329
185 3300005843 Ga0068860_100015157 Ga0068860_10001515711 329
186 3300005983 Ga0081540_1076471 Ga0081540_10764711 329
187 3300006846 Ga0075430_100026431 Ga0075430_1000264311 329
188 3300006847 Ga0075431_100229698 Ga0075431_1002296981 329
189 3300006931 Ga0097620_100000074 Ga0097620_10000007450 329
190 3300006931 Ga0097620_100000441 Ga0097620_10000044132 329
191 3300006931 Ga0097620_100008641 Ga0097620_10000864110 329
192 3300009101 Ga0105247_10000923 Ga0105247_100009233 329
193 3300009147 Ga0114129_10015078 Ga0114129_100150785 329
194 3300009177 Ga0105248_10001761 Ga0105248_1000176111 329
195 3300009545 Ga0105237_10014363 Ga0105237_100143637 329
196 3300009545 Ga0105237_10110467 Ga0105237_101104671 329
197 3300009553 Ga0105249_10028928 Ga0105249_100289283 329
198 3300010375 Ga0105239_10125251 Ga0105239_101252512 329
199 3300010375 Ga0105239_10363989 Ga0105239_103639892 329
200 3300013296 Ga0157374_10216424 Ga0157374_102164242 329
201 3300013306 Ga0163162_10046655 Ga0163162_100466554 329
202 3300013306 Ga0163162_10071234 Ga0163162_100712342 329
203 3300014745 Ga0157377_10179063 Ga0157377_101790631 329
204 3300014968 Ga0157379_10243492 Ga0157379_102434922 329
205 3300014968 Ga0157379_10288227 Ga0157379_102882272 329
206 3300025250 Ga0209026_1002380 Ga0209026_10023802 329
207 3300025297 Ga0209758_1000736 Ga0209758_100073619 329
208 3300025298 Ga0209050_1000029 Ga0209050_1000029429 329
209 3300025304 Ga0209257_1000493 Ga0209257_100049333 329
210 3300025304 Ga0209257_1002196 Ga0209257_100219610 329
211 3300025900 Ga0207710_10001276 Ga0207710_1000127612 329
212 3300025903 Ga0207680_10112898 Ga0207680_101128982 329
213 3300025904 Ga0207647_10008924 Ga0207647_100089247 329
214 3300025913 Ga0207695_10040313 Ga0207695_100403135 329
215 3300025914 Ga0207671_10197129 Ga0207671_101971291 329
216 3300025914 Ga0207671_10201936 Ga0207671_102019362 329
217 3300025924 Ga0207694_10111187 Ga0207694_101111872 329
218 3300025925 Ga0207650_10117377 Ga0207650_101173772 329
219 3300025926 Ga0207659_10002884 Ga0207659_100028849 329
220 3300025931 Ga0207644_10007549 Ga0207644_100075493 329
221 3300025933 Ga0207706_10065021 Ga0207706_100650212 329
222 3300025933 Ga0207706_10174814 Ga0207706_101748142 329
223 3300025940 Ga0207691_10083538 Ga0207691_100835382 329
224 3300025941 Ga0207711_10003658 Ga0207711_1000365812 329
225 3300025961 Ga0207712_10180717 Ga0207712_101807172 329
226 3300025981 Ga0207640_10072245 Ga0207640_100722452 329
227 3300025986 Ga0207658_10017674 Ga0207658_100176747 329
228 3300025986 Ga0207658_10165239 Ga0207658_101652392 329
229 3300026035 Ga0207703_10001628 Ga0207703_1000162822 329
230 3300026035 Ga0207703_10001635 Ga0207703_1000163515 329
231 3300026067 Ga0207678_10038324 Ga0207678_100383243 329
232 3300026088 Ga0207641_10028560 Ga0207641_100285604 329
233 3300026089 Ga0207648_10110095 Ga0207648_101100953 329
234 3300026116 Ga0207674_10229405 Ga0207674_102294052 329
235 3300026121 Ga0207683_10253076 Ga0207683_102530762 329
236 3300028379 Ga0268266_10037406 Ga0268266_100374062 329
237 3300028381 Ga0268264_10000100 Ga0268264_10000100155 329
238 3300030521 Ga0307511_10000260 Ga0307511_1000026032 329
239 3300030521 Ga0307511_10017236 Ga0307511_100172366 329
240 3300031616 Ga0307508_10251272 Ga0307508_102512721 329
241 3300031911 Ga0307412_10003164 Ga0307412_100031647 329
242 3300032004 Ga0307414_10276437 Ga0307414_102764371 329
243 3300033180 Ga0307510_10000001 Ga0307510_10000001432 329
244 3300033180 Ga0307510_10008818 Ga0307510_100088186 329
245 3300035113 Ga0373936_0004159 Ga0373936_0004159_1402_2421 329
246 3300037471 Ga0395905_0234766 Ga0395905_0234766_110_1114 329
247 3300042005 Ga0439448_0000557 Ga0439448_0000557_7599_8642 329
248 3300042005 Ga0439448_0006523 Ga0439448_0006523_2083_3102 329
249 3300042157 Ga0439458_0001347 Ga0439458_0001347_293_1312 329
250 3300042157 Ga0439458_0002817 Ga0439458_0002817_968_2011 329
251 3300046460 Ga0495638_0000523 Ga0495638_0000523_30359_31372 329
252 3300046506 Ga0495583_0092854 Ga0495583_0092854_282_1286 329
253 3300046660 Ga0495625_0000153 Ga0495625_0000153_72076_73089 329
254 3300046691 Ga0495670_0000002 Ga0495670_0000002_371863_372915 329
255 3300047472 Ga0495686_0012441 Ga0495686_0012441_4408_5412 329
256 3300047472 Ga0495686_0057275 Ga0495686_0057275_616_1629 329
257 3300048905 Ga0496102_0015105 Ga0496102_0015105_3193_4212 329
258 3300048905 Ga0496102_0015973 Ga0496102_0015973_2079_3092 329
259 3300048909 Ga0496106_0082458 Ga0496106_0082458_920_1939 329
260 3300048915 Ga0496112_0096532 Ga0496112_0096532_1786_2805 329
261 3300048920 Ga0496117_0000035 Ga0496117_0000035_290747_291760 329
262 3300048920 Ga0496117_0172962 Ga0496117_0172962_211_1218 329
263 3300048921 Ga0496118_0000038 Ga0496118_0000038_67816_68829 329
264 3300048922 Ga0496119_0003923 Ga0496119_0003923_4439_5452 329
265 3300048922 Ga0496119_0020625 Ga0496119_0020625_234_1247 329
266 3300048923 Ga0496120_0000591 Ga0496120_0000591_45979_46992 329
267 3300048923 Ga0496120_0010224 Ga0496120_0010224_737_1750 329
268 3300048924 Ga0496121_0004643 Ga0496121_0004643_1612_2631 329
269 3300048924 Ga0496121_0016951 Ga0496121_0016951_1084_2097 329
270 3300048925 Ga0496122_0027450 Ga0496122_0027450_1524_2531 329
271 3300048926 Ga0496123_0007270 Ga0496123_0007270_5174_6181 329
272 3300048927 Ga0496124_0000071 Ga0496124_0000071_66031_67038 329
273 3300048927 Ga0496124_0002463 Ga0496124_0002463_18336_19343 329
274 3300048927 Ga0496124_0027703 Ga0496124_0027703_3823_4830 329
275 3300048927 Ga0496124_0087772 Ga0496124_0087772_1148_2161 329
276 3300048928 Ga0496125_0010198 Ga0496125_0010198_477_1496 329
277 3300048928 Ga0496125_0031098 Ga0496125_0031098_3084_4097 329
278 3300048928 Ga0496125_0033625 Ga0496125_0033625_2030_3046 329
279 3300048928 Ga0496125_0172989 Ga0496125_0172989_163_1170 329
280 3300050507 nmdc:mga05p37_14429_c1 nmdc:mga05p37_14429_c1_7609_8616 329
281 3300050508 nmdc:mga09592_75144_c1 nmdc:mga09592_75144_c1_951_1961 329
282 3300050511 nmdc:mga08y16_6676_c1 nmdc:mga08y16_6676_c1_9847_10854 329
283 3300053125 Ga0500618_003364 Ga0500618_003364_909_1961 329
284 3300053134 Ga0500658_0000707 Ga0500658_0000707_2006_3019 329
285 3300053148 Ga0500590_086676 Ga0500590_086676_45_1058 329
286 3300053178 Ga0500637_0004718 Ga0500637_0004718_2202_3227 329
287 3300053730 Ga0500645_005168 Ga0500645_005168_1457_2461 329
288 iso_pu_bacteria 2842918807 2842921120 329
289 iso_pu_bacteria 2939589442 2939592146 329
290 iso_pu_bacteria 2953994433 2953996396 329
291 3300003322 rootL2_10081122 rootL2_100811223 330
292 3300005295 Ga0065707_10092877 Ga0065707_100928772 330
293 3300005329 Ga0070683_100013418 Ga0070683_1000134185 330
294 3300005330 Ga0070690_100006381 Ga0070690_1000063813 330
295 3300005331 Ga0070670_100085994 Ga0070670_1000859942 330
296 3300005334 Ga0068869_100003496 Ga0068869_1000034962 330
297 3300005336 Ga0070680_100368814 Ga0070680_1003688141 330
298 3300005338 Ga0068868_100297023 Ga0068868_1002970232 330
299 3300005353 Ga0070669_100017191 Ga0070669_1000171914 330
300 3300005354 Ga0070675_100052358 Ga0070675_1000523582 330
301 3300005356 Ga0070674_100190459 Ga0070674_1001904591 330
302 3300005364 Ga0070673_100091993 Ga0070673_1000919932 330
303 3300005438 Ga0070701_10141666 Ga0070701_101416661 330
304 3300005441 Ga0070700_100005845 Ga0070700_1000058452 330
305 3300005459 Ga0068867_100038337 Ga0068867_1000383372 330
306 3300005535 Ga0070684_100094446 Ga0070684_1000944463 330
307 3300005545 Ga0070695_100195534 Ga0070695_1001955342 330
308 3300005578 Ga0068854_100146030 Ga0068854_1001460302 330
309 3300005719 Ga0068861_100055469 Ga0068861_1000554692 330
310 3300005719 Ga0068861_100295342 Ga0068861_1002953422 330
311 3300005840 Ga0068870_10105645 Ga0068870_101056452 330
312 3300005842 Ga0068858_100099111 Ga0068858_1000991112 330
313 3300006038 Ga0075365_10053109 Ga0075365_100531093 330
314 3300006051 Ga0075364_10007623 Ga0075364_100076234 330
315 3300006173 Ga0070716_100171168 Ga0070716_1001711681 330
316 3300006178 Ga0075367_10049686 Ga0075367_100496862 330
317 3300006353 Ga0075370_10070789 Ga0075370_100707891 330
318 3300006844 Ga0075428_100399462 Ga0075428_1003994621 330
319 3300006846 Ga0075430_100041131 Ga0075430_1000411314 330
320 3300006846 Ga0075430_100204161 Ga0075430_1002041612 330
321 3300006847 Ga0075431_100085607 Ga0075431_1000856072 330
322 3300006852 Ga0075433_10034494 Ga0075433_100344942 330
323 3300006852 Ga0075433_10088056 Ga0075433_100880562 330
324 3300006871 Ga0075434_100100580 Ga0075434_1001005802 330
325 3300006880 Ga0075429_100098756 Ga0075429_1000987562 330
326 3300006881 Ga0068865_100006865 Ga0068865_1000068652 330
327 3300009094 Ga0111539_10000049 Ga0111539_1000004933 330
328 3300009094 Ga0111539_10008943 Ga0111539_1000894313 330
329 3300009094 Ga0111539_10054280 Ga0111539_100542806 330
330 3300009094 Ga0111539_10159766 Ga0111539_101597662 330
331 3300009094 Ga0111539_10234904 Ga0111539_102349042 330
332 3300009098 Ga0105245_10145452 Ga0105245_101454522 330
333 3300009147 Ga0114129_10021805 Ga0114129_100218053 330
334 3300009147 Ga0114129_10168886 Ga0114129_101688863 330
335 3300009148 Ga0105243_10040969 Ga0105243_100409692 330
336 3300009176 Ga0105242_10071701 Ga0105242_100717012 330
337 3300009177 Ga0105248_10142693 Ga0105248_101426932 330
338 3300014325 Ga0163163_10024873 Ga0163163_100248734 330
339 3300014326 Ga0157380_10074853 Ga0157380_100748532 330
340 3300014745 Ga0157377_10050727 Ga0157377_100507271 330
341 3300025899 Ga0207642_10039477 Ga0207642_100394772 330
342 3300025907 Ga0207645_10009707 Ga0207645_100097076 330
343 3300025923 Ga0207681_10042902 Ga0207681_100429022 330
344 3300025925 Ga0207650_10097529 Ga0207650_100975292 330
345 3300025926 Ga0207659_10005234 Ga0207659_100052348 330
346 3300025934 Ga0207686_10005442 Ga0207686_100054424 330
347 3300025935 Ga0207709_10058163 Ga0207709_100581632 330
348 3300025939 Ga0207665_10227534 Ga0207665_102275342 330
349 3300025940 Ga0207691_10041774 Ga0207691_100417744 330
350 3300025941 Ga0207711_10232479 Ga0207711_102324792 330
351 3300025942 Ga0207689_10004598 Ga0207689_100045989 330
352 3300025944 Ga0207661_10076664 Ga0207661_100766642 330
353 3300025945 Ga0207679_10168876 Ga0207679_101688761 330
354 3300025960 Ga0207651_10023309 Ga0207651_100233092 330
355 3300025960 Ga0207651_10246909 Ga0207651_102469091 330
356 3300026075 Ga0207708_10009619 Ga0207708_100096194 330
357 3300026075 Ga0207708_10214961 Ga0207708_102149611 330
358 3300026089 Ga0207648_10006060 Ga0207648_100060603 330
359 3300026118 Ga0207675_100089543 Ga0207675_1000895432 330
360 3300027907 Ga0207428_10000331 Ga0207428_1000033115 330
361 3300027907 Ga0207428_10089873 Ga0207428_100898732 330
362 3300031730 Ga0307516_10000034 Ga0307516_1000003437 330
363 3300031995 Ga0307409_100293851 Ga0307409_1002938511 330
364 3300037471 Ga0395905_0000174 Ga0395905_0000174_78152_79159 330
365 3300046455 Ga0495603_0204627 Ga0495603_0204627_13_1041 330
366 3300046524 Ga0495648_0079689 Ga0495648_0079689_722_1747 330
367 3300046692 Ga0495671_0065859 Ga0495671_0065859_606_1631 330
368 3300046692 Ga0495671_0074127 Ga0495671_0074127_40_1044 330
369 3300048912 Ga0496109_0181430 Ga0496109_0181430_224_1240 330
370 3300048916 Ga0496113_0254245 Ga0496113_0254245_215_1225 330
371 3300049572 Ga0501036_0295012 Ga0501036_0295012_220_1230 330
372 3300049574 Ga0501038_0107195 Ga0501038_0107195_1216_2226 330
373 3300049576 Ga0501040_0204608 Ga0501040_0204608_257_1267 330
374 3300049577 Ga0501041_0071871 Ga0501041_0071871_306_1316 330
375 3300049578 Ga0501042_0039490 Ga0501042_0039490_2125_3135 330
376 3300049579 Ga0501043_0003083 Ga0501043_0003083_9696_10706 330
377 3300049581 Ga0501047_0000090 Ga0501047_0000090_79520_80530 330
378 3300049582 Ga0501048_0115898 Ga0501048_0115898_835_1866 330
379 3300049582 Ga0501048_0168900 Ga0501048_0168900_315_1325 330
380 3300049587 Ga0501071_0152577 Ga0501071_0152577_549_1559 330
381 3300049588 Ga0501072_0052135 Ga0501072_0052135_809_1840 330
382 3300049589 Ga0501073_0070581 Ga0501073_0070581_886_1896 330
383 3300049590 Ga0501074_0180195 Ga0501074_0180195_325_1335 330
384 3300049590 Ga0501074_0207311 Ga0501074_0207311_11_1042 330
385 3300049591 Ga0501075_0115351 Ga0501075_0115351_56_1066 330
386 3300049591 Ga0501075_0163329 Ga0501075_0163329_404_1435 330
387 3300049741 Ga0501079_0007223 Ga0501079_0007223_2470_3480 330
388 3300049742 Ga0501080_0241661 Ga0501080_0241661_98_1129 330
389 3300049743 Ga0501081_0045427 Ga0501081_0045427_157_1167 330
390 3300049744 Ga0501083_0014694 Ga0501083_0014694_3361_4371 330
391 3300049824 Ga0501045_0018516 Ga0501045_0018516_3920_4930 330
392 3300050491 nmdc:mga00v17_64538_c1 nmdc:mga00v17_64538_c1_1088_2104 330
393 3300050492 nmdc:mga0yw44_32028_c1 nmdc:mga0yw44_32028_c1_1476_2492 330
394 3300050496 nmdc:mga07m45_63713_c1 nmdc:mga07m45_63713_c1_47_1063 330
395 3300050507 nmdc:mga05p37_195680_c1 nmdc:mga05p37_195680_c1_759_1781 330
396 3300050509 nmdc:mga0qj67_66995_c1 nmdc:mga0qj67_66995_c1_1032_2042 330
397 3300050510 nmdc:mga06r32_91728_c1 nmdc:mga06r32_91728_c1_1711_2721 330
398 3300050511 nmdc:mga08y16_102855_c1 nmdc:mga08y16_102855_c1_707_1717 330
399 3300050511 nmdc:mga08y16_295858_c1 nmdc:mga08y16_295858_c1_108_1217 330
400 3300050511 nmdc:mga08y16_39_c1 nmdc:mga08y16_39_c1_63741_64751 330
401 3300050512 nmdc:mga0n895_81032_c1 nmdc:mga0n895_81032_c1_1447_2463 330
402 3300050515 nmdc:mga0a205_103351_c1 nmdc:mga0a205_103351_c1_316_1329 330
403 3300050515 nmdc:mga0a205_43385_c1 nmdc:mga0a205_43385_c1_1935_2951 330
404 3300050515 nmdc:mga0a205_8596_c1 nmdc:mga0a205_8596_c1_2462_3472 330
405 3300053092 Ga0500583_0067790 Ga0500583_0067790_540_1547 330
406 3300053118 Ga0500594_0002617 Ga0500594_0002617_2592_3596 330
407 3300054114 Ga0501084_0004174 Ga0501084_0004174_557_1567 330
408 3300054114 Ga0501084_0041677 Ga0501084_0041677_2531_3562 330
409 3300054114 Ga0501084_0057571 Ga0501084_0057571_1768_2778 330
410 3300060353 Ga0501082_0023709 Ga0501082_0023709_506_1516 330
411 3300060353 Ga0501082_0073883 Ga0501082_0073883_494_1504 330
412 3300061734 Ga0530510_0051507 Ga0530510_0051507_174_1184 330
413 iso_pu_bacteria 2643221593 2643973606 330
414 iso_pu_bacteria 2852684882 2852686487 330
415 iso_pu_bacteria 2974307012 2974309678 330
416 iso_pu_bacteria 2977247770 2977250426 330
417 iso_pu_bacteria 2984514374 2984515109 330
418 iso_pu_bacteria 2995948881 2995951649 330
419 3300003203 JGI25406J46586_10005401 JGI25406J46586_100054012 331
420 3300005290 Ga0065712_10106997 Ga0065712_101069972 331
421 3300005293 Ga0065715_10004188 Ga0065715_100041881 331
422 3300005295 Ga0065707_10003170 Ga0065707_100031703 331
423 3300005295 Ga0065707_10198382 Ga0065707_101983821 331
424 3300005328 Ga0070676_10257570 Ga0070676_102575701 331
425 3300005329 Ga0070683_100160851 Ga0070683_1001608512 331
426 3300005330 Ga0070690_100289245 Ga0070690_1002892451 331
427 3300005331 Ga0070670_100004309 Ga0070670_1000043094 331
428 3300005331 Ga0070670_100022221 Ga0070670_1000222212 331
429 3300005331 Ga0070670_100023356 Ga0070670_1000233562 331
430 3300005331 Ga0070670_100164515 Ga0070670_1001645152 331
431 3300005331 Ga0070670_100179812 Ga0070670_1001798122 331
432 3300005334 Ga0068869_100136230 Ga0068869_1001362301 331
433 3300005334 Ga0068869_100248095 Ga0068869_1002480952 331
434 3300005335 Ga0070666_10115508 Ga0070666_101155082 331
435 3300005340 Ga0070689_100032021 Ga0070689_1000320213 331
436 3300005340 Ga0070689_100032944 Ga0070689_1000329441 331
437 3300005340 Ga0070689_100038392 Ga0070689_1000383922 331
438 3300005340 Ga0070689_100039411 Ga0070689_1000394113 331
439 3300005340 Ga0070689_100074258 Ga0070689_1000742583 331
440 3300005341 Ga0070691_10010618 Ga0070691_100106183 331
441 3300005343 Ga0070687_100012617 Ga0070687_1000126174 331
442 3300005343 Ga0070687_100152432 Ga0070687_1001524322 331
443 3300005344 Ga0070661_100012157 Ga0070661_1000121572 331
444 3300005345 Ga0070692_10071957 Ga0070692_100719572 331
445 3300005353 Ga0070669_100001414 Ga0070669_1000014147 331
446 3300005353 Ga0070669_100027408 Ga0070669_1000274081 331
447 3300005353 Ga0070669_100058591 Ga0070669_1000585912 331
448 3300005353 Ga0070669_100374442 Ga0070669_1003744421 331
449 3300005354 Ga0070675_100001217 Ga0070675_1000012174 331
450 3300005354 Ga0070675_100001225 Ga0070675_1000012255 331
451 3300005354 Ga0070675_100008687 Ga0070675_1000086875 331
452 3300005354 Ga0070675_100039757 Ga0070675_1000397572 331
453 3300005354 Ga0070675_100076372 Ga0070675_1000763721 331
454 3300005354 Ga0070675_100162562 Ga0070675_1001625622 331
455 3300005355 Ga0070671_100005852 Ga0070671_1000058528 331
456 3300005355 Ga0070671_100009229 Ga0070671_1000092292 331
457 3300005356 Ga0070674_100312467 Ga0070674_1003124671 331
458 3300005364 Ga0070673_100148350 Ga0070673_1001483502 331
459 3300005364 Ga0070673_100179045 Ga0070673_1001790452 331
460 3300005364 Ga0070673_100342702 Ga0070673_1003427021 331
461 3300005365 Ga0070688_100002411 Ga0070688_1000024113 331
462 3300005365 Ga0070688_100003784 Ga0070688_1000037848 331
463 3300005365 Ga0070688_100050052 Ga0070688_1000500523 331
464 3300005365 Ga0070688_100180537 Ga0070688_1001805371 331
465 3300005366 Ga0070659_100113743 Ga0070659_1001137432 331
466 3300005367 Ga0070667_100061524 Ga0070667_1000615242 331
467 3300005440 Ga0070705_100000116 Ga0070705_10000011629 331
468 3300005440 Ga0070705_100032260 Ga0070705_1000322603 331
469 3300005441 Ga0070700_100072300 Ga0070700_1000723002 331
470 3300005441 Ga0070700_100176452 Ga0070700_1001764522 331
471 3300005444 Ga0070694_100084248 Ga0070694_1000842483 331
472 3300005444 Ga0070694_100264000 Ga0070694_1002640002 331
473 3300005445 Ga0070708_100333050 Ga0070708_1003330501 331
474 3300005445 Ga0070708_100419736 Ga0070708_1004197361 331
475 3300005455 Ga0070663_100185106 Ga0070663_1001851062 331
476 3300005457 Ga0070662_100083848 Ga0070662_1000838482 331
477 3300005457 Ga0070662_100093816 Ga0070662_1000938162 331
478 3300005459 Ga0068867_100039559 Ga0068867_1000395592 331
479 3300005468 Ga0070707_100432239 Ga0070707_1004322392 331
480 3300005471 Ga0070698_100008611 Ga0070698_1000086114 331
481 3300005471 Ga0070698_100074877 Ga0070698_1000748772 331
482 3300005471 Ga0070698_100094926 Ga0070698_1000949263 331
483 3300005518 Ga0070699_100013945 Ga0070699_1000139453 331
484 3300005518 Ga0070699_100106092 Ga0070699_1001060922 331
485 3300005518 Ga0070699_100130553 Ga0070699_1001305532 331
486 3300005535 Ga0070684_100000131 Ga0070684_1000001318 331
487 3300005543 Ga0070672_100011456 Ga0070672_1000114564 331
488 3300005543 Ga0070672_100116012 Ga0070672_1001160122 331
489 3300005545 Ga0070695_100001466 Ga0070695_1000014666 331
490 3300005546 Ga0070696_100000141 Ga0070696_10000014113 331
491 3300005546 Ga0070696_100010528 Ga0070696_1000105283 331
492 3300005549 Ga0070704_100252371 Ga0070704_1002523711 331
493 3300005564 Ga0070664_100013166 Ga0070664_1000131664 331
494 3300005564 Ga0070664_100180015 Ga0070664_1001800152 331
495 3300005577 Ga0068857_100006456 Ga0068857_1000064567 331
496 3300005578 Ga0068854_100084220 Ga0068854_1000842202 331
497 3300005615 Ga0070702_100005096 Ga0070702_1000050965 331
498 3300005615 Ga0070702_100021415 Ga0070702_1000214152 331
499 3300005617 Ga0068859_100001084 Ga0068859_1000010843 331
500 3300005617 Ga0068859_100114953 Ga0068859_1001149532 331
501 3300005618 Ga0068864_100000583 Ga0068864_10000058316 331
502 3300005618 Ga0068864_100043296 Ga0068864_1000432963 331
503 3300005618 Ga0068864_100081212 Ga0068864_1000812122 331
504 3300005719 Ga0068861_100010517 Ga0068861_1000105176 331
505 3300005719 Ga0068861_100057934 Ga0068861_1000579343 331
506 3300005719 Ga0068861_100351496 Ga0068861_1003514961 331
507 3300005841 Ga0068863_100000019 Ga0068863_100000019202 331
508 3300005841 Ga0068863_100033097 Ga0068863_1000330973 331
509 3300005841 Ga0068863_100081690 Ga0068863_1000816902 331
510 3300005843 Ga0068860_100179866 Ga0068860_1001798662 331
511 3300005843 Ga0068860_100250185 Ga0068860_1002501852 331
512 3300005843 Ga0068860_100348768 Ga0068860_1003487682 331
513 3300005844 Ga0068862_100054848 Ga0068862_1000548482 331
514 3300005844 Ga0068862_100182058 Ga0068862_1001820582 331
515 3300005844 Ga0068862_100278351 Ga0068862_1002783512 331
516 3300005937 Ga0081455_10035042 Ga0081455_100350421 331
517 3300005985 Ga0081539_10000334 Ga0081539_1000033472 331
518 3300005985 Ga0081539_10000548 Ga0081539_1000054828 331
519 3300006051 Ga0075364_10259181 Ga0075364_102591812 331
520 3300006358 Ga0068871_100141796 Ga0068871_1001417961 331
521 3300006844 Ga0075428_100001819 Ga0075428_1000018195 331
522 3300006844 Ga0075428_100057101 Ga0075428_1000571013 331
523 3300006844 Ga0075428_100079670 Ga0075428_1000796702 331
524 3300006844 Ga0075428_100080881 Ga0075428_1000808812 331
525 3300006844 Ga0075428_100108460 Ga0075428_1001084602 331
526 3300006844 Ga0075428_100160340 Ga0075428_1001603402 331
527 3300006846 Ga0075430_100016744 Ga0075430_1000167442 331
528 3300006846 Ga0075430_100114973 Ga0075430_1001149732 331
529 3300006846 Ga0075430_100180286 Ga0075430_1001802862 331
530 3300006847 Ga0075431_100059805 Ga0075431_1000598052 331
531 3300006847 Ga0075431_100071732 Ga0075431_1000717322 331
532 3300006852 Ga0075433_10046558 Ga0075433_100465582 331
533 3300006852 Ga0075433_10049165 Ga0075433_100491652 331
534 3300006852 Ga0075433_10155746 Ga0075433_101557461 331
535 3300006852 Ga0075433_10159709 Ga0075433_101597092 331
536 3300006852 Ga0075433_10211999 Ga0075433_102119992 331
537 3300006871 Ga0075434_100016423 Ga0075434_1000164235 331
538 3300006871 Ga0075434_100024027 Ga0075434_1000240274 331
539 3300006871 Ga0075434_100037189 Ga0075434_1000371895 331
540 3300006871 Ga0075434_100118947 Ga0075434_1001189471 331
541 3300006871 Ga0075434_100126099 Ga0075434_1001260992 331
542 3300006871 Ga0075434_100131168 Ga0075434_1001311682 331
543 3300006871 Ga0075434_100514235 Ga0075434_1005142351 331
544 3300006880 Ga0075429_100058037 Ga0075429_1000580371 331
545 3300006880 Ga0075429_100070422 Ga0075429_1000704222 331
546 3300006880 Ga0075429_100201739 Ga0075429_1002017392 331
547 3300006880 Ga0075429_100295260 Ga0075429_1002952601 331
548 3300006931 Ga0097620_100001083 Ga0097620_1000010833 331
549 3300006931 Ga0097620_100114953 Ga0097620_1001149532 331
550 3300007076 Ga0075435_100005829 Ga0075435_1000058296 331
551 3300007076 Ga0075435_100094384 Ga0075435_1000943842 331
552 3300007076 Ga0075435_100143497 Ga0075435_1001434971 331
553 3300007076 Ga0075435_100188600 Ga0075435_1001886001 331
554 3300009092 Ga0105250_10001875 Ga0105250_1000187513 331
555 3300009094 Ga0111539_10006856 Ga0111539_100068569 331
556 3300009094 Ga0111539_10007298 Ga0111539_100072985 331
557 3300009094 Ga0111539_10019390 Ga0111539_100193903 331
558 3300009094 Ga0111539_10086698 Ga0111539_100866981 331
559 3300009094 Ga0111539_10294161 Ga0111539_102941612 331
560 3300009094 Ga0111539_10326706 Ga0111539_103267061 331
561 3300009147 Ga0114129_10017991 Ga0114129_100179917 331
562 3300009147 Ga0114129_10021206 Ga0114129_100212066 331
563 3300009147 Ga0114129_10027614 Ga0114129_100276146 331
564 3300009147 Ga0114129_10037003 Ga0114129_100370036 331
565 3300009147 Ga0114129_10039981 Ga0114129_100399813 331
566 3300009147 Ga0114129_10092853 Ga0114129_100928533 331
567 3300009147 Ga0114129_10097270 Ga0114129_100972703 331
568 3300009147 Ga0114129_10105548 Ga0114129_101055482 331
569 3300009147 Ga0114129_10427377 Ga0114129_104273772 331
570 3300009148 Ga0105243_10491266 Ga0105243_104912662 331
571 3300009174 Ga0105241_10048546 Ga0105241_100485462 331
572 3300009176 Ga0105242_10075697 Ga0105242_100756972 331
573 3300009177 Ga0105248_10004937 Ga0105248_1000493711 331
574 3300009177 Ga0105248_10030345 Ga0105248_100303453 331
575 3300009545 Ga0105237_10085870 Ga0105237_100858703 331
576 3300009553 Ga0105249_10000654 Ga0105249_100006548 331
577 3300009553 Ga0105249_10107619 Ga0105249_101076193 331
578 3300009553 Ga0105249_10198420 Ga0105249_101984202 331
579 3300009553 Ga0105249_10326727 Ga0105249_103267272 331
580 3300010375 Ga0105239_10246529 Ga0105239_102465292 331
581 3300013296 Ga0157374_10041093 Ga0157374_100410931 331
582 3300013296 Ga0157374_10194629 Ga0157374_101946292 331
583 3300013308 Ga0157375_10019096 Ga0157375_100190963 331
584 3300014325 Ga0163163_10004894 Ga0163163_100048943 331
585 3300014325 Ga0163163_10050639 Ga0163163_100506392 331
586 3300014325 Ga0163163_10447815 Ga0163163_104478151 331
587 3300014326 Ga0157380_10055011 Ga0157380_100550113 331
588 3300014745 Ga0157377_10017156 Ga0157377_100171564 331
589 3300014745 Ga0157377_10045165 Ga0157377_100451652 331
590 3300014968 Ga0157379_10435620 Ga0157379_104356202 331
591 3300025315 Ga0207697_10007900 Ga0207697_100079002 331
592 3300025315 Ga0207697_10075189 Ga0207697_100751892 331
593 3300025711 Ga0207696_1016053 Ga0207696_10160532 331
594 3300025903 Ga0207680_10077036 Ga0207680_100770361 331
595 3300025908 Ga0207643_10001752 Ga0207643_100017528 331
596 3300025918 Ga0207662_10007677 Ga0207662_100076772 331
597 3300025918 Ga0207662_10023443 Ga0207662_100234432 331
598 3300025925 Ga0207650_10007102 Ga0207650_100071025 331
599 3300025925 Ga0207650_10015962 Ga0207650_100159621 331
600 3300025925 Ga0207650_10136821 Ga0207650_101368212 331
601 3300025925 Ga0207650_10138597 Ga0207650_101385972 331
602 3300025926 Ga0207659_10000110 Ga0207659_1000011032 331
603 3300025926 Ga0207659_10005455 Ga0207659_100054555 331
604 3300025926 Ga0207659_10009646 Ga0207659_100096462 331
605 3300025926 Ga0207659_10025939 Ga0207659_100259393 331
606 3300025926 Ga0207659_10212906 Ga0207659_102129062 331
607 3300025927 Ga0207687_10125483 Ga0207687_101254832 331
608 3300025931 Ga0207644_10011367 Ga0207644_100113672 331
609 3300025931 Ga0207644_10088751 Ga0207644_100887512 331
610 3300025933 Ga0207706_10046751 Ga0207706_100467512 331
611 3300025933 Ga0207706_10136090 Ga0207706_101360902 331
612 3300025933 Ga0207706_10244336 Ga0207706_102443362 331
613 3300025934 Ga0207686_10275402 Ga0207686_102754022 331
614 3300025936 Ga0207670_10011792 Ga0207670_100117923 331
615 3300025936 Ga0207670_10061176 Ga0207670_100611762 331
616 3300025938 Ga0207704_10230296 Ga0207704_102302962 331
617 3300025940 Ga0207691_10010734 Ga0207691_100107343 331
618 3300025940 Ga0207691_10017127 Ga0207691_100171273 331
619 3300025940 Ga0207691_10145049 Ga0207691_101450492 331
620 3300025940 Ga0207691_10149499 Ga0207691_101494992 331
621 3300025940 Ga0207691_10202520 Ga0207691_102025202 331
622 3300025941 Ga0207711_10109413 Ga0207711_101094133 331
623 3300025942 Ga0207689_10181233 Ga0207689_101812332 331
624 3300025944 Ga0207661_10001850 Ga0207661_100018504 331
625 3300025945 Ga0207679_10007781 Ga0207679_100077812 331
626 3300025945 Ga0207679_10065127 Ga0207679_100651272 331
627 3300025960 Ga0207651_10125745 Ga0207651_101257452 331
628 3300025960 Ga0207651_10294267 Ga0207651_102942671 331
629 3300025960 Ga0207651_10310162 Ga0207651_103101621 331
630 3300025981 Ga0207640_10181997 Ga0207640_101819971 331
631 3300025986 Ga0207658_10056542 Ga0207658_100565422 331
632 3300025986 Ga0207658_10216821 Ga0207658_102168212 331
633 3300026035 Ga0207703_10001472 Ga0207703_100014729 331
634 3300026035 Ga0207703_10124888 Ga0207703_101248882 331
635 3300026041 Ga0207639_10332689 Ga0207639_103326891 331
636 3300026067 Ga0207678_10093256 Ga0207678_100932562 331
637 3300026067 Ga0207678_10363542 Ga0207678_103635422 331
638 3300026075 Ga0207708_10020509 Ga0207708_100205093 331
639 3300026088 Ga0207641_10000005 Ga0207641_1000000520 331
640 3300026088 Ga0207641_10121503 Ga0207641_101215032 331
641 3300026089 Ga0207648_10010861 Ga0207648_100108614 331
642 3300026095 Ga0207676_10002609 Ga0207676_1000260915 331
643 3300026095 Ga0207676_10020241 Ga0207676_100202412 331
644 3300026095 Ga0207676_10194997 Ga0207676_101949972 331
645 3300026116 Ga0207674_10032779 Ga0207674_100327794 331
646 3300026116 Ga0207674_10078540 Ga0207674_100785403 331
647 3300026116 Ga0207674_10095302 Ga0207674_100953022 331
648 3300026118 Ga0207675_100004144 Ga0207675_1000041447 331
649 3300026118 Ga0207675_100039417 Ga0207675_1000394172 331
650 3300026118 Ga0207675_100131679 Ga0207675_1001316792 331
651 3300026118 Ga0207675_100355489 Ga0207675_1003554892 331
652 3300026142 Ga0207698_10142204 Ga0207698_101422041 331
653 3300027907 Ga0207428_10000814 Ga0207428_1000081425 331
654 3300027907 Ga0207428_10023480 Ga0207428_100234802 331
655 3300027907 Ga0207428_10023677 Ga0207428_100236773 331
656 3300027907 Ga0207428_10109115 Ga0207428_101091152 331
657 3300027907 Ga0207428_10145544 Ga0207428_101455441 331
658 3300028380 Ga0268265_10100210 Ga0268265_101002101 331
659 3300028380 Ga0268265_10130797 Ga0268265_101307971 331
660 3300028380 Ga0268265_10341374 Ga0268265_103413741 331
661 3300028381 Ga0268264_10044990 Ga0268264_100449902 331
662 3300031824 Ga0307413_10010611 Ga0307413_100106112 331
663 3300031852 Ga0307410_10024217 Ga0307410_100242173 331
664 3300031901 Ga0307406_10129684 Ga0307406_101296841 331
665 3300031995 Ga0307409_100013022 Ga0307409_1000130222 331
666 3300031995 Ga0307409_100018478 Ga0307409_1000184783 331
667 3300032002 Ga0307416_100086564 Ga0307416_1000865642 331
668 3300032005 Ga0307411_10121049 Ga0307411_101210492 331
669 3300032126 Ga0307415_100104302 Ga0307415_1001043022 331
670 3300035112 Ga0373932_0049668 Ga0373932_0049668_40_1050 331
671 3300037068 Ga0373925_0121611 Ga0373925_0121611_794_1810 331
672 3300042435 Ga0439434_0021324 Ga0439434_0021324_844_1875 331
673 3300042461 Ga0439460_0014263 Ga0439460_0014263_823_1878 331
674 3300044656 Ga0466969_0005283 Ga0466969_0005283_3167_4180 331
675 3300045051 Ga0451576_0038031 Ga0451576_0038031_1005_2021 331
676 3300045051 Ga0451576_0055575 Ga0451576_0055575_1488_2504 331
677 3300046539 Ga0495621_0045606 Ga0495621_0045606_230_1246 331
678 3300046616 Ga0495668_0000024 Ga0495668_0000024_346472_347500 331
679 3300046664 Ga0495659_0009276 Ga0495659_0009276_1415_2431 331
680 3300046664 Ga0495659_0012961 Ga0495659_0012961_26_1042 331
681 3300046664 Ga0495659_0067026 Ga0495659_0067026_247_1260 331
682 3300046664 Ga0495659_0085380 Ga0495659_0085380_36_1052 331
683 3300046683 Ga0495658_0198613 Ga0495658_0198613_141_1157 331
684 3300046684 Ga0495669_0007859 Ga0495669_0007859_2765_3781 331
685 3300047318 Ga0495636_0020569 Ga0495636_0020569_1510_2523 331
686 3300048903 Ga0496100_0102951 Ga0496100_0102951_770_1780 331
687 3300048905 Ga0496102_0287319 Ga0496102_0287319_309_1319 331
688 3300048907 Ga0496104_0003434 Ga0496104_0003434_12164_13174 331
689 3300048908 Ga0496105_0023194 Ga0496105_0023194_731_1741 331
690 3300048909 Ga0496106_0304668 Ga0496106_0304668_168_1184 331
691 3300048911 Ga0496108_0002594 Ga0496108_0002594_9544_10554 331
692 3300048912 Ga0496109_0003044 Ga0496109_0003044_11532_12542 331
693 3300048912 Ga0496109_0246009 Ga0496109_0246009_116_1126 331
694 3300048913 Ga0496110_0004462 Ga0496110_0004462_8815_9825 331
695 3300048915 Ga0496112_0008114 Ga0496112_0008114_4656_5666 331
696 3300048916 Ga0496113_0010492 Ga0496113_0010492_1024_2034 331
697 3300048917 Ga0496114_0045076 Ga0496114_0045076_853_1878 331
698 3300049569 Ga0501032_0006519 Ga0501032_0006519_1261_2277 331
699 3300049569 Ga0501032_0054984 Ga0501032_0054984_354_1373 331
700 3300049571 Ga0501034_0009602 Ga0501034_0009602_2948_3967 331
701 3300049571 Ga0501034_0021706 Ga0501034_0021706_2897_3913 331
702 3300049572 Ga0501036_0047615 Ga0501036_0047615_2083_3102 331
703 3300049572 Ga0501036_0095789 Ga0501036_0095789_1433_2452 331
704 3300049574 Ga0501038_0009816 Ga0501038_0009816_1455_2471 331
705 3300049574 Ga0501038_0080664 Ga0501038_0080664_1710_2729 331
706 3300049575 Ga0501039_0014224 Ga0501039_0014224_2635_3651 331
707 3300049575 Ga0501039_0048953 Ga0501039_0048953_138_1157 331
708 3300049575 Ga0501039_0299277 Ga0501039_0299277_34_1047 331
709 3300049576 Ga0501040_0023710 Ga0501040_0023710_389_1402 331
710 3300049579 Ga0501043_0034044 Ga0501043_0034044_1892_2911 331
711 3300049580 Ga0501046_0013245 Ga0501046_0013245_3649_4665 331
712 3300049581 Ga0501047_0038513 Ga0501047_0038513_1993_3009 331
713 3300049581 Ga0501047_0047353 Ga0501047_0047353_2882_3901 331
714 3300049582 Ga0501048_0044212 Ga0501048_0044212_1432_2448 331
715 3300049583 Ga0501067_0025768 Ga0501067_0025768_789_1808 331
716 3300049583 Ga0501067_0053450 Ga0501067_0053450_537_1553 331
717 3300049584 Ga0501068_0093923 Ga0501068_0093923_791_1810 331
718 3300049586 Ga0501070_0074157 Ga0501070_0074157_330_1349 331
719 3300049589 Ga0501073_0018115 Ga0501073_0018115_3208_4227 331
720 3300049589 Ga0501073_0094712 Ga0501073_0094712_343_1356 331
721 3300049592 Ga0501076_0116632 Ga0501076_0116632_610_1629 331
722 3300049742 Ga0501080_0009143 Ga0501080_0009143_4260_5276 331
723 3300049742 Ga0501080_0136327 Ga0501080_0136327_67_1086 331
724 3300049822 Ga0501035_0016181 Ga0501035_0016181_2872_3888 331
725 3300049823 Ga0501044_0002228 Ga0501044_0002228_1338_2354 331
726 3300049823 Ga0501044_0104326 Ga0501044_0104326_1651_2670 331
727 3300050491 nmdc:mga00v17_61120_c1 nmdc:mga00v17_61120_c1_1244_2254 331
728 3300050507 nmdc:mga05p37_113658_c1 nmdc:mga05p37_113658_c1_1399_2427 331
729 3300050507 nmdc:mga05p37_114217_c1 nmdc:mga05p37_114217_c1_137_1147 331
730 3300050507 nmdc:mga05p37_14951_c1 nmdc:mga05p37_14951_c1_7852_8883 331
731 3300050507 nmdc:mga05p37_20417_c1 nmdc:mga05p37_20417_c1_1692_2708 331
732 3300050507 nmdc:mga05p37_56964_c1 nmdc:mga05p37_56964_c1_2860_3876 331
733 3300050507 nmdc:mga05p37_64255_c1 nmdc:mga05p37_64255_c1_1379_2464 331
734 3300050508 nmdc:mga09592_235295_c1 nmdc:mga09592_235295_c1_29_1045 331
735 3300050508 nmdc:mga09592_241463_c1 nmdc:mga09592_241463_c1_417_1502 331
736 3300050508 nmdc:mga09592_74670_c1 nmdc:mga09592_74670_c1_387_1427 331
737 3300050509 nmdc:mga0qj67_107382_c1 nmdc:mga0qj67_107382_c1_520_1593 331
738 3300050509 nmdc:mga0qj67_82798_c1 nmdc:mga0qj67_82798_c1_74_1105 331
739 3300050510 nmdc:mga06r32_225664_c1 nmdc:mga06r32_225664_c1_483_1499 331
740 3300050510 nmdc:mga06r32_58760_c1 nmdc:mga06r32_58760_c1_1485_2558 331
741 3300050511 nmdc:mga08y16_416437_c1 nmdc:mga08y16_416437_c1_298_1314 331
742 3300050511 nmdc:mga08y16_6402_c1 nmdc:mga08y16_6402_c1_2148_3188 331
743 3300050512 nmdc:mga0n895_125962_c1 nmdc:mga0n895_125962_c1_109_1122 331
744 3300050512 nmdc:mga0n895_16737_c1 nmdc:mga0n895_16737_c1_2060_3076 331
745 3300050512 nmdc:mga0n895_168210_c1 nmdc:mga0n895_168210_c1_549_1559 331
746 3300050512 nmdc:mga0n895_19263_c1 nmdc:mga0n895_19263_c1_571_1587 331
747 3300050512 nmdc:mga0n895_412145_c1 nmdc:mga0n895_412145_c1_153_1169 331
748 3300050512 nmdc:mga0n895_4246_c1 nmdc:mga0n895_4246_c1_1481_2524 331
749 3300050512 nmdc:mga0n895_57949_c1 nmdc:mga0n895_57949_c1_2480_3508 331
750 3300050512 nmdc:mga0n895_84598_c1 nmdc:mga0n895_84598_c1_283_1293 331
751 3300050513 nmdc:mga0rr50_4416_c1 nmdc:mga0rr50_4416_c1_3884_4900 331
752 3300050513 nmdc:mga0rr50_64007_c1 nmdc:mga0rr50_64007_c1_1481_2491 331
753 3300050515 nmdc:mga0a205_112872_c1 nmdc:mga0a205_112872_c1_149_1282 331
754 3300050515 nmdc:mga0a205_178200_c1 nmdc:mga0a205_178200_c1_636_1652 331
755 3300050515 nmdc:mga0a205_28284_c1 nmdc:mga0a205_28284_c1_2207_3223 331
756 3300050515 nmdc:mga0a205_6227_c1 nmdc:mga0a205_6227_c1_2494_3507 331
757 3300053093 Ga0500651_0119011 Ga0500651_0119011_87_1097 331
758 3300054114 Ga0501084_0031351 Ga0501084_0031351_390_1403 331
759 3300054114 Ga0501084_0396586 Ga0501084_0396586_59_1075 331
760 3300060353 Ga0501082_0001523 Ga0501082_0001523_3747_4760 331
761 3300060353 Ga0501082_0007454 Ga0501082_0007454_1540_2559 331
762 iso_pu_bacteria 2547132130 2547500771 331
763 iso_pu_bacteria 2576861471 2578459248 331
764 iso_pu_bacteria 2816332141 2816516134 331
765 iso_pu_bacteria 2852649853 2852651579 331
766 iso_pu_bacteria 2919130084 2919132765 331
767 iso_pu_bacteria 2919134579 2919134617 331
768 iso_pu_bacteria 2929195423 2929196933 331
769 iso_pu_bacteria 2939622612 2939625156 331
770 iso_pu_bacteria 2941475908 2941477006 331
771 iso_pu_bacteria 2941489479 2941490344 331
772 iso_pu_bacteria 8002869464 8002872092 331
773 iso_pu_bacteria 8021622325 8021625261 331
774 iso_pu_bacteria 8021648035 8021649726 331
775 2162886007 SwRhRL2b_contig_3539020 SwRhRL2b_0314.00005670 332
776 3300005289 Ga0065704_10070190 Ga0065704_1007019064 332
777 3300005328 Ga0070676_10004330 Ga0070676_100043302 332
778 3300005335 Ga0070666_10043508 Ga0070666_100435083 332
779 3300005341 Ga0070691_10003000 Ga0070691_100030007 332
780 3300005343 Ga0070687_100013142 Ga0070687_1000131422 332
781 3300005343 Ga0070687_100090533 Ga0070687_1000905332 332
782 3300005345 Ga0070692_10056824 Ga0070692_100568242 332
783 3300005353 Ga0070669_100029241 Ga0070669_1000292412 332
784 3300005354 Ga0070675_100442358 Ga0070675_1004423581 332
785 3300005438 Ga0070701_10012165 Ga0070701_100121652 332
786 3300005440 Ga0070705_100003965 Ga0070705_1000039652 332
787 3300005444 Ga0070694_100011107 Ga0070694_1000111073 332
788 3300005459 Ga0068867_100053738 Ga0068867_1000537382 332
789 3300005459 Ga0068867_100061470 Ga0068867_1000614701 332
790 3300005468 Ga0070707_100147585 Ga0070707_1001475853 332
791 3300005468 Ga0070707_100209972 Ga0070707_1002099722 332
792 3300005518 Ga0070699_100464075 Ga0070699_1004640751 332
793 3300005544 Ga0070686_100001409 Ga0070686_1000014099 332
794 3300005545 Ga0070695_100003657 Ga0070695_1000036572 332
795 3300005545 Ga0070695_100006552 Ga0070695_1000065522 332
796 3300005546 Ga0070696_100008448 Ga0070696_1000084482 332
797 3300005548 Ga0070665_100005360 Ga0070665_1000053606 332
798 3300005549 Ga0070704_100003072 Ga0070704_1000030723 332
799 3300005578 Ga0068854_100007820 Ga0068854_1000078203 332
800 3300005578 Ga0068854_100082043 Ga0068854_1000820432 332
801 3300005618 Ga0068864_100371295 Ga0068864_1003712951 332
802 3300005718 Ga0068866_10018596 Ga0068866_100185963 332
803 3300005719 Ga0068861_100005269 Ga0068861_1000052691 332
804 3300005719 Ga0068861_100151935 Ga0068861_1001519352 332
805 3300005834 Ga0068851_10065657 Ga0068851_100656572 332
806 3300005841 Ga0068863_100350008 Ga0068863_1003500081 332
807 3300005842 Ga0068858_100012279 Ga0068858_1000122793 332
808 3300005842 Ga0068858_100024743 Ga0068858_1000247432 332
809 3300005844 Ga0068862_100158428 Ga0068862_1001584282 332
810 3300006237 Ga0097621_100024815 Ga0097621_1000248151 332
811 3300006358 Ga0068871_100006884 Ga0068871_1000068846 332
812 3300006846 Ga0075430_100001773 Ga0075430_10000177311 332
813 3300006847 Ga0075431_100029382 Ga0075431_1000293822 332
814 3300006852 Ga0075433_10018342 Ga0075433_100183422 332
815 3300006871 Ga0075434_100009173 Ga0075434_1000091733 332
816 3300006871 Ga0075434_100117300 Ga0075434_1001173002 332
817 3300006880 Ga0075429_100087006 Ga0075429_1000870062 332
818 3300006881 Ga0068865_100000942 Ga0068865_10000094213 332
819 3300006881 Ga0068865_100065977 Ga0068865_1000659771 332
820 3300006914 Ga0075436_100059382 Ga0075436_1000593822 332
821 3300007076 Ga0075435_100000928 Ga0075435_1000009282 332
822 3300007076 Ga0075435_100003002 Ga0075435_1000030027 332
823 3300007076 Ga0075435_100109768 Ga0075435_1001097682 332
824 3300007076 Ga0075435_100139830 Ga0075435_1001398302 332
825 3300009093 Ga0105240_10013459 Ga0105240_100134595 332
826 3300009094 Ga0111539_10039504 Ga0111539_100395042 332
827 3300009098 Ga0105245_10022300 Ga0105245_100223003 332
828 3300009101 Ga0105247_10172018 Ga0105247_101720181 332
829 3300009147 Ga0114129_10017374 Ga0114129_100173745 332
830 3300009147 Ga0114129_10055881 Ga0114129_100558812 332
831 3300009147 Ga0114129_10063964 Ga0114129_100639643 332
832 3300009147 Ga0114129_10469870 Ga0114129_104698703 332
833 3300009148 Ga0105243_10012897 Ga0105243_100128976 332
834 3300009174 Ga0105241_10134353 Ga0105241_101343532 332
835 3300009176 Ga0105242_10008281 Ga0105242_100082816 332
836 3300009176 Ga0105242_10179844 Ga0105242_101798442 332
837 3300009177 Ga0105248_10013157 Ga0105248_100131576 332
838 3300009545 Ga0105237_10006300 Ga0105237_100063003 332
839 3300009553 Ga0105249_10012954 Ga0105249_100129544 332
840 3300013296 Ga0157374_10053818 Ga0157374_100538182 332
841 3300013297 Ga0157378_10008708 Ga0157378_100087082 332
842 3300013306 Ga0163162_10078015 Ga0163162_100780152 332
843 3300013307 Ga0157372_10207269 Ga0157372_102072692 332
844 3300014325 Ga0163163_10123269 Ga0163163_101232692 332
845 3300014325 Ga0163163_10209284 Ga0163163_102092842 332
846 3300014326 Ga0157380_10013953 Ga0157380_100139533 332
847 3300025900 Ga0207710_10089290 Ga0207710_100892901 332
848 3300025903 Ga0207680_10077737 Ga0207680_100777372 332
849 3300025907 Ga0207645_10005050 Ga0207645_100050504 332
850 3300025911 Ga0207654_10252755 Ga0207654_102527551 332
851 3300025918 Ga0207662_10010309 Ga0207662_100103094 332
852 3300025918 Ga0207662_10015467 Ga0207662_100154671 332
853 3300025922 Ga0207646_10093154 Ga0207646_100931543 332
854 3300025922 Ga0207646_10101801 Ga0207646_101018013 332
855 3300025922 Ga0207646_10243182 Ga0207646_102431821 332
856 3300025923 Ga0207681_10006282 Ga0207681_100062827 332
857 3300025925 Ga0207650_10335452 Ga0207650_103354521 332
858 3300025934 Ga0207686_10002104 Ga0207686_100021044 332
859 3300025934 Ga0207686_10006277 Ga0207686_100062773 332
860 3300025935 Ga0207709_10008442 Ga0207709_100084422 332
861 3300025938 Ga0207704_10001200 Ga0207704_100012002 332
862 3300025941 Ga0207711_10002106 Ga0207711_100021063 332
863 3300025941 Ga0207711_10169430 Ga0207711_101694301 332
864 3300025960 Ga0207651_10007650 Ga0207651_100076503 332
865 3300025961 Ga0207712_10044185 Ga0207712_100441852 332
866 3300025981 Ga0207640_10038990 Ga0207640_100389903 332
867 3300025981 Ga0207640_10058860 Ga0207640_100588602 332
868 3300026035 Ga0207703_10090140 Ga0207703_100901403 332
869 3300026088 Ga0207641_10093846 Ga0207641_100938462 332
870 3300026089 Ga0207648_10071064 Ga0207648_100710642 332
871 3300026089 Ga0207648_10206383 Ga0207648_102063832 332
872 3300026095 Ga0207676_10411425 Ga0207676_104114251 332
873 3300026118 Ga0207675_100004655 Ga0207675_1000046556 332
874 3300026118 Ga0207675_100117617 Ga0207675_1001176172 332
875 3300026118 Ga0207675_100232526 Ga0207675_1002325262 332
876 3300034817 Ga0373948_0008419 Ga0373948_0008419_554_1579 332
877 3300034818 Ga0373950_0006066 Ga0373950_0006066_316_1341 332
878 3300034820 Ga0373959_0002412 Ga0373959_0002412_1756_2781 332
879 3300034957 Ga0373938_0000534 Ga0373938_0000534_4480_5505 332
880 3300035084 Ga0373928_0002510 Ga0373928_0002510_1261_2286 332
881 3300035085 Ga0373929_0000719 Ga0373929_0000719_3714_4739 332
882 3300035088 Ga0373940_0000338 Ga0373940_0000338_5610_6635 332
883 3300035090 Ga0373949_0002015 Ga0373949_0002015_1759_2784 332
884 3300035091 Ga0373951_0000760 Ga0373951_0000760_2633_3658 332
885 3300035112 Ga0373932_0002231 Ga0373932_0002231_3553_4578 332
886 3300035114 Ga0373939_0000610 Ga0373939_0000610_858_1883 332
887 3300035115 Ga0373941_0000441 Ga0373941_0000441_4277_5302 332
888 3300035121 Ga0373960_0000099 Ga0373960_0000099_10336_11361 332
889 3300035207 Ga0373942_0000501 Ga0373942_0000501_7875_8900 332
890 3300035241 Ga0373961_0001461 Ga0373961_0001461_3463_4488 332
891 3300035242 Ga0373962_0002767 Ga0373962_0002767_573_1598 332
892 3300035691 Ga0373931_0004832 Ga0373931_0004832_3228_4253 332
893 3300035692 Ga0373935_0223138 Ga0373935_0223138_30_1049 332
894 3300046681 Ga0495647_0026822 Ga0495647_0026822_986_2005 332
895 3300048905 Ga0496102_0123104 Ga0496102_0123104_958_1992 332
896 3300048909 Ga0496106_0019449 Ga0496106_0019449_2344_3378 332
897 3300048918 Ga0496115_0008535 Ga0496115_0008535_531_1550 332
898 3300049575 Ga0501039_0030770 Ga0501039_0030770_875_1924 332
899 3300049577 Ga0501041_0068088 Ga0501041_0068088_239_1288 332
900 3300049579 Ga0501043_0146341 Ga0501043_0146341_477_1526 332
901 3300049580 Ga0501046_0164993 Ga0501046_0164993_152_1201 332
902 3300049588 Ga0501072_0037550 Ga0501072_0037550_1598_2647 332
903 3300049592 Ga0501076_0055252 Ga0501076_0055252_1680_2729 332
904 3300049741 Ga0501079_0008840 Ga0501079_0008840_706_1755 332
905 3300049743 Ga0501081_0103222 Ga0501081_0103222_930_1979 332
906 3300049824 Ga0501045_0032318 Ga0501045_0032318_1989_3038 332
907 3300050507 nmdc:mga05p37_173268_c1 nmdc:mga05p37_173268_c1_1377_2390 332
908 3300050507 nmdc:mga05p37_17374_c1 nmdc:mga05p37_17374_c1_2838_3875 332
909 3300050507 nmdc:mga05p37_5461_c1 nmdc:mga05p37_5461_c1_5231_6253 332
910 3300050507 nmdc:mga05p37_86332_c1 nmdc:mga05p37_86332_c1_2695_3717 332
911 3300050509 nmdc:mga0qj67_2660_c1 nmdc:mga0qj67_2660_c1_1195_2244 332
912 3300050510 nmdc:mga06r32_50480_c1 nmdc:mga06r32_50480_c1_128_1165 332
913 3300050512 nmdc:mga0n895_104824_c1 nmdc:mga0n895_104824_c1_1006_2040 332
914 3300050512 nmdc:mga0n895_16181_c1 nmdc:mga0n895_16181_c1_1991_3019 332
915 3300050512 nmdc:mga0n895_240200_c1 nmdc:mga0n895_240200_c1_296_1318 332
916 3300050512 nmdc:mga0n895_4336_c1 nmdc:mga0n895_4336_c1_214_1227 332
917 3300050513 nmdc:mga0rr50_1067_c1 nmdc:mga0rr50_1067_c1_8423_9457 332
918 3300050513 nmdc:mga0rr50_124699_c1 nmdc:mga0rr50_124699_c1_748_1773 332
919 3300050513 nmdc:mga0rr50_127921_c1 nmdc:mga0rr50_127921_c1_35_1057 332
920 3300050513 nmdc:mga0rr50_58034_c1 nmdc:mga0rr50_58034_c1_1662_2690 332
921 3300050513 nmdc:mga0rr50_73754_c1 nmdc:mga0rr50_73754_c1_1434_2495 332
922 3300050514 nmdc:mga08x19_53223_c1 nmdc:mga08x19_53223_c1_837_1865 332
923 3300050514 nmdc:mga08x19_56685_c1 nmdc:mga08x19_56685_c1_347_1372 332
924 3300050515 nmdc:mga0a205_286497_c1 nmdc:mga0a205_286497_c1_473_1510 332
925 3300050515 nmdc:mga0a205_64123_c1 nmdc:mga0a205_64123_c1_1570_2598 332
926 3300050515 nmdc:mga0a205_9730_c1 nmdc:mga0a205_9730_c1_5560_6573 332
927 3300060353 Ga0501082_0042059 Ga0501082_0042059_1268_2317 332
928 3300061734 Ga0530510_0004917 Ga0530510_0004917_660_1709 332
929 3300002075 JGI24738J21930_10000759 JGI24738J21930_100007593 333
930 3300014497 Ga0182008_10019950 Ga0182008_100199503 333
931 3300015265 Ga0182005_1001455 Ga0182005_10014558 333
932 3300030742 Ga0316183_1083776 Ga0316183_10837762 333
933 3300031911 Ga0307412_10001045 Ga0307412_100010459 333
934 3300041404 Ga0439436_0000046 Ga0439436_0000046_32531_33532 333
935 3300041413 Ga0439465_0000157 Ga0439465_0000157_1220_2221 333
936 3300046512 Ga0495610_0000184 Ga0495610_0000184_5650_6651 333
937 3300046522 Ga0495643_0000767 Ga0495643_0000767_32773_33774 333
938 3300046660 Ga0495625_0020533 Ga0495625_0020533_432_1433 333
939 3300046691 Ga0495670_0005324 Ga0495670_0005324_1841_2842 333
940 3300047320 Ga0495672_0000230 Ga0495672_0000230_76814_77815 333
941 3300048927 Ga0496124_0067845 Ga0496124_0067845_458_1459 333
942 3300002774 JGI25150J39212_1000458 JGI25150J39212_100045817 334
943 3300003187 JGI25151J46595_10000016 JGI25151J46595_10000016125 334
944 3300003187 JGI25151J46595_10000057 JGI25151J46595_100000571 334
945 3300003215 JGI25153J46596_10000041 JGI25153J46596_100000418 334
946 3300003322 rootL2_10145053 rootL2_101450534 334
947 3300003771 Ga0055526_1000006 Ga0055526_100000675 334
948 3300003773 Ga0055537_1000003 Ga0055537_1000003151 334
949 3300003773 Ga0055537_1000018 Ga0055537_100001875 334
950 3300003773 Ga0055537_1000442 Ga0055537_100044224 334
951 3300003775 Ga0055524_1000009 Ga0055524_1000009151 334
952 3300003784 Ga0055534_1000004 Ga0055534_1000004151 334
953 3300003784 Ga0055534_1001119 Ga0055534_100111913 334
954 3300003790 Ga0055528_1000003 Ga0055528_1000003184 334
955 3300003790 Ga0055528_1000990 Ga0055528_100099014 334
956 3300003856 Ga0058692_1000015 Ga0058692_100001533 334
957 3300005289 Ga0065704_10105639 Ga0065704_101056392 334
958 3300005354 Ga0070675_100019988 Ga0070675_1000199884 334
959 3300005548 Ga0070665_100311681 Ga0070665_1003116812 334
960 3300015689 Ga0183360_10001 Ga0183360_100011496 334
961 3300025245 Ga0207425_1000044 Ga0207425_1000044178 334
962 3300025245 Ga0207425_1000388 Ga0207425_100038819 334
963 3300025258 Ga0209129_1000044 Ga0209129_100004498 334
964 3300025263 Ga0209565_1000001 Ga0209565_10000012240 334
965 3300025263 Ga0209565_1000031 Ga0209565_1000031239 334
966 3300025273 Ga0209673_1000001 Ga0209673_10000012240 334
967 3300025273 Ga0209673_1000674 Ga0209673_100067420 334
968 3300025291 Ga0209675_1000001 Ga0209675_1000001292 334
969 3300025291 Ga0209675_1000015 Ga0209675_1000015338 334
970 3300025294 Ga0209025_1000006 Ga0209025_1000006879 334
971 3300025294 Ga0209025_1000012 Ga0209025_1000012402 334
972 3300025295 Ga0209564_1000001 Ga0209564_1000001454 334
973 3300025295 Ga0209564_1000037 Ga0209564_100003731 334
974 3300025297 Ga0209758_1000018 Ga0209758_1000018255 334
975 3300025297 Ga0209758_1031300 Ga0209758_10313001 334
976 3300025299 Ga0209256_1000002 Ga0209256_10000021098 334
977 3300025935 Ga0207709_10020870 Ga0207709_100208703 334
978 3300027312 Ga0209371_1000011 Ga0209371_1000011517 334
979 3300030500 Ga0268256_1000011 Ga0268256_1000011517 334
980 3300041407 Ga0439447_002290 Ga0439447_002290_2540_3544 334
981 3300042006 Ga0439432_032812 Ga0439432_032812_545_1600 334
982 3300042184 Ga0450908_000067 Ga0450908_000067_6003_7007 334
983 3300046501 Ga0495607_0027190 Ga0495607_0027190_428_1432 334
984 3300046507 Ga0495606_0014574 Ga0495606_0014574_1411_2415 334
985 3300046525 Ga0495663_0011295 Ga0495663_0011295_726_1730 334
986 3300046558 Ga0495633_0005263 Ga0495633_0005263_3261_4274 334
987 3300046616 Ga0495668_0005888 Ga0495668_0005888_5776_6780 334
988 3300047472 Ga0495686_0034422 Ga0495686_0034422_1300_2304 334
989 3300048920 Ga0496117_0002617 Ga0496117_0002617_21167_22222 334
990 3300048921 Ga0496118_0001666 Ga0496118_0001666_6406_7461 334
991 3300048926 Ga0496123_0065191 Ga0496123_0065191_911_1966 334
992 3300048928 Ga0496125_0138338 Ga0496125_0138338_50_1105 334
993 2162886007 SwRhRL2b_contig_1411923 SwRhRL2b_0740.00006040 335
994 3300003781 Ga0055536_1006687 Ga0055536_10066873 335
995 3300003781 Ga0055536_1007631 Ga0055536_10076313 335
996 3300003791 Ga0055530_10000301 Ga0055530_1000030115 335
997 3300003794 Ga0055531_10008703 Ga0055531_100087033 335
998 3300003794 Ga0055531_10009940 Ga0055531_100099403 335
999 3300003856 Ga0058692_1000022 Ga0058692_1000022158 335
1000 3300005289 Ga0065704_10000363 Ga0065704_100003639 335
1001 3300005331 Ga0070670_100001701 Ga0070670_1000017018 335
1002 3300005333 Ga0070677_10050298 Ga0070677_100502982 335
1003 3300009011 Ga0105251_10000013 Ga0105251_1000001326 335
1004 3300009036 Ga0105244_10043643 Ga0105244_100436433 335
1005 3300014497 Ga0182008_10000187 Ga0182008_100001873 335
1006 3300017792 Ga0163161_10002965 Ga0163161_100029653 335
1007 3300025292 Ga0209676_1000570 Ga0209676_100057023 335
1008 3300025292 Ga0209676_1000998 Ga0209676_100099823 335
1009 3300025298 Ga0209050_1000201 Ga0209050_100020125 335
1010 3300025298 Ga0209050_1000709 Ga0209050_100070919 335
1011 3300025298 Ga0209050_1030006 Ga0209050_10300062 335
1012 3300025299 Ga0209256_1002877 Ga0209256_10028772 335
1013 3300025303 Ga0209051_1000798 Ga0209051_10007983 335
1014 3300025304 Ga0209257_1000208 Ga0209257_100020828 335
1015 3300025304 Ga0209257_1000273 Ga0209257_100027388 335
1016 3300025304 Ga0209257_1001168 Ga0209257_100116823 335
1017 3300025735 Ga0207713_1000445 Ga0207713_100044513 335
1018 3300025925 Ga0207650_10001485 Ga0207650_100014858 335
1019 3300027312 Ga0209371_1000004 Ga0209371_1000004770 335
1020 3300030500 Ga0268256_1000005 Ga0268256_1000005277 335
1021 3300030732 Ga0316176_1017131 Ga0316176_10171313 335
1022 3300038705 Ga0237819_00014 Ga0237819_00014_39795_40802 335
1023 3300046460 Ga0495638_0000642 Ga0495638_0000642_2897_3904 335
1024 3300046501 Ga0495607_0002111 Ga0495607_0002111_7806_8849 335
1025 3300048919 Ga0496116_0050858 Ga0496116_0050858_98_1105 335
1026 3300048919 Ga0496116_0127826 Ga0496116_0127826_61_1110 335
1027 3300048920 Ga0496117_0003560 Ga0496117_0003560_582_1589 335
1028 3300048920 Ga0496117_0009832 Ga0496117_0009832_272_1279 335
1029 3300048921 Ga0496118_0000944 Ga0496118_0000944_1712_2719 335
1030 3300048921 Ga0496118_0019847 Ga0496118_0019847_4244_5251 335
1031 3300048921 Ga0496118_0061323 Ga0496118_0061323_143_1150 335
1032 3300048922 Ga0496119_0000596 Ga0496119_0000596_46831_47883 335
1033 3300048922 Ga0496119_0045327 Ga0496119_0045327_1663_2670 335
1034 3300048923 Ga0496120_0002725 Ga0496120_0002725_14479_15486 335
1035 3300048923 Ga0496120_0012981 Ga0496120_0012981_1652_2704 335
1036 3300048923 Ga0496120_0040421 Ga0496120_0040421_81_1088 335
1037 3300048924 Ga0496121_0000036 Ga0496121_0000036_314011_315033 335
1038 3300048924 Ga0496121_0004638 Ga0496121_0004638_167_1174 335
1039 3300048925 Ga0496122_0003813 Ga0496122_0003813_16594_17601 335
1040 3300048925 Ga0496122_0003919 Ga0496122_0003919_17939_18946 335
1041 3300048925 Ga0496122_0004805 Ga0496122_0004805_810_1820 335
1042 3300048925 Ga0496122_0008759 Ga0496122_0008759_9357_10364 335
1043 3300048925 Ga0496122_0136023 Ga0496122_0136023_85_1092 335
1044 3300048926 Ga0496123_0003419 Ga0496123_0003419_14697_15704 335
1045 3300048926 Ga0496123_0013647 Ga0496123_0013647_722_1732 335
1046 3300048926 Ga0496123_0051832 Ga0496123_0051832_1655_2662 335
1047 3300048926 Ga0496123_0065000 Ga0496123_0065000_1124_2131 335
1048 3300048927 Ga0496124_0007392 Ga0496124_0007392_9834_10886 335
1049 3300048927 Ga0496124_0082468 Ga0496124_0082468_1561_2568 335
1050 3300048928 Ga0496125_0003007 Ga0496125_0003007_18552_19559 335
1051 3300048928 Ga0496125_0177087 Ga0496125_0177087_81_1088 335
1052 3300048929 Ga0496126_0013261 Ga0496126_0013261_7138_8190 335

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00356

LacI

Bacterial regulatory proteins, lacI family

76

121

0.98

PF13377

Peripla_BP_3

Periplasmic binding protein-like domain

243

402

0.9

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

132

400

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c3k-assembly1.cif.gz_A crystal structure of an uncharacterized protein from actinobacillus succinogenes 0.9229 58 329
1sxg-assembly3.cif.gz_F structural studies on the apo transcription factor form b. megaterium 0.9175 61 329
3c3k-assembly1.cif.gz_A crystal structure of an uncharacterized protein from actinobacillus succinogenes 0.9162 58 329
2fep-assembly1.cif.gz_A-2 structure of truncated ccpa in complex with p-ser-hpr and sulfate ions 0.9154 60 329
4o5a-assembly1.cif.gz_A-2 the crystal structure of a laci family transcriptional regulator from bifidobacterium animalis subsp. lactis dsm 10140 0.9123 58 332
ID Description Score Start End Superfamily
2rgyA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9485 161 288 3.40.50.2300
3kkeB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9439 163 288 3.40.50.2300
3c3kB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.941 163 288 3.40.50.2300
3h5tA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9336 4 45 1.10.260.40
2pafA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.924 162 329 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A4Q3DKY9-F1-model_v4 Uncharacterized protein 0.9686 161 267 GO:0000976
GO:0003700
GO:0016798
AF-A0A7I0J546-F1-model_v4 LacI family transcriptional regulator 0.9676 167 269 GO:0000976
GO:0003700
AF-A0A660QII2-F1-model_v4 LacI family transcriptional regulator 0.9611 158 331 GO:0000976
GO:0003700
AF-A0A4Q6DTD8-F1-model_v4 deleted 0.9578 176 331
AF-A0A7H4P3Q3-F1-model_v4 Regulatory protein 0.9524 155 331 GO:0000976
GO:0003700

Feature Viewer

pLDDT pTM Quality
92.44 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map