F489033

General Info

Members Datasets Scaffolds Average Seq Length
1049 348 1023 309

Family's Representative Sequence

Representative Sequence 3300046537|Ga0495598_0025332|Ga0495598_0025332_61_999
Length 312
Sequence MACAPAIDEQQSIPIKKPNWLRVKLPIGEEYKHVRNLVDTHKLHTICESGNCPNMGECWGAGTATFMILGNICTRSCGFCAVATGRPLAVDWDEPQRVAEAIHLMKVKHAVITSVDRDELKDGGSIIWYNTIKAVKSLNPGTTLETLIPDFKGKNKKENIQRIIDAAPEVVSHNIETTERLTRQVRIQAQYWQSMDTLKILKAGGMRTKSGIMLGLGEVKEEVVETLQELYNSGVDVVTIGQYLQPSKKHLPVQRFVHPDEFAEYREIGYQIGLDYVESGPLVRSSYHSEKHVIPNWGRNKWMEEKAIVSCE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2738541278 Niastella sp. CF465 Isolate Unclassified
4 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
5 2818991444 Filimonas endophytica 3197 Isolate Unclassified
6 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
7 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
8 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
9 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
10 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
11 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
12 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
13 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
14 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
15 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
16 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
17 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
18 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
19 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
20 2914759650 Rhizosphaericola mali Isolate Rhizosphere
21 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
22 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
23 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
24 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
25 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
26 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
30 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
31 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
32 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
36 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
37 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
38 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
39 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
40 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
41 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
42 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
47 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
52 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
53 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
54 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
57 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
58 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
59 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
60 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
61 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
62 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
63 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
66 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
80 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
81 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
84 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
85 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
86 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
87 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
88 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
89 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
90 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
96 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
97 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
98 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
99 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
100 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
101 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
111 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
121 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
122 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
143 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
144 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
145 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
151 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
152 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
154 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
158 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
217 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
220 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
221 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
222 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
230 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
231 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
245 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
246 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
247 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
248 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
249 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
250 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
251 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
252 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
253 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
254 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
258 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
262 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
263 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
264 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
265 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
266 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
267 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
275 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
276 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
282 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
292 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
306 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
307 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
308 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
309 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
310 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
311 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
314 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
315 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
316 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
320 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
321 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
322 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
323 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
326 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
327 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
328 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
329 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
330 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
331 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
332 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
333 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
334 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
335 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
338 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
341 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
342 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
343 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
344 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
345 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
346 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
347 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
348 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0.1
Isolates 2.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.29
Nodule 0
Rhizoplane 0.57
Rhizosphere 88.56
Stem 0
Stem Tuber 0
Unclassified 4.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663468 2162886007 Bacteria 272152
2 MRS1b_contig_3254756 2162886011 Bacteria 1906
3 JGI24740J21852_10000968 3300001979 Bacteria 12786
4 JGI24740J21852_10003566 3300001979 Bacteria 6812
5 JGI24739J22299_10002248 3300001989 Bacteria 7425
6 JGI25162J39368_1000596 3300002737 Bacteria 26217
7 JGI25154J39366_1000007 3300002738 Bacteria 335932
8 JGI25164J39214_1001152 3300002772 Bacteria 7380
9 JGI25406J46586_10000275 3300003203 Bacteria 22821
10 JGI25165J46597_1000658 3300003214 Bacteria 28305
11 JGI25153J46596_10001828 3300003215 Bacteria 12620
12 rootH2_10004243 3300003320 Bacteria 29145
13 rootH2_10005337 3300003320 Bacteria 13777
14 rootH2_10030616 3300003320 Bacteria 10703
15 rootH2_10047541 3300003320 Bacteria 3059
16 rootL2_10048891 3300003322 Bacteria 9935
17 rootH1_10005386 3300003323 Bacteria 37172
18 rootH1_10015480 3300003323 Bacteria 5993
19 rootH1_10046162 3300003323 Bacteria 20769
20 rootH1_10046794 3300003323 Bacteria 11572
21 rootH1_10078005 3300003323 Bacteria 5030
22 rootH1_10151388 3300003323 Bacteria 4444
23 rootH1_10198429 3300003323 Bacteria 5071
24 JGI25160J50197_1003166 3300003354 Bacteria 7474
25 JGI25160J50197_1007598 3300003354 Bacteria 4226
26 JGI25160J50197_1008935 3300003354 Bacteria 3764
27 Ga0055526_1007853 3300003771 Bacteria 5452
28 Ga0055526_1030696 3300003771 Bacteria 1561
29 Ga0055528_1000988 3300003790 Bacteria 18890
30 Ga0055530_10003312 3300003791 Bacteria 9305
31 Ga0055531_10000020 3300003794 Bacteria 170186
32 Ga0055543_1010640 3300004625 Bacteria 1919
33 Ga0058862_12776854 3300004803 Bacteria 1947
34 Ga0065165_1000010 3300005262 Bacteria 323737
35 Ga0065704_10070133 3300005289 Bacteria 1266035
36 Ga0065704_10071485 3300005289 Bacteria 10961
37 Ga0065704_10075586 3300005289 Bacteria 5515
38 Ga0065704_10197039 3300005289 Bacteria 1163
39 Ga0065712_10004320 3300005290 Bacteria 6225
40 Ga0065712_10075331 3300005290 Bacteria 3884
41 Ga0065715_10002738 3300005293 Bacteria 7057
42 Ga0070658_10000483 3300005327 Bacteria 34634
43 Ga0070658_10060899 3300005327 Bacteria 3075
44 Ga0070658_10153952 3300005327 Bacteria 1926
45 Ga0070658_10232729 3300005327 Bacteria 1560
46 Ga0070658_10306739 3300005327 Bacteria 1354
47 Ga0070676_10012612 3300005328 Bacteria 4619
48 Ga0070676_10015947 3300005328 Unclassified 4147
49 Ga0070676_10039187 3300005328 Bacteria 2739
50 Ga0070676_10085670 3300005328 Bacteria 1920
51 Ga0070683_100005058 3300005329 Bacteria 10948
52 Ga0070683_100005468 3300005329 Bacteria 10612
53 Ga0070683_100011766 3300005329 Bacteria 7577
54 Ga0070683_100109411 3300005329 Bacteria 2606
55 Ga0070683_100134591 3300005329 Bacteria 2340
56 Ga0070690_100030816 3300005330 Bacteria 3337
57 Ga0070690_100054763 3300005330 Bacteria 2554
58 Ga0070670_100033516 3300005331 Bacteria 4423
59 Ga0070670_100072298 3300005331 Bacteria 2962
60 Ga0070670_100092222 3300005331 Bacteria 2604
61 Ga0070670_100133511 3300005331 Bacteria 2144
62 Ga0070670_100271920 3300005331 Bacteria 1478
63 Ga0070677_10018741 3300005333 Bacteria 2497
64 Ga0070677_10029413 3300005333 Bacteria 2083
65 Ga0068869_100009134 3300005334 Bacteria 6424
66 Ga0068869_100009581 3300005334 Bacteria 6291
67 Ga0068869_100011549 3300005334 Bacteria 5797
68 Ga0068869_100023228 3300005334 Bacteria 4280
69 Ga0068869_100027561 3300005334 Bacteria 3962
70 Ga0068869_100035957 3300005334 Bacteria 3514
71 Ga0068869_100068099 3300005334 Unclassified 2628
72 Ga0068869_100161178 3300005334 Bacteria 1746
73 Ga0070666_10000077 3300005335 Bacteria 70693
74 Ga0070666_10024837 3300005335 Unclassified 3906
75 Ga0070666_10068064 3300005335 Bacteria 2419
76 Ga0070666_10117698 3300005335 Bacteria 1841
77 Ga0070666_10227048 3300005335 Bacteria 1318
78 Ga0070680_100001760 3300005336 Bacteria 15915
79 Ga0070680_100004542 3300005336 Bacteria 10443
80 Ga0070680_100035429 3300005336 Bacteria 4029
81 Ga0070680_100122572 3300005336 Bacteria 2171
82 Ga0070682_100000306 3300005337 Bacteria 34011
83 Ga0070682_100000842 3300005337 Bacteria 17923
84 Ga0070682_100019778 3300005337 Unclassified 3954
85 Ga0070682_100149252 3300005337 Bacteria 1602
86 Ga0070682_100187350 3300005337 Bacteria 1450
87 Ga0068868_100000437 3300005338 Bacteria 28070
88 Ga0068868_100005380 3300005338 Bacteria 8994
89 Ga0068868_100035971 3300005338 Bacteria 3830
90 Ga0068868_100100405 3300005338 Bacteria 2341
91 Ga0068868_100103426 3300005338 Bacteria 2307
92 Ga0068868_100123634 3300005338 Bacteria 2112
93 Ga0070660_100012924 3300005339 Bacteria 5974
94 Ga0070660_100039939 3300005339 Bacteria 3568
95 Ga0070660_100041864 3300005339 Bacteria 3493
96 Ga0070660_100107619 3300005339 Bacteria 2215
97 Ga0070660_100178122 3300005339 Bacteria 1720
98 Ga0070689_100002371 3300005340 Bacteria 12281
99 Ga0070689_100022515 3300005340 Bacteria 4704
100 Ga0070689_100108190 3300005340 Bacteria 2208
101 Ga0070689_100234110 3300005340 Bacteria 1511
102 Ga0070691_10000288 3300005341 Bacteria 17572
103 Ga0070687_100046413 3300005343 Bacteria 2224
104 Ga0070661_100059071 3300005344 Bacteria 2811
105 Ga0070661_100109072 3300005344 Bacteria 2066
106 Ga0070668_100008526 3300005347 Bacteria 7614
107 Ga0070668_100020355 3300005347 Bacteria 5007
108 Ga0070668_100068191 3300005347 Bacteria 2765
109 Ga0070668_100099265 3300005347 Bacteria 2305
110 Ga0070669_100030583 3300005353 Bacteria 3886
111 Ga0070669_100065430 3300005353 Bacteria 2678
112 Ga0070669_100069770 3300005353 Bacteria 2596
113 Ga0070675_100015103 3300005354 Bacteria 6099
114 Ga0070675_100017583 3300005354 Bacteria 5684
115 Ga0070675_100144278 3300005354 Unclassified 2037
116 Ga0070675_100283699 3300005354 Bacteria 1456
117 Ga0070671_100033033 3300005355 Bacteria 4277
118 Ga0070671_100111497 3300005355 Bacteria 2298
119 Ga0070671_100173865 3300005355 Bacteria 1822
120 Ga0070671_100179940 3300005355 Bacteria 1790
121 Ga0070674_100146468 3300005356 Bacteria 1778
122 Ga0070674_100158046 3300005356 Bacteria 1717
123 Ga0070673_100008146 3300005364 Bacteria 6953
124 Ga0070673_100024477 3300005364 Bacteria 4428
125 Ga0070673_100069784 3300005364 Bacteria 2818
126 Ga0070673_100170710 3300005364 Bacteria 1856
127 Ga0070673_100184515 3300005364 Bacteria 1787
128 Ga0070688_100002069 3300005365 Bacteria 10126
129 Ga0070688_100035235 3300005365 Bacteria 3039
130 Ga0070688_100143379 3300005365 Bacteria 1625
131 Ga0070688_100188800 3300005365 Bacteria 1434
132 Ga0070688_100287467 3300005365 Bacteria 1184
133 Ga0070659_100000094 3300005366 Bacteria 66823
134 Ga0070659_100180978 3300005366 Bacteria 1730
135 Ga0070667_100000393 3300005367 Bacteria 47271
136 Ga0070667_100011353 3300005367 Bacteria 7365
137 Ga0070667_100022041 3300005367 Bacteria 5286
138 Ga0070667_100101727 3300005367 Bacteria 2483
139 Ga0070667_100121109 3300005367 Bacteria 2276
140 Ga0070667_100150880 3300005367 Bacteria 2041
141 Ga0070667_100352991 3300005367 Bacteria 1332
142 Ga0070694_100085018 3300005444 Bacteria 2208
143 Ga0070678_100063251 3300005456 Unclassified 2737
144 Ga0070678_100071121 3300005456 Bacteria 2604
145 Ga0070678_100112325 3300005456 Bacteria 2134
146 Ga0070678_100165176 3300005456 Bacteria 1798
147 Ga0070678_100176472 3300005456 Bacteria 1745
148 Ga0070678_100236596 3300005456 Bacteria 1525
149 Ga0070662_100012405 3300005457 Bacteria 5651
150 Ga0070662_100018400 3300005457 Bacteria 4725
151 Ga0070662_100154423 3300005457 Bacteria 1790
152 Ga0070662_100322316 3300005457 Unclassified 1260
153 Ga0070662_100350080 3300005457 Bacteria 1210
154 Ga0070681_10001202 3300005458 Bacteria 22492
155 Ga0070681_10011141 3300005458 Bacteria 8900
156 Ga0070681_10075040 3300005458 Bacteria 3342
157 Ga0070681_10080678 3300005458 Bacteria 3209
158 Ga0070681_10082446 3300005458 Bacteria 3171
159 Ga0070681_10129116 3300005458 Bacteria 2460
160 Ga0068867_100001722 3300005459 Bacteria 15244
161 Ga0068867_100092441 3300005459 Bacteria 2298
162 Ga0068867_100125429 3300005459 Bacteria 1989
163 Ga0068867_100142014 3300005459 Bacteria 1878
164 Ga0068867_100373116 3300005459 Bacteria 1196
165 Ga0068867_100442735 3300005459 Bacteria 1105
166 Ga0070685_10005845 3300005466 Bacteria 6260
167 Ga0070685_10011894 3300005466 Bacteria 4564
168 Ga0070685_10024029 3300005466 Bacteria 3344
169 Ga0070685_10041467 3300005466 Bacteria 2622
170 Ga0070685_10048205 3300005466 Bacteria 2453
171 Ga0070685_10302564 3300005466 Bacteria 1078
172 Ga0070707_100304386 3300005468 Bacteria 1549
173 Ga0070698_100001455 3300005471 Bacteria 26296
174 Ga0070698_100002086 3300005471 Bacteria 22201
175 Ga0070698_100013153 3300005471 Bacteria 8758
176 Ga0070698_100074996 3300005471 Bacteria 3387
177 Ga0070679_100000517 3300005530 Bacteria 32752
178 Ga0070679_100003499 3300005530 Bacteria 14380
179 Ga0070679_100075259 3300005530 Bacteria 3366
180 Ga0070679_100191107 3300005530 Bacteria 2016
181 Ga0070684_100000662 3300005535 Bacteria 23780
182 Ga0070684_100001898 3300005535 Bacteria 15313
183 Ga0070684_100007861 3300005535 Bacteria 8317
184 Ga0070684_100170174 3300005535 Bacteria 1979
185 Ga0070684_100295862 3300005535 Bacteria 1485
186 Ga0068853_100004296 3300005539 Bacteria 11016
187 Ga0068853_100008858 3300005539 Bacteria 8097
188 Ga0068853_100013818 3300005539 Bacteria 6600
189 Ga0068853_100043395 3300005539 Bacteria 3846
190 Ga0068853_100045232 3300005539 Bacteria 3770
191 Ga0068853_100097077 3300005539 Bacteria 2600
192 Ga0068853_100137061 3300005539 Unclassified 2195
193 Ga0068853_100281613 3300005539 Bacteria 1533
194 Ga0068853_100446129 3300005539 Bacteria 1216
195 Ga0068853_100457206 3300005539 Bacteria 1201
196 Ga0070672_100000460 3300005543 Bacteria 23628
197 Ga0070672_100024616 3300005543 Bacteria 4453
198 Ga0070672_100102334 3300005543 Bacteria 2325
199 Ga0070686_100011877 3300005544 Bacteria 4951
200 Ga0070686_100253933 3300005544 Bacteria 1285
201 Ga0070665_100000031 3300005548 Bacteria 333365
202 Ga0070665_100000920 3300005548 Bacteria 37726
203 Ga0070665_100165243 3300005548 Bacteria 2215
204 Ga0068855_100000108 3300005563 Bacteria 103059
205 Ga0068855_100002288 3300005563 Bacteria 23656
206 Ga0068855_100003623 3300005563 Bacteria 18884
207 Ga0068855_100011616 3300005563 Bacteria 10642
208 Ga0068855_100013253 3300005563 Bacteria 9942
209 Ga0068855_100041655 3300005563 Bacteria 5442
210 Ga0068855_100048795 3300005563 Bacteria 4995
211 Ga0068855_100059036 3300005563 Bacteria 4489
212 Ga0070664_100008481 3300005564 Bacteria 8310
213 Ga0070664_100025584 3300005564 Bacteria 4895
214 Ga0070664_100070707 3300005564 Bacteria 2989
215 Ga0070664_100076812 3300005564 Bacteria 2870
216 Ga0070664_100148947 3300005564 Bacteria 2065
217 Ga0070664_100403466 3300005564 Unclassified 1250
218 Ga0070664_100571062 3300005564 Bacteria 1047
219 Ga0070664_100611541 3300005564 Unclassified 1011
220 Ga0068857_100001839 3300005577 Bacteria 17074
221 Ga0068857_100007777 3300005577 Bacteria 9238
222 Ga0068857_100048407 3300005577 Bacteria 3774
223 Ga0068857_100070305 3300005577 Bacteria 3117
224 Ga0068857_100184502 3300005577 Bacteria 1899
225 Ga0068857_100220657 3300005577 Bacteria 1732
226 Ga0068856_100012395 3300005614 Bacteria 8257
227 Ga0068856_100030624 3300005614 Bacteria 5260
228 Ga0068856_100076272 3300005614 Unclassified 3321
229 Ga0068856_100080031 3300005614 Bacteria 3241
230 Ga0068856_100201866 3300005614 Bacteria 2003
231 Ga0068856_100609209 3300005614 Bacteria 1113
232 Ga0068852_100009098 3300005616 Bacteria 7352
233 Ga0068852_100076536 3300005616 Bacteria 2955
234 Ga0068852_100227611 3300005616 Bacteria 1776
235 Ga0068859_100000063 3300005617 Bacteria 106123
236 Ga0068859_100000642 3300005617 Bacteria 34917
237 Ga0068859_100012696 3300005617 Bacteria 8469
238 Ga0068859_100077279 3300005617 Bacteria 3370
239 Ga0068859_100140410 3300005617 Bacteria 2489
240 Ga0068859_100162689 3300005617 Bacteria 2311
241 Ga0068859_100242167 3300005617 Bacteria 1893
242 Ga0068864_100007023 3300005618 Bacteria 9240
243 Ga0068864_100035314 3300005618 Bacteria 4255
244 Ga0068864_100258232 3300005618 Bacteria 1620
245 Ga0068864_100313369 3300005618 Bacteria 1472
246 Ga0068861_100004719 3300005719 Bacteria 9161
247 Ga0068861_100011589 3300005719 Bacteria 6134
248 Ga0068861_100018922 3300005719 Bacteria 4911
249 Ga0068851_10002415 3300005834 Bacteria 8203
250 Ga0068851_10007237 3300005834 Bacteria 5087
251 Ga0068870_10007343 3300005840 Bacteria 4909
252 Ga0068870_10098049 3300005840 Bacteria 1650
253 Ga0068870_10154903 3300005840 Bacteria 1353
254 Ga0068863_100000600 3300005841 Bacteria 36635
255 Ga0068863_100000953 3300005841 Bacteria 29004
256 Ga0068863_100003683 3300005841 Bacteria 15140
257 Ga0068863_100072469 3300005841 Bacteria 3258
258 Ga0068863_100105115 3300005841 Bacteria 2686
259 Ga0068863_100142456 3300005841 Bacteria 2291
260 Ga0068863_100531540 3300005841 Bacteria 1160
261 Ga0068858_100000787 3300005842 Bacteria 33141
262 Ga0068858_100010265 3300005842 Bacteria 8882
263 Ga0068858_100159286 3300005842 Bacteria 2125
264 Ga0068860_100000072 3300005843 Bacteria 174997
265 Ga0068860_100000397 3300005843 Bacteria 57001
266 Ga0068860_100002531 3300005843 Bacteria 19141
267 Ga0068860_100002670 3300005843 Bacteria 18579
268 Ga0068860_100003468 3300005843 Bacteria 16226
269 Ga0068860_100005148 3300005843 Bacteria 13296
270 Ga0068860_100020101 3300005843 Bacteria 6469
271 Ga0068860_100030344 3300005843 Bacteria 5200
272 Ga0068860_100042202 3300005843 Bacteria 4358
273 Ga0068860_100053039 3300005843 Bacteria 3856
274 Ga0068862_100010336 3300005844 Bacteria 7701
275 Ga0068862_100015157 3300005844 Bacteria 6401
276 Ga0081539_10000916 3300005985 Bacteria 55685
277 Ga0075366_10014716 3300006195 Bacteria 4473
278 Ga0075366_10032776 3300006195 Bacteria 3059
279 Ga0097621_100010191 3300006237 Bacteria 6861
280 Ga0097621_100015328 3300006237 Bacteria 5765
281 Ga0097621_100015366 3300006237 Bacteria 5757
282 Ga0097621_100017683 3300006237 Bacteria 5422
283 Ga0097621_100079058 3300006237 Bacteria 2733
284 Ga0097621_100209802 3300006237 Bacteria 1694
285 Ga0068871_100000029 3300006358 Bacteria 77924
286 Ga0068871_100002956 3300006358 Bacteria 11666
287 Ga0068871_100009435 3300006358 Bacteria 7071
288 Ga0068871_100015855 3300006358 Bacteria 5657
289 Ga0068871_100127927 3300006358 Bacteria 2151
290 Ga0068871_100163960 3300006358 Bacteria 1902
291 Ga0068871_100172497 3300006358 Bacteria 1855
292 Ga0068871_100249293 3300006358 Bacteria 1546
293 Ga0068871_100357688 3300006358 Bacteria 1293
294 Ga0075428_100029082 3300006844 Bacteria 6115
295 Ga0075428_100074513 3300006844 Bacteria 3708
296 Ga0075428_100155215 3300006844 Bacteria 2487
297 Ga0075428_100298164 3300006844 Bacteria 1733
298 Ga0075430_100004519 3300006846 Bacteria 11727
299 Ga0075430_100247283 3300006846 Bacteria 1478
300 Ga0075431_100006988 3300006847 Bacteria 11223
301 Ga0075434_100205369 3300006871 Bacteria 1990
302 Ga0075429_100001931 3300006880 Bacteria 17186
303 Ga0068865_100004356 3300006881 Bacteria 8542
304 Ga0068865_100008502 3300006881 Bacteria 6348
305 Ga0068865_100169316 3300006881 Bacteria 1673
306 Ga0068865_100393088 3300006881 Bacteria 1134
307 Ga0097620_100000063 3300006931 Bacteria 106123
308 Ga0097620_100000642 3300006931 Bacteria 34917
309 Ga0097620_100012696 3300006931 Bacteria 8469
310 Ga0097620_100077278 3300006931 Bacteria 3370
311 Ga0097620_100140423 3300006931 Bacteria 2489
312 Ga0097620_100162695 3300006931 Bacteria 2311
313 Ga0097620_100242173 3300006931 Bacteria 1893
314 Ga0105251_10085987 3300009011 Bacteria 1449
315 Ga0105240_10000152 3300009093 Bacteria 141054
316 Ga0105240_10000991 3300009093 Bacteria 50697
317 Ga0105240_10005996 3300009093 Bacteria 17966
318 Ga0105240_10006830 3300009093 Bacteria 16691
319 Ga0105240_10013679 3300009093 Bacteria 11129
320 Ga0105240_10015493 3300009093 Bacteria 10363
321 Ga0105240_10023494 3300009093 Bacteria 8150
322 Ga0105240_10076121 3300009093 Bacteria 4138
323 Ga0105240_10168037 3300009093 Bacteria 2600
324 Ga0105240_10193143 3300009093 Bacteria 2392
325 Ga0111539_10023939 3300009094 Bacteria 7502
326 Ga0111539_10036996 3300009094 Bacteria 5898
327 Ga0111539_10276550 3300009094 Bacteria 1954
328 Ga0105245_10111416 3300009098 Unclassified 2545
329 Ga0105245_10203538 3300009098 Bacteria 1902
330 Ga0105247_10004670 3300009101 Bacteria 8730
331 Ga0105247_10013705 3300009101 Bacteria 4861
332 Ga0105247_10020063 3300009101 Bacteria 4018
333 Ga0105247_10125874 3300009101 Bacteria 1665
334 Ga0114129_10013160 3300009147 Bacteria 11789
335 Ga0114129_10173933 3300009147 Bacteria 2933
336 Ga0105243_10160067 3300009148 Bacteria 1940
337 Ga0105241_10000841 3300009174 Bacteria 23285
338 Ga0105241_10006029 3300009174 Bacteria 8941
339 Ga0105241_10006670 3300009174 Bacteria 8495
340 Ga0105241_10247853 3300009174 Bacteria 1509
341 Ga0105241_10284903 3300009174 Bacteria 1413
342 Ga0105241_10502553 3300009174 Bacteria 1081
343 Ga0105242_10036337 3300009176 Bacteria 3951
344 Ga0105242_10061247 3300009176 Bacteria 3095
345 Ga0105242_10187699 3300009176 Unclassified 1828
346 Ga0105242_10224183 3300009176 Bacteria 1681
347 Ga0105242_10372121 3300009176 Bacteria 1325
348 Ga0105248_10016795 3300009177 Bacteria 8059
349 Ga0105248_10370678 3300009177 Bacteria 1612
350 Ga0105237_10003827 3300009545 Bacteria 17686
351 Ga0105237_10005933 3300009545 Bacteria 13698
352 Ga0105237_10007237 3300009545 Bacteria 12172
353 Ga0105237_10024342 3300009545 Bacteria 6196
354 Ga0105237_10026297 3300009545 Bacteria 5947
355 Ga0105237_10030233 3300009545 Bacteria 5504
356 Ga0105237_10125329 3300009545 Unclassified 2563
357 Ga0105237_10549065 3300009545 Bacteria 1162
358 Ga0105237_10549071 3300009545 Bacteria 1162
359 Ga0105238_10002471 3300009551 Bacteria 18498
360 Ga0105238_10048142 3300009551 Bacteria 4297
361 Ga0105238_10152756 3300009551 Bacteria 2283
362 Ga0105238_10245557 3300009551 Unclassified 1768
363 Ga0105249_10000611 3300009553 Bacteria 32583
364 Ga0105249_10001393 3300009553 Bacteria 21161
365 Ga0105249_10003278 3300009553 Bacteria 14028
366 Ga0105249_10007541 3300009553 Bacteria 9492
367 Ga0105249_10009892 3300009553 Bacteria 8360
368 Ga0105249_10020431 3300009553 Bacteria 5920
369 Ga0105249_10033619 3300009553 Bacteria 4643
370 Ga0105249_10070292 3300009553 Bacteria 3231
371 Ga0105249_10105146 3300009553 Bacteria 2661
372 Ga0105249_10137725 3300009553 Bacteria 2338
373 Ga0105249_10145097 3300009553 Bacteria 2279
374 Ga0105239_10000168 3300010375 Bacteria 94279
375 Ga0105239_10000389 3300010375 Bacteria 64422
376 Ga0105239_10001793 3300010375 Bacteria 28180
377 Ga0105239_10005636 3300010375 Bacteria 14630
378 Ga0105239_10015774 3300010375 Bacteria 8363
379 Ga0105239_10076602 3300010375 Bacteria 3679
380 Ga0105239_10094822 3300010375 Bacteria 3296
381 Ga0105239_10132477 3300010375 Bacteria 2773
382 Ga0105239_10476774 3300010375 Bacteria 1417
383 Ga0105239_10798789 3300010375 Bacteria 1081
384 Ga0105239_10798844 3300010375 Bacteria 1081
385 Ga0105246_10069270 3300011119 Bacteria 2477
386 Ga0157373_10004322 3300013100 Bacteria 10693
387 Ga0157373_10009768 3300013100 Bacteria 7077
388 Ga0157373_10019514 3300013100 Bacteria 4932
389 Ga0157373_10049703 3300013100 Bacteria 2987
390 Ga0157371_10001969 3300013102 Bacteria 20346
391 Ga0157371_10006030 3300013102 Bacteria 10089
392 Ga0157371_10013967 3300013102 Bacteria 6082
393 Ga0157371_10017177 3300013102 Bacteria 5380
394 Ga0157371_10017650 3300013102 Bacteria 5294
395 Ga0157371_10023509 3300013102 Bacteria 4507
396 Ga0157371_10029773 3300013102 Bacteria 3944
397 Ga0157371_10036079 3300013102 Bacteria 3541
398 Ga0157371_10037127 3300013102 Bacteria 3488
399 Ga0157371_10070527 3300013102 Unclassified 2474
400 Ga0157371_10198570 3300013102 Bacteria 1437
401 Ga0157370_10001108 3300013104 Bacteria 33740
402 Ga0157370_10002021 3300013104 Bacteria 24922
403 Ga0157370_10002515 3300013104 Bacteria 22060
404 Ga0157370_10007598 3300013104 Bacteria 11775
405 Ga0157370_10011826 3300013104 Bacteria 9107
406 Ga0157370_10015995 3300013104 Bacteria 7610
407 Ga0157370_10030199 3300013104 Bacteria 5312
408 Ga0157370_10033332 3300013104 Bacteria 5022
409 Ga0157370_10070858 3300013104 Bacteria 3290
410 Ga0157370_10114863 3300013104 Bacteria 2515
411 Ga0157370_10157384 3300013104 Bacteria 2114
412 Ga0157370_10337895 3300013104 Bacteria 1388
413 Ga0157369_10003424 3300013105 Bacteria 18822
414 Ga0157369_10014442 3300013105 Bacteria 8916
415 Ga0157369_10020053 3300013105 Bacteria 7477
416 Ga0157369_10078890 3300013105 Bacteria 3527
417 Ga0157369_10079976 3300013105 Bacteria 3500
418 Ga0157369_10554330 3300013105 Bacteria 1188
419 Ga0157374_10000002 3300013296 Bacteria 1054226
420 Ga0157374_10001246 3300013296 Bacteria 21704
421 Ga0157374_10006504 3300013296 Bacteria 9924
422 Ga0157374_10067003 3300013296 Bacteria 3374
423 Ga0157374_10131466 3300013296 Bacteria 2423
424 Ga0157374_10134001 3300013296 Bacteria 2400
425 Ga0157374_10167632 3300013296 Bacteria 2141
426 Ga0157374_10353653 3300013296 Bacteria 1460
427 Ga0157378_10002863 3300013297 Bacteria 15391
428 Ga0157378_10004467 3300013297 Bacteria 12284
429 Ga0157378_10006350 3300013297 Bacteria 10342
430 Ga0157378_10009594 3300013297 Bacteria 8429
431 Ga0157378_10041273 3300013297 Bacteria 4093
432 Ga0157378_10058116 3300013297 Bacteria 3449
433 Ga0157378_10091981 3300013297 Bacteria 2759
434 Ga0163162_10000040 3300013306 Bacteria 133855
435 Ga0163162_10000098 3300013306 Bacteria 78708
436 Ga0163162_10000195 3300013306 Bacteria 55910
437 Ga0163162_10000218 3300013306 Bacteria 52447
438 Ga0163162_10002166 3300013306 Bacteria 18429
439 Ga0163162_10002331 3300013306 Bacteria 17814
440 Ga0163162_10010308 3300013306 Bacteria 9082
441 Ga0163162_10017666 3300013306 Bacteria 6979
442 Ga0163162_10018925 3300013306 Bacteria 6752
443 Ga0163162_10027603 3300013306 Bacteria 5614
444 Ga0163162_10034004 3300013306 Bacteria 5070
445 Ga0163162_10039034 3300013306 Bacteria 4741
446 Ga0163162_10062017 3300013306 Bacteria 3778
447 Ga0163162_10084266 3300013306 Bacteria 3254
448 Ga0163162_10096316 3300013306 Bacteria 3047
449 Ga0163162_10338682 3300013306 Unclassified 1636
450 Ga0163162_10497799 3300013306 Bacteria 1349
451 Ga0157372_10004134 3300013307 Bacteria 15542
452 Ga0157372_10005788 3300013307 Bacteria 13169
453 Ga0157372_10007445 3300013307 Bacteria 11643
454 Ga0157372_10011126 3300013307 Bacteria 9570
455 Ga0157372_10063301 3300013307 Bacteria 4147
456 Ga0157372_10063967 3300013307 Bacteria 4127
457 Ga0157372_10064346 3300013307 Bacteria 4115
458 Ga0157372_10086194 3300013307 Bacteria 3563
459 Ga0157372_10088488 3300013307 Bacteria 3516
460 Ga0157372_10097871 3300013307 Bacteria 3347
461 Ga0157372_10119406 3300013307 Bacteria 3026
462 Ga0157372_10155316 3300013307 Bacteria 2643
463 Ga0157372_10155818 3300013307 Bacteria 2638
464 Ga0157372_10249265 3300013307 Bacteria 2061
465 Ga0157372_10263820 3300013307 Bacteria 2000
466 Ga0157372_10403776 3300013307 Bacteria 1592
467 Ga0157372_10832362 3300013307 Bacteria 1072
468 Ga0157375_10000270 3300013308 Bacteria 47166
469 Ga0157375_10001329 3300013308 Bacteria 21304
470 Ga0157375_10010648 3300013308 Bacteria 8098
471 Ga0157375_10076457 3300013308 Bacteria 3375
472 Ga0157375_10110874 3300013308 Bacteria 2842
473 Ga0157375_10134903 3300013308 Bacteria 2591
474 Ga0157375_10182420 3300013308 Bacteria 2251
475 Ga0157375_10360826 3300013308 Bacteria 1619
476 Ga0157375_10746276 3300013308 Bacteria 1130
477 Ga0157375_10768893 3300013308 Bacteria 1113
478 Ga0163163_10000110 3300014325 Bacteria 87033
479 Ga0163163_10001583 3300014325 Bacteria 19135
480 Ga0163163_10055346 3300014325 Bacteria 3921
481 Ga0163163_10157692 3300014325 Bacteria 2314
482 Ga0163163_10183379 3300014325 Bacteria 2140
483 Ga0163163_10681054 3300014325 Bacteria 1092
484 Ga0157380_10001610 3300014326 Bacteria 14874
485 Ga0157380_10007247 3300014326 Bacteria 7865
486 Ga0157380_10008348 3300014326 Bacteria 7385
487 Ga0157380_10337474 3300014326 Bacteria 1404
488 Ga0157377_10010555 3300014745 Bacteria 4572
489 Ga0157377_10014508 3300014745 Bacteria 4010
490 Ga0157377_10046578 3300014745 Bacteria 2426
491 Ga0157379_10000227 3300014968 Bacteria 44156
492 Ga0157379_10058661 3300014968 Bacteria 3442
493 Ga0157379_10189812 3300014968 Bacteria 1857
494 Ga0157376_10000161 3300014969 Bacteria 46915
495 Ga0157376_10001210 3300014969 Bacteria 17016
496 Ga0157376_10016392 3300014969 Bacteria 5624
497 Ga0157376_10016806 3300014969 Bacteria 5565
498 Ga0157376_10113505 3300014969 Unclassified 2389
499 Ga0157376_10122021 3300014969 Bacteria 2311
500 Ga0182005_1000215 3300015265 Bacteria 38214
501 Ga0163161_10050595 3300017792 Bacteria 3008
502 Ga0163161_10089795 3300017792 Unclassified 2273
503 Ga0163161_10135342 3300017792 Bacteria 1862
504 Ga0163161_10280184 3300017792 Bacteria 1307
505 Ga0213876_10001264 3300021384 Bacteria 15967
506 Ga0213876_10005277 3300021384 Bacteria 7117
507 Ga0213876_10150920 3300021384 Bacteria 1236
508 Ga0209436_103141 3300025208 Bacteria 4537
509 Ga0209436_107529 3300025208 Bacteria 2261
510 Ga0209563_104030 3300025230 Bacteria 2889
511 Ga0207427_100109 3300025231 Bacteria 116061
512 Ga0209437_100096 3300025233 Bacteria 233558
513 Ga0209258_100219 3300025242 Bacteria 108974
514 Ga0209646_1000002 3300025246 Bacteria 1425781
515 Ga0209646_1002373 3300025246 Bacteria 4217
516 Ga0209026_1001015 3300025250 Bacteria 13857
517 Ga0209148_1000283 3300025254 Bacteria 77780
518 Ga0209233_1000029 3300025261 Bacteria 641642
519 Ga0209233_1001254 3300025261 Bacteria 10199
520 Ga0209455_1010006 3300025272 Bacteria 2442
521 Ga0209673_1000082 3300025273 Bacteria 219716
522 Ga0209564_1018436 3300025295 Bacteria 2659
523 Ga0209758_1003398 3300025297 Bacteria 14538
524 Ga0209758_1005513 3300025297 Bacteria 9676
525 Ga0209050_1000389 3300025298 Bacteria 82517
526 Ga0207426_1000002 3300025302 Bacteria 1249660
527 Ga0207426_1000341 3300025302 Bacteria 87735
528 Ga0207426_1001921 3300025302 Bacteria 14980
529 Ga0207426_1002430 3300025302 Bacteria 11906
530 Ga0209257_1000001 3300025304 Bacteria 2274655
531 Ga0209257_1013981 3300025304 Bacteria 3500
532 Ga0207656_10002074 3300025321 Bacteria 6695
533 Ga0207656_10013332 3300025321 Bacteria 3140
534 Ga0207682_10030403 3300025893 Bacteria 2163
535 Ga0207642_10208408 3300025899 Bacteria 1084
536 Ga0207710_10009798 3300025900 Bacteria 4027
537 Ga0207710_10023325 3300025900 Unclassified 2658
538 Ga0207710_10072624 3300025900 Bacteria 1580
539 Ga0207680_10000071 3300025903 Bacteria 44839
540 Ga0207680_10018368 3300025903 Unclassified 3716
541 Ga0207680_10138670 3300025903 Bacteria 1610
542 Ga0207680_10160637 3300025903 Bacteria 1506
543 Ga0207647_10000135 3300025904 Bacteria 58247
544 Ga0207647_10000334 3300025904 Bacteria 38696
545 Ga0207647_10018962 3300025904 Bacteria 4635
546 Ga0207647_10165015 3300025904 Unclassified 1291
547 Ga0207645_10000625 3300025907 Bacteria 29328
548 Ga0207645_10004207 3300025907 Bacteria 10688
549 Ga0207645_10006543 3300025907 Bacteria 8341
550 Ga0207643_10033835 3300025908 Bacteria 2860
551 Ga0207643_10050031 3300025908 Bacteria 2369
552 Ga0207705_10006613 3300025909 Bacteria 8578
553 Ga0207705_10014850 3300025909 Bacteria 5600
554 Ga0207705_10042955 3300025909 Bacteria 3246
555 Ga0207705_10058890 3300025909 Unclassified 2771
556 Ga0207705_10066958 3300025909 Bacteria 2599
557 Ga0207705_10068419 3300025909 Bacteria 2571
558 Ga0207705_10162671 3300025909 Bacteria 1677
559 Ga0207654_10001277 3300025911 Bacteria 13402
560 Ga0207654_10006848 3300025911 Bacteria 5737
561 Ga0207707_10000189 3300025912 Bacteria 65118
562 Ga0207707_10021111 3300025912 Bacteria 5691
563 Ga0207707_10175050 3300025912 Bacteria 1875
564 Ga0207707_10286225 3300025912 Bacteria 1426
565 Ga0207707_10289944 3300025912 Bacteria 1416
566 Ga0207695_10000020 3300025913 Bacteria 723025
567 Ga0207695_10000060 3300025913 Bacteria 360217
568 Ga0207695_10000185 3300025913 Bacteria 180225
569 Ga0207695_10000666 3300025913 Bacteria 67698
570 Ga0207695_10004754 3300025913 Bacteria 18373
571 Ga0207695_10005298 3300025913 Bacteria 17190
572 Ga0207695_10005845 3300025913 Bacteria 16163
573 Ga0207695_10021773 3300025913 Bacteria 7302
574 Ga0207695_10031202 3300025913 Bacteria 5850
575 Ga0207695_10065655 3300025913 Bacteria 3731
576 Ga0207671_10002226 3300025914 Bacteria 21038
577 Ga0207671_10002465 3300025914 Bacteria 19764
578 Ga0207671_10004248 3300025914 Bacteria 13797
579 Ga0207671_10008975 3300025914 Bacteria 8412
580 Ga0207671_10011253 3300025914 Bacteria 7300
581 Ga0207671_10012652 3300025914 Bacteria 6773
582 Ga0207671_10064967 3300025914 Bacteria 2713
583 Ga0207660_10011327 3300025917 Bacteria 5801
584 Ga0207660_10012341 3300025917 Bacteria 5589
585 Ga0207660_10099227 3300025917 Bacteria 2173
586 Ga0207662_10212135 3300025918 Bacteria 1257
587 Ga0207657_10013000 3300025919 Bacteria 8181
588 Ga0207657_10030780 3300025919 Bacteria 4866
589 Ga0207657_10043302 3300025919 Bacteria 3966
590 Ga0207657_10057852 3300025919 Bacteria 3339
591 Ga0207657_10060211 3300025919 Bacteria 3259
592 Ga0207657_10143447 3300025919 Bacteria 1950
593 Ga0207649_10040859 3300025920 Bacteria 2822
594 Ga0207652_10000101 3300025921 Bacteria 93033
595 Ga0207652_10000115 3300025921 Bacteria 87927
596 Ga0207652_10000755 3300025921 Bacteria 31094
597 Ga0207652_10001304 3300025921 Bacteria 22193
598 Ga0207652_10011671 3300025921 Bacteria 7088
599 Ga0207652_10050890 3300025921 Bacteria 3550
600 Ga0207652_10112039 3300025921 Bacteria 2420
601 Ga0207652_10396691 3300025921 Bacteria 1245
602 Ga0207681_10019330 3300025923 Bacteria 4303
603 Ga0207681_10152690 3300025923 Bacteria 1732
604 Ga0207694_10016278 3300025924 Bacteria 5612
605 Ga0207694_10204369 3300025924 Bacteria 1608
606 Ga0207650_10001994 3300025925 Bacteria 14309
607 Ga0207650_10006365 3300025925 Bacteria 8040
608 Ga0207650_10136377 3300025925 Bacteria 1925
609 Ga0207650_10141181 3300025925 Bacteria 1894
610 Ga0207650_10160298 3300025925 Bacteria 1782
611 Ga0207650_10264406 3300025925 Bacteria 1396
612 Ga0207659_10025460 3300025926 Bacteria 3976
613 Ga0207659_10034959 3300025926 Bacteria 3470
614 Ga0207659_10043006 3300025926 Bacteria 3170
615 Ga0207659_10067216 3300025926 Bacteria 2603
616 Ga0207659_10072728 3300025926 Unclassified 2515
617 Ga0207644_10004339 3300025931 Bacteria 9200
618 Ga0207644_10132359 3300025931 Bacteria 1911
619 Ga0207644_10178252 3300025931 Bacteria 1664
620 Ga0207644_10290710 3300025931 Bacteria 1314
621 Ga0207690_10139675 3300025932 Bacteria 1784
622 Ga0207690_10343035 3300025932 Bacteria 1179
623 Ga0207706_10005669 3300025933 Bacteria 11636
624 Ga0207706_10008123 3300025933 Bacteria 9686
625 Ga0207706_10018223 3300025933 Bacteria 6317
626 Ga0207706_10063078 3300025933 Bacteria 3263
627 Ga0207706_10085182 3300025933 Bacteria 2779
628 Ga0207706_10086907 3300025933 Bacteria 2749
629 Ga0207706_10255942 3300025933 Bacteria 1529
630 Ga0207686_10033450 3300025934 Bacteria 3070
631 Ga0207686_10060691 3300025934 Bacteria 2395
632 Ga0207686_10320008 3300025934 Bacteria 1159
633 Ga0207686_10429163 3300025934 Bacteria 1012
634 Ga0207709_10000021 3300025935 Bacteria 386722
635 Ga0207670_10007084 3300025936 Bacteria 6244
636 Ga0207670_10051555 3300025936 Bacteria 2763
637 Ga0207670_10087781 3300025936 Bacteria 2192
638 Ga0207669_10083075 3300025937 Bacteria 2058
639 Ga0207669_10199167 3300025937 Bacteria 1452
640 Ga0207704_10005379 3300025938 Bacteria 5900
641 Ga0207704_10005792 3300025938 Bacteria 5714
642 Ga0207704_10153868 3300025938 Bacteria 1627
643 Ga0207704_10188501 3300025938 Bacteria 1498
644 Ga0207691_10000013 3300025940 Bacteria 147349
645 Ga0207691_10016067 3300025940 Bacteria 7111
646 Ga0207691_10017254 3300025940 Bacteria 6847
647 Ga0207691_10028055 3300025940 Bacteria 5274
648 Ga0207691_10153565 3300025940 Bacteria 2023
649 Ga0207689_10002023 3300025942 Bacteria 19162
650 Ga0207689_10002982 3300025942 Bacteria 15620
651 Ga0207689_10009549 3300025942 Bacteria 8367
652 Ga0207689_10011551 3300025942 Bacteria 7564
653 Ga0207689_10013393 3300025942 Bacteria 7000
654 Ga0207689_10013488 3300025942 Bacteria 6981
655 Ga0207689_10039112 3300025942 Bacteria 3927
656 Ga0207689_10061632 3300025942 Bacteria 3085
657 Ga0207689_10165272 3300025942 Bacteria 1823
658 Ga0207689_10323469 3300025942 Bacteria 1280
659 Ga0207689_10550954 3300025942 Bacteria 968
660 Ga0207661_10008977 3300025944 Bacteria 7161
661 Ga0207661_10014203 3300025944 Bacteria 5829
662 Ga0207661_10032512 3300025944 Bacteria 4042
663 Ga0207661_10072673 3300025944 Bacteria 2814
664 Ga0207661_10136430 3300025944 Bacteria 2107
665 Ga0207661_10280593 3300025944 Bacteria 1489
666 Ga0207679_10001619 3300025945 Bacteria 14028
667 Ga0207679_10019198 3300025945 Bacteria 4590
668 Ga0207679_10045197 3300025945 Bacteria 3184
669 Ga0207679_10109911 3300025945 Bacteria 2173
670 Ga0207679_10372668 3300025945 Unclassified 1250
671 Ga0207679_10547503 3300025945 Unclassified 1038
672 Ga0207667_10000084 3300025949 Bacteria 152086
673 Ga0207667_10001142 3300025949 Bacteria 33351
674 Ga0207667_10001931 3300025949 Bacteria 25993
675 Ga0207667_10007792 3300025949 Bacteria 12802
676 Ga0207667_10036967 3300025949 Bacteria 5225
677 Ga0207667_10037238 3300025949 Bacteria 5202
678 Ga0207667_10039468 3300025949 Bacteria 5032
679 Ga0207667_10090643 3300025949 Bacteria 3159
680 Ga0207667_10126106 3300025949 Bacteria 2637
681 Ga0207667_10144378 3300025949 Bacteria 2450
682 Ga0207667_10296452 3300025949 Bacteria 1652
683 Ga0207667_10427817 3300025949 Bacteria 1347
684 Ga0207651_10004006 3300025960 Bacteria 7327
685 Ga0207651_10064614 3300025960 Bacteria 2562
686 Ga0207651_10112242 3300025960 Bacteria 2049
687 Ga0207651_10208136 3300025960 Bacteria 1572
688 Ga0207651_10240491 3300025960 Bacteria 1475
689 Ga0207712_10001375 3300025961 Bacteria 16660
690 Ga0207712_10007333 3300025961 Bacteria 6962
691 Ga0207712_10013688 3300025961 Bacteria 5201
692 Ga0207712_10142873 3300025961 Bacteria 1839
693 Ga0207712_10278320 3300025961 Bacteria 1364
694 Ga0207712_10296661 3300025961 Bacteria 1325
695 Ga0207712_10400196 3300025961 Bacteria 1154
696 Ga0207668_10000317 3300025972 Bacteria 31387
697 Ga0207668_10034770 3300025972 Bacteria 3350
698 Ga0207668_10049181 3300025972 Bacteria 2897
699 Ga0207668_10344458 3300025972 Bacteria 1244
700 Ga0207658_10000707 3300025986 Bacteria 28907
701 Ga0207658_10047852 3300025986 Bacteria 3132
702 Ga0207658_10195387 3300025986 Bacteria 1685
703 Ga0207658_10209618 3300025986 Bacteria 1632
704 Ga0207677_10000441 3300026023 Bacteria 28085
705 Ga0207677_10019567 3300026023 Bacteria 4092
706 Ga0207677_10042832 3300026023 Bacteria 3005
707 Ga0207677_10080118 3300026023 Bacteria 2338
708 Ga0207677_10160334 3300026023 Bacteria 1747
709 Ga0207677_10201204 3300026023 Bacteria 1583
710 Ga0207677_10539163 3300026023 Bacteria 1015
711 Ga0207703_10001988 3300026035 Bacteria 18032
712 Ga0207703_10025985 3300026035 Bacteria 4607
713 Ga0207703_10194928 3300026035 Bacteria 1797
714 Ga0207703_10328506 3300026035 Bacteria 1402
715 Ga0207639_10011824 3300026041 Bacteria 6069
716 Ga0207639_10014872 3300026041 Bacteria 5480
717 Ga0207639_10015280 3300026041 Bacteria 5412
718 Ga0207639_10021286 3300026041 Bacteria 4656
719 Ga0207639_10035701 3300026041 Bacteria 3679
720 Ga0207639_10055976 3300026041 Unclassified 3020
721 Ga0207639_10098188 3300026041 Bacteria 2360
722 Ga0207639_10126390 3300026041 Bacteria 2109
723 Ga0207639_10248291 3300026041 Bacteria 1551
724 Ga0207639_10334364 3300026041 Bacteria 1349
725 Ga0207678_10030051 3300026067 Bacteria 4743
726 Ga0207678_10152281 3300026067 Bacteria 1975
727 Ga0207678_10342685 3300026067 Unclassified 1288
728 Ga0207702_10040565 3300026078 Unclassified 3902
729 Ga0207702_10044771 3300026078 Bacteria 3720
730 Ga0207702_10096015 3300026078 Bacteria 2606
731 Ga0207641_10000215 3300026088 Bacteria 74812
732 Ga0207641_10002496 3300026088 Bacteria 16979
733 Ga0207641_10013258 3300026088 Bacteria 6760
734 Ga0207641_10014636 3300026088 Bacteria 6432
735 Ga0207641_10060436 3300026088 Bacteria 3230
736 Ga0207641_10084046 3300026088 Bacteria 2770
737 Ga0207641_10106425 3300026088 Bacteria 2479
738 Ga0207648_10000260 3300026089 Bacteria 57280
739 Ga0207648_10004821 3300026089 Bacteria 13757
740 Ga0207648_10014984 3300026089 Bacteria 7141
741 Ga0207648_10065199 3300026089 Bacteria 3175
742 Ga0207648_10139729 3300026089 Bacteria 2134
743 Ga0207648_10161934 3300026089 Bacteria 1976
744 Ga0207648_10267042 3300026089 Bacteria 1528
745 Ga0207648_10319586 3300026089 Bacteria 1395
746 Ga0207676_10006919 3300026095 Bacteria 8037
747 Ga0207676_10011538 3300026095 Bacteria 6319
748 Ga0207676_10058690 3300026095 Bacteria 3036
749 Ga0207676_10099758 3300026095 Bacteria 2404
750 Ga0207676_10100637 3300026095 Bacteria 2395
751 Ga0207676_10146334 3300026095 Bacteria 2030
752 Ga0207676_10197501 3300026095 Bacteria 1775
753 Ga0207674_10001616 3300026116 Bacteria 28994
754 Ga0207674_10013185 3300026116 Bacteria 9193
755 Ga0207674_10028191 3300026116 Bacteria 5930
756 Ga0207674_10042452 3300026116 Bacteria 4697
757 Ga0207674_10061815 3300026116 Bacteria 3784
758 Ga0207674_10072652 3300026116 Bacteria 3455
759 Ga0207674_10111798 3300026116 Bacteria 2706
760 Ga0207674_10161767 3300026116 Bacteria 2193
761 Ga0207674_10224624 3300026116 Bacteria 1826
762 Ga0207674_10453559 3300026116 Bacteria 1239
763 Ga0207675_100000051 3300026118 Bacteria 83288
764 Ga0207675_100005537 3300026118 Bacteria 12078
765 Ga0207675_100147742 3300026118 Bacteria 2236
766 Ga0207675_100155238 3300026118 Bacteria 2181
767 Ga0207675_100183409 3300026118 Bacteria 2005
768 Ga0207675_100596031 3300026118 Bacteria 1108
769 Ga0207683_10000737 3300026121 Bacteria 29767
770 Ga0207683_10011666 3300026121 Bacteria 7501
771 Ga0207683_10018947 3300026121 Bacteria 5873
772 Ga0207683_10032487 3300026121 Bacteria 4534
773 Ga0207683_10099803 3300026121 Unclassified 2591
774 Ga0207683_10135062 3300026121 Bacteria 2220
775 Ga0207683_10220853 3300026121 Bacteria 1727
776 Ga0207683_10414837 3300026121 Bacteria 1239
777 Ga0207698_10007914 3300026142 Bacteria 6695
778 Ga0207698_10009223 3300026142 Bacteria 6277
779 Ga0207698_10057441 3300026142 Bacteria 3011
780 Ga0207698_10088841 3300026142 Bacteria 2522
781 Ga0207698_10442622 3300026142 Bacteria 1252
782 Ga0268266_10000088 3300028379 Bacteria 199029
783 Ga0268266_10004617 3300028379 Bacteria 13142
784 Ga0268266_10225934 3300028379 Bacteria 1722
785 Ga0268265_10014141 3300028380 Bacteria 5439
786 Ga0268265_10091142 3300028380 Bacteria 2437
787 Ga0268265_10112740 3300028380 Bacteria 2224
788 Ga0268264_10000484 3300028381 Bacteria 52947
789 Ga0268264_10002345 3300028381 Bacteria 16737
790 Ga0268264_10004151 3300028381 Bacteria 12386
791 Ga0268264_10005368 3300028381 Bacteria 10853
792 Ga0268264_10008340 3300028381 Bacteria 8610
793 Ga0268264_10013534 3300028381 Bacteria 6718
794 Ga0268264_10016909 3300028381 Bacteria 5970
795 Ga0268264_10136402 3300028381 Bacteria 2182
796 Ga0307517_10016311 3300028786 Bacteria 9775
797 Ga0307515_10000001 3300028794 Bacteria 4259510
798 Ga0307515_10000380 3300028794 Bacteria 108537
799 Ga0265338_10240236 3300028800 Bacteria 1342
800 Ga0307511_10000114 3300030521 Bacteria 72895
801 Ga0316177_1060514 3300030731 Bacteria 16407
802 Ga0316176_1024039 3300030732 Bacteria 7407
803 Ga0316183_1147165 3300030742 Bacteria 25466
804 Ga0316181_1119078 3300030744 Bacteria 6546
805 Ga0265331_10018286 3300031250 Bacteria 3640
806 Ga0265327_10000054 3300031251 Bacteria 250337
807 Ga0265327_10000234 3300031251 Bacteria 112034
808 Ga0265327_10000383 3300031251 Bacteria 83372
809 Ga0265327_10025072 3300031251 Bacteria 3485
810 Ga0265327_10075700 3300031251 Bacteria 1674
811 Ga0307513_10153500 3300031456 Bacteria 2206
812 Ga0307509_10031930 3300031507 Bacteria 5807
813 Ga0307408_100003500 3300031548 Bacteria 10702
814 Ga0307408_100100685 3300031548 Bacteria 2201
815 Ga0265313_10080320 3300031595 Bacteria 1482
816 Ga0265314_10196571 3300031711 Bacteria 1195
817 Ga0307516_10002853 3300031730 Bacteria 22760
818 Ga0307518_10215144 3300031838 Bacteria 1261
819 Ga0307412_10001216 3300031911 Bacteria 14637
820 Ga0307412_10123698 3300031911 Bacteria 1867
821 Ga0307416_100019957 3300032002 Bacteria 4768
822 Ga0307416_100418867 3300032002 Bacteria 1383
823 Ga0307414_10030239 3300032004 Bacteria 3536
824 Ga0307415_100025922 3300032126 Bacteria 3689
825 Ga0307510_10000074 3300033180 Bacteria 75194
826 Ga0373947_0139535 3300035725 Bacteria 1554
827 Ga0373937_0107451 3300036401 Bacteria 2594
828 Ga0395899_0000526 3300037312 Bacteria 42013
829 Ga0395899_0010628 3300037312 Bacteria 7053
830 Ga0395899_0023419 3300037312 Bacteria 4676
831 Ga0395899_0025513 3300037312 Bacteria 4461
832 Ga0395899_0043291 3300037312 Bacteria 3359
833 Ga0395900_0021329 3300037418 Bacteria 6622
834 Ga0395900_0029525 3300037418 Bacteria 5624
835 Ga0395900_0035242 3300037418 Bacteria 5155
836 Ga0395900_0086004 3300037418 Bacteria 3231
837 Ga0395900_0111358 3300037418 Bacteria 2812
838 Ga0395900_0324329 3300037418 Bacteria 1519
839 Ga0395898_0004432 3300037466 Bacteria 15361
840 Ga0395898_0113622 3300037466 Bacteria 2595
841 Ga0395898_0139438 3300037466 Bacteria 2321
842 Ga0395898_0274594 3300037466 Bacteria 1607
843 Ga0395905_0000011 3300037471 Bacteria 424563
844 Ga0395905_0003517 3300037471 Bacteria 16707
845 Ga0395905_0109237 3300037471 Bacteria 2597
846 Ga0395901_0001764 3300038443 Bacteria 22313
847 Ga0395901_0008545 3300038443 Bacteria 10348
848 Ga0395901_0033645 3300038443 Bacteria 5293
849 Ga0395901_0059246 3300038443 Bacteria 3983
850 Ga0395901_0111225 3300038443 Bacteria 2876
851 Ga0395901_0185576 3300038443 Bacteria 2181
852 Ga0436365_0392399 3300039437 Bacteria 17533
853 Ga0436365_1478429 3300039437 Bacteria 2402
854 Ga0436365_1874674 3300039437 Bacteria 58580
855 Ga0439436_0012275 3300041404 Bacteria 2600
856 Ga0439439_0013754 3300041406 Bacteria 1963
857 Ga0451791_0134091 3300041451 Bacteria 1161
858 Ga0451853_0855199 3300041512 Bacteria 1771
859 Ga0439431_0001480 3300041997 Bacteria 5182
860 Ga0439431_0005371 3300041997 Bacteria 2827
861 Ga0439433_0030129 3300041999 Bacteria 1240
862 Ga0439449_0004630 3300042007 Bacteria 5311
863 Ga0439449_0040047 3300042007 Bacteria 1742
864 Ga0439449_0106270 3300042007 Bacteria 1039
865 Ga0439457_001745 3300042014 Bacteria 6435
866 Ga0439434_0004288 3300042435 Bacteria 4168
867 Ga0439444_0017163 3300042437 Bacteria 1240
868 Ga0451577_0000452 3300042876 Bacteria 71587
869 Ga0451577_0003071 3300042876 Bacteria 18889
870 Ga0451577_0035086 3300042876 Bacteria 4519
871 Ga0466969_0000259 3300044656 Bacteria 29035
872 Ga0466972_0000022 3300044658 Bacteria 193802
873 Ga0466972_0000061 3300044658 Bacteria 109075
874 Ga0466972_0007404 3300044658 Bacteria 5517
875 Ga0466972_0027866 3300044658 Bacteria 2792
876 Ga0453683_0209797 3300044673 Bacteria 1237
877 Ga0466966_0000064 3300044684 Bacteria 73424
878 Ga0466961_0239497 3300044693 Bacteria 1115
879 Ga0466964_0090424 3300044706 Bacteria 1331
880 Ga0453684_0099791 3300044712 Bacteria 3555
881 Ga0466971_0137741 3300044719 Bacteria 1136
882 Ga0466970_0002236 3300044765 Bacteria 9339
883 Ga0466970_0040032 3300044765 Bacteria 2488
884 Ga0466970_0199374 3300044765 Bacteria 1113
885 Ga0466957_0000176 3300044842 Bacteria 28557
886 Ga0466959_0000005 3300045049 Bacteria 213958
887 Ga0466959_0003437 3300045049 Bacteria 10362
888 Ga0466959_0013932 3300045049 Bacteria 5837
889 Ga0466959_0269271 3300045049 Bacteria 1171
890 Ga0466959_0274648 3300045049 Bacteria 1158
891 Ga0451576_0000012 3300045051 Bacteria 674684
892 Ga0451576_0360873 3300045051 Bacteria 1522
893 Ga0466958_0249006 3300045836 Bacteria 1136
894 Ga0466967_0165046 3300045976 Bacteria 2081
895 Ga0495580_0187742 3300046472 Bacteria 1426
896 Ga0495606_0011207 3300046507 Bacteria 7338
897 Ga0495652_0159840 3300046529 Bacteria 1751
898 Ga0495586_0019463 3300046535 Bacteria 3615
899 Ga0495587_0126356 3300046536 Bacteria 1463
900 Ga0495587_0138477 3300046536 Bacteria 1390
901 Ga0495598_0025332 3300046537 Bacteria 1617
902 Ga0495598_0036639 3300046537 Bacteria 1411
903 Ga0495645_0039596 3300046543 Bacteria 3438
904 Ga0495633_0000090 3300046558 Bacteria 122693
905 Ga0495668_0005493 3300046616 Bacteria 8566
906 Ga0495611_0000274 3300046648 Bacteria 35206
907 Ga0495625_0133646 3300046660 Bacteria 1679
908 Ga0495649_0058541 3300046694 Bacteria 2076
909 Ga0495636_0000025 3300047318 Bacteria 66081
910 Ga0495674_0043245 3300047319 Bacteria 4010
911 Ga0495672_0007135 3300047320 Bacteria 8457
912 Ga0495687_000010 3300047443 Bacteria 413735
913 Ga0495686_0010216 3300047472 Bacteria 6686
914 Ga0495686_0014315 3300047472 Bacteria 5463
915 Ga0495686_0040837 3300047472 Bacteria 2956
916 Ga0496102_0514579 3300048905 Bacteria 1119
917 Ga0496104_0257228 3300048907 Bacteria 1659
918 Ga0496109_0146911 3300048912 Unclassified 2206
919 Ga0496114_0008771 3300048917 Bacteria 8011
920 Ga0496114_0016633 3300048917 Bacteria 5931
921 Ga0496126_0014327 3300048929 Bacteria 8018
922 Ga0501032_0005312 3300049569 Bacteria 9580
923 Ga0501032_0021353 3300049569 Bacteria 4501
924 Ga0501032_0033518 3300049569 Bacteria 3518
925 Ga0501032_0051908 3300049569 Bacteria 2764
926 Ga0501032_0146349 3300049569 Bacteria 1555
927 Ga0501033_0127491 3300049570 Bacteria 1845
928 Ga0501034_0000114 3300049571 Bacteria 148505
929 Ga0501034_0007875 3300049571 Bacteria 11325
930 Ga0501034_0016959 3300049571 Bacteria 7466
931 Ga0501034_0175913 3300049571 Bacteria 2106
932 Ga0501034_0195373 3300049571 Bacteria 1983
933 Ga0501036_0015208 3300049572 Bacteria 6425
934 Ga0501036_0044603 3300049572 Bacteria 3756
935 Ga0501036_0152900 3300049572 Bacteria 1946
936 Ga0501037_0010355 3300049573 Bacteria 6842
937 Ga0501037_0015199 3300049573 Bacteria 5664
938 Ga0501037_0287910 3300049573 Bacteria 1143
939 Ga0501038_0017337 3300049574 Bacteria 6510
940 Ga0501038_0205698 3300049574 Bacteria 1577
941 Ga0501043_0002333 3300049579 Bacteria 16079
942 Ga0501043_0053274 3300049579 Bacteria 3177
943 Ga0501043_0121509 3300049579 Bacteria 2048
944 Ga0501046_0035195 3300049580 Bacteria 4036
945 Ga0501047_0046168 3300049581 Bacteria 4210
946 Ga0501047_0048142 3300049581 Bacteria 4117
947 Ga0501047_0052853 3300049581 Bacteria 3927
948 Ga0501048_0070471 3300049582 Bacteria 2469
949 Ga0501067_0078482 3300049583 Bacteria 1830
950 Ga0501068_0204217 3300049584 Bacteria 1254
951 Ga0501070_0060585 3300049586 Bacteria 3137
952 Ga0501070_0087505 3300049586 Bacteria 2578
953 Ga0501073_0025092 3300049589 Bacteria 4279
954 Ga0501074_0033974 3300049590 Bacteria 3697
955 Ga0501074_0125855 3300049590 Bacteria 1833
956 Ga0501074_0393641 3300049590 Bacteria 983
957 Ga0501202_000253 3300049652 Bacteria 7137
958 Ga0501223_013341 3300049663 Bacteria 1637
959 Ga0501227_032226 3300049665 Bacteria 1263
960 Ga0501238_010708 3300049671 Bacteria 1227
961 Ga0501225_0005918 3300049705 Bacteria 3579
962 Ga0501225_0010381 3300049705 Bacteria 2638
963 Ga0501080_0070803 3300049742 Bacteria 3243
964 Ga0501083_0002034 3300049744 Bacteria 13918
965 Ga0501083_0067456 3300049744 Bacteria 2381
966 Ga0501241_003979 3300049758 Bacteria 2781
967 Ga0501263_004778 3300049760 Bacteria 1509
968 Ga0501279_007199 3300049775 Bacteria 1476
969 Ga0501035_0032383 3300049822 Bacteria 4756
970 Ga0501035_0057022 3300049822 Bacteria 3483
971 Ga0501035_0080155 3300049822 Bacteria 2883
972 Ga0501035_0197693 3300049822 Bacteria 1726
973 Ga0501044_0000710 3300049823 Bacteria 40187
974 Ga0501044_0011248 3300049823 Bacteria 9702
975 Ga0501044_0045500 3300049823 Bacteria 4546
976 Ga0501044_0058640 3300049823 Bacteria 3947
977 Ga0501044_0071130 3300049823 Bacteria 3538
978 Ga0501044_0104578 3300049823 Bacteria 2845
979 Ga0501044_0119376 3300049823 Bacteria 2639
980 Ga0501044_0140585 3300049823 Bacteria 2403
981 Ga0501044_0234618 3300049823 Bacteria 1781
982 Ga0501044_0234809 3300049823 Bacteria 1780
983 Ga0501044_0258581 3300049823 Bacteria 1680
984 Ga0501204_001047 3300049850 Bacteria 2615
985 nmdc:mga0k408_74586_c1 3300050493 Bacteria 1982
986 nmdc:mga09592_267171_c1 3300050508 Bacteria 1484
987 nmdc:mga09592_97000_c1 3300050508 Bacteria 2523
988 nmdc:mga0qj67_51976_c1 3300050509 Bacteria 3242
989 nmdc:mga06r32_11744_c1 3300050510 Bacteria 7886
990 nmdc:mga06r32_407656_c1 3300050510 Bacteria 1341
991 nmdc:mga08y16_194397_c1 3300050511 Bacteria 2103
992 nmdc:mga08y16_28396_c1 3300050511 Bacteria 5898
993 nmdc:mga08y16_5492_c1 3300050511 Bacteria 13253
994 Ga0500578_0000303 3300053086 Bacteria 60307
995 Ga0500644_0000279 3300053088 Bacteria 28337
996 Ga0500644_0007453 3300053088 Bacteria 2850
997 Ga0500583_0000029 3300053092 Bacteria 107304
998 Ga0500583_0002060 3300053092 Bacteria 5951
999 Ga0500583_0011371 3300053092 Bacteria 3350
1000 Ga0500562_000007 3300053108 Bacteria 241755
1001 Ga0500569_029004 3300053109 Bacteria 1538
1002 Ga0500572_044168 3300053111 Bacteria 1305
1003 Ga0500594_0028006 3300053118 Bacteria 1463
1004 Ga0500642_0011532 3300053130 Bacteria 3166
1005 Ga0500652_054635 3300053131 Bacteria 1635
1006 Ga0500658_0013053 3300053134 Bacteria 3067
1007 Ga0500658_0094960 3300053134 Bacteria 1295
1008 Ga0500559_0038161 3300053136 Bacteria 2085
1009 Ga0500568_0009501 3300053139 Bacteria 4612
1010 Ga0500568_0058856 3300053139 Bacteria 1492
1011 Ga0500577_0039345 3300053142 Bacteria 1713
1012 Ga0500588_0000272 3300053146 Bacteria 7561
1013 Ga0500616_0006340 3300053153 Bacteria 7765
1014 Ga0500616_0016011 3300053153 Bacteria 4278
1015 Ga0500616_0094989 3300053153 Bacteria 1468
1016 Ga0500622_0000575 3300053156 Bacteria 33359
1017 Ga0500622_0047165 3300053156 Bacteria 2226
1018 Ga0500627_0023387 3300053158 Bacteria 2519
1019 Ga0500634_0163381 3300053161 Bacteria 1025
1020 Ga0500611_000050 3300053727 Bacteria 54600
1021 Ga0500645_025303 3300053730 Bacteria 1811
1022 Ga0501084_0002535 3300054114 Bacteria 14724
1023 Ga0466962_0014785 3300061719 Bacteria 3761

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053134 Ga0500658_0094960 Ga0500658_0094960_13_891 280
2 3300009174 Ga0105241_10247853 Ga0105241_102478532 283
3 3300049744 Ga0501083_0067456 Ga0501083_0067456_1515_2366 283
4 3300049823 Ga0501044_0058640 Ga0501044_0058640_37_888 283
5 3300045049 Ga0466959_0269271 Ga0466959_0269271_20_874 284
6 3300049569 Ga0501032_0005312 Ga0501032_0005312_8642_9505 284
7 iso_pu_bacteria 2890804823 2890806612 284
8 3300049569 Ga0501032_0146349 Ga0501032_0146349_651_1517 285
9 3300005466 Ga0070685_10024029 Ga0070685_100240293 286
10 3300026116 Ga0207674_10161767 Ga0207674_101617671 286
11 3300042876 Ga0451577_0000452 Ga0451577_0000452_56561_57439 286
12 3300006881 Ga0068865_100169316 Ga0068865_1001693162 287
13 3300009176 Ga0105242_10061247 Ga0105242_100612473 287
14 3300037418 Ga0395900_0035242 Ga0395900_0035242_2481_3356 287
15 3300037471 Ga0395905_0000011 Ga0395905_0000011_187256_188125 288
16 3300049823 Ga0501044_0258581 Ga0501044_0258581_237_1115 288
17 iso_pu_bacteria 2842903701 2842908755 288
18 iso_pu_bacteria 2890737413 2890737482 288
19 iso_pu_bacteria 2896317667 2896321037 288
20 iso_pu_bacteria 2896344016 2896346191 288
21 iso_pu_bacteria 8055588893 8055591989 288
22 3300045051 Ga0451576_0000012 Ga0451576_0000012_472136_473017 289
23 3300005289 Ga0065704_10071485 Ga0065704_100714853 290
24 3300013102 Ga0157371_10023509 Ga0157371_100235093 290
25 3300049850 Ga0501204_001047 Ga0501204_001047_525_1406 290
26 3300002737 JGI25162J39368_1000596 JGI25162J39368_10005969 291
27 3300002772 JGI25164J39214_1001152 JGI25164J39214_10011525 291
28 3300003214 JGI25165J46597_1000658 JGI25165J46597_10006589 291
29 3300003323 rootH1_10005386 rootH1_1000538617 291
30 3300005339 Ga0070660_100039939 Ga0070660_1000399393 291
31 3300005366 Ga0070659_100000094 Ga0070659_10000009410 291
32 3300005577 Ga0068857_100048407 Ga0068857_1000484073 291
33 3300013104 Ga0157370_10007598 Ga0157370_1000759810 291
34 3300013104 Ga0157370_10070858 Ga0157370_100708583 291
35 3300013307 Ga0157372_10004134 Ga0157372_100041345 291
36 3300025230 Ga0209563_104030 Ga0209563_1040304 291
37 3300025231 Ga0207427_100109 Ga0207427_10010922 291
38 3300025233 Ga0209437_100096 Ga0209437_100096129 291
39 3300025261 Ga0209233_1000029 Ga0209233_1000029505 291
40 3300025261 Ga0209233_1001254 Ga0209233_10012546 291
41 3300025904 Ga0207647_10000135 Ga0207647_100001354 291
42 3300025919 Ga0207657_10060211 Ga0207657_100602114 291
43 3300026116 Ga0207674_10061815 Ga0207674_100618153 291
44 3300031250 Ga0265331_10018286 Ga0265331_100182862 291
45 3300031711 Ga0265314_10196571 Ga0265314_101965711 291
46 3300046660 Ga0495625_0133646 Ga0495625_0133646_38_916 291
47 3300046694 Ga0495649_0058541 Ga0495649_0058541_267_1145 291
48 3300025272 Ga0209455_1010006 Ga0209455_10100063 292
49 3300025935 Ga0207709_10000021 Ga0207709_10000021304 292
50 3300025961 Ga0207712_10400196 Ga0207712_104001962 292
51 3300030731 Ga0316177_1060514 Ga0316177_106051410 292
52 3300030732 Ga0316176_1024039 Ga0316176_10240394 292
53 3300030742 Ga0316183_1147165 Ga0316183_114716511 292
54 3300030744 Ga0316181_1119078 Ga0316181_11190784 292
55 3300032004 Ga0307414_10030239 Ga0307414_100302392 292
56 iso_pu_bacteria 2840677318 2840677602 292
57 iso_pu_bacteria 2883068021 2883072982 292
58 iso_pu_bacteria 2896085136 2896085420 292
59 iso_pu_bacteria 2896109856 2896113606 292
60 3300005563 Ga0068855_100000108 Ga0068855_10000010851 293
61 3300009093 Ga0105240_10006830 Ga0105240_100068306 293
62 3300013105 Ga0157369_10014442 Ga0157369_100144422 293
63 3300013296 Ga0157374_10000002 Ga0157374_10000002662 293
64 3300025913 Ga0207695_10000060 Ga0207695_10000060155 293
65 3300025944 Ga0207661_10014203 Ga0207661_100142034 293
66 3300025949 Ga0207667_10000084 Ga0207667_1000008492 293
67 iso_pu_bacteria 2929921140 2929923399 293
68 iso_pu_bacteria 8003151029 8003152801 293
69 3300046558 Ga0495633_0000090 Ga0495633_0000090_66179_67102 294
70 iso_pu_bacteria 2818991460 2819680510 294
71 iso_pu_bacteria 2884791551 2884798079 294
72 iso_pu_bacteria 2929177148 2929182803 294
73 iso_pu_bacteria 2945977869 2945978758 294
74 iso_pu_bacteria 2946013367 2946015375 294
75 3300031548 Ga0307408_100003500 Ga0307408_1000035006 295
76 3300031911 Ga0307412_10001216 Ga0307412_100012168 295
77 iso_pu_bacteria 2818991442 2819573762 295
78 iso_pu_bacteria 2821136567 2821137097 295
79 iso_pu_bacteria 2904467357 2904468161 295
80 iso_pu_bacteria 2929239360 2929241379 295
81 3300003203 JGI25406J46586_10000275 JGI25406J46586_1000027530 296
82 3300003320 rootH2_10030616 rootH2_100306164 296
83 3300005289 Ga0065704_10075586 Ga0065704_100755863 296
84 3300005329 Ga0070683_100109411 Ga0070683_1001094112 296
85 3300005336 Ga0070680_100035429 Ga0070680_1000354293 296
86 3300005336 Ga0070680_100122572 Ga0070680_1001225721 296
87 3300005339 Ga0070660_100107619 Ga0070660_1001076192 296
88 3300005339 Ga0070660_100178122 Ga0070660_1001781222 296
89 3300005458 Ga0070681_10080678 Ga0070681_100806782 296
90 3300005530 Ga0070679_100191107 Ga0070679_1001911072 296
91 3300005577 Ga0068857_100220657 Ga0068857_1002206572 296
92 3300005985 Ga0081539_10000916 Ga0081539_1000091643 296
93 3300025909 Ga0207705_10066958 Ga0207705_100669583 296
94 3300025917 Ga0207660_10012341 Ga0207660_100123416 296
95 3300025919 Ga0207657_10030780 Ga0207657_100307804 296
96 3300025921 Ga0207652_10011671 Ga0207652_100116714 296
97 3300025921 Ga0207652_10112039 Ga0207652_101120392 296
98 3300025933 Ga0207706_10085182 Ga0207706_100851821 296
99 3300026116 Ga0207674_10042452 Ga0207674_100424521 296
100 3300041997 Ga0439431_0001480 Ga0439431_0001480_3568_4461 296
101 3300049671 Ga0501238_010708 Ga0501238_010708_70_963 296
102 3300001979 JGI24740J21852_10000968 JGI24740J21852_1000096811 297
103 3300001979 JGI24740J21852_10003566 JGI24740J21852_100035664 297
104 3300001989 JGI24739J22299_10002248 JGI24739J22299_100022485 297
105 3300002738 JGI25154J39366_1000007 JGI25154J39366_100000764 297
106 3300003215 JGI25153J46596_10001828 JGI25153J46596_100018284 297
107 3300003320 rootH2_10047541 rootH2_100475413 297
108 3300003354 JGI25160J50197_1003166 JGI25160J50197_10031664 297
109 3300003354 JGI25160J50197_1007598 JGI25160J50197_10075984 297
110 3300003771 Ga0055526_1007853 Ga0055526_10078535 297
111 3300003771 Ga0055526_1030696 Ga0055526_10306962 297
112 3300003790 Ga0055528_1000988 Ga0055528_10009885 297
113 3300003791 Ga0055530_10003312 Ga0055530_100033126 297
114 3300004625 Ga0055543_1010640 Ga0055543_10106402 297
115 3300005262 Ga0065165_1000010 Ga0065165_1000010208 297
116 3300006195 Ga0075366_10014716 Ga0075366_100147163 297
117 3300025246 Ga0209646_1000002 Ga0209646_1000002669 297
118 3300025250 Ga0209026_1001015 Ga0209026_100101510 297
119 3300025273 Ga0209673_1000082 Ga0209673_1000082181 297
120 3300025295 Ga0209564_1018436 Ga0209564_10184363 297
121 3300025297 Ga0209758_1003398 Ga0209758_10033989 297
122 3300025297 Ga0209758_1005513 Ga0209758_10055135 297
123 3300025298 Ga0209050_1000389 Ga0209050_100038943 297
124 3300025302 Ga0207426_1001921 Ga0207426_10019215 297
125 3300025302 Ga0207426_1002430 Ga0207426_100243012 297
126 3300025304 Ga0209257_1013981 Ga0209257_10139813 297
127 3300045049 Ga0466959_0013932 Ga0466959_0013932_273_1169 297
128 3300049571 Ga0501034_0016959 Ga0501034_0016959_5555_6451 297
129 3300049581 Ga0501047_0046168 Ga0501047_0046168_2686_3582 297
130 3300049823 Ga0501044_0234618 Ga0501044_0234618_281_1177 297
131 3300053131 Ga0500652_054635 Ga0500652_054635_340_1236 297
132 3300053139 Ga0500568_0058856 Ga0500568_0058856_67_963 297
133 3300003323 rootH1_10046794 rootH1_1004679412 298
134 3300003354 JGI25160J50197_1008935 JGI25160J50197_10089353 298
135 3300005530 Ga0070679_100000517 Ga0070679_10000051723 298
136 3300025208 Ga0209436_107529 Ga0209436_1075292 298
137 3300025302 Ga0207426_1000341 Ga0207426_100034124 298
138 3300025909 Ga0207705_10068419 Ga0207705_100684194 298
139 3300025919 Ga0207657_10057852 Ga0207657_100578524 298
140 3300025921 Ga0207652_10000101 Ga0207652_1000010127 298
141 3300025921 Ga0207652_10396691 Ga0207652_103966912 298
142 3300044693 Ga0466961_0239497 Ga0466961_0239497_95_1000 298
143 3300044765 Ga0466970_0040032 Ga0466970_0040032_39_962 298
144 3300045049 Ga0466959_0003437 Ga0466959_0003437_3230_4135 298
145 3300045836 Ga0466958_0249006 Ga0466958_0249006_164_1069 298
146 3300048929 Ga0496126_0014327 Ga0496126_0014327_894_1808 298
147 3300049570 Ga0501033_0127491 Ga0501033_0127491_138_1037 298
148 3300049758 Ga0501241_003979 Ga0501241_003979_381_1295 298
149 3300049823 Ga0501044_0140585 Ga0501044_0140585_1188_2099 298
150 3300061719 Ga0466962_0014785 Ga0466962_0014785_883_1788 298
151 3300003320 rootH2_10004243 rootH2_1000424326 299
152 3300003320 rootH2_10005337 rootH2_1000533711 299
153 3300003322 rootL2_10048891 rootL2_1004889110 299
154 3300003323 rootH1_10015480 rootH1_100154802 299
155 3300005327 Ga0070658_10060899 Ga0070658_100608992 299
156 3300005329 Ga0070683_100011766 Ga0070683_1000117665 299
157 3300005338 Ga0068868_100103426 Ga0068868_1001034262 299
158 3300005353 Ga0070669_100030583 Ga0070669_1000305832 299
159 3300005458 Ga0070681_10075040 Ga0070681_100750404 299
160 3300005535 Ga0070684_100001898 Ga0070684_1000018982 299
161 3300005539 Ga0068853_100446129 Ga0068853_1004461291 299
162 3300005548 Ga0070665_100000031 Ga0070665_100000031138 299
163 3300005563 Ga0068855_100011616 Ga0068855_1000116163 299
164 3300005614 Ga0068856_100609209 Ga0068856_1006092091 299
165 3300005843 Ga0068860_100000072 Ga0068860_100000072138 299
166 3300005843 Ga0068860_100003468 Ga0068860_1000034689 299
167 3300006237 Ga0097621_100209802 Ga0097621_1002098022 299
168 3300006358 Ga0068871_100249293 Ga0068871_1002492932 299
169 3300009093 Ga0105240_10168037 Ga0105240_101680372 299
170 3300009174 Ga0105241_10284903 Ga0105241_102849032 299
171 3300009174 Ga0105241_10502553 Ga0105241_105025531 299
172 3300009545 Ga0105237_10005933 Ga0105237_100059333 299
173 3300009545 Ga0105237_10007237 Ga0105237_100072376 299
174 3300009545 Ga0105237_10026297 Ga0105237_100262975 299
175 3300009545 Ga0105237_10030233 Ga0105237_100302334 299
176 3300009545 Ga0105237_10549065 Ga0105237_105490651 299
177 3300009545 Ga0105237_10549071 Ga0105237_105490711 299
178 3300009551 Ga0105238_10002471 Ga0105238_100024713 299
179 3300009551 Ga0105238_10152756 Ga0105238_101527562 299
180 3300009553 Ga0105249_10105146 Ga0105249_101051462 299
181 3300010375 Ga0105239_10000168 Ga0105239_1000016837 299
182 3300010375 Ga0105239_10076602 Ga0105239_100766022 299
183 3300010375 Ga0105239_10094822 Ga0105239_100948223 299
184 3300010375 Ga0105239_10798789 Ga0105239_107987891 299
185 3300010375 Ga0105239_10798844 Ga0105239_107988441 299
186 3300013102 Ga0157371_10036079 Ga0157371_100360792 299
187 3300013104 Ga0157370_10015995 Ga0157370_100159956 299
188 3300013105 Ga0157369_10020053 Ga0157369_100200534 299
189 3300013306 Ga0163162_10000218 Ga0163162_1000021812 299
190 3300013307 Ga0157372_10005788 Ga0157372_100057882 299
191 3300013307 Ga0157372_10088488 Ga0157372_100884883 299
192 3300015265 Ga0182005_1000215 Ga0182005_100021515 299
193 3300025208 Ga0209436_103141 Ga0209436_1031414 299
194 3300025909 Ga0207705_10042955 Ga0207705_100429552 299
195 3300025911 Ga0207654_10006848 Ga0207654_100068484 299
196 3300025912 Ga0207707_10175050 Ga0207707_101750502 299
197 3300025912 Ga0207707_10286225 Ga0207707_102862252 299
198 3300025913 Ga0207695_10005845 Ga0207695_1000584512 299
199 3300025913 Ga0207695_10021773 Ga0207695_100217733 299
200 3300025914 Ga0207671_10002465 Ga0207671_1000246514 299
201 3300025914 Ga0207671_10008975 Ga0207671_100089754 299
202 3300025914 Ga0207671_10011253 Ga0207671_100112536 299
203 3300025914 Ga0207671_10012652 Ga0207671_100126522 299
204 3300025924 Ga0207694_10016278 Ga0207694_100162785 299
205 3300025949 Ga0207667_10007792 Ga0207667_100077925 299
206 3300025949 Ga0207667_10039468 Ga0207667_100394682 299
207 3300025949 Ga0207667_10427817 Ga0207667_104278172 299
208 3300026041 Ga0207639_10334364 Ga0207639_103343641 299
209 3300028379 Ga0268266_10000088 Ga0268266_1000008831 299
210 3300028380 Ga0268265_10091142 Ga0268265_100911422 299
211 3300028381 Ga0268264_10000484 Ga0268264_1000048433 299
212 3300028381 Ga0268264_10004151 Ga0268264_100041512 299
213 3300030521 Ga0307511_10000114 Ga0307511_1000011453 299
214 3300038443 Ga0395901_0033645 Ga0395901_0033645_1504_2436 299
215 3300041997 Ga0439431_0005371 Ga0439431_0005371_345_1265 299
216 3300044658 Ga0466972_0027866 Ga0466972_0027866_14_958 299
217 3300046507 Ga0495606_0011207 Ga0495606_0011207_212_1159 299
218 3300046648 Ga0495611_0000274 Ga0495611_0000274_12026_13012 299
219 3300047443 Ga0495687_000010 Ga0495687_000010_307174_308151 299
220 3300049571 Ga0501034_0000114 Ga0501034_0000114_83079_84002 299
221 3300049571 Ga0501034_0175913 Ga0501034_0175913_570_1499 299
222 3300049586 Ga0501070_0060585 Ga0501070_0060585_1005_1934 299
223 3300049822 Ga0501035_0057022 Ga0501035_0057022_2233_3162 299
224 3300049822 Ga0501035_0080155 Ga0501035_0080155_331_1269 299
225 3300003794 Ga0055531_10000020 Ga0055531_1000002082 300
226 3300005293 Ga0065715_10002738 Ga0065715_100027384 300
227 3300005328 Ga0070676_10085670 Ga0070676_100856703 300
228 3300005331 Ga0070670_100092222 Ga0070670_1000922222 300
229 3300005334 Ga0068869_100009134 Ga0068869_1000091342 300
230 3300005334 Ga0068869_100035957 Ga0068869_1000359571 300
231 3300005338 Ga0068868_100035971 Ga0068868_1000359714 300
232 3300005340 Ga0070689_100108190 Ga0070689_1001081903 300
233 3300005344 Ga0070661_100059071 Ga0070661_1000590711 300
234 3300005353 Ga0070669_100069770 Ga0070669_1000697702 300
235 3300005354 Ga0070675_100017583 Ga0070675_1000175836 300
236 3300005456 Ga0070678_100236596 Ga0070678_1002365961 300
237 3300005466 Ga0070685_10005845 Ga0070685_100058457 300
238 3300005466 Ga0070685_10302564 Ga0070685_103025641 300
239 3300005471 Ga0070698_100001455 Ga0070698_10000145515 300
240 3300005471 Ga0070698_100002086 Ga0070698_10000208620 300
241 3300005471 Ga0070698_100013153 Ga0070698_10001315313 300
242 3300005539 Ga0068853_100281613 Ga0068853_1002816132 300
243 3300005543 Ga0070672_100024616 Ga0070672_1000246164 300
244 3300005544 Ga0070686_100253933 Ga0070686_1002539331 300
245 3300005564 Ga0070664_100025584 Ga0070664_1000255844 300
246 3300005617 Ga0068859_100140410 Ga0068859_1001404104 300
247 3300005617 Ga0068859_100162689 Ga0068859_1001626891 300
248 3300005840 Ga0068870_10007343 Ga0068870_100073434 300
249 3300005843 Ga0068860_100002670 Ga0068860_1000026709 300
250 3300005844 Ga0068862_100010336 Ga0068862_1000103362 300
251 3300006844 Ga0075428_100155215 Ga0075428_1001552152 300
252 3300006931 Ga0097620_100140423 Ga0097620_1001404234 300
253 3300006931 Ga0097620_100162695 Ga0097620_1001626953 300
254 3300009093 Ga0105240_10000991 Ga0105240_1000099147 300
255 3300009553 Ga0105249_10000611 Ga0105249_1000061125 300
256 3300009553 Ga0105249_10137725 Ga0105249_101377252 300
257 3300009553 Ga0105249_10145097 Ga0105249_101450971 300
258 3300010375 Ga0105239_10001793 Ga0105239_100017932 300
259 3300013102 Ga0157371_10017177 Ga0157371_100171774 300
260 3300013104 Ga0157370_10002021 Ga0157370_1000202122 300
261 3300013105 Ga0157369_10003424 Ga0157369_100034242 300
262 3300013297 Ga0157378_10006350 Ga0157378_100063502 300
263 3300013306 Ga0163162_10034004 Ga0163162_100340044 300
264 3300013308 Ga0157375_10134903 Ga0157375_101349032 300
265 3300014745 Ga0157377_10010555 Ga0157377_100105554 300
266 3300014745 Ga0157377_10046578 Ga0157377_100465784 300
267 3300017792 Ga0163161_10280184 Ga0163161_102801841 300
268 3300025242 Ga0209258_100219 Ga0209258_10021995 300
269 3300025254 Ga0209148_1000283 Ga0209148_100028365 300
270 3300025304 Ga0209257_1000001 Ga0209257_10000011302 300
271 3300025904 Ga0207647_10000334 Ga0207647_100003343 300
272 3300025913 Ga0207695_10000666 Ga0207695_100006664 300
273 3300025923 Ga0207681_10152690 Ga0207681_101526903 300
274 3300025925 Ga0207650_10006365 Ga0207650_100063652 300
275 3300025926 Ga0207659_10067216 Ga0207659_100672162 300
276 3300025934 Ga0207686_10429163 Ga0207686_104291631 300
277 3300025938 Ga0207704_10153868 Ga0207704_101538681 300
278 3300025938 Ga0207704_10188501 Ga0207704_101885012 300
279 3300025940 Ga0207691_10016067 Ga0207691_100160673 300
280 3300025940 Ga0207691_10153565 Ga0207691_101535652 300
281 3300025942 Ga0207689_10013488 Ga0207689_100134888 300
282 3300025942 Ga0207689_10039112 Ga0207689_100391121 300
283 3300025942 Ga0207689_10165272 Ga0207689_101652722 300
284 3300025945 Ga0207679_10045197 Ga0207679_100451974 300
285 3300025960 Ga0207651_10208136 Ga0207651_102081362 300
286 3300025961 Ga0207712_10007333 Ga0207712_100073337 300
287 3300025961 Ga0207712_10278320 Ga0207712_102783202 300
288 3300026023 Ga0207677_10080118 Ga0207677_100801183 300
289 3300026035 Ga0207703_10328506 Ga0207703_103285062 300
290 3300026041 Ga0207639_10098188 Ga0207639_100981881 300
291 3300026041 Ga0207639_10126390 Ga0207639_101263902 300
292 3300026041 Ga0207639_10248291 Ga0207639_102482913 300
293 3300026095 Ga0207676_10146334 Ga0207676_101463342 300
294 3300026118 Ga0207675_100147742 Ga0207675_1001477422 300
295 3300026121 Ga0207683_10135062 Ga0207683_101350621 300
296 3300026121 Ga0207683_10414837 Ga0207683_104148372 300
297 3300026142 Ga0207698_10088841 Ga0207698_100888412 300
298 3300028380 Ga0268265_10112740 Ga0268265_101127403 300
299 3300028381 Ga0268264_10136402 Ga0268264_101364022 300
300 3300028786 Ga0307517_10016311 Ga0307517_100163114 300
301 3300031730 Ga0307516_10002853 Ga0307516_100028534 300
302 3300044706 Ga0466964_0090424 Ga0466964_0090424_262_1227 300
303 3300044765 Ga0466970_0199374 Ga0466970_0199374_75_1040 300
304 3300046537 Ga0495598_0036639 Ga0495598_0036639_15_920 300
305 3300049569 Ga0501032_0051908 Ga0501032_0051908_114_1043 300
306 3300049574 Ga0501038_0205698 Ga0501038_0205698_98_1027 300
307 3300049590 Ga0501074_0393641 Ga0501074_0393641_14_931 300
308 3300049823 Ga0501044_0234809 Ga0501044_0234809_590_1519 300
309 3300053088 Ga0500644_0000279 Ga0500644_0000279_6261_7187 300
310 3300053092 Ga0500583_0002060 Ga0500583_0002060_1864_2790 300
311 3300053109 Ga0500569_029004 Ga0500569_029004_206_1132 300
312 3300053134 Ga0500658_0013053 Ga0500658_0013053_650_1576 300
313 3300053136 Ga0500559_0038161 Ga0500559_0038161_612_1538 300
314 3300053142 Ga0500577_0039345 Ga0500577_0039345_240_1166 300
315 3300053161 Ga0500634_0163381 Ga0500634_0163381_76_981 300
316 3300005290 Ga0065712_10075331 Ga0065712_100753314 301
317 3300005327 Ga0070658_10153952 Ga0070658_101539522 301
318 3300005327 Ga0070658_10232729 Ga0070658_102327292 301
319 3300005327 Ga0070658_10306739 Ga0070658_103067391 301
320 3300005328 Ga0070676_10012612 Ga0070676_100126122 301
321 3300005329 Ga0070683_100005468 Ga0070683_10000546811 301
322 3300005329 Ga0070683_100134591 Ga0070683_1001345913 301
323 3300005331 Ga0070670_100033516 Ga0070670_1000335165 301
324 3300005331 Ga0070670_100133511 Ga0070670_1001335112 301
325 3300005334 Ga0068869_100009581 Ga0068869_1000095816 301
326 3300005335 Ga0070666_10068064 Ga0070666_100680642 301
327 3300005338 Ga0068868_100005380 Ga0068868_1000053808 301
328 3300005339 Ga0070660_100012924 Ga0070660_1000129242 301
329 3300005343 Ga0070687_100046413 Ga0070687_1000464131 301
330 3300005355 Ga0070671_100173865 Ga0070671_1001738652 301
331 3300005364 Ga0070673_100184515 Ga0070673_1001845152 301
332 3300005365 Ga0070688_100143379 Ga0070688_1001433791 301
333 3300005365 Ga0070688_100287467 Ga0070688_1002874672 301
334 3300005457 Ga0070662_100018400 Ga0070662_1000184002 301
335 3300005458 Ga0070681_10001202 Ga0070681_100012024 301
336 3300005458 Ga0070681_10129116 Ga0070681_101291163 301
337 3300005466 Ga0070685_10041467 Ga0070685_100414673 301
338 3300005468 Ga0070707_100304386 Ga0070707_1003043861 301
339 3300005530 Ga0070679_100075259 Ga0070679_1000752592 301
340 3300005535 Ga0070684_100170174 Ga0070684_1001701742 301
341 3300005539 Ga0068853_100045232 Ga0068853_1000452324 301
342 3300005563 Ga0068855_100002288 Ga0068855_10000228816 301
343 3300005563 Ga0068855_100003623 Ga0068855_1000036234 301
344 3300005563 Ga0068855_100048795 Ga0068855_1000487952 301
345 3300005563 Ga0068855_100059036 Ga0068855_1000590362 301
346 3300005564 Ga0070664_100008481 Ga0070664_1000084817 301
347 3300005564 Ga0070664_100148947 Ga0070664_1001489472 301
348 3300005564 Ga0070664_100611541 Ga0070664_1006115411 301
349 3300005577 Ga0068857_100184502 Ga0068857_1001845022 301
350 3300005614 Ga0068856_100030624 Ga0068856_1000306244 301
351 3300005618 Ga0068864_100313369 Ga0068864_1003133692 301
352 3300006844 Ga0075428_100029082 Ga0075428_1000290825 301
353 3300006846 Ga0075430_100004519 Ga0075430_10000451910 301
354 3300006847 Ga0075431_100006988 Ga0075431_10000698813 301
355 3300009093 Ga0105240_10076121 Ga0105240_100761212 301
356 3300009094 Ga0111539_10036996 Ga0111539_100369967 301
357 3300009147 Ga0114129_10173933 Ga0114129_101739332 301
358 3300009553 Ga0105249_10009892 Ga0105249_100098924 301
359 3300013100 Ga0157373_10004322 Ga0157373_1000432211 301
360 3300013100 Ga0157373_10019514 Ga0157373_100195144 301
361 3300013102 Ga0157371_10001969 Ga0157371_100019692 301
362 3300013102 Ga0157371_10006030 Ga0157371_100060304 301
363 3300013102 Ga0157371_10013967 Ga0157371_100139673 301
364 3300013102 Ga0157371_10029773 Ga0157371_100297732 301
365 3300013102 Ga0157371_10037127 Ga0157371_100371272 301
366 3300013102 Ga0157371_10070527 Ga0157371_100705271 301
367 3300013102 Ga0157371_10198570 Ga0157371_101985702 301
368 3300013104 Ga0157370_10002515 Ga0157370_100025154 301
369 3300013104 Ga0157370_10011826 Ga0157370_100118265 301
370 3300013104 Ga0157370_10033332 Ga0157370_100333323 301
371 3300013104 Ga0157370_10114863 Ga0157370_101148632 301
372 3300013105 Ga0157369_10079976 Ga0157369_100799764 301
373 3300013296 Ga0157374_10134001 Ga0157374_101340012 301
374 3300013296 Ga0157374_10167632 Ga0157374_101676322 301
375 3300013296 Ga0157374_10353653 Ga0157374_103536532 301
376 3300013297 Ga0157378_10041273 Ga0157378_100412734 301
377 3300013306 Ga0163162_10027603 Ga0163162_100276033 301
378 3300013306 Ga0163162_10084266 Ga0163162_100842662 301
379 3300013306 Ga0163162_10338682 Ga0163162_103386821 301
380 3300013307 Ga0157372_10011126 Ga0157372_100111266 301
381 3300013307 Ga0157372_10063301 Ga0157372_100633013 301
382 3300013307 Ga0157372_10063967 Ga0157372_100639672 301
383 3300013307 Ga0157372_10086194 Ga0157372_100861941 301
384 3300013307 Ga0157372_10155818 Ga0157372_101558184 301
385 3300013307 Ga0157372_10263820 Ga0157372_102638202 301
386 3300013307 Ga0157372_10403776 Ga0157372_104037762 301
387 3300013308 Ga0157375_10010648 Ga0157375_100106484 301
388 3300013308 Ga0157375_10360826 Ga0157375_103608261 301
389 3300013308 Ga0157375_10746276 Ga0157375_107462761 301
390 3300014325 Ga0163163_10157692 Ga0163163_101576922 301
391 3300014326 Ga0157380_10337474 Ga0157380_103374741 301
392 3300021384 Ga0213876_10001264 Ga0213876_100012649 301
393 3300025907 Ga0207645_10006543 Ga0207645_100065435 301
394 3300025909 Ga0207705_10006613 Ga0207705_100066133 301
395 3300025909 Ga0207705_10162671 Ga0207705_101626712 301
396 3300025912 Ga0207707_10021111 Ga0207707_100211114 301
397 3300025912 Ga0207707_10289944 Ga0207707_102899442 301
398 3300025919 Ga0207657_10043302 Ga0207657_100433023 301
399 3300025921 Ga0207652_10000115 Ga0207652_100001154 301
400 3300025921 Ga0207652_10050890 Ga0207652_100508902 301
401 3300025925 Ga0207650_10001994 Ga0207650_100019942 301
402 3300025925 Ga0207650_10264406 Ga0207650_102644061 301
403 3300025931 Ga0207644_10132359 Ga0207644_101323592 301
404 3300025931 Ga0207644_10178252 Ga0207644_101782522 301
405 3300025932 Ga0207690_10139675 Ga0207690_101396752 301
406 3300025932 Ga0207690_10343035 Ga0207690_103430351 301
407 3300025933 Ga0207706_10008123 Ga0207706_100081236 301
408 3300025936 Ga0207670_10087781 Ga0207670_100877812 301
409 3300025942 Ga0207689_10011551 Ga0207689_100115517 301
410 3300025944 Ga0207661_10008977 Ga0207661_100089775 301
411 3300025944 Ga0207661_10032512 Ga0207661_100325123 301
412 3300025945 Ga0207679_10109911 Ga0207679_101099112 301
413 3300025945 Ga0207679_10547503 Ga0207679_105475031 301
414 3300025949 Ga0207667_10001142 Ga0207667_1000114225 301
415 3300025949 Ga0207667_10036967 Ga0207667_100369672 301
416 3300025949 Ga0207667_10090643 Ga0207667_100906434 301
417 3300025949 Ga0207667_10126106 Ga0207667_101261061 301
418 3300025949 Ga0207667_10144378 Ga0207667_101443782 301
419 3300025960 Ga0207651_10240491 Ga0207651_102404912 301
420 3300025961 Ga0207712_10001375 Ga0207712_1000137520 301
421 3300026023 Ga0207677_10539163 Ga0207677_105391631 301
422 3300026035 Ga0207703_10194928 Ga0207703_101949282 301
423 3300026067 Ga0207678_10030051 Ga0207678_100300514 301
424 3300026078 Ga0207702_10096015 Ga0207702_100960152 301
425 3300026088 Ga0207641_10106425 Ga0207641_101064253 301
426 3300026095 Ga0207676_10099758 Ga0207676_100997583 301
427 3300026116 Ga0207674_10453559 Ga0207674_104535591 301
428 3300026142 Ga0207698_10442622 Ga0207698_104426222 301
429 3300032002 Ga0307416_100418867 Ga0307416_1004188672 301
430 3300037312 Ga0395899_0000526 Ga0395899_0000526_15318_16259 301
431 3300037312 Ga0395899_0010628 Ga0395899_0010628_5186_6127 301
432 3300037312 Ga0395899_0023419 Ga0395899_0023419_1987_2997 301
433 3300037312 Ga0395899_0025513 Ga0395899_0025513_1689_2702 301
434 3300037312 Ga0395899_0043291 Ga0395899_0043291_727_1668 301
435 3300037418 Ga0395900_0021329 Ga0395900_0021329_4370_5311 301
436 3300037418 Ga0395900_0029525 Ga0395900_0029525_2748_3689 301
437 3300037418 Ga0395900_0086004 Ga0395900_0086004_459_1472 301
438 3300037418 Ga0395900_0324329 Ga0395900_0324329_424_1365 301
439 3300037466 Ga0395898_0004432 Ga0395898_0004432_5933_6874 301
440 3300037466 Ga0395898_0113622 Ga0395898_0113622_179_1120 301
441 3300037466 Ga0395898_0139438 Ga0395898_0139438_928_1869 301
442 3300037466 Ga0395898_0274594 Ga0395898_0274594_116_1126 301
443 3300037471 Ga0395905_0109237 Ga0395905_0109237_1258_2181 301
444 3300038443 Ga0395901_0001764 Ga0395901_0001764_13892_14905 301
445 3300038443 Ga0395901_0008545 Ga0395901_0008545_9235_10176 301
446 3300038443 Ga0395901_0059246 Ga0395901_0059246_360_1301 301
447 3300038443 Ga0395901_0111225 Ga0395901_0111225_582_1523 301
448 3300038443 Ga0395901_0185576 Ga0395901_0185576_482_1492 301
449 3300039437 Ga0436365_1874674 Ga0436365_1874674_42022_42942 301
450 3300045049 Ga0466959_0274648 Ga0466959_0274648_175_1095 301
451 3300045051 Ga0451576_0360873 Ga0451576_0360873_229_1146 301
452 3300045976 Ga0466967_0165046 Ga0466967_0165046_258_1175 301
453 3300046529 Ga0495652_0159840 Ga0495652_0159840_261_1184 301
454 3300046543 Ga0495645_0039596 Ga0495645_0039596_1024_1947 301
455 3300049573 Ga0501037_0015199 Ga0501037_0015199_2641_3561 301
456 3300049823 Ga0501044_0104578 Ga0501044_0104578_1034_2035 301
457 3300050508 nmdc:mga09592_97000_c1 nmdc:mga09592_97000_c1_1578_2486 301
458 3300050509 nmdc:mga0qj67_51976_c1 nmdc:mga0qj67_51976_c1_1732_2640 301
459 3300050510 nmdc:mga06r32_407656_c1 nmdc:mga06r32_407656_c1_47_955 301
460 3300050511 nmdc:mga08y16_28396_c1 nmdc:mga08y16_28396_c1_4632_5543 301
461 3300005289 Ga0065704_10197039 Ga0065704_101970391 302
462 3300005330 Ga0070690_100030816 Ga0070690_1000308162 302
463 3300005355 Ga0070671_100033033 Ga0070671_1000330333 302
464 3300005367 Ga0070667_100121109 Ga0070667_1001211092 302
465 3300005456 Ga0070678_100071121 Ga0070678_1000711212 302
466 3300005457 Ga0070662_100012405 Ga0070662_1000124056 302
467 3300005544 Ga0070686_100011877 Ga0070686_1000118774 302
468 3300005618 Ga0068864_100258232 Ga0068864_1002582323 302
469 3300005840 Ga0068870_10154903 Ga0068870_101549032 302
470 3300005841 Ga0068863_100003683 Ga0068863_1000036838 302
471 3300006237 Ga0097621_100079058 Ga0097621_1000790582 302
472 3300006844 Ga0075428_100074513 Ga0075428_1000745134 302
473 3300009093 Ga0105240_10000152 Ga0105240_100001525 302
474 3300013307 Ga0157372_10155316 Ga0157372_101553162 302
475 3300013307 Ga0157372_10249265 Ga0157372_102492652 302
476 3300013308 Ga0157375_10110874 Ga0157375_101108744 302
477 3300017792 Ga0163161_10050595 Ga0163161_100505953 302
478 3300025899 Ga0207642_10208408 Ga0207642_102084081 302
479 3300025903 Ga0207680_10160637 Ga0207680_101606372 302
480 3300025908 Ga0207643_10050031 Ga0207643_100500311 302
481 3300025913 Ga0207695_10000185 Ga0207695_100001855 302
482 3300025931 Ga0207644_10290710 Ga0207644_102907101 302
483 3300025933 Ga0207706_10018223 Ga0207706_100182236 302
484 3300025934 Ga0207686_10060691 Ga0207686_100606911 302
485 3300025944 Ga0207661_10280593 Ga0207661_102805932 302
486 3300025960 Ga0207651_10112242 Ga0207651_101122422 302
487 3300026023 Ga0207677_10042832 Ga0207677_100428323 302
488 3300026067 Ga0207678_10152281 Ga0207678_101522812 302
489 3300026088 Ga0207641_10002496 Ga0207641_100024968 302
490 3300026095 Ga0207676_10197501 Ga0207676_101975012 302
491 3300026116 Ga0207674_10028191 Ga0207674_100281916 302
492 3300026121 Ga0207683_10018947 Ga0207683_100189475 302
493 3300031595 Ga0265313_10080320 Ga0265313_100803201 302
494 3300042437 Ga0439444_0017163 Ga0439444_0017163_23_934 302
495 3300046537 Ga0495598_0025332 Ga0495598_0025332_61_999 302
496 3300005290 Ga0065712_10004320 Ga0065712_100043207 303
497 3300005330 Ga0070690_100054763 Ga0070690_1000547632 303
498 3300005333 Ga0070677_10018741 Ga0070677_100187412 303
499 3300005334 Ga0068869_100161178 Ga0068869_1001611781 303
500 3300005335 Ga0070666_10227048 Ga0070666_102270482 303
501 3300005336 Ga0070680_100004542 Ga0070680_1000045425 303
502 3300005337 Ga0070682_100019778 Ga0070682_1000197784 303
503 3300005339 Ga0070660_100041864 Ga0070660_1000418644 303
504 3300005340 Ga0070689_100022515 Ga0070689_1000225153 303
505 3300005344 Ga0070661_100109072 Ga0070661_1001090722 303
506 3300005354 Ga0070675_100283699 Ga0070675_1002836992 303
507 3300005367 Ga0070667_100011353 Ga0070667_1000113534 303
508 3300005367 Ga0070667_100150880 Ga0070667_1001508802 303
509 3300005456 Ga0070678_100176472 Ga0070678_1001764722 303
510 3300005458 Ga0070681_10082446 Ga0070681_100824462 303
511 3300005466 Ga0070685_10011894 Ga0070685_100118942 303
512 3300005530 Ga0070679_100003499 Ga0070679_1000034995 303
513 3300005535 Ga0070684_100000662 Ga0070684_10000066221 303
514 3300005535 Ga0070684_100295862 Ga0070684_1002958621 303
515 3300005539 Ga0068853_100004296 Ga0068853_10000429611 303
516 3300005539 Ga0068853_100457206 Ga0068853_1004572062 303
517 3300005564 Ga0070664_100076812 Ga0070664_1000768122 303
518 3300005577 Ga0068857_100007777 Ga0068857_10000777711 303
519 3300005614 Ga0068856_100080031 Ga0068856_1000800314 303
520 3300005614 Ga0068856_100201866 Ga0068856_1002018661 303
521 3300005616 Ga0068852_100076536 Ga0068852_1000765362 303
522 3300005616 Ga0068852_100227611 Ga0068852_1002276112 303
523 3300005841 Ga0068863_100105115 Ga0068863_1001051153 303
524 3300005841 Ga0068863_100142456 Ga0068863_1001424562 303
525 3300005841 Ga0068863_100531540 Ga0068863_1005315401 303
526 3300006237 Ga0097621_100015328 Ga0097621_1000153287 303
527 3300006237 Ga0097621_100015366 Ga0097621_1000153664 303
528 3300006358 Ga0068871_100000029 Ga0068871_10000002941 303
529 3300006358 Ga0068871_100127927 Ga0068871_1001279273 303
530 3300006358 Ga0068871_100163960 Ga0068871_1001639602 303
531 3300006844 Ga0075428_100298164 Ga0075428_1002981642 303
532 3300006846 Ga0075430_100247283 Ga0075430_1002472831 303
533 3300006880 Ga0075429_100001931 Ga0075429_1000019313 303
534 3300006881 Ga0068865_100008502 Ga0068865_1000085024 303
535 3300009101 Ga0105247_10125874 Ga0105247_101258741 303
536 3300009174 Ga0105241_10006029 Ga0105241_100060295 303
537 3300009176 Ga0105242_10036337 Ga0105242_100363375 303
538 3300009177 Ga0105248_10370678 Ga0105248_103706781 303
539 3300009553 Ga0105249_10070292 Ga0105249_100702922 303
540 3300011119 Ga0105246_10069270 Ga0105246_100692701 303
541 3300013100 Ga0157373_10009768 Ga0157373_100097682 303
542 3300013100 Ga0157373_10049703 Ga0157373_100497032 303
543 3300013105 Ga0157369_10078890 Ga0157369_100788903 303
544 3300013105 Ga0157369_10554330 Ga0157369_105543302 303
545 3300013296 Ga0157374_10067003 Ga0157374_100670031 303
546 3300013297 Ga0157378_10009594 Ga0157378_100095946 303
547 3300013306 Ga0163162_10000195 Ga0163162_100001959 303
548 3300013306 Ga0163162_10002331 Ga0163162_1000233116 303
549 3300013306 Ga0163162_10017666 Ga0163162_100176663 303
550 3300013306 Ga0163162_10018925 Ga0163162_100189257 303
551 3300013306 Ga0163162_10062017 Ga0163162_100620173 303
552 3300013306 Ga0163162_10096316 Ga0163162_100963164 303
553 3300013308 Ga0157375_10001329 Ga0157375_1000132913 303
554 3300013308 Ga0157375_10182420 Ga0157375_101824201 303
555 3300014325 Ga0163163_10055346 Ga0163163_100553461 303
556 3300014325 Ga0163163_10681054 Ga0163163_106810541 303
557 3300014968 Ga0157379_10058661 Ga0157379_100586613 303
558 3300014968 Ga0157379_10189812 Ga0157379_101898122 303
559 3300014969 Ga0157376_10001210 Ga0157376_100012107 303
560 3300014969 Ga0157376_10122021 Ga0157376_101220212 303
561 3300025893 Ga0207682_10030403 Ga0207682_100304034 303
562 3300025903 Ga0207680_10138670 Ga0207680_101386702 303
563 3300025909 Ga0207705_10014850 Ga0207705_100148504 303
564 3300025913 Ga0207695_10065655 Ga0207695_100656553 303
565 3300025914 Ga0207671_10064967 Ga0207671_100649672 303
566 3300025917 Ga0207660_10099227 Ga0207660_100992272 303
567 3300025919 Ga0207657_10013000 Ga0207657_100130008 303
568 3300025919 Ga0207657_10143447 Ga0207657_101434472 303
569 3300025920 Ga0207649_10040859 Ga0207649_100408592 303
570 3300025921 Ga0207652_10001304 Ga0207652_1000130413 303
571 3300025926 Ga0207659_10043006 Ga0207659_100430064 303
572 3300025931 Ga0207644_10004339 Ga0207644_100043394 303
573 3300025938 Ga0207704_10005379 Ga0207704_100053794 303
574 3300025940 Ga0207691_10017254 Ga0207691_100172545 303
575 3300025940 Ga0207691_10028055 Ga0207691_100280552 303
576 3300025942 Ga0207689_10323469 Ga0207689_103234692 303
577 3300025944 Ga0207661_10136430 Ga0207661_101364302 303
578 3300025945 Ga0207679_10001619 Ga0207679_1000161912 303
579 3300025986 Ga0207658_10047852 Ga0207658_100478524 303
580 3300025986 Ga0207658_10209618 Ga0207658_102096182 303
581 3300026041 Ga0207639_10014872 Ga0207639_100148721 303
582 3300026078 Ga0207702_10044771 Ga0207702_100447714 303
583 3300026088 Ga0207641_10014636 Ga0207641_100146364 303
584 3300026088 Ga0207641_10084046 Ga0207641_100840463 303
585 3300026089 Ga0207648_10139729 Ga0207648_101397291 303
586 3300026095 Ga0207676_10100637 Ga0207676_101006372 303
587 3300026116 Ga0207674_10013185 Ga0207674_1001318511 303
588 3300026118 Ga0207675_100183409 Ga0207675_1001834092 303
589 3300026118 Ga0207675_100596031 Ga0207675_1005960311 303
590 3300026121 Ga0207683_10220853 Ga0207683_102208532 303
591 3300026142 Ga0207698_10007914 Ga0207698_100079146 303
592 3300031251 Ga0265327_10000054 Ga0265327_10000054122 303
593 3300031251 Ga0265327_10075700 Ga0265327_100757002 303
594 3300035725 Ga0373947_0139535 Ga0373947_0139535_223_1149 303
595 3300036401 Ga0373937_0107451 Ga0373937_0107451_1347_2270 303
596 3300044712 Ga0453684_0099791 Ga0453684_0099791_2203_3132 303
597 3300046535 Ga0495586_0019463 Ga0495586_0019463_719_1642 303
598 3300046536 Ga0495587_0126356 Ga0495587_0126356_345_1268 303
599 3300048905 Ga0496102_0514579 Ga0496102_0514579_151_1065 303
600 3300048907 Ga0496104_0257228 Ga0496104_0257228_608_1534 303
601 3300048917 Ga0496114_0016633 Ga0496114_0016633_582_1496 303
602 3300050508 nmdc:mga09592_267171_c1 nmdc:mga09592_267171_c1_183_1097 303
603 iso_pu_bacteria 2738541278 2738730357 303
604 iso_pu_bacteria 2914759650 2914761180 303
605 iso_pu_bacteria 2929154850 2929156333 303
606 3300003323 rootH1_10198429 rootH1_101984291 304
607 3300005327 Ga0070658_10000483 Ga0070658_1000048315 304
608 3300005328 Ga0070676_10015947 Ga0070676_100159473 304
609 3300005334 Ga0068869_100068099 Ga0068869_1000680993 304
610 3300005335 Ga0070666_10024837 Ga0070666_100248374 304
611 3300005337 Ga0070682_100000306 Ga0070682_1000003067 304
612 3300005337 Ga0070682_100149252 Ga0070682_1001492521 304
613 3300005338 Ga0068868_100000437 Ga0068868_10000043723 304
614 3300005347 Ga0070668_100008526 Ga0070668_1000085261 304
615 3300005354 Ga0070675_100144278 Ga0070675_1001442782 304
616 3300005364 Ga0070673_100008146 Ga0070673_1000081465 304
617 3300005367 Ga0070667_100000393 Ga0070667_10000039347 304
618 3300005456 Ga0070678_100063251 Ga0070678_1000632513 304
619 3300005457 Ga0070662_100322316 Ga0070662_1003223161 304
620 3300005459 Ga0068867_100001722 Ga0068867_1000017224 304
621 3300005539 Ga0068853_100137061 Ga0068853_1001370613 304
622 3300005543 Ga0070672_100000460 Ga0070672_10000046018 304
623 3300005548 Ga0070665_100000920 Ga0070665_10000092022 304
624 3300005564 Ga0070664_100403466 Ga0070664_1004034661 304
625 3300005618 Ga0068864_100007023 Ga0068864_1000070236 304
626 3300005719 Ga0068861_100011589 Ga0068861_1000115894 304
627 3300005834 Ga0068851_10002415 Ga0068851_100024153 304
628 3300005841 Ga0068863_100000953 Ga0068863_1000009537 304
629 3300005842 Ga0068858_100000787 Ga0068858_10000078714 304
630 3300005843 Ga0068860_100000397 Ga0068860_10000039722 304
631 3300006237 Ga0097621_100017683 Ga0097621_1000176833 304
632 3300006358 Ga0068871_100002956 Ga0068871_1000029568 304
633 3300006881 Ga0068865_100004356 Ga0068865_1000043562 304
634 3300009093 Ga0105240_10023494 Ga0105240_100234944 304
635 3300009098 Ga0105245_10111416 Ga0105245_101114162 304
636 3300009101 Ga0105247_10004670 Ga0105247_100046709 304
637 3300009176 Ga0105242_10187699 Ga0105242_101876991 304
638 3300009177 Ga0105248_10016795 Ga0105248_100167955 304
639 3300009551 Ga0105238_10245557 Ga0105238_102455572 304
640 3300009553 Ga0105249_10003278 Ga0105249_100032786 304
641 3300013104 Ga0157370_10157384 Ga0157370_101573842 304
642 3300013296 Ga0157374_10001246 Ga0157374_1000124618 304
643 3300013297 Ga0157378_10004467 Ga0157378_1000446712 304
644 3300013306 Ga0163162_10000040 Ga0163162_1000004025 304
645 3300013307 Ga0157372_10097871 Ga0157372_100978714 304
646 3300013308 Ga0157375_10000270 Ga0157375_1000027010 304
647 3300014325 Ga0163163_10000110 Ga0163163_100001105 304
648 3300014968 Ga0157379_10000227 Ga0157379_100002277 304
649 3300014969 Ga0157376_10000161 Ga0157376_100001613 304
650 3300017792 Ga0163161_10089795 Ga0163161_100897952 304
651 3300025321 Ga0207656_10002074 Ga0207656_100020743 304
652 3300025900 Ga0207710_10023325 Ga0207710_100233252 304
653 3300025903 Ga0207680_10018368 Ga0207680_100183684 304
654 3300025907 Ga0207645_10000625 Ga0207645_100006253 304
655 3300025909 Ga0207705_10058890 Ga0207705_100588904 304
656 3300025933 Ga0207706_10005669 Ga0207706_100056695 304
657 3300025938 Ga0207704_10005792 Ga0207704_100057925 304
658 3300025940 Ga0207691_10000013 Ga0207691_10000013113 304
659 3300025942 Ga0207689_10061632 Ga0207689_100616324 304
660 3300025942 Ga0207689_10550954 Ga0207689_105509541 304
661 3300025945 Ga0207679_10372668 Ga0207679_103726682 304
662 3300025960 Ga0207651_10004006 Ga0207651_100040064 304
663 3300025972 Ga0207668_10000317 Ga0207668_100003171 304
664 3300025986 Ga0207658_10000707 Ga0207658_100007076 304
665 3300026023 Ga0207677_10000441 Ga0207677_100004414 304
666 3300026035 Ga0207703_10001988 Ga0207703_1000198814 304
667 3300026041 Ga0207639_10055976 Ga0207639_100559763 304
668 3300026067 Ga0207678_10342685 Ga0207678_103426852 304
669 3300026088 Ga0207641_10013258 Ga0207641_100132586 304
670 3300026089 Ga0207648_10014984 Ga0207648_100149845 304
671 3300026095 Ga0207676_10006919 Ga0207676_100069196 304
672 3300026121 Ga0207683_10099803 Ga0207683_100998033 304
673 3300028379 Ga0268266_10004617 Ga0268266_100046171 304
674 3300028381 Ga0268264_10008340 Ga0268264_100083405 304
675 3300033180 Ga0307510_10000074 Ga0307510_1000007432 304
676 3300048912 Ga0496109_0146911 Ga0496109_0146911_1256_2185 304
677 3300049571 Ga0501034_0007875 Ga0501034_0007875_986_1903 304
678 3300049571 Ga0501034_0195373 Ga0501034_0195373_316_1233 304
679 3300049823 Ga0501044_0119376 Ga0501044_0119376_1676_2593 304
680 3300004803 Ga0058862_12776854 Ga0058862_127768542 305
681 3300005328 Ga0070676_10039187 Ga0070676_100391871 305
682 3300005334 Ga0068869_100027561 Ga0068869_1000275615 305
683 3300005336 Ga0070680_100001760 Ga0070680_1000017607 305
684 3300005337 Ga0070682_100000842 Ga0070682_1000008426 305
685 3300005341 Ga0070691_10000288 Ga0070691_1000028816 305
686 3300005347 Ga0070668_100099265 Ga0070668_1000992651 305
687 3300005356 Ga0070674_100146468 Ga0070674_1001464682 305
688 3300005356 Ga0070674_100158046 Ga0070674_1001580462 305
689 3300005364 Ga0070673_100024477 Ga0070673_1000244775 305
690 3300005366 Ga0070659_100180978 Ga0070659_1001809782 305
691 3300005367 Ga0070667_100101727 Ga0070667_1001017272 305
692 3300005456 Ga0070678_100112325 Ga0070678_1001123252 305
693 3300005456 Ga0070678_100165176 Ga0070678_1001651762 305
694 3300005457 Ga0070662_100350080 Ga0070662_1003500802 305
695 3300005458 Ga0070681_10011141 Ga0070681_100111417 305
696 3300005459 Ga0068867_100125429 Ga0068867_1001254292 305
697 3300005459 Ga0068867_100142014 Ga0068867_1001420142 305
698 3300005459 Ga0068867_100373116 Ga0068867_1003731161 305
699 3300005459 Ga0068867_100442735 Ga0068867_1004427351 305
700 3300005539 Ga0068853_100013818 Ga0068853_1000138184 305
701 3300005539 Ga0068853_100097077 Ga0068853_1000970772 305
702 3300005543 Ga0070672_100102334 Ga0070672_1001023342 305
703 3300005563 Ga0068855_100013253 Ga0068855_1000132535 305
704 3300005617 Ga0068859_100012696 Ga0068859_1000126963 305
705 3300005719 Ga0068861_100018922 Ga0068861_1000189226 305
706 3300005834 Ga0068851_10007237 Ga0068851_100072375 305
707 3300005843 Ga0068860_100042202 Ga0068860_1000422023 305
708 3300006931 Ga0097620_100012696 Ga0097620_1000126963 305
709 3300009093 Ga0105240_10005996 Ga0105240_100059965 305
710 3300009093 Ga0105240_10193143 Ga0105240_101931432 305
711 3300009094 Ga0111539_10276550 Ga0111539_102765501 305
712 3300009098 Ga0105245_10203538 Ga0105245_102035382 305
713 3300009148 Ga0105243_10160067 Ga0105243_101600672 305
714 3300009174 Ga0105241_10006670 Ga0105241_100066703 305
715 3300009176 Ga0105242_10372121 Ga0105242_103721211 305
716 3300013104 Ga0157370_10001108 Ga0157370_1000110813 305
717 3300013104 Ga0157370_10337895 Ga0157370_103378951 305
718 3300013306 Ga0163162_10000098 Ga0163162_1000009832 305
719 3300013306 Ga0163162_10497799 Ga0163162_104977992 305
720 3300013307 Ga0157372_10832362 Ga0157372_108323622 305
721 3300014326 Ga0157380_10008348 Ga0157380_100083488 305
722 3300025321 Ga0207656_10013332 Ga0207656_100133322 305
723 3300025907 Ga0207645_10004207 Ga0207645_100042072 305
724 3300025911 Ga0207654_10001277 Ga0207654_100012777 305
725 3300025912 Ga0207707_10000189 Ga0207707_100001892 305
726 3300025913 Ga0207695_10005298 Ga0207695_100052983 305
727 3300025917 Ga0207660_10011327 Ga0207660_100113277 305
728 3300025921 Ga0207652_10000755 Ga0207652_100007557 305
729 3300025924 Ga0207694_10204369 Ga0207694_102043692 305
730 3300025926 Ga0207659_10025460 Ga0207659_100254605 305
731 3300025933 Ga0207706_10086907 Ga0207706_100869072 305
732 3300025934 Ga0207686_10033450 Ga0207686_100334504 305
733 3300025934 Ga0207686_10320008 Ga0207686_103200082 305
734 3300025937 Ga0207669_10083075 Ga0207669_100830752 305
735 3300025937 Ga0207669_10199167 Ga0207669_101991672 305
736 3300025942 Ga0207689_10002023 Ga0207689_100020235 305
737 3300025942 Ga0207689_10002982 Ga0207689_100029825 305
738 3300025949 Ga0207667_10037238 Ga0207667_100372384 305
739 3300025972 Ga0207668_10049181 Ga0207668_100491812 305
740 3300026023 Ga0207677_10201204 Ga0207677_102012042 305
741 3300026041 Ga0207639_10015280 Ga0207639_100152805 305
742 3300026041 Ga0207639_10035701 Ga0207639_100357012 305
743 3300026089 Ga0207648_10000260 Ga0207648_1000026035 305
744 3300026089 Ga0207648_10004821 Ga0207648_100048218 305
745 3300026089 Ga0207648_10065199 Ga0207648_100651992 305
746 3300026095 Ga0207676_10011538 Ga0207676_100115382 305
747 3300026118 Ga0207675_100005537 Ga0207675_1000055376 305
748 3300026121 Ga0207683_10000737 Ga0207683_1000073726 305
749 3300026121 Ga0207683_10011666 Ga0207683_100116665 305
750 3300028379 Ga0268266_10225934 Ga0268266_102259342 305
751 3300028380 Ga0268265_10014141 Ga0268265_100141415 305
752 3300042007 Ga0439449_0004630 Ga0439449_0004630_4005_4991 305
753 3300047472 Ga0495686_0014315 Ga0495686_0014315_4448_5413 305
754 3300047472 Ga0495686_0040837 Ga0495686_0040837_1092_2036 305
755 3300049569 Ga0501032_0021353 Ga0501032_0021353_65_994 305
756 3300049572 Ga0501036_0044603 Ga0501036_0044603_2042_2971 305
757 3300049579 Ga0501043_0121509 Ga0501043_0121509_163_1092 305
758 3300049580 Ga0501046_0035195 Ga0501046_0035195_1261_2190 305
759 3300049582 Ga0501048_0070471 Ga0501048_0070471_1108_2037 305
760 3300049583 Ga0501067_0078482 Ga0501067_0078482_402_1331 305
761 3300049586 Ga0501070_0087505 Ga0501070_0087505_363_1286 305
762 3300049589 Ga0501073_0025092 Ga0501073_0025092_1507_2430 305
763 3300049590 Ga0501074_0033974 Ga0501074_0033974_2416_3345 305
764 3300049590 Ga0501074_0125855 Ga0501074_0125855_507_1430 305
765 3300049742 Ga0501080_0070803 Ga0501080_0070803_1712_2641 305
766 3300049744 Ga0501083_0002034 Ga0501083_0002034_2350_3279 305
767 3300049823 Ga0501044_0071130 Ga0501044_0071130_732_1661 305
768 3300050511 nmdc:mga08y16_194397_c1 nmdc:mga08y16_194397_c1_692_1615 305
769 3300054114 Ga0501084_0002535 Ga0501084_0002535_504_1427 305
770 iso_pu_bacteria 2818991444 2819589655 305
771 iso_pu_bacteria 2881955468 2881957735 305
772 2162886011 MRS1b_contig_3254756 MRS1b_0803.00001010 306
773 3300005329 Ga0070683_100005058 Ga0070683_1000050587 306
774 3300005331 Ga0070670_100072298 Ga0070670_1000722982 306
775 3300005334 Ga0068869_100023228 Ga0068869_1000232282 306
776 3300005335 Ga0070666_10117698 Ga0070666_101176982 306
777 3300005337 Ga0070682_100187350 Ga0070682_1001873502 306
778 3300005340 Ga0070689_100002371 Ga0070689_1000023716 306
779 3300005340 Ga0070689_100234110 Ga0070689_1002341102 306
780 3300005347 Ga0070668_100020355 Ga0070668_1000203552 306
781 3300005347 Ga0070668_100068191 Ga0070668_1000681912 306
782 3300005353 Ga0070669_100065430 Ga0070669_1000654302 306
783 3300005354 Ga0070675_100015103 Ga0070675_1000151032 306
784 3300005355 Ga0070671_100111497 Ga0070671_1001114973 306
785 3300005364 Ga0070673_100069784 Ga0070673_1000697842 306
786 3300005365 Ga0070688_100002069 Ga0070688_1000020693 306
787 3300005365 Ga0070688_100035235 Ga0070688_1000352352 306
788 3300005367 Ga0070667_100352991 Ga0070667_1003529911 306
789 3300005444 Ga0070694_100085018 Ga0070694_1000850182 306
790 3300005457 Ga0070662_100154423 Ga0070662_1001544231 306
791 3300005459 Ga0068867_100092441 Ga0068867_1000924412 306
792 3300005466 Ga0070685_10048205 Ga0070685_100482052 306
793 3300005535 Ga0070684_100007861 Ga0070684_10000786111 306
794 3300005539 Ga0068853_100008858 Ga0068853_1000088589 306
795 3300005539 Ga0068853_100043395 Ga0068853_1000433954 306
796 3300005548 Ga0070665_100165243 Ga0070665_1001652432 306
797 3300005563 Ga0068855_100041655 Ga0068855_1000416554 306
798 3300005564 Ga0070664_100070707 Ga0070664_1000707072 306
799 3300005564 Ga0070664_100571062 Ga0070664_1005710621 306
800 3300005577 Ga0068857_100001839 Ga0068857_10000183913 306
801 3300005577 Ga0068857_100070305 Ga0068857_1000703052 306
802 3300005614 Ga0068856_100076272 Ga0068856_1000762722 306
803 3300005616 Ga0068852_100009098 Ga0068852_1000090983 306
804 3300005617 Ga0068859_100000642 Ga0068859_10000064214 306
805 3300005617 Ga0068859_100242167 Ga0068859_1002421671 306
806 3300005719 Ga0068861_100004719 Ga0068861_1000047193 306
807 3300005840 Ga0068870_10098049 Ga0068870_100980492 306
808 3300005842 Ga0068858_100159286 Ga0068858_1001592862 306
809 3300005843 Ga0068860_100020101 Ga0068860_1000201015 306
810 3300005843 Ga0068860_100030344 Ga0068860_1000303444 306
811 3300005844 Ga0068862_100015157 Ga0068862_1000151574 306
812 3300006237 Ga0097621_100010191 Ga0097621_1000101912 306
813 3300006358 Ga0068871_100009435 Ga0068871_1000094356 306
814 3300006358 Ga0068871_100357688 Ga0068871_1003576881 306
815 3300006871 Ga0075434_100205369 Ga0075434_1002053691 306
816 3300006881 Ga0068865_100393088 Ga0068865_1003930881 306
817 3300006931 Ga0097620_100000642 Ga0097620_10000064214 306
818 3300006931 Ga0097620_100242173 Ga0097620_1002421731 306
819 3300009011 Ga0105251_10085987 Ga0105251_100859872 306
820 3300009093 Ga0105240_10013679 Ga0105240_100136794 306
821 3300009094 Ga0111539_10023939 Ga0111539_100239395 306
822 3300009176 Ga0105242_10224183 Ga0105242_102241832 306
823 3300009545 Ga0105237_10125329 Ga0105237_101253292 306
824 3300009551 Ga0105238_10048142 Ga0105238_100481424 306
825 3300009553 Ga0105249_10001393 Ga0105249_1000139321 306
826 3300009553 Ga0105249_10033619 Ga0105249_100336194 306
827 3300010375 Ga0105239_10005636 Ga0105239_100056361 306
828 3300013102 Ga0157371_10017650 Ga0157371_100176504 306
829 3300013104 Ga0157370_10030199 Ga0157370_100301994 306
830 3300013296 Ga0157374_10006504 Ga0157374_100065042 306
831 3300013297 Ga0157378_10058116 Ga0157378_100581162 306
832 3300013306 Ga0163162_10010308 Ga0163162_100103085 306
833 3300013307 Ga0157372_10007445 Ga0157372_100074452 306
834 3300013307 Ga0157372_10064346 Ga0157372_100643462 306
835 3300013307 Ga0157372_10119406 Ga0157372_101194063 306
836 3300013308 Ga0157375_10076457 Ga0157375_100764573 306
837 3300013308 Ga0157375_10768893 Ga0157375_107688931 306
838 3300014325 Ga0163163_10001583 Ga0163163_100015837 306
839 3300014326 Ga0157380_10001610 Ga0157380_1000161010 306
840 3300014326 Ga0157380_10007247 Ga0157380_100072479 306
841 3300014745 Ga0157377_10014508 Ga0157377_100145082 306
842 3300014969 Ga0157376_10113505 Ga0157376_101135051 306
843 3300017792 Ga0163161_10135342 Ga0163161_101353421 306
844 3300021384 Ga0213876_10150920 Ga0213876_101509202 306
845 3300025904 Ga0207647_10018962 Ga0207647_100189623 306
846 3300025904 Ga0207647_10165015 Ga0207647_101650151 306
847 3300025908 Ga0207643_10033835 Ga0207643_100338352 306
848 3300025913 Ga0207695_10031202 Ga0207695_100312022 306
849 3300025918 Ga0207662_10212135 Ga0207662_102121352 306
850 3300025923 Ga0207681_10019330 Ga0207681_100193302 306
851 3300025925 Ga0207650_10136377 Ga0207650_101363772 306
852 3300025925 Ga0207650_10160298 Ga0207650_101602981 306
853 3300025926 Ga0207659_10034959 Ga0207659_100349592 306
854 3300025926 Ga0207659_10072728 Ga0207659_100727281 306
855 3300025933 Ga0207706_10063078 Ga0207706_100630783 306
856 3300025933 Ga0207706_10255942 Ga0207706_102559422 306
857 3300025936 Ga0207670_10007084 Ga0207670_100070842 306
858 3300025936 Ga0207670_10051555 Ga0207670_100515553 306
859 3300025942 Ga0207689_10009549 Ga0207689_100095497 306
860 3300025944 Ga0207661_10072673 Ga0207661_100726732 306
861 3300025945 Ga0207679_10019198 Ga0207679_100191984 306
862 3300025949 Ga0207667_10001931 Ga0207667_1000193114 306
863 3300025960 Ga0207651_10064614 Ga0207651_100646142 306
864 3300025961 Ga0207712_10142873 Ga0207712_101428732 306
865 3300025972 Ga0207668_10344458 Ga0207668_103444582 306
866 3300026041 Ga0207639_10011824 Ga0207639_100118245 306
867 3300026041 Ga0207639_10021286 Ga0207639_100212862 306
868 3300026078 Ga0207702_10040565 Ga0207702_100405654 306
869 3300026089 Ga0207648_10161934 Ga0207648_101619342 306
870 3300026089 Ga0207648_10267042 Ga0207648_102670422 306
871 3300026089 Ga0207648_10319586 Ga0207648_103195862 306
872 3300026116 Ga0207674_10001616 Ga0207674_1000161612 306
873 3300026116 Ga0207674_10072652 Ga0207674_100726522 306
874 3300026116 Ga0207674_10111798 Ga0207674_101117983 306
875 3300026118 Ga0207675_100000051 Ga0207675_10000005165 306
876 3300026121 Ga0207683_10032487 Ga0207683_100324873 306
877 3300026142 Ga0207698_10009223 Ga0207698_100092233 306
878 3300028381 Ga0268264_10013534 Ga0268264_100135343 306
879 3300028381 Ga0268264_10016909 Ga0268264_100169094 306
880 3300028794 Ga0307515_10000001 Ga0307515_10000001544 306
881 3300028800 Ga0265338_10240236 Ga0265338_102402362 306
882 3300031251 Ga0265327_10000383 Ga0265327_1000038345 306
883 3300031548 Ga0307408_100100685 Ga0307408_1001006853 306
884 3300031911 Ga0307412_10123698 Ga0307412_101236981 306
885 3300032002 Ga0307416_100019957 Ga0307416_1000199572 306
886 3300032126 Ga0307415_100025922 Ga0307415_1000259223 306
887 3300037418 Ga0395900_0111358 Ga0395900_0111358_1397_2326 306
888 3300037471 Ga0395905_0003517 Ga0395905_0003517_11718_12647 306
889 3300039437 Ga0436365_1478429 Ga0436365_1478429_1084_2010 306
890 3300041999 Ga0439433_0030129 Ga0439433_0030129_181_1110 306
891 3300042007 Ga0439449_0106270 Ga0439449_0106270_65_994 306
892 3300042435 Ga0439434_0004288 Ga0439434_0004288_178_1107 306
893 3300042876 Ga0451577_0003071 Ga0451577_0003071_17574_18497 306
894 3300042876 Ga0451577_0035086 Ga0451577_0035086_1697_2623 306
895 3300044673 Ga0453683_0209797 Ga0453683_0209797_174_1100 306
896 3300046616 Ga0495668_0005493 Ga0495668_0005493_6283_7215 306
897 3300047320 Ga0495672_0007135 Ga0495672_0007135_3090_4022 306
898 3300049569 Ga0501032_0033518 Ga0501032_0033518_1513_2448 306
899 3300049572 Ga0501036_0152900 Ga0501036_0152900_778_1713 306
900 3300049573 Ga0501037_0010355 Ga0501037_0010355_1257_2192 306
901 3300049574 Ga0501038_0017337 Ga0501038_0017337_2761_3696 306
902 3300049579 Ga0501043_0002333 Ga0501043_0002333_14797_15732 306
903 3300049581 Ga0501047_0048142 Ga0501047_0048142_1847_2782 306
904 3300049652 Ga0501202_000253 Ga0501202_000253_5652_6581 306
905 3300049663 Ga0501223_013341 Ga0501223_013341_314_1243 306
906 3300049665 Ga0501227_032226 Ga0501227_032226_107_1036 306
907 3300049705 Ga0501225_0005918 Ga0501225_0005918_1919_2848 306
908 3300049760 Ga0501263_004778 Ga0501263_004778_307_1236 306
909 3300049775 Ga0501279_007199 Ga0501279_007199_479_1408 306
910 3300049822 Ga0501035_0032383 Ga0501035_0032383_3724_4659 306
911 3300049823 Ga0501044_0000710 Ga0501044_0000710_29757_30692 306
912 3300050510 nmdc:mga06r32_11744_c1 nmdc:mga06r32_11744_c1_5035_5970 306
913 3300050511 nmdc:mga08y16_5492_c1 nmdc:mga08y16_5492_c1_9251_10180 306
914 3300053139 Ga0500568_0009501 Ga0500568_0009501_601_1536 306
915 3300003323 rootH1_10046162 rootH1_1004616214 307
916 3300005331 Ga0070670_100271920 Ga0070670_1002719201 307
917 3300005333 Ga0070677_10029413 Ga0070677_100294132 307
918 3300005334 Ga0068869_100011549 Ga0068869_1000115494 307
919 3300005335 Ga0070666_10000077 Ga0070666_1000007749 307
920 3300005338 Ga0068868_100100405 Ga0068868_1001004052 307
921 3300005338 Ga0068868_100123634 Ga0068868_1001236342 307
922 3300005355 Ga0070671_100179940 Ga0070671_1001799402 307
923 3300005364 Ga0070673_100170710 Ga0070673_1001707101 307
924 3300005365 Ga0070688_100188800 Ga0070688_1001888002 307
925 3300005367 Ga0070667_100022041 Ga0070667_1000220415 307
926 3300005471 Ga0070698_100074996 Ga0070698_1000749962 307
927 3300005614 Ga0068856_100012395 Ga0068856_1000123957 307
928 3300005617 Ga0068859_100000063 Ga0068859_10000006364 307
929 3300005617 Ga0068859_100077279 Ga0068859_1000772792 307
930 3300005618 Ga0068864_100035314 Ga0068864_1000353143 307
931 3300005841 Ga0068863_100000600 Ga0068863_10000060037 307
932 3300005841 Ga0068863_100072469 Ga0068863_1000724693 307
933 3300005842 Ga0068858_100010265 Ga0068858_1000102653 307
934 3300005843 Ga0068860_100002531 Ga0068860_1000025316 307
935 3300005843 Ga0068860_100005148 Ga0068860_1000051482 307
936 3300005843 Ga0068860_100053039 Ga0068860_1000530391 307
937 3300006195 Ga0075366_10032776 Ga0075366_100327762 307
938 3300006358 Ga0068871_100015855 Ga0068871_1000158557 307
939 3300006358 Ga0068871_100172497 Ga0068871_1001724972 307
940 3300006931 Ga0097620_100000063 Ga0097620_10000006364 307
941 3300006931 Ga0097620_100077278 Ga0097620_1000772782 307
942 3300009101 Ga0105247_10013705 Ga0105247_100137055 307
943 3300009101 Ga0105247_10020063 Ga0105247_100200632 307
944 3300009147 Ga0114129_10013160 Ga0114129_1001316012 307
945 3300009174 Ga0105241_10000841 Ga0105241_100008414 307
946 3300009545 Ga0105237_10003827 Ga0105237_1000382711 307
947 3300009553 Ga0105249_10007541 Ga0105249_100075417 307
948 3300009553 Ga0105249_10020431 Ga0105249_100204314 307
949 3300010375 Ga0105239_10015774 Ga0105239_100157746 307
950 3300013296 Ga0157374_10131466 Ga0157374_101314662 307
951 3300013297 Ga0157378_10002863 Ga0157378_100028633 307
952 3300013297 Ga0157378_10091981 Ga0157378_100919812 307
953 3300013306 Ga0163162_10002166 Ga0163162_1000216613 307
954 3300013306 Ga0163162_10039034 Ga0163162_100390342 307
955 3300014325 Ga0163163_10183379 Ga0163163_101833792 307
956 3300014969 Ga0157376_10016392 Ga0157376_100163924 307
957 3300014969 Ga0157376_10016806 Ga0157376_100168062 307
958 3300021384 Ga0213876_10005277 Ga0213876_100052772 307
959 3300025246 Ga0209646_1002373 Ga0209646_10023734 307
960 3300025302 Ga0207426_1000002 Ga0207426_1000002146 307
961 3300025900 Ga0207710_10009798 Ga0207710_100097982 307
962 3300025900 Ga0207710_10072624 Ga0207710_100726241 307
963 3300025903 Ga0207680_10000071 Ga0207680_1000007125 307
964 3300025914 Ga0207671_10004248 Ga0207671_1000424816 307
965 3300025925 Ga0207650_10141181 Ga0207650_101411812 307
966 3300025942 Ga0207689_10013393 Ga0207689_100133934 307
967 3300025961 Ga0207712_10013688 Ga0207712_100136881 307
968 3300025961 Ga0207712_10296661 Ga0207712_102966611 307
969 3300025972 Ga0207668_10034770 Ga0207668_100347702 307
970 3300025986 Ga0207658_10195387 Ga0207658_101953871 307
971 3300026023 Ga0207677_10019567 Ga0207677_100195672 307
972 3300026023 Ga0207677_10160334 Ga0207677_101603341 307
973 3300026035 Ga0207703_10025985 Ga0207703_100259854 307
974 3300026088 Ga0207641_10000215 Ga0207641_100002157 307
975 3300026088 Ga0207641_10060436 Ga0207641_100604362 307
976 3300026095 Ga0207676_10058690 Ga0207676_100586902 307
977 3300026116 Ga0207674_10224624 Ga0207674_102246241 307
978 3300026118 Ga0207675_100155238 Ga0207675_1001552382 307
979 3300026142 Ga0207698_10057441 Ga0207698_100574414 307
980 3300028381 Ga0268264_10002345 Ga0268264_100023456 307
981 3300028381 Ga0268264_10005368 Ga0268264_100053686 307
982 3300028794 Ga0307515_10000380 Ga0307515_1000038065 307
983 3300031251 Ga0265327_10025072 Ga0265327_100250723 307
984 3300031507 Ga0307509_10031930 Ga0307509_100319304 307
985 3300039437 Ga0436365_0392399 Ga0436365_0392399_7153_8088 307
986 3300041404 Ga0439436_0012275 Ga0439436_0012275_1438_2373 307
987 3300041406 Ga0439439_0013754 Ga0439439_0013754_867_1802 307
988 3300041451 Ga0451791_0134091 Ga0451791_0134091_17_952 307
989 3300041512 Ga0451853_0855199 Ga0451853_0855199_202_1137 307
990 3300042007 Ga0439449_0040047 Ga0439449_0040047_594_1532 307
991 3300042014 Ga0439457_001745 Ga0439457_001745_513_1448 307
992 3300044656 Ga0466969_0000259 Ga0466969_0000259_15825_16763 307
993 3300044658 Ga0466972_0000022 Ga0466972_0000022_6700_7632 307
994 3300044658 Ga0466972_0000061 Ga0466972_0000061_28864_29799 307
995 3300044658 Ga0466972_0007404 Ga0466972_0007404_3436_4365 307
996 3300044684 Ga0466966_0000064 Ga0466966_0000064_63073_64011 307
997 3300044719 Ga0466971_0137741 Ga0466971_0137741_87_1025 307
998 3300044765 Ga0466970_0002236 Ga0466970_0002236_3394_4326 307
999 3300044842 Ga0466957_0000176 Ga0466957_0000176_13700_14635 307
1000 3300045049 Ga0466959_0000005 Ga0466959_0000005_129049_129987 307
1001 3300046472 Ga0495580_0187742 Ga0495580_0187742_410_1348 307
1002 3300046536 Ga0495587_0138477 Ga0495587_0138477_42_980 307
1003 3300047318 Ga0495636_0000025 Ga0495636_0000025_41645_42571 307
1004 3300047319 Ga0495674_0043245 Ga0495674_0043245_2422_3360 307
1005 3300048917 Ga0496114_0008771 Ga0496114_0008771_4405_5346 307
1006 3300049572 Ga0501036_0015208 Ga0501036_0015208_358_1299 307
1007 3300049573 Ga0501037_0287910 Ga0501037_0287910_164_1105 307
1008 3300049579 Ga0501043_0053274 Ga0501043_0053274_92_1033 307
1009 3300049581 Ga0501047_0052853 Ga0501047_0052853_2395_3330 307
1010 3300049584 Ga0501068_0204217 Ga0501068_0204217_96_1037 307
1011 3300049705 Ga0501225_0010381 Ga0501225_0010381_236_1174 307
1012 3300049822 Ga0501035_0197693 Ga0501035_0197693_721_1662 307
1013 3300049823 Ga0501044_0011248 Ga0501044_0011248_4806_5747 307
1014 3300049823 Ga0501044_0045500 Ga0501044_0045500_1066_2004 307
1015 3300050493 nmdc:mga0k408_74586_c1 nmdc:mga0k408_74586_c1_478_1410 307
1016 3300053086 Ga0500578_0000303 Ga0500578_0000303_45837_46772 307
1017 3300053088 Ga0500644_0007453 Ga0500644_0007453_1644_2597 307
1018 3300053092 Ga0500583_0000029 Ga0500583_0000029_80305_81240 307
1019 3300053092 Ga0500583_0011371 Ga0500583_0011371_724_1659 307
1020 3300053108 Ga0500562_000007 Ga0500562_000007_226403_227356 307
1021 3300053111 Ga0500572_044168 Ga0500572_044168_257_1192 307
1022 3300053153 Ga0500616_0094989 Ga0500616_0094989_156_1109 307
1023 3300053156 Ga0500622_0000575 Ga0500622_0000575_14142_15095 307
1024 3300053156 Ga0500622_0047165 Ga0500622_0047165_659_1594 307
1025 3300053727 Ga0500611_000050 Ga0500611_000050_29809_30765 307
1026 3300053730 Ga0500645_025303 Ga0500645_025303_793_1746 307
1027 3300003323 rootH1_10078005 rootH1_100780052 308
1028 3300010375 Ga0105239_10000389 Ga0105239_1000038937 308
1029 3300025913 Ga0207695_10000020 Ga0207695_10000020266 308
1030 3300031251 Ga0265327_10000234 Ga0265327_1000023493 308
1031 3300053153 Ga0500616_0016011 Ga0500616_0016011_2441_3403 308
1032 2162886007 SwRhRL2b_contig_1663468 SwRhRL2b_0819.00004220 309
1033 3300003323 rootH1_10151388 rootH1_101513884 309
1034 3300005289 Ga0065704_10070133 Ga0065704_100701331154 309
1035 3300009093 Ga0105240_10015493 Ga0105240_100154936 309
1036 3300009545 Ga0105237_10024342 Ga0105237_100243423 309
1037 3300010375 Ga0105239_10132477 Ga0105239_101324773 309
1038 3300010375 Ga0105239_10476774 Ga0105239_104767742 309
1039 3300025913 Ga0207695_10004754 Ga0207695_100047545 309
1040 3300025914 Ga0207671_10002226 Ga0207671_1000222616 309
1041 3300025949 Ga0207667_10296452 Ga0207667_102964522 309
1042 3300031456 Ga0307513_10153500 Ga0307513_101535002 309
1043 3300031838 Ga0307518_10215144 Ga0307518_102151442 309
1044 3300047472 Ga0495686_0010216 Ga0495686_0010216_2561_3523 309
1045 3300053118 Ga0500594_0028006 Ga0500594_0028006_452_1414 309
1046 3300053130 Ga0500642_0011532 Ga0500642_0011532_371_1339 309
1047 3300053146 Ga0500588_0000272 Ga0500588_0000272_2486_3436 309
1048 3300053153 Ga0500616_0006340 Ga0500616_0006340_3170_4138 309
1049 3300053158 Ga0500627_0023387 Ga0500627_0023387_760_1728 309

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

67

230

0.94

PF16881

LIAS_N

N-terminal domain of lipoyl synthase of Radical_SAM family

6

52

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.9617 18 290
5exk-assembly6.cif.gz_K crystal structure of m. tuberculosis lipoyl synthase with 6-thiooctanoyl peptide intermediate 0.9447 18 301
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9346 20 290
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.9246 20 290
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.9222 18 290
ID Description Score Start End Superfamily
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9847 68 274 3.20.20.70
af_P9WK91_74_280_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.98 68 274 3.20.20.70
af_P60716_82_298_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.98 64 276 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9659 58 264 3.20.20.70
af_Q2FZX4_3_265_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9603 12 269 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A355BV36-F1-model_v4 Lipoyl synthase 0.9943 155 295 GO:0016992
GO:0046872
GO:0051539
AF-A0A1T1D1J6-F1-model_v4 Lipoyl synthase 0.994 206 291 GO:0016992
GO:0051539
AF-A0A3D5KS07-F1-model_v4 Lipoyl synthase 0.9922 186 295 GO:0016992
GO:0046872
GO:0051539
AF-A0A6L8I7H7-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) 0.9914 103 293 GO:0016992
GO:0046872
GO:0051539
AF-A0A848UFZ2-F1-model_v4 Lipoyl synthase (EC 2.8.1.8) 0.9902 110 293 GO:0005737
GO:0016992
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
85.46 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map