F488979

General Info

Members Datasets Scaffolds Average Seq Length
1047 455 2094 214

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0052130|Ga0466957_0052130_1669_2442
Length 239
Sequence MTAEMKTATTMSDNIAAAGVARAETSVLIVDDHAVVREGYRRLLEVSGNLRICGEAANATEAYQRFCALKPDVVVMDVSLPGASGIEAMRRVLAREPAARVLIFSVHEDALFVRRALDAGALGYVTKASAPDVLVEAVRTVARRASYLSPDVSQALAMRTTLSAGPPGRQLSAREFEVLRMLVQGYTLPTIAEKLGLSQKTVANHQSAIRHKFGADNGVQLAQIASRLGLHLTGSASPA

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
122 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
192 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
193 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
194 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
195 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
196 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
197 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
198 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
201 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
202 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
203 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
204 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
205 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
214 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
217 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
218 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
219 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
220 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
226 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
227 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
228 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
229 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
231 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
235 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
238 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
239 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
240 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
242 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
243 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
244 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
247 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
248 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
249 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
250 3300044668 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 Metagenome Unclassified
251 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
252 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
260 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
261 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
262 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
263 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
264 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
265 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
266 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
267 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
270 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
271 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
272 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
273 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
274 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
277 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
278 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
279 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
280 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
281 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
282 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
283 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
284 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
285 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
286 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
287 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
288 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
289 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
290 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
291 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
292 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
293 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
294 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
295 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
296 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
297 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
298 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
299 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
300 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
301 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
302 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
303 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
308 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
309 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
310 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
313 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
314 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
315 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
319 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
320 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
321 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
322 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
323 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
324 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
325 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
328 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
329 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
332 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
333 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
334 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
335 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
336 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
337 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
338 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
339 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
345 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
346 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
359 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
360 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
361 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
362 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
363 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
364 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
365 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
366 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
369 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
374 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
375 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
376 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
378 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
382 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
383 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
384 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
385 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
386 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
387 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
388 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
389 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
390 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
391 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
394 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
399 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
400 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
401 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
402 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
403 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
404 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
405 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
406 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
407 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
408 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
409 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
410 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
413 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
414 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
415 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
416 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
417 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
418 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
419 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
420 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
421 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
422 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
423 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
424 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
425 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
426 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
427 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
428 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
429 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
430 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
431 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
432 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
433 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
434 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
435 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
436 2818991450 Burkholderia sp. 604 Isolate Unclassified
437 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
438 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
439 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
440 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
441 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
442 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
443 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
444 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
445 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
446 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
447 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
448 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
449 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
450 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
451 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
452 639633007 Azoarcus olearius BH72 Isolate Unclassified
453 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
454 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
455 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.13
Metatranscriptomes 0.67
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.82
Nodule 1.24
Rhizoplane 4.78
Rhizosphere 82.33
Stem 0
Stem Tuber 0
Unclassified 5.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0052130 3300044842 Bacteria 2491
2 JGI24740J21852_10054051 3300001979 Bacteria 1136
3 JGI24739J22299_10017569 3300001989 Bacteria 2579
4 JGI24737J22298_10019013 3300001990 Bacteria 2198
5 JGI24735J21928_10001150 3300002067 Bacteria 9464
6 JGI24735J21928_10001956 3300002067 Bacteria 7237
7 JGI24738J21930_10003481 3300002075 Bacteria 3964
8 JGI25156J39149_1001373 3300002705 Bacteria 10417
9 JGI25156J39149_1002723 3300002705 Bacteria 6158
10 JGI25165J46597_1002677 3300003214 Bacteria 5346
11 rootL2_10123036 3300003322 Bacteria 1778
12 rootH1_10138059 3300003323 Bacteria 2499
13 rootH1_10211585 3300003323 Bacteria 1684
14 JGI25160J50197_1000120 3300003354 Bacteria 71260
15 Ga0006556J51387_1024168 3300003479 Bacteria 4133
16 Ga0006554J51385_1022598 3300003567 Bacteria 4366
17 Ga0055533_1000069 3300003756 Bacteria 153904
18 Ga0055533_1001661 3300003756 Bacteria 5723
19 Ga0055532_1000011 3300003758 Bacteria 385294
20 Ga0055527_1000009 3300003760 Bacteria 385294
21 Ga0055535_1000008 3300003761 Bacteria 385294
22 Ga0055542_1000014 3300003762 Bacteria 385294
23 Ga0055529_1000010 3300003763 Bacteria 385294
24 Ga0065165_1000382 3300005262 Bacteria 71834
25 Ga0070658_10174489 3300005327 Unclassified 1807
26 Ga0070658_10216191 3300005327 Bacteria 1620
27 Ga0070658_10267467 3300005327 Bacteria 1453
28 Ga0070676_10048106 3300005328 Bacteria 2493
29 Ga0070676_10130321 3300005328 Bacteria 1589
30 Ga0070683_100010629 3300005329 Bacteria 7911
31 Ga0070670_100074863 3300005331 Bacteria 2909
32 Ga0070670_100144328 3300005331 Bacteria 2059
33 Ga0070677_10000351 3300005333 Bacteria 16069
34 Ga0068869_100018796 3300005334 Bacteria 4711
35 Ga0068869_100029457 3300005334 Bacteria 3846
36 Ga0068869_100156722 3300005334 Bacteria 1770
37 Ga0068869_100474791 3300005334 Bacteria 1040
38 Ga0068869_100517622 3300005334 Unclassified 998
39 Ga0068869_100529748 3300005334 Bacteria 987
40 Ga0070666_10047242 3300005335 Bacteria 2890
41 Ga0070666_10084508 3300005335 Bacteria 2172
42 Ga0070680_100028148 3300005336 Bacteria 4507
43 Ga0070680_100029377 3300005336 Unclassified 4416
44 Ga0068868_100013696 3300005338 Bacteria 5956
45 Ga0068868_100020809 3300005338 Bacteria 4937
46 Ga0068868_100046927 3300005338 Bacteria 3382
47 Ga0070689_100019246 3300005340 Bacteria 5046
48 Ga0070689_100027205 3300005340 Bacteria 4311
49 Ga0070691_10023817 3300005341 Bacteria 2844
50 Ga0070692_10002831 3300005345 Bacteria 6852
51 Ga0070692_10056894 3300005345 Bacteria 2049
52 Ga0070668_100030554 3300005347 Bacteria 4096
53 Ga0070668_100128434 3300005347 Bacteria 2032
54 Ga0070668_100167017 3300005347 Bacteria 1789
55 Ga0070669_100118158 3300005353 Bacteria 2019
56 Ga0070675_100009721 3300005354 Bacteria 7492
57 Ga0070675_100055802 3300005354 Bacteria 3253
58 Ga0070675_100901453 3300005354 Bacteria 810
59 Ga0070671_100000338 3300005355 Bacteria 32240
60 Ga0070674_100001615 3300005356 Bacteria 12104
61 Ga0070674_100045777 3300005356 Bacteria 2990
62 Ga0070674_100062933 3300005356 Bacteria 2595
63 Ga0070673_100000839 3300005364 Bacteria 17232
64 Ga0070673_100215208 3300005364 Unclassified 1661
65 Ga0070673_100287134 3300005364 Bacteria 1445
66 Ga0070688_100251181 3300005365 Archaea 1259
67 Ga0070659_100169259 3300005366 Bacteria 1789
68 Ga0070659_100714409 3300005366 Bacteria 867
69 Ga0070667_100027313 3300005367 Bacteria 4748
70 Ga0070667_100052700 3300005367 Bacteria 3434
71 Ga0070667_100084929 3300005367 Bacteria 2714
72 Ga0070667_100130646 3300005367 Bacteria 2191
73 Ga0070667_100240358 3300005367 Bacteria 1617
74 Ga0070667_100394856 3300005367 Archaea 1258
75 Ga0070714_100108308 3300005435 Unclassified 2457
76 Ga0070713_100000153 3300005436 Bacteria 46278
77 Ga0070713_100062207 3300005436 Unclassified 3126
78 Ga0070701_10001527 3300005438 Bacteria 8589
79 Ga0070705_100085919 3300005440 Unclassified 1946
80 Ga0070705_100385541 3300005440 Bacteria 1033
81 Ga0070700_100001746 3300005441 Bacteria 10924
82 Ga0070700_100006528 3300005441 Bacteria 6240
83 Ga0070700_100191857 3300005441 Archaea 1429
84 Ga0070694_100075617 3300005444 Bacteria 2330
85 Ga0070663_100063430 3300005455 Bacteria 2668
86 Ga0070663_100074045 3300005455 Bacteria 2486
87 Ga0070663_100214623 3300005455 Bacteria 1508
88 Ga0070663_100585163 3300005455 Bacteria 937
89 Ga0070663_100645814 3300005455 Bacteria 894
90 Ga0070678_100000181 3300005456 Bacteria 27394
91 Ga0070678_100002694 3300005456 Bacteria 9795
92 Ga0070678_100174321 3300005456 Bacteria 1755
93 Ga0070678_100205645 3300005456 Bacteria 1628
94 Ga0070678_100221381 3300005456 Bacteria 1573
95 Ga0070678_100418737 3300005456 Bacteria 1167
96 Ga0070662_100241069 3300005457 Bacteria 1450
97 Ga0070662_100544280 3300005457 Bacteria 972
98 Ga0070681_10025996 3300005458 Bacteria 5886
99 Ga0070681_10035517 3300005458 Bacteria 5008
100 Ga0070681_10039374 3300005458 Unclassified 4739
101 Ga0068867_100002536 3300005459 Bacteria 12856
102 Ga0068867_100007853 3300005459 Bacteria 7541
103 Ga0068867_100021131 3300005459 Bacteria 4643
104 Ga0068867_100030435 3300005459 Bacteria 3894
105 Ga0070679_100045148 3300005530 Unclassified 4390
106 Ga0070679_100081818 3300005530 Bacteria 3218
107 Ga0070684_100205193 3300005535 Bacteria 1796
108 Ga0068853_100014471 3300005539 Bacteria 6462
109 Ga0068853_100033272 3300005539 Bacteria 4373
110 Ga0068853_100194660 3300005539 Bacteria 1843
111 Ga0070672_100008475 3300005543 Bacteria 7036
112 Ga0070672_100032768 3300005543 Bacteria 3926
113 Ga0070672_100112396 3300005543 Bacteria 2222
114 Ga0070672_100440337 3300005543 Bacteria 1121
115 Ga0070686_100036020 3300005544 Bacteria 3060
116 Ga0070696_100140430 3300005546 Unclassified 1765
117 Ga0070696_100142512 3300005546 Bacteria 1753
118 Ga0070693_100157464 3300005547 Bacteria 1444
119 Ga0070665_100002442 3300005548 Bacteria 20489
120 Ga0070665_100006578 3300005548 Bacteria 11813
121 Ga0070665_100008852 3300005548 Bacteria 10193
122 Ga0070665_100024587 3300005548 Bacteria 6069
123 Ga0070665_100042072 3300005548 Bacteria 4592
124 Ga0070665_100059437 3300005548 Bacteria 3832
125 Ga0070665_100195334 3300005548 Bacteria 2024
126 Ga0070704_100091858 3300005549 Bacteria 2265
127 Ga0068855_100022954 3300005563 Bacteria 7476
128 Ga0068855_100117559 3300005563 Bacteria 3046
129 Ga0068855_100153203 3300005563 Bacteria 2620
130 Ga0068855_100248832 3300005563 Bacteria 1983
131 Ga0068857_100093233 3300005577 Bacteria 2697
132 Ga0068857_100587468 3300005577 Bacteria 1052
133 Ga0068857_100675357 3300005577 Bacteria 980
134 Ga0068854_100774360 3300005578 Bacteria 834
135 Ga0070702_100173989 3300005615 Bacteria 1403
136 Ga0068852_100126971 3300005616 Bacteria 2343
137 Ga0068859_100076262 3300005617 Bacteria 3393
138 Ga0068859_100228290 3300005617 Bacteria 1950
139 Ga0068859_100505306 3300005617 Archaea 1304
140 Ga0068859_101170093 3300005617 Bacteria 847
141 Ga0068864_100003186 3300005618 Bacteria 13568
142 Ga0068864_100045568 3300005618 Bacteria 3762
143 Ga0068866_10014311 3300005718 Bacteria 3500
144 Ga0068866_10021453 3300005718 Bacteria 2975
145 Ga0068861_100005585 3300005719 Bacteria 8525
146 Ga0068861_100010029 3300005719 Bacteria 6565
147 Ga0068861_100050610 3300005719 Bacteria 3151
148 Ga0068861_100201352 3300005719 Unclassified 1671
149 Ga0068861_100225028 3300005719 Unclassified 1588
150 Ga0068861_100919069 3300005719 Bacteria 830
151 Ga0068851_10003036 3300005834 Bacteria 7420
152 Ga0068851_10333053 3300005834 Bacteria 879
153 Ga0068870_10016848 3300005840 Bacteria 3502
154 Ga0068870_10027184 3300005840 Bacteria 2859
155 Ga0068863_100094694 3300005841 Bacteria 2834
156 Ga0068858_100013613 3300005842 Bacteria 7677
157 Ga0068858_100041174 3300005842 Unclassified 4284
158 Ga0068858_100413726 3300005842 Bacteria 1296
159 Ga0068860_100004363 3300005843 Bacteria 14447
160 Ga0068860_100031666 3300005843 Bacteria 5084
161 Ga0068860_100045577 3300005843 Bacteria 4182
162 Ga0068860_100548273 3300005843 Bacteria 1158
163 Ga0068860_100669112 3300005843 Unclassified 1046
164 Ga0068862_100031027 3300005844 Bacteria 4507
165 Ga0068862_100253991 3300005844 Bacteria 1603
166 Ga0068862_100466779 3300005844 Unclassified 1192
167 Ga0068862_100727896 3300005844 Unclassified 963
168 Ga0081539_10000159 3300005985 Bacteria 157561
169 Ga0070712_100148848 3300006175 Bacteria 1795
170 Ga0075367_10249451 3300006178 Bacteria 1113
171 Ga0097621_100011909 3300006237 Bacteria 6432
172 Ga0097621_100038168 3300006237 Bacteria 3854
173 Ga0097621_100052279 3300006237 Bacteria 3328
174 Ga0097621_100271903 3300006237 Unclassified 1489
175 Ga0068871_100037560 3300006358 Bacteria 3863
176 Ga0068871_100048205 3300006358 Unclassified 3438
177 Ga0068871_100112594 3300006358 Unclassified 2290
178 Ga0068871_100153916 3300006358 Bacteria 1962
179 Ga0075428_100006300 3300006844 Bacteria 13190
180 Ga0075428_100755954 3300006844 Bacteria 1034
181 Ga0075430_100094685 3300006846 Bacteria 2497
182 Ga0075431_100033265 3300006847 Bacteria 5314
183 Ga0075434_100021209 3300006871 Bacteria 6314
184 Ga0075429_100016275 3300006880 Bacteria 6445
185 Ga0068865_100003361 3300006881 Bacteria 9581
186 Ga0068865_100004597 3300006881 Bacteria 8331
187 Ga0068865_100093990 3300006881 Bacteria 2181
188 Ga0068865_100098777 3300006881 Archaea 2133
189 Ga0068865_100262610 3300006881 Bacteria 1367
190 Ga0097620_100076262 3300006931 Bacteria 3393
191 Ga0097620_100228291 3300006931 Bacteria 1950
192 Ga0097620_100505298 3300006931 Archaea 1304
193 Ga0097620_101170166 3300006931 Bacteria 847
194 Ga0075435_100051111 3300007076 Bacteria 3329
195 Ga0099794_10067718 3300007265 Unclassified 1744
196 Ga0099794_10222216 3300007265 Bacteria 970
197 Ga0099795_10000120 3300007788 Bacteria 13107
198 Ga0099795_10035530 3300007788 Unclassified 1743
199 Ga0105251_10000072 3300009011 Bacteria 97611
200 Ga0105251_10000295 3300009011 Bacteria 50007
201 Ga0105244_10049780 3300009036 Bacteria 2139
202 Ga0105240_10059434 3300009093 Bacteria 4771
203 Ga0105240_10104035 3300009093 Bacteria 3448
204 Ga0105240_10124025 3300009093 Bacteria 3107
205 Ga0105240_10167188 3300009093 Bacteria 2608
206 Ga0105240_10515445 3300009093 Unclassified 1328
207 Ga0105240_10524544 3300009093 Bacteria 1314
208 Ga0111539_10007194 3300009094 Bacteria 14261
209 Ga0111539_10085810 3300009094 Bacteria 3700
210 Ga0111539_10135393 3300009094 Bacteria 2885
211 Ga0111539_10336370 3300009094 Bacteria 1757
212 Ga0105245_10004734 3300009098 Bacteria 12017
213 Ga0105247_10171600 3300009101 Bacteria 1442
214 Ga0114129_10007843 3300009147 Bacteria 15190
215 Ga0105243_10003015 3300009148 Bacteria 13897
216 Ga0105243_10586516 3300009148 Bacteria 1071
217 Ga0105241_10229904 3300009174 Unclassified 1563
218 Ga0105242_10005521 3300009176 Bacteria 9761
219 Ga0105242_10104211 3300009176 Bacteria 2408
220 Ga0105242_10267039 3300009176 Bacteria 1548
221 Ga0105248_10059415 3300009177 Bacteria 4295
222 Ga0105248_10066595 3300009177 Bacteria 4044
223 Ga0105248_10226308 3300009177 Bacteria 2105
224 Ga0105248_10349742 3300009177 Bacteria 1664
225 Ga0105237_10026511 3300009545 Bacteria 5923
226 Ga0105237_10079351 3300009545 Bacteria 3272
227 Ga0105237_10136375 3300009545 Unclassified 2448
228 Ga0105238_10097485 3300009551 Bacteria 2926
229 Ga0105238_10110252 3300009551 Bacteria 2733
230 Ga0105238_10466247 3300009551 Bacteria 1261
231 Ga0105238_10605905 3300009551 Unclassified 1103
232 Ga0105238_10836203 3300009551 Bacteria 937
233 Ga0105249_10126338 3300009553 Bacteria 2436
234 Ga0105239_10409879 3300010375 Bacteria 1534
235 Ga0105239_10544081 3300010375 Bacteria 1322
236 Ga0105246_10191504 3300011119 Bacteria 1583
237 Ga0157369_10009789 3300013105 Bacteria 10965
238 Ga0157369_10062985 3300013105 Bacteria 3996
239 Ga0157369_10108300 3300013105 Bacteria 2955
240 Ga0157369_10137543 3300013105 Bacteria 2585
241 Ga0157369_10347850 3300013105 Bacteria 1540
242 Ga0157369_10955847 3300013105 Bacteria 878
243 Ga0157374_10014152 3300013296 Bacteria 6975
244 Ga0157374_10100947 3300013296 Bacteria 2766
245 Ga0157374_10659498 3300013296 Bacteria 1058
246 Ga0157378_10003237 3300013297 Bacteria 14493
247 Ga0157378_10010149 3300013297 Bacteria 8213
248 Ga0157378_10116295 3300013297 Unclassified 2459
249 Ga0157378_10264173 3300013297 Unclassified 1653
250 Ga0163162_10008237 3300013306 Bacteria 10175
251 Ga0163162_10021095 3300013306 Bacteria 6408
252 Ga0163162_10131139 3300013306 Bacteria 2615
253 Ga0163162_10619850 3300013306 Bacteria 1207
254 Ga0157372_10097140 3300013307 Bacteria 3359
255 Ga0157375_10000068 3300013308 Bacteria 110172
256 Ga0157375_10005514 3300013308 Bacteria 11010
257 Ga0157375_10024005 3300013308 Bacteria 5637
258 Ga0157375_10061887 3300013308 Bacteria 3718
259 Ga0157375_10524684 3300013308 Bacteria 1347
260 Ga0157375_10919525 3300013308 Unclassified 1018
261 Ga0163163_10024773 3300014325 Bacteria 5714
262 Ga0157380_10035257 3300014326 Bacteria 3864
263 Ga0157380_10269691 3300014326 Archaea 1551
264 Ga0182008_10173299 3300014497 Bacteria 1090
265 Ga0157379_10002215 3300014968 Bacteria 16168
266 Ga0157379_10013196 3300014968 Bacteria 7235
267 Ga0157379_10384897 3300014968 Bacteria 1287
268 Ga0157379_10688444 3300014968 Bacteria 959
269 Ga0157376_10059846 3300014969 Bacteria 3195
270 Ga0182007_10001285 3300015262 Bacteria 13587
271 Ga0163161_10036566 3300017792 Bacteria 3516
272 Ga0163161_10250311 3300017792 Bacteria 1381
273 Ga0209435_107632 3300025206 Bacteria 1195
274 Ga0209674_100011 3300025226 Bacteria 997175
275 Ga0209674_100029 3300025226 Bacteria 466683
276 Ga0209672_100002 3300025228 Bacteria 1733325
277 Ga0209147_100003 3300025229 Bacteria 1733325
278 Ga0207427_100974 3300025231 Bacteria 12147
279 Ga0209258_100005 3300025242 Bacteria 1087938
280 Ga0209646_1015382 3300025246 Bacteria 1143
281 Ga0209148_1000006 3300025254 Bacteria 1733325
282 Ga0209759_1000006 3300025256 Bacteria 492407
283 Ga0209759_1000008 3300025256 Bacteria 461395
284 Ga0209233_1000018 3300025261 Bacteria 886857
285 Ga0209455_1000003 3300025272 Bacteria 1471893
286 Ga0209564_1016088 3300025295 Bacteria 3000
287 Ga0207426_1000004 3300025302 Bacteria 1047900
288 Ga0207426_1012265 3300025302 Bacteria 3226
289 Ga0207656_10006515 3300025321 Bacteria 4203
290 Ga0207655_1032000 3300025728 Bacteria 2412
291 Ga0207713_1000651 3300025735 Bacteria 33250
292 Ga0207713_1002352 3300025735 Bacteria 13865
293 Ga0207682_10006350 3300025893 Bacteria 4770
294 Ga0207642_10008072 3300025899 Bacteria 3591
295 Ga0207642_10057598 3300025899 Bacteria 1788
296 Ga0207642_10092002 3300025899 Archaea 1500
297 Ga0207688_10114191 3300025901 Bacteria 1570
298 Ga0207680_10010115 3300025903 Bacteria 4707
299 Ga0207680_10237328 3300025903 Bacteria 1255
300 Ga0207647_10019319 3300025904 Bacteria 4585
301 Ga0207647_10061543 3300025904 Bacteria 2290
302 Ga0207645_10011586 3300025907 Bacteria 6012
303 Ga0207645_10317684 3300025907 Bacteria 1039
304 Ga0207643_10011965 3300025908 Bacteria 4685
305 Ga0207643_10012010 3300025908 Bacteria 4677
306 Ga0207643_10248431 3300025908 Bacteria 1095
307 Ga0207705_10090441 3300025909 Bacteria 2241
308 Ga0207705_10196493 3300025909 Bacteria 1527
309 Ga0207654_10208522 3300025911 Bacteria 1290
310 Ga0207654_10414039 3300025911 Bacteria 939
311 Ga0207707_10027860 3300025912 Bacteria 4940
312 Ga0207707_10289554 3300025912 Bacteria 1417
313 Ga0207707_10926660 3300025912 Unclassified 719
314 Ga0207695_10029609 3300025913 Bacteria 6043
315 Ga0207695_10038625 3300025913 Bacteria 5137
316 Ga0207695_10043698 3300025913 Bacteria 4774
317 Ga0207695_10292463 3300025913 Unclassified 1521
318 Ga0207671_10073240 3300025914 Bacteria 2558
319 Ga0207671_10589308 3300025914 Bacteria 886
320 Ga0207660_10104114 3300025917 Bacteria 2124
321 Ga0207660_10156095 3300025917 Bacteria 1757
322 Ga0207660_10228151 3300025917 Bacteria 1463
323 Ga0207657_10028819 3300025919 Bacteria 5059
324 Ga0207652_10247527 3300025921 Bacteria 1607
325 Ga0207681_10044962 3300025923 Bacteria 2962
326 Ga0207694_11067664 3300025924 Bacteria 683
327 Ga0207659_10027144 3300025926 Bacteria 3872
328 Ga0207659_10711652 3300025926 Unclassified 860
329 Ga0207687_10072238 3300025927 Bacteria 2468
330 Ga0207700_10000047 3300025928 Bacteria 87205
331 Ga0207700_10047061 3300025928 Bacteria 3195
332 Ga0207700_10393319 3300025928 Unclassified 1214
333 Ga0207644_10573841 3300025931 Bacteria 935
334 Ga0207706_10246765 3300025933 Bacteria 1560
335 Ga0207706_10565182 3300025933 Bacteria 978
336 Ga0207686_10234281 3300025934 Bacteria 1333
337 Ga0207670_10059524 3300025936 Bacteria 2598
338 Ga0207669_10067251 3300025937 Bacteria 2232
339 Ga0207669_10087505 3300025937 Bacteria 2018
340 Ga0207669_10178774 3300025937 Bacteria 1519
341 Ga0207669_10340893 3300025937 Unclassified 1154
342 Ga0207704_10011712 3300025938 Bacteria 4331
343 Ga0207704_10073221 3300025938 Bacteria 2181
344 Ga0207704_10374864 3300025938 Bacteria 1115
345 Ga0207704_10488889 3300025938 Bacteria 990
346 Ga0207691_10000445 3300025940 Bacteria 40892
347 Ga0207691_10024348 3300025940 Bacteria 5694
348 Ga0207691_10319911 3300025940 Bacteria 1330
349 Ga0207691_10870717 3300025940 Unclassified 755
350 Ga0207711_10064107 3300025941 Bacteria 3173
351 Ga0207711_10071543 3300025941 Unclassified 3009
352 Ga0207711_10143482 3300025941 Bacteria 2150
353 Ga0207711_10162086 3300025941 Bacteria 2025
354 Ga0207711_10236356 3300025941 Bacteria 1675
355 Ga0207689_10000498 3300025942 Bacteria 37073
356 Ga0207689_10001020 3300025942 Bacteria 26905
357 Ga0207689_10366949 3300025942 Bacteria 1198
358 Ga0207689_10697380 3300025942 Unclassified 856
359 Ga0207661_10046053 3300025944 Bacteria 3457
360 Ga0207667_10043349 3300025949 Bacteria 4775
361 Ga0207651_10319137 3300025960 Bacteria 1298
362 Ga0207651_10537612 3300025960 Archaea 1015
363 Ga0207712_10049841 3300025961 Bacteria 2921
364 Ga0207668_10067307 3300025972 Bacteria 2542
365 Ga0207668_10091729 3300025972 Archaea 2234
366 Ga0207668_10188374 3300025972 Bacteria 1633
367 Ga0207640_10218315 3300025981 Bacteria 1458
368 Ga0207658_10062478 3300025986 Bacteria 2787
369 Ga0207658_10096987 3300025986 Bacteria 2300
370 Ga0207658_10292105 3300025986 Bacteria 1401
371 Ga0207658_10348038 3300025986 Archaea 1290
372 Ga0207658_10365578 3300025986 Bacteria 1260
373 Ga0207658_10604588 3300025986 Bacteria 985
374 Ga0207677_10047245 3300026023 Bacteria 2889
375 Ga0207703_10029837 3300026035 Bacteria 4305
376 Ga0207703_10033209 3300026035 Bacteria 4088
377 Ga0207703_10083757 3300026035 Unclassified 2665
378 Ga0207703_10086646 3300026035 Bacteria 2624
379 Ga0207703_10165361 3300026035 Bacteria 1941
380 Ga0207703_10515128 3300026035 Bacteria 1124
381 Ga0207639_10094305 3300026041 Bacteria 2402
382 Ga0207639_10712210 3300026041 Bacteria 932
383 Ga0207678_10036583 3300026067 Bacteria 4273
384 Ga0207678_10104480 3300026067 Bacteria 2417
385 Ga0207678_10467084 3300026067 Bacteria 1098
386 Ga0207708_10004000 3300026075 Bacteria 10847
387 Ga0207708_10004970 3300026075 Bacteria 9794
388 Ga0207708_10085503 3300026075 Archaea 2426
389 Ga0207708_10460980 3300026075 Bacteria 1060
390 Ga0207641_10061898 3300026088 Bacteria 3192
391 Ga0207641_10508327 3300026088 Bacteria 1171
392 Ga0207648_10004532 3300026089 Bacteria 14240
393 Ga0207648_10004732 3300026089 Bacteria 13902
394 Ga0207648_10013066 3300026089 Bacteria 7741
395 Ga0207648_10031859 3300026089 Bacteria 4659
396 Ga0207648_10034863 3300026089 Bacteria 4436
397 Ga0207676_10055597 3300026095 Bacteria 3108
398 Ga0207676_10212746 3300026095 Bacteria 1716
399 Ga0207674_10066488 3300026116 Bacteria 3631
400 Ga0207674_10726576 3300026116 Bacteria 958
401 Ga0207675_100001881 3300026118 Bacteria 20975
402 Ga0207675_100010665 3300026118 Bacteria 8609
403 Ga0207675_100114497 3300026118 Bacteria 2547
404 Ga0207675_100135759 3300026118 Bacteria 2334
405 Ga0207675_100260001 3300026118 Bacteria 1682
406 Ga0207675_101022904 3300026118 Bacteria 845
407 Ga0207683_10000568 3300026121 Bacteria 34203
408 Ga0207683_10005214 3300026121 Bacteria 11158
409 Ga0207683_10125795 3300026121 Bacteria 2304
410 Ga0207683_10132900 3300026121 Bacteria 2238
411 Ga0207683_10616848 3300026121 Unclassified 1004
412 Ga0207698_10214500 3300026142 Bacteria 1734
413 Ga0209371_1006863 3300027312 Bacteria 4113
414 Ga0207428_10050472 3300027907 Bacteria 3328
415 Ga0207428_10344976 3300027907 Bacteria 1096
416 Ga0265354_1002352 3300028016 Bacteria 2369
417 Ga0268266_10000572 3300028379 Bacteria 50809
418 Ga0268266_10002990 3300028379 Bacteria 17432
419 Ga0268266_10064935 3300028379 Bacteria 3154
420 Ga0268266_10067015 3300028379 Bacteria 3106
421 Ga0268266_10105119 3300028379 Bacteria 2494
422 Ga0268266_10197071 3300028379 Bacteria 1842
423 Ga0268266_10604474 3300028379 Bacteria 1053
424 Ga0268265_10042291 3300028380 Bacteria 3380
425 Ga0268265_10048302 3300028380 Bacteria 3194
426 Ga0268265_11227967 3300028380 Bacteria 748
427 Ga0268264_10320542 3300028381 Bacteria 1465
428 Ga0268264_10398949 3300028381 Bacteria 1321
429 Ga0265337_1100367 3300028556 Bacteria 788
430 Ga0265334_10001462 3300028573 Bacteria 11372
431 Ga0265334_10020034 3300028573 Bacteria 2743
432 Ga0265318_10022970 3300028577 Bacteria 2489
433 Ga0265323_10002683 3300028653 Bacteria 8041
434 Ga0265323_10058555 3300028653 Bacteria 1345
435 Ga0307515_10030456 3300028794 Bacteria 9058
436 Ga0265338_10042471 3300028800 Bacteria 4233
437 Ga0265338_10045686 3300028800 Bacteria 4023
438 Ga0265338_10115264 3300028800 Bacteria 2154
439 Ga0265338_10227645 3300028800 Bacteria 1388
440 Ga0268256_1003422 3300030500 Bacteria 7151
441 Ga0265762_1011265 3300030760 Bacteria 1600
442 Ga0265760_10000144 3300031090 Bacteria 18264
443 Ga0265330_10030371 3300031235 Bacteria 2426
444 Ga0265332_10001019 3300031238 Bacteria 16538
445 Ga0265332_10010047 3300031238 Bacteria 4215
446 Ga0265332_10039408 3300031238 Bacteria 2046
447 Ga0265320_10000602 3300031240 Bacteria 27546
448 Ga0265320_10083500 3300031240 Bacteria 1488
449 Ga0265325_10042429 3300031241 Bacteria 2378
450 Ga0265329_10002719 3300031242 Bacteria 7939
451 Ga0265340_10180690 3300031247 Bacteria 954
452 Ga0265340_10210306 3300031247 Bacteria 873
453 Ga0265339_10011690 3300031249 Bacteria 5393
454 Ga0265331_10001819 3300031250 Bacteria 15112
455 Ga0265331_10002369 3300031250 Bacteria 12804
456 Ga0265331_10011222 3300031250 Bacteria 4914
457 Ga0265327_10016362 3300031251 Unclassified 4713
458 Ga0307513_10314729 3300031456 Bacteria 1326
459 Ga0307513_10496151 3300031456 Bacteria 939
460 Ga0307509_10000080 3300031507 Bacteria 134551
461 Ga0307509_10000109 3300031507 Bacteria 117520
462 Ga0307509_10000138 3300031507 Bacteria 108694
463 Ga0307509_10003473 3300031507 Bacteria 23867
464 Ga0265313_10002432 3300031595 Bacteria 16073
465 Ga0307508_10013259 3300031616 Bacteria 7541
466 Ga0316575_10018727 3300031665 Bacteria 2642
467 Ga0316575_10066616 3300031665 Bacteria 1443
468 Ga0316575_10116421 3300031665 Unclassified 1092
469 Ga0316575_10238337 3300031665 Unclassified 761
470 Ga0316579_10031990 3300031691 Bacteria 2411
471 Ga0316579_10089283 3300031691 Bacteria 1471
472 Ga0265342_10209958 3300031712 Bacteria 1053
473 Ga0265342_10323080 3300031712 Bacteria 808
474 Ga0316576_10012263 3300031727 Bacteria 5657
475 Ga0316576_10017687 3300031727 Bacteria 4849
476 Ga0316576_10048489 3300031727 Bacteria 3081
477 Ga0316576_10158196 3300031727 Unclassified 1708
478 Ga0316576_10307432 3300031727 Bacteria 1184
479 Ga0316576_10353179 3300031727 Bacteria 1094
480 Ga0316578_10052083 3300031728 Bacteria 2398
481 Ga0316578_10083573 3300031728 Bacteria 1902
482 Ga0316578_10176319 3300031728 Bacteria 1288
483 Ga0316578_10217971 3300031728 Bacteria 1147
484 Ga0307516_10028617 3300031730 Bacteria 5637
485 Ga0316577_10006757 3300031733 Bacteria 6086
486 Ga0316577_10012463 3300031733 Bacteria 4632
487 Ga0307413_10583864 3300031824 Unclassified 912
488 Ga0307410_10077398 3300031852 Unclassified 2325
489 Ga0307412_10000002 3300031911 Bacteria 743446
490 Ga0307409_100929650 3300031995 Bacteria 885
491 Ga0307416_100163760 3300032002 Unclassified 2060
492 Ga0307411_10789175 3300032005 Bacteria 835
493 Ga0316583_10006750 3300032133 Bacteria 4137
494 Ga0316583_10051104 3300032133 Bacteria 1454
495 Ga0316583_10125201 3300032133 Bacteria 895
496 Ga0316585_10000289 3300032137 Bacteria 11123
497 Ga0316585_10119428 3300032137 Unclassified 867
498 Ga0316580_10002263 3300032139 Bacteria 5266
499 Ga0316580_10023246 3300032139 Bacteria 1914
500 Ga0316593_10001799 3300032168 Bacteria 4887
501 Ga0307510_10080879 3300033180 Bacteria 3156
502 Ga0316588_1001564 3300033528 Bacteria 3801
503 Ga0316596_1002628 3300033541 Unclassified 3852
504 Ga0373944_0072616 3300035089 Bacteria 1123
505 Ga0373946_0215688 3300035171 Bacteria 925
506 Ga0373946_0238776 3300035171 Bacteria 883
507 Ga0316574_0001317 3300035398 Bacteria 11623
508 Ga0316574_0010561 3300035398 Bacteria 5224
509 Ga0316574_0023977 3300035398 Bacteria 3647
510 Ga0316574_0030810 3300035398 Bacteria 3251
511 Ga0316574_0063325 3300035398 Bacteria 2325
512 Ga0316574_0066234 3300035398 Bacteria 2275
513 Ga0316574_0117580 3300035398 Bacteria 1706
514 Ga0316574_0138912 3300035398 Bacteria 1565
515 Ga0316574_0216124 3300035398 Bacteria 1229
516 Ga0316574_0368876 3300035398 Bacteria 907
517 Ga0373924_0065757 3300035410 Bacteria 1523
518 Ga0373937_0570215 3300036401 Bacteria 1075
519 Ga0316582_0012654 3300036647 Bacteria 4718
520 Ga0316582_0020698 3300036647 Bacteria 3873
521 Ga0316582_0051419 3300036647 Bacteria 2614
522 Ga0316582_0095343 3300036647 Bacteria 1964
523 Ga0316582_0117772 3300036647 Bacteria 1775
524 Ga0316582_0476292 3300036647 Bacteria 860
525 Ga0316584_0016214 3300036712 Bacteria 5341
526 Ga0316584_0042188 3300036712 Unclassified 3401
527 Ga0316584_0165192 3300036712 Bacteria 1644
528 Ga0316584_0173216 3300036712 Bacteria 1599
529 Ga0316584_0246198 3300036712 Unclassified 1307
530 Ga0316584_0271739 3300036712 Bacteria 1234
531 Ga0316584_0300229 3300036712 Bacteria 1163
532 Ga0316584_0322941 3300036712 Bacteria 1113
533 Ga0316584_0324744 3300036712 Bacteria 1109
534 Ga0373925_0001698 3300037068 Bacteria 18538
535 Ga0373925_0224329 3300037068 Unclassified 1501
536 Ga0395899_0017299 3300037312 Bacteria 5494
537 Ga0395899_0282377 3300037312 Bacteria 1129
538 Ga0395899_0430239 3300037312 Bacteria 868
539 Ga0395900_0006153 3300037418 Bacteria 12529
540 Ga0395898_0003979 3300037466 Bacteria 16267
541 Ga0395898_0132432 3300037466 Bacteria 2387
542 Ga0395898_0240898 3300037466 Unclassified 1725
543 Ga0395905_0000039 3300037471 Bacteria 253197
544 Ga0395905_0001775 3300037471 Bacteria 25025
545 Ga0395905_0003191 3300037471 Bacteria 17656
546 Ga0395905_0056879 3300037471 Bacteria 3658
547 Ga0395901_0402083 3300038443 Bacteria 1407
548 Ga0451789_0229899 3300041443 Bacteria 1453
549 Ga0451837_0547275 3300041494 Bacteria 1284
550 Ga0451577_0518880 3300042876 Bacteria 1082
551 Ga0466969_0017880 3300044656 Bacteria 3698
552 Ga0466980_0179952 3300044668 Bacteria 1377
553 Ga0466965_0142776 3300044683 Bacteria 1248
554 Ga0466966_0020736 3300044684 Bacteria 4319
555 Ga0466966_0090039 3300044684 Bacteria 1905
556 Ga0466966_0413324 3300044684 Bacteria 811
557 Ga0466961_0014233 3300044693 Bacteria 5106
558 Ga0466961_0016640 3300044693 Bacteria 4728
559 Ga0466971_0053406 3300044719 Bacteria 1821
560 Ga0466959_0003650 3300045049 Bacteria 10153
561 Ga0466959_0063359 3300045049 Bacteria 2685
562 Ga0466959_0137981 3300045049 Bacteria 1725
563 Ga0466959_0198179 3300045049 Bacteria 1399
564 Ga0451576_0000591 3300045051 Bacteria 76735
565 Ga0451576_0217638 3300045051 Bacteria 1994
566 Ga0451576_0541048 3300045051 Bacteria 1224
567 Ga0466967_0135264 3300045976 Bacteria 2292
568 Ga0466967_0293141 3300045976 Bacteria 1563
569 Ga0466967_0730155 3300045976 Bacteria 982
570 Ga0495592_0000035 3300046454 Bacteria 125802
571 Ga0495592_0006627 3300046454 Bacteria 8634
572 Ga0495592_0084501 3300046454 Bacteria 2290
573 Ga0495603_0000247 3300046455 Bacteria 28211
574 Ga0495603_0001296 3300046455 Bacteria 14581
575 Ga0495603_0020727 3300046455 Bacteria 3981
576 Ga0495603_0081926 3300046455 Bacteria 1890
577 Ga0495603_0203051 3300046455 Bacteria 1145
578 Ga0495590_0001367 3300046457 Bacteria 10596
579 Ga0495590_0001683 3300046457 Bacteria 9401
580 Ga0495590_0043304 3300046457 Bacteria 1570
581 Ga0495590_0337422 3300046457 Bacteria 571
582 Ga0495591_003664 3300046458 Bacteria 7816
583 Ga0495629_0001266 3300046459 Bacteria 19862
584 Ga0495629_0014967 3300046459 Bacteria 5573
585 Ga0495629_0015967 3300046459 Bacteria 5395
586 Ga0495638_0003399 3300046460 Bacteria 12549
587 Ga0495638_0277393 3300046460 Bacteria 912
588 Ga0495638_0352523 3300046460 Bacteria 777
589 Ga0495641_0014732 3300046461 Bacteria 4218
590 Ga0495641_0211065 3300046461 Bacteria 870
591 Ga0495651_0060103 3300046462 Bacteria 2912
592 Ga0495653_0003596 3300046463 Bacteria 12498
593 Ga0495653_0005250 3300046463 Bacteria 10537
594 Ga0495653_0030739 3300046463 Bacteria 4274
595 Ga0495653_0044728 3300046463 Bacteria 3435
596 Ga0495653_0075309 3300046463 Bacteria 2512
597 Ga0495653_0172741 3300046463 Bacteria 1490
598 Ga0495650_0001275 3300046471 Bacteria 25910
599 Ga0495650_0002047 3300046471 Bacteria 17583
600 Ga0495650_0003633 3300046471 Bacteria 11089
601 Ga0495650_0004710 3300046471 Bacteria 9197
602 Ga0495650_0010946 3300046471 Bacteria 5018
603 Ga0495650_0097659 3300046471 Unclassified 1107
604 Ga0495650_0139438 3300046471 Bacteria 878
605 Ga0495580_0000044 3300046472 Bacteria 69950
606 Ga0495580_0000077 3300046472 Bacteria 61724
607 Ga0495580_0009356 3300046472 Bacteria 7708
608 Ga0495580_0022615 3300046472 Bacteria 4624
609 Ga0495580_0329989 3300046472 Bacteria 1036
610 Ga0495582_0001360 3300046473 Bacteria 13761
611 Ga0495582_0007169 3300046473 Bacteria 6189
612 Ga0495582_0039912 3300046473 Bacteria 2584
613 Ga0495582_0128612 3300046473 Bacteria 1430
614 Ga0495605_0005792 3300046474 Bacteria 7149
615 Ga0495605_0018793 3300046474 Bacteria 3699
616 Ga0495605_0020633 3300046474 Bacteria 3500
617 Ga0495605_0116392 3300046474 Bacteria 1215
618 Ga0495639_0026261 3300046475 Bacteria 2573
619 Ga0495639_0034271 3300046475 Bacteria 2271
620 Ga0495662_0023637 3300046476 Bacteria 2967
621 Ga0495662_0085189 3300046476 Bacteria 1539
622 Ga0495664_0008582 3300046477 Bacteria 5700
623 Ga0495664_0148769 3300046477 Bacteria 1420
624 Ga0495584_0036642 3300046491 Bacteria 2478
625 Ga0495584_0052569 3300046491 Bacteria 2050
626 Ga0495585_0024735 3300046492 Bacteria 3442
627 Ga0495594_0015849 3300046499 Bacteria 3965
628 Ga0495594_0029153 3300046499 Bacteria 2982
629 Ga0495594_0681772 3300046499 Bacteria 581
630 Ga0495596_0030361 3300046500 Bacteria 2164
631 Ga0495596_0037859 3300046500 Bacteria 1907
632 Ga0495596_0166945 3300046500 Bacteria 856
633 Ga0495583_0001664 3300046506 Bacteria 21537
634 Ga0495583_0053072 3300046506 Bacteria 1841
635 Ga0495606_0006969 3300046507 Bacteria 10275
636 Ga0495606_0045509 3300046507 Bacteria 2907
637 Ga0495606_0078152 3300046507 Bacteria 2064
638 Ga0495606_0109983 3300046507 Bacteria 1664
639 Ga0495606_0157378 3300046507 Bacteria 1328
640 Ga0495608_0017380 3300046511 Bacteria 4976
641 Ga0495608_0025361 3300046511 Bacteria 4047
642 Ga0495610_0005022 3300046512 Bacteria 9573
643 Ga0495616_0044849 3300046513 Bacteria 2241
644 Ga0495618_0002030 3300046514 Bacteria 13282
645 Ga0495618_0030999 3300046514 Bacteria 3342
646 Ga0495618_0032691 3300046514 Bacteria 3258
647 Ga0495620_0032890 3300046515 Bacteria 2359
648 Ga0495628_0000465 3300046516 Bacteria 37158
649 Ga0495628_0010859 3300046516 Bacteria 7709
650 Ga0495628_0025779 3300046516 Bacteria 4800
651 Ga0495628_0032338 3300046516 Bacteria 4223
652 Ga0495628_0078933 3300046516 Bacteria 2559
653 Ga0495628_0539512 3300046516 Bacteria 838
654 Ga0495630_0022645 3300046517 Bacteria 4641
655 Ga0495630_0072444 3300046517 Bacteria 2593
656 Ga0495630_0100902 3300046517 Bacteria 2183
657 Ga0495631_0010977 3300046518 Bacteria 4472
658 Ga0495632_0157043 3300046519 Bacteria 1049
659 Ga0495643_0256551 3300046522 Bacteria 814
660 Ga0495644_0075231 3300046523 Bacteria 1271
661 Ga0495644_0079796 3300046523 Bacteria 1233
662 Ga0495648_0002071 3300046524 Bacteria 18980
663 Ga0495648_0006898 3300046524 Bacteria 9161
664 Ga0495648_0020990 3300046524 Bacteria 4537
665 Ga0495648_0044939 3300046524 Bacteria 2752
666 Ga0495648_0059667 3300046524 Bacteria 2274
667 Ga0495663_0083028 3300046525 Bacteria 1034
668 Ga0495666_0001112 3300046526 Bacteria 12872
669 Ga0495666_0024284 3300046526 Bacteria 2995
670 Ga0495666_0024491 3300046526 Bacteria 2981
671 Ga0495666_0059038 3300046526 Bacteria 1834
672 Ga0495666_0143864 3300046526 Bacteria 1110
673 Ga0495666_0176872 3300046526 Bacteria 986
674 Ga0495652_0004163 3300046529 Bacteria 13951
675 Ga0495652_0028128 3300046529 Bacteria 4951
676 Ga0495652_0068263 3300046529 Bacteria 2978
677 Ga0495652_0160785 3300046529 Bacteria 1744
678 Ga0495652_0301000 3300046529 Bacteria 1166
679 Ga0495654_0170967 3300046530 Bacteria 947
680 Ga0495654_0179643 3300046530 Bacteria 917
681 Ga0495665_0000850 3300046531 Bacteria 15980
682 Ga0495665_0017710 3300046531 Bacteria 3830
683 Ga0495665_0021493 3300046531 Bacteria 3466
684 Ga0495640_0001559 3300046533 Bacteria 18045
685 Ga0495640_0008215 3300046533 Bacteria 8190
686 Ga0495640_0020447 3300046533 Bacteria 4871
687 Ga0495586_0008023 3300046535 Bacteria 5632
688 Ga0495586_0021049 3300046535 Bacteria 3475
689 Ga0495586_0026197 3300046535 Bacteria 3119
690 Ga0495586_0069560 3300046535 Unclassified 1921
691 Ga0495586_0075782 3300046535 Bacteria 1842
692 Ga0495586_0162303 3300046535 Bacteria 1261
693 Ga0495587_0024617 3300046536 Bacteria 3687
694 Ga0495598_0056286 3300046537 Bacteria 1200
695 Ga0495598_0066898 3300046537 Bacteria 1122
696 Ga0495609_0045280 3300046538 Bacteria 1972
697 Ga0495609_0310458 3300046538 Bacteria 641
698 Ga0495621_0000732 3300046539 Bacteria 8328
699 Ga0495621_0064524 3300046539 Bacteria 1336
700 Ga0495597_0008426 3300046542 Bacteria 5169
701 Ga0495597_0108794 3300046542 Bacteria 1164
702 Ga0495645_0000711 3300046543 Bacteria 22852
703 Ga0495645_0003632 3300046543 Bacteria 10479
704 Ga0495645_0015497 3300046543 Bacteria 5421
705 Ga0495645_0023969 3300046543 Bacteria 4423
706 Ga0495645_0068067 3300046543 Bacteria 2571
707 Ga0495645_0072339 3300046543 Bacteria 2484
708 Ga0495645_0287650 3300046543 Bacteria 1078
709 Ga0495645_0308308 3300046543 Bacteria 1032
710 Ga0495622_0000189 3300046557 Bacteria 49512
711 Ga0495667_0216812 3300046559 Bacteria 1222
712 Ga0495656_0048401 3300046615 Bacteria 1806
713 Ga0495634_0001118 3300046642 Bacteria 24827
714 Ga0495634_0007356 3300046642 Bacteria 8284
715 Ga0495634_0008158 3300046642 Bacteria 7803
716 Ga0495634_0274929 3300046642 Unclassified 1024
717 Ga0495634_0542168 3300046642 Bacteria 679
718 Ga0495611_0015759 3300046648 Bacteria 3230
719 Ga0495611_0134781 3300046648 Bacteria 1153
720 Ga0495611_0214817 3300046648 Bacteria 895
721 Ga0495625_0040113 3300046660 Bacteria 3417
722 Ga0495625_0123096 3300046660 Bacteria 1763
723 Ga0495625_0494377 3300046660 Bacteria 749
724 Ga0495635_0000924 3300046663 Bacteria 19353
725 Ga0495635_0005087 3300046663 Bacteria 9143
726 Ga0495635_0006417 3300046663 Bacteria 8200
727 Ga0495635_0025331 3300046663 Bacteria 4131
728 Ga0495635_0108500 3300046663 Bacteria 1897
729 Ga0495661_0001617 3300046665 Bacteria 18461
730 Ga0495661_0001859 3300046665 Bacteria 16869
731 Ga0495661_0058089 3300046665 Bacteria 2307
732 Ga0495661_0122549 3300046665 Bacteria 1434
733 Ga0495588_0041802 3300046674 Bacteria 2342
734 Ga0495588_0053373 3300046674 Bacteria 2084
735 Ga0495588_0493313 3300046674 Bacteria 642
736 Ga0495657_0001839 3300046675 Bacteria 18127
737 Ga0495599_0000917 3300046678 Bacteria 16486
738 Ga0495599_0034409 3300046678 Bacteria 3183
739 Ga0495599_0041991 3300046678 Bacteria 2870
740 Ga0495599_0076810 3300046678 Bacteria 2085
741 Ga0495599_0129328 3300046678 Bacteria 1569
742 Ga0495599_0283673 3300046678 Bacteria 1002
743 Ga0495623_0009207 3300046679 Bacteria 6406
744 Ga0495623_0019217 3300046679 Bacteria 4417
745 Ga0495623_0071804 3300046679 Bacteria 2153
746 Ga0495623_0073752 3300046679 Bacteria 2121
747 Ga0495623_0092311 3300046679 Bacteria 1856
748 Ga0495646_0000424 3300046680 Bacteria 22356
749 Ga0495646_0006533 3300046680 Bacteria 7397
750 Ga0495646_0023783 3300046680 Bacteria 3857
751 Ga0495646_0045096 3300046680 Bacteria 2694
752 Ga0495646_0048065 3300046680 Bacteria 2594
753 Ga0495646_0083694 3300046680 Bacteria 1854
754 Ga0495646_0110389 3300046680 Bacteria 1567
755 Ga0495646_0149975 3300046680 Bacteria 1297
756 Ga0495658_0336598 3300046683 Bacteria 958
757 Ga0495669_0005719 3300046684 Bacteria 5185
758 Ga0495669_0012713 3300046684 Bacteria 3584
759 Ga0495669_0019182 3300046684 Bacteria 2950
760 Ga0495613_0001024 3300046689 Bacteria 21296
761 Ga0495613_0003572 3300046689 Bacteria 11655
762 Ga0495613_0024382 3300046689 Bacteria 4508
763 Ga0495624_0000544 3300046690 Bacteria 29457
764 Ga0495624_0001568 3300046690 Bacteria 17628
765 Ga0495624_0001962 3300046690 Bacteria 15648
766 Ga0495624_0042459 3300046690 Bacteria 2906
767 Ga0495624_0131535 3300046690 Bacteria 1534
768 Ga0495670_0026506 3300046691 Bacteria 2869
769 Ga0495670_0061688 3300046691 Bacteria 1885
770 Ga0495670_0193473 3300046691 Bacteria 1076
771 Ga0495671_0044223 3300046692 Bacteria 2234
772 Ga0495671_0054316 3300046692 Bacteria 1986
773 Ga0495649_0003771 3300046694 Bacteria 10053
774 Ga0495649_0028474 3300046694 Bacteria 3096
775 Ga0495649_0036378 3300046694 Bacteria 2705
776 Ga0495649_0041101 3300046694 Bacteria 2529
777 Ga0495649_0174811 3300046694 Bacteria 1122
778 Ga0495649_0217053 3300046694 Bacteria 990
779 Ga0495649_0277097 3300046694 Bacteria 857
780 Ga0495589_0003472 3300046794 Bacteria 8528
781 Ga0495589_0013450 3300046794 Bacteria 4221
782 Ga0495589_0048408 3300046794 Bacteria 2105
783 Ga0495589_0132776 3300046794 Bacteria 1195
784 Ga0495589_0206111 3300046794 Bacteria 927
785 Ga0495600_0001799 3300046809 Bacteria 11988
786 Ga0495600_0002478 3300046809 Bacteria 10598
787 Ga0495600_0045719 3300046809 Bacteria 2857
788 Ga0495660_0227926 3300046810 Bacteria 875
789 Ga0495581_0007999 3300047315 Bacteria 6126
790 Ga0495581_0014840 3300047315 Bacteria 4518
791 Ga0495581_0060722 3300047315 Bacteria 2184
792 Ga0495581_0115974 3300047315 Bacteria 1557
793 Ga0495604_0004577 3300047317 Bacteria 10955
794 Ga0495604_0021854 3300047317 Bacteria 5108
795 Ga0495604_0078136 3300047317 Bacteria 2484
796 Ga0495604_0085938 3300047317 Bacteria 2346
797 Ga0495604_0141166 3300047317 Bacteria 1721
798 Ga0495674_0003975 3300047319 Bacteria 14336
799 Ga0495674_0031845 3300047319 Bacteria 4785
800 Ga0495674_0032399 3300047319 Bacteria 4740
801 Ga0495674_0050637 3300047319 Bacteria 3664
802 Ga0495674_0078963 3300047319 Bacteria 2827
803 Ga0495674_0087977 3300047319 Bacteria 2657
804 Ga0495672_0006332 3300047320 Bacteria 9197
805 Ga0495672_0056663 3300047320 Bacteria 2278
806 Ga0495672_0123667 3300047320 Bacteria 1371
807 Ga0495676_0122394 3300047321 Bacteria 1890
808 Ga0495680_0001352 3300047322 Bacteria 26627
809 Ga0495680_0005702 3300047322 Bacteria 11657
810 Ga0495680_0085384 3300047322 Bacteria 2376
811 Ga0495680_0116425 3300047322 Bacteria 1976
812 Ga0495683_0000509 3300047323 Bacteria 29948
813 Ga0495683_0000736 3300047323 Bacteria 23733
814 Ga0495683_0017227 3300047323 Bacteria 3746
815 Ga0495683_0035934 3300047323 Bacteria 2517
816 Ga0495683_0305225 3300047323 Bacteria 682
817 Ga0495687_000021 3300047443 Bacteria 334681
818 Ga0495687_005610 3300047443 Bacteria 7934
819 Ga0495687_024449 3300047443 Bacteria 2870
820 Ga0495687_045320 3300047443 Bacteria 1905
821 Ga0495687_100880 3300047443 Bacteria 1083
822 Ga0495675_0003647 3300047444 Bacteria 9300
823 Ga0495675_0006834 3300047444 Bacteria 7001
824 Ga0495675_0020466 3300047444 Bacteria 4208
825 Ga0495675_0040794 3300047444 Bacteria 2959
826 Ga0495675_0045141 3300047444 Bacteria 2806
827 Ga0495675_0230925 3300047444 Bacteria 1116
828 Ga0495677_0309949 3300047445 Bacteria 621
829 Ga0495679_000948 3300047446 Bacteria 18029
830 Ga0495679_001256 3300047446 Bacteria 14951
831 Ga0495681_0012001 3300047470 Bacteria 5115
832 Ga0495681_0023298 3300047470 Bacteria 3293
833 Ga0495681_0102547 3300047470 Bacteria 1249
834 Ga0495684_0049563 3300047471 Bacteria 3208
835 Ga0495684_0098708 3300047471 Bacteria 2208
836 Ga0495684_0358899 3300047471 Bacteria 1033
837 Ga0495684_0429573 3300047471 Bacteria 922
838 Ga0495686_0000081 3300047472 Bacteria 201295
839 Ga0495593_0000391 3300047673 Bacteria 24317
840 Ga0495593_0002693 3300047673 Bacteria 10692
841 Ga0495593_0003637 3300047673 Bacteria 9209
842 Ga0495593_0024192 3300047673 Bacteria 3368
843 Ga0495593_0077607 3300047673 Bacteria 1721
844 Ga0495602_0000552 3300048088 Bacteria 34944
845 Ga0495602_0034737 3300048088 Bacteria 4710
846 Ga0495602_0114264 3300048088 Bacteria 2186
847 Ga0495602_0561844 3300048088 Bacteria 789
848 Ga0495614_0003520 3300048089 Bacteria 7014
849 Ga0495614_0052133 3300048089 Bacteria 1753
850 Ga0495615_0058551 3300048090 Bacteria 1011
851 Ga0495626_0011215 3300048091 Bacteria 4747
852 Ga0495626_0028254 3300048091 Bacteria 2721
853 Ga0495626_0095466 3300048091 Bacteria 1302
854 Ga0495626_0097082 3300048091 Bacteria 1289
855 Ga0495626_0220124 3300048091 Unclassified 772
856 Ga0496100_0000132 3300048903 Bacteria 41949
857 Ga0496100_0011084 3300048903 Bacteria 5117
858 Ga0496100_0151511 3300048903 Bacteria 1654
859 Ga0496100_0201979 3300048903 Bacteria 1449
860 Ga0496101_0000208 3300048904 Bacteria 44706
861 Ga0496101_0013538 3300048904 Bacteria 5468
862 Ga0496101_0099848 3300048904 Bacteria 2170
863 Ga0496101_0102842 3300048904 Bacteria 2140
864 Ga0496101_0154603 3300048904 Bacteria 1756
865 Ga0496101_0221191 3300048904 Bacteria 1469
866 Ga0496102_0000731 3300048905 Bacteria 32282
867 Ga0496102_0005828 3300048905 Bacteria 10481
868 Ga0496102_0009067 3300048905 Bacteria 8536
869 Ga0496102_0018882 3300048905 Bacteria 6066
870 Ga0496102_0019016 3300048905 Bacteria 6045
871 Ga0496102_0581889 3300048905 Bacteria 1042
872 Ga0496103_0000654 3300048906 Bacteria 26241
873 Ga0496103_0005975 3300048906 Bacteria 7281
874 Ga0496103_0021006 3300048906 Bacteria 3926
875 Ga0496104_0031418 3300048907 Bacteria 4938
876 Ga0496104_0087388 3300048907 Bacteria 2977
877 Ga0496104_0088526 3300048907 Bacteria 2958
878 Ga0496104_0103599 3300048907 Bacteria 2726
879 Ga0496104_0129901 3300048907 Bacteria 2420
880 Ga0496104_0283241 3300048907 Bacteria 1570
881 Ga0496105_0009985 3300048908 Bacteria 7448
882 Ga0496105_0246811 3300048908 Bacteria 1447
883 Ga0496105_0328979 3300048908 Bacteria 1223
884 Ga0496105_0581008 3300048908 Bacteria 872
885 Ga0496106_0000001 3300048909 Bacteria 497458
886 Ga0496106_0004611 3300048909 Bacteria 10222
887 Ga0496106_0064049 3300048909 Bacteria 2796
888 Ga0496107_0000920 3300048910 Bacteria 17331
889 Ga0496107_0035220 3300048910 Bacteria 3588
890 Ga0496107_0072029 3300048910 Bacteria 2512
891 Ga0496108_0023750 3300048911 Bacteria 5046
892 Ga0496109_0178159 3300048912 Bacteria 1996
893 Ga0496109_0660664 3300048912 Bacteria 982
894 Ga0496110_0007042 3300048913 Bacteria 8948
895 Ga0496110_0132215 3300048913 Bacteria 2254
896 Ga0496112_0006167 3300048915 Bacteria 10485
897 Ga0496112_0045456 3300048915 Bacteria 4304
898 Ga0496113_0003166 3300048916 Bacteria 9799
899 Ga0496113_0003339 3300048916 Bacteria 9585
900 Ga0496114_0004166 3300048917 Bacteria 11192
901 Ga0496114_0057052 3300048917 Bacteria 3260
902 Ga0496114_0469873 3300048917 Bacteria 1113
903 Ga0496115_0201357 3300048918 Bacteria 1645
904 Ga0496116_0006063 3300048919 Bacteria 11058
905 Ga0496116_0069159 3300048919 Bacteria 2246
906 Ga0496116_0133545 3300048919 Bacteria 1410
907 Ga0496117_0000963 3300048920 Bacteria 44072
908 Ga0496117_0007007 3300048920 Bacteria 11169
909 Ga0496117_0019118 3300048920 Bacteria 5640
910 Ga0496117_0096700 3300048920 Bacteria 1883
911 Ga0496118_0000191 3300048921 Bacteria 107968
912 Ga0496118_0000574 3300048921 Bacteria 60884
913 Ga0496118_0002675 3300048921 Bacteria 23557
914 Ga0496118_0005993 3300048921 Bacteria 13566
915 Ga0496118_0016512 3300048921 Bacteria 6771
916 Ga0496118_0068167 3300048921 Bacteria 2586
917 Ga0496118_0071100 3300048921 Bacteria 2507
918 Ga0496118_0227715 3300048921 Bacteria 1079
919 Ga0496119_0135631 3300048922 Bacteria 1335
920 Ga0496120_0042136 3300048923 Bacteria 2668
921 Ga0496121_0000317 3300048924 Bacteria 100867
922 Ga0496121_0000877 3300048924 Bacteria 54435
923 Ga0496121_0005367 3300048924 Bacteria 16474
924 Ga0496121_0005385 3300048924 Bacteria 16442
925 Ga0496121_0015099 3300048924 Bacteria 8124
926 Ga0496121_0015162 3300048924 Bacteria 8105
927 Ga0496121_0096087 3300048924 Bacteria 2301
928 Ga0496122_0083217 3300048925 Bacteria 2219
929 Ga0496123_0011177 3300048926 Bacteria 7816
930 Ga0496124_0004891 3300048927 Bacteria 15411
931 Ga0496124_0059950 3300048927 Bacteria 3195
932 Ga0496124_0253544 3300048927 Bacteria 1300
933 Ga0496125_0026271 3300048928 Bacteria 5310
934 Ga0496125_0139461 3300048928 Bacteria 1689
935 Ga0496125_0168230 3300048928 Bacteria 1478
936 Ga0496126_0000073 3300048929 Bacteria 236027
937 Ga0496126_0000277 3300048929 Bacteria 108040
938 Ga0496126_0001036 3300048929 Bacteria 47014
939 Ga0496126_0001078 3300048929 Bacteria 45930
940 Ga0496126_0001899 3300048929 Bacteria 30092
941 Ga0496126_0028888 3300048929 Bacteria 5276
942 Ga0496126_0036980 3300048929 Bacteria 4560
943 Ga0496126_0291357 3300048929 Bacteria 1350
944 Ga0496126_0550155 3300048929 Bacteria 916
945 Ga0495678_071923 3300049459 Bacteria 1265
946 Ga0495678_091507 3300049459 Bacteria 1070
947 Ga0495682_0015971 3300049460 Bacteria 2841
948 Ga0495682_0019014 3300049460 Bacteria 2586
949 Ga0495682_0029675 3300049460 Bacteria 2026
950 Ga0501300_005221 3300049523 Bacteria 1922
951 Ga0501034_0000487 3300049571 Bacteria 64548
952 Ga0501034_0237096 3300049571 Bacteria 1771
953 Ga0501039_0315998 3300049575 Bacteria 1228
954 Ga0501039_0385636 3300049575 Bacteria 1101
955 Ga0501046_0066998 3300049580 Bacteria 2797
956 Ga0501047_0043522 3300049581 Bacteria 4338
957 Ga0501047_0275803 3300049581 Bacteria 1527
958 Ga0501047_0634970 3300049581 Unclassified 888
959 Ga0501068_0005351 3300049584 Bacteria 7016
960 Ga0501070_0131012 3300049586 Bacteria 2071
961 Ga0501072_0007929 3300049588 Bacteria 8063
962 Ga0501073_0021357 3300049589 Bacteria 4666
963 Ga0501074_0023124 3300049590 Bacteria 4520
964 Ga0501074_0078119 3300049590 Bacteria 2375
965 Ga0501074_0592580 3300049590 Bacteria 784
966 Ga0501076_0198954 3300049592 Bacteria 1636
967 Ga0501080_0002146 3300049742 Bacteria 17124
968 Ga0501080_0343018 3300049742 Bacteria 1350
969 Ga0501083_0040217 3300049744 Bacteria 3174
970 Ga0501280_000174 3300049776 Bacteria 16446
971 Ga0501280_000496 3300049776 Bacteria 9321
972 Ga0501282_000823 3300049778 Bacteria 3537
973 Ga0501282_012358 3300049778 Bacteria 921
974 Ga0501044_0849008 3300049823 Bacteria 790
975 nmdc:mga06z11_261488_c1 3300050494 Bacteria 1021
976 nmdc:mga05p37_35579_c1 3300050507 Bacteria 6107
977 nmdc:mga09592_1644_c1 3300050508 Bacteria 18003
978 nmdc:mga0qj67_102546_c1 3300050509 Bacteria 2307
979 nmdc:mga06r32_275030_c1 3300050510 Bacteria 1671
980 nmdc:mga06r32_4493_c1 3300050510 Bacteria 12489
981 nmdc:mga08y16_30599_c1 3300050511 Bacteria 5664
982 nmdc:mga08y16_40603_c1 3300050511 Bacteria 4875
983 nmdc:mga08y16_67864_c1 3300050511 Bacteria 3720
984 nmdc:mga08y16_71218_c1 3300050511 Bacteria 3623
985 nmdc:mga0n895_95047_c1 3300050512 Bacteria 2985
986 Ga0495601_0780583 3300053077 Bacteria 607
987 Ga0500578_0102136 3300053086 Bacteria 1814
988 Ga0500583_0019736 3300053092 Bacteria 2769
989 Ga0500583_0111166 3300053092 Bacteria 1349
990 Ga0500641_0065286 3300053096 Bacteria 1522
991 Ga0500595_047778 3300053119 Unclassified 1339
992 Ga0500642_0171430 3300053130 Unclassified 1016
993 Ga0500658_0146213 3300053134 Bacteria 1063
994 Ga0500568_0002355 3300053139 Bacteria 11190
995 Ga0500568_0036035 3300053139 Bacteria 2016
996 Ga0500616_0000162 3300053153 Bacteria 111421
997 Ga0500616_0017976 3300053153 Bacteria 4003
998 Ga0500622_0001405 3300053156 Bacteria 19406
999 Ga0500627_0280390 3300053158 Bacteria 732
1000 Ga0500638_031106 3300053162 Bacteria 2573
1001 Ga0500637_0047752 3300053178 Bacteria 2433
1002 Ga0500637_0069842 3300053178 Bacteria 2020
1003 Ga0501084_0056439 3300054114 Bacteria 3286
1004 2501084753 2501025502 Bacteria 9641094
1005 2509130585 2508501125 Bacteria 7208311
1006 2510247899 2510065045 Bacteria 7761063
1007 2511092387 2510917013 Bacteria 9951648
1008 2512350229 2512047030 Bacteria 9031815
1009 2513717204 2513237104 Bacteria 10034502
1010 2513958610 2513237151 Bacteria 6309801
1011 2514047218 2513237166 Bacteria 10373764
1012 2515682252 2515154122 Bacteria 8609520
1013 2515687302 2515154123 Bacteria 6387382
1014 2527075899 2526164713 Bacteria 6780608
1015 2563059080 2562617112 Bacteria 10918404
1016 2574432007 2574179768 Bacteria 4907129
1017 2596374388 2595698237 Bacteria 6712432
1018 2600811886 2600255067 Bacteria 6795583
1019 2713480641 2711768613 Bacteria 11048459
1020 2719643668 2718217991 Bacteria 7829542
1021 2738820486 2738541296 Bacteria 7285013
1022 2738832966 2738541298 Bacteria 7286732
1023 2738874493 2738541306 Bacteria 7284992
1024 2739186123 2738543002 Bacteria 7284546
1025 2739221091 2738543008 Bacteria 7282815
1026 2753566970 2751185846 Bacteria 7242164
1027 2792837109 2791355137 Bacteria 9654227
1028 2819620580 2818991450 Bacteria 6962147
1029 2824671129 2824661429 Bacteria 9877870
1030 2829750893 2829745981 Bacteria 5406054
1031 2861695809 2861691609 Bacteria 5628931
1032 2885273811 2885270888 Bacteria 9831543
1033 2894510903 2894510363 Bacteria 5121143
1034 2902690772 2902682994 Bacteria 8951596
1035 2904486583 2904483920 Bacteria 7545285
1036 2904620143 2904615490 Bacteria 10047340
1037 2919527914 2919527303 Bacteria 7718827
1038 2921644770 2921643360 Bacteria 11448031
1039 2928108821 2928108538 Bacteria 7360024
1040 2928136045 2928135762 Bacteria 7259641
1041 2928504175 2928503688 Bacteria 7268108
1042 2945938733 2945934425 Bacteria 7444609
1043 2990708732 2990703756 Bacteria 7715990
1044 639786644 639633007 Bacteria 4376040
1045 642420880 641736151 Bacteria 7477263
1046 8055269178 8055266321 Bacteria 7999742
1047 8055304590 8055301274 Bacteria 8587385
1048 Ga0466957_0052130
1049 JGI24740J21852_10054051
1050 JGI24739J22299_10017569
1051 JGI24737J22298_10019013
1052 JGI24735J21928_10001150
1053 JGI24735J21928_10001956
1054 JGI24738J21930_10003481
1055 JGI25156J39149_1001373
1056 JGI25156J39149_1002723
1057 JGI25165J46597_1002677
1058 rootL2_10123036
1059 rootH1_10138059
1060 rootH1_10211585
1061 JGI25160J50197_1000120
1062 Ga0006556J51387_1024168
1063 Ga0006554J51385_1022598
1064 Ga0055533_1000069
1065 Ga0055533_1001661
1066 Ga0055532_1000011
1067 Ga0055527_1000009
1068 Ga0055535_1000008
1069 Ga0055542_1000014
1070 Ga0055529_1000010
1071 Ga0065165_1000382
1072 Ga0070658_10174489
1073 Ga0070658_10216191
1074 Ga0070658_10267467
1075 Ga0070676_10048106
1076 Ga0070676_10130321
1077 Ga0070683_100010629
1078 Ga0070670_100074863
1079 Ga0070670_100144328
1080 Ga0070677_10000351
1081 Ga0068869_100018796
1082 Ga0068869_100029457
1083 Ga0068869_100156722
1084 Ga0068869_100474791
1085 Ga0068869_100517622
1086 Ga0068869_100529748
1087 Ga0070666_10047242
1088 Ga0070666_10084508
1089 Ga0070680_100028148
1090 Ga0070680_100029377
1091 Ga0068868_100013696
1092 Ga0068868_100020809
1093 Ga0068868_100046927
1094 Ga0070689_100019246
1095 Ga0070689_100027205
1096 Ga0070691_10023817
1097 Ga0070692_10002831
1098 Ga0070692_10056894
1099 Ga0070668_100030554
1100 Ga0070668_100128434
1101 Ga0070668_100167017
1102 Ga0070669_100118158
1103 Ga0070675_100009721
1104 Ga0070675_100055802
1105 Ga0070675_100901453
1106 Ga0070671_100000338
1107 Ga0070674_100001615
1108 Ga0070674_100045777
1109 Ga0070674_100062933
1110 Ga0070673_100000839
1111 Ga0070673_100215208
1112 Ga0070673_100287134
1113 Ga0070688_100251181
1114 Ga0070659_100169259
1115 Ga0070659_100714409
1116 Ga0070667_100027313
1117 Ga0070667_100052700
1118 Ga0070667_100084929
1119 Ga0070667_100130646
1120 Ga0070667_100240358
1121 Ga0070667_100394856
1122 Ga0070714_100108308
1123 Ga0070713_100000153
1124 Ga0070713_100062207
1125 Ga0070701_10001527
1126 Ga0070705_100085919
1127 Ga0070705_100385541
1128 Ga0070700_100001746
1129 Ga0070700_100006528
1130 Ga0070700_100191857
1131 Ga0070694_100075617
1132 Ga0070663_100063430
1133 Ga0070663_100074045
1134 Ga0070663_100214623
1135 Ga0070663_100585163
1136 Ga0070663_100645814
1137 Ga0070678_100000181
1138 Ga0070678_100002694
1139 Ga0070678_100174321
1140 Ga0070678_100205645
1141 Ga0070678_100221381
1142 Ga0070678_100418737
1143 Ga0070662_100241069
1144 Ga0070662_100544280
1145 Ga0070681_10025996
1146 Ga0070681_10035517
1147 Ga0070681_10039374
1148 Ga0068867_100002536
1149 Ga0068867_100007853
1150 Ga0068867_100021131
1151 Ga0068867_100030435
1152 Ga0070679_100045148
1153 Ga0070679_100081818
1154 Ga0070684_100205193
1155 Ga0068853_100014471
1156 Ga0068853_100033272
1157 Ga0068853_100194660
1158 Ga0070672_100008475
1159 Ga0070672_100032768
1160 Ga0070672_100112396
1161 Ga0070672_100440337
1162 Ga0070686_100036020
1163 Ga0070696_100140430
1164 Ga0070696_100142512
1165 Ga0070693_100157464
1166 Ga0070665_100002442
1167 Ga0070665_100006578
1168 Ga0070665_100008852
1169 Ga0070665_100024587
1170 Ga0070665_100042072
1171 Ga0070665_100059437
1172 Ga0070665_100195334
1173 Ga0070704_100091858
1174 Ga0068855_100022954
1175 Ga0068855_100117559
1176 Ga0068855_100153203
1177 Ga0068855_100248832
1178 Ga0068857_100093233
1179 Ga0068857_100587468
1180 Ga0068857_100675357
1181 Ga0068854_100774360
1182 Ga0070702_100173989
1183 Ga0068852_100126971
1184 Ga0068859_100076262
1185 Ga0068859_100228290
1186 Ga0068859_100505306
1187 Ga0068859_101170093
1188 Ga0068864_100003186
1189 Ga0068864_100045568
1190 Ga0068866_10014311
1191 Ga0068866_10021453
1192 Ga0068861_100005585
1193 Ga0068861_100010029
1194 Ga0068861_100050610
1195 Ga0068861_100201352
1196 Ga0068861_100225028
1197 Ga0068861_100919069
1198 Ga0068851_10003036
1199 Ga0068851_10333053
1200 Ga0068870_10016848
1201 Ga0068870_10027184
1202 Ga0068863_100094694
1203 Ga0068858_100013613
1204 Ga0068858_100041174
1205 Ga0068858_100413726
1206 Ga0068860_100004363
1207 Ga0068860_100031666
1208 Ga0068860_100045577
1209 Ga0068860_100548273
1210 Ga0068860_100669112
1211 Ga0068862_100031027
1212 Ga0068862_100253991
1213 Ga0068862_100466779
1214 Ga0068862_100727896
1215 Ga0081539_10000159
1216 Ga0070712_100148848
1217 Ga0075367_10249451
1218 Ga0097621_100011909
1219 Ga0097621_100038168
1220 Ga0097621_100052279
1221 Ga0097621_100271903
1222 Ga0068871_100037560
1223 Ga0068871_100048205
1224 Ga0068871_100112594
1225 Ga0068871_100153916
1226 Ga0075428_100006300
1227 Ga0075428_100755954
1228 Ga0075430_100094685
1229 Ga0075431_100033265
1230 Ga0075434_100021209
1231 Ga0075429_100016275
1232 Ga0068865_100003361
1233 Ga0068865_100004597
1234 Ga0068865_100093990
1235 Ga0068865_100098777
1236 Ga0068865_100262610
1237 Ga0097620_100076262
1238 Ga0097620_100228291
1239 Ga0097620_100505298
1240 Ga0097620_101170166
1241 Ga0075435_100051111
1242 Ga0099794_10067718
1243 Ga0099794_10222216
1244 Ga0099795_10000120
1245 Ga0099795_10035530
1246 Ga0105251_10000072
1247 Ga0105251_10000295
1248 Ga0105244_10049780
1249 Ga0105240_10059434
1250 Ga0105240_10104035
1251 Ga0105240_10124025
1252 Ga0105240_10167188
1253 Ga0105240_10515445
1254 Ga0105240_10524544
1255 Ga0111539_10007194
1256 Ga0111539_10085810
1257 Ga0111539_10135393
1258 Ga0111539_10336370
1259 Ga0105245_10004734
1260 Ga0105247_10171600
1261 Ga0114129_10007843
1262 Ga0105243_10003015
1263 Ga0105243_10586516
1264 Ga0105241_10229904
1265 Ga0105242_10005521
1266 Ga0105242_10104211
1267 Ga0105242_10267039
1268 Ga0105248_10059415
1269 Ga0105248_10066595
1270 Ga0105248_10226308
1271 Ga0105248_10349742
1272 Ga0105237_10026511
1273 Ga0105237_10079351
1274 Ga0105237_10136375
1275 Ga0105238_10097485
1276 Ga0105238_10110252
1277 Ga0105238_10466247
1278 Ga0105238_10605905
1279 Ga0105238_10836203
1280 Ga0105249_10126338
1281 Ga0105239_10409879
1282 Ga0105239_10544081
1283 Ga0105246_10191504
1284 Ga0157369_10009789
1285 Ga0157369_10062985
1286 Ga0157369_10108300
1287 Ga0157369_10137543
1288 Ga0157369_10347850
1289 Ga0157369_10955847
1290 Ga0157374_10014152
1291 Ga0157374_10100947
1292 Ga0157374_10659498
1293 Ga0157378_10003237
1294 Ga0157378_10010149
1295 Ga0157378_10116295
1296 Ga0157378_10264173
1297 Ga0163162_10008237
1298 Ga0163162_10021095
1299 Ga0163162_10131139
1300 Ga0163162_10619850
1301 Ga0157372_10097140
1302 Ga0157375_10000068
1303 Ga0157375_10005514
1304 Ga0157375_10024005
1305 Ga0157375_10061887
1306 Ga0157375_10524684
1307 Ga0157375_10919525
1308 Ga0163163_10024773
1309 Ga0157380_10035257
1310 Ga0157380_10269691
1311 Ga0182008_10173299
1312 Ga0157379_10002215
1313 Ga0157379_10013196
1314 Ga0157379_10384897
1315 Ga0157379_10688444
1316 Ga0157376_10059846
1317 Ga0182007_10001285
1318 Ga0163161_10036566
1319 Ga0163161_10250311
1320 Ga0209435_107632
1321 Ga0209674_100011
1322 Ga0209674_100029
1323 Ga0209672_100002
1324 Ga0209147_100003
1325 Ga0207427_100974
1326 Ga0209258_100005
1327 Ga0209646_1015382
1328 Ga0209148_1000006
1329 Ga0209759_1000006
1330 Ga0209759_1000008
1331 Ga0209233_1000018
1332 Ga0209455_1000003
1333 Ga0209564_1016088
1334 Ga0207426_1000004
1335 Ga0207426_1012265
1336 Ga0207656_10006515
1337 Ga0207655_1032000
1338 Ga0207713_1000651
1339 Ga0207713_1002352
1340 Ga0207682_10006350
1341 Ga0207642_10008072
1342 Ga0207642_10057598
1343 Ga0207642_10092002
1344 Ga0207688_10114191
1345 Ga0207680_10010115
1346 Ga0207680_10237328
1347 Ga0207647_10019319
1348 Ga0207647_10061543
1349 Ga0207645_10011586
1350 Ga0207645_10317684
1351 Ga0207643_10011965
1352 Ga0207643_10012010
1353 Ga0207643_10248431
1354 Ga0207705_10090441
1355 Ga0207705_10196493
1356 Ga0207654_10208522
1357 Ga0207654_10414039
1358 Ga0207707_10027860
1359 Ga0207707_10289554
1360 Ga0207707_10926660
1361 Ga0207695_10029609
1362 Ga0207695_10038625
1363 Ga0207695_10043698
1364 Ga0207695_10292463
1365 Ga0207671_10073240
1366 Ga0207671_10589308
1367 Ga0207660_10104114
1368 Ga0207660_10156095
1369 Ga0207660_10228151
1370 Ga0207657_10028819
1371 Ga0207652_10247527
1372 Ga0207681_10044962
1373 Ga0207694_11067664
1374 Ga0207659_10027144
1375 Ga0207659_10711652
1376 Ga0207687_10072238
1377 Ga0207700_10000047
1378 Ga0207700_10047061
1379 Ga0207700_10393319
1380 Ga0207644_10573841
1381 Ga0207706_10246765
1382 Ga0207706_10565182
1383 Ga0207686_10234281
1384 Ga0207670_10059524
1385 Ga0207669_10067251
1386 Ga0207669_10087505
1387 Ga0207669_10178774
1388 Ga0207669_10340893
1389 Ga0207704_10011712
1390 Ga0207704_10073221
1391 Ga0207704_10374864
1392 Ga0207704_10488889
1393 Ga0207691_10000445
1394 Ga0207691_10024348
1395 Ga0207691_10319911
1396 Ga0207691_10870717
1397 Ga0207711_10064107
1398 Ga0207711_10071543
1399 Ga0207711_10143482
1400 Ga0207711_10162086
1401 Ga0207711_10236356
1402 Ga0207689_10000498
1403 Ga0207689_10001020
1404 Ga0207689_10366949
1405 Ga0207689_10697380
1406 Ga0207661_10046053
1407 Ga0207667_10043349
1408 Ga0207651_10319137
1409 Ga0207651_10537612
1410 Ga0207712_10049841
1411 Ga0207668_10067307
1412 Ga0207668_10091729
1413 Ga0207668_10188374
1414 Ga0207640_10218315
1415 Ga0207658_10062478
1416 Ga0207658_10096987
1417 Ga0207658_10292105
1418 Ga0207658_10348038
1419 Ga0207658_10365578
1420 Ga0207658_10604588
1421 Ga0207677_10047245
1422 Ga0207703_10029837
1423 Ga0207703_10033209
1424 Ga0207703_10083757
1425 Ga0207703_10086646
1426 Ga0207703_10165361
1427 Ga0207703_10515128
1428 Ga0207639_10094305
1429 Ga0207639_10712210
1430 Ga0207678_10036583
1431 Ga0207678_10104480
1432 Ga0207678_10467084
1433 Ga0207708_10004000
1434 Ga0207708_10004970
1435 Ga0207708_10085503
1436 Ga0207708_10460980
1437 Ga0207641_10061898
1438 Ga0207641_10508327
1439 Ga0207648_10004532
1440 Ga0207648_10004732
1441 Ga0207648_10013066
1442 Ga0207648_10031859
1443 Ga0207648_10034863
1444 Ga0207676_10055597
1445 Ga0207676_10212746
1446 Ga0207674_10066488
1447 Ga0207674_10726576
1448 Ga0207675_100001881
1449 Ga0207675_100010665
1450 Ga0207675_100114497
1451 Ga0207675_100135759
1452 Ga0207675_100260001
1453 Ga0207675_101022904
1454 Ga0207683_10000568
1455 Ga0207683_10005214
1456 Ga0207683_10125795
1457 Ga0207683_10132900
1458 Ga0207683_10616848
1459 Ga0207698_10214500
1460 Ga0209371_1006863
1461 Ga0207428_10050472
1462 Ga0207428_10344976
1463 Ga0265354_1002352
1464 Ga0268266_10000572
1465 Ga0268266_10002990
1466 Ga0268266_10064935
1467 Ga0268266_10067015
1468 Ga0268266_10105119
1469 Ga0268266_10197071
1470 Ga0268266_10604474
1471 Ga0268265_10042291
1472 Ga0268265_10048302
1473 Ga0268265_11227967
1474 Ga0268264_10320542
1475 Ga0268264_10398949
1476 Ga0265337_1100367
1477 Ga0265334_10001462
1478 Ga0265334_10020034
1479 Ga0265318_10022970
1480 Ga0265323_10002683
1481 Ga0265323_10058555
1482 Ga0307515_10030456
1483 Ga0265338_10042471
1484 Ga0265338_10045686
1485 Ga0265338_10115264
1486 Ga0265338_10227645
1487 Ga0268256_1003422
1488 Ga0265762_1011265
1489 Ga0265760_10000144
1490 Ga0265330_10030371
1491 Ga0265332_10001019
1492 Ga0265332_10010047
1493 Ga0265332_10039408
1494 Ga0265320_10000602
1495 Ga0265320_10083500
1496 Ga0265325_10042429
1497 Ga0265329_10002719
1498 Ga0265340_10180690
1499 Ga0265340_10210306
1500 Ga0265339_10011690
1501 Ga0265331_10001819
1502 Ga0265331_10002369
1503 Ga0265331_10011222
1504 Ga0265327_10016362
1505 Ga0307513_10314729
1506 Ga0307513_10496151
1507 Ga0307509_10000080
1508 Ga0307509_10000109
1509 Ga0307509_10000138
1510 Ga0307509_10003473
1511 Ga0265313_10002432
1512 Ga0307508_10013259
1513 Ga0316575_10018727
1514 Ga0316575_10066616
1515 Ga0316575_10116421
1516 Ga0316575_10238337
1517 Ga0316579_10031990
1518 Ga0316579_10089283
1519 Ga0265342_10209958
1520 Ga0265342_10323080
1521 Ga0316576_10012263
1522 Ga0316576_10017687
1523 Ga0316576_10048489
1524 Ga0316576_10158196
1525 Ga0316576_10307432
1526 Ga0316576_10353179
1527 Ga0316578_10052083
1528 Ga0316578_10083573
1529 Ga0316578_10176319
1530 Ga0316578_10217971
1531 Ga0307516_10028617
1532 Ga0316577_10006757
1533 Ga0316577_10012463
1534 Ga0307413_10583864
1535 Ga0307410_10077398
1536 Ga0307412_10000002
1537 Ga0307409_100929650
1538 Ga0307416_100163760
1539 Ga0307411_10789175
1540 Ga0316583_10006750
1541 Ga0316583_10051104
1542 Ga0316583_10125201
1543 Ga0316585_10000289
1544 Ga0316585_10119428
1545 Ga0316580_10002263
1546 Ga0316580_10023246
1547 Ga0316593_10001799
1548 Ga0307510_10080879
1549 Ga0316588_1001564
1550 Ga0316596_1002628
1551 Ga0373944_0072616
1552 Ga0373946_0215688
1553 Ga0373946_0238776
1554 Ga0316574_0001317
1555 Ga0316574_0010561
1556 Ga0316574_0023977
1557 Ga0316574_0030810
1558 Ga0316574_0063325
1559 Ga0316574_0066234
1560 Ga0316574_0117580
1561 Ga0316574_0138912
1562 Ga0316574_0216124
1563 Ga0316574_0368876
1564 Ga0373924_0065757
1565 Ga0373937_0570215
1566 Ga0316582_0012654
1567 Ga0316582_0020698
1568 Ga0316582_0051419
1569 Ga0316582_0095343
1570 Ga0316582_0117772
1571 Ga0316582_0476292
1572 Ga0316584_0016214
1573 Ga0316584_0042188
1574 Ga0316584_0165192
1575 Ga0316584_0173216
1576 Ga0316584_0246198
1577 Ga0316584_0271739
1578 Ga0316584_0300229
1579 Ga0316584_0322941
1580 Ga0316584_0324744
1581 Ga0373925_0001698
1582 Ga0373925_0224329
1583 Ga0395899_0017299
1584 Ga0395899_0282377
1585 Ga0395899_0430239
1586 Ga0395900_0006153
1587 Ga0395898_0003979
1588 Ga0395898_0132432
1589 Ga0395898_0240898
1590 Ga0395905_0000039
1591 Ga0395905_0001775
1592 Ga0395905_0003191
1593 Ga0395905_0056879
1594 Ga0395901_0402083
1595 Ga0451789_0229899
1596 Ga0451837_0547275
1597 Ga0451577_0518880
1598 Ga0466969_0017880
1599 Ga0466980_0179952
1600 Ga0466965_0142776
1601 Ga0466966_0020736
1602 Ga0466966_0090039
1603 Ga0466966_0413324
1604 Ga0466961_0014233
1605 Ga0466961_0016640
1606 Ga0466971_0053406
1607 Ga0466959_0003650
1608 Ga0466959_0063359
1609 Ga0466959_0137981
1610 Ga0466959_0198179
1611 Ga0451576_0000591
1612 Ga0451576_0217638
1613 Ga0451576_0541048
1614 Ga0466967_0135264
1615 Ga0466967_0293141
1616 Ga0466967_0730155
1617 Ga0495592_0000035
1618 Ga0495592_0006627
1619 Ga0495592_0084501
1620 Ga0495603_0000247
1621 Ga0495603_0001296
1622 Ga0495603_0020727
1623 Ga0495603_0081926
1624 Ga0495603_0203051
1625 Ga0495590_0001367
1626 Ga0495590_0001683
1627 Ga0495590_0043304
1628 Ga0495590_0337422
1629 Ga0495591_003664
1630 Ga0495629_0001266
1631 Ga0495629_0014967
1632 Ga0495629_0015967
1633 Ga0495638_0003399
1634 Ga0495638_0277393
1635 Ga0495638_0352523
1636 Ga0495641_0014732
1637 Ga0495641_0211065
1638 Ga0495651_0060103
1639 Ga0495653_0003596
1640 Ga0495653_0005250
1641 Ga0495653_0030739
1642 Ga0495653_0044728
1643 Ga0495653_0075309
1644 Ga0495653_0172741
1645 Ga0495650_0001275
1646 Ga0495650_0002047
1647 Ga0495650_0003633
1648 Ga0495650_0004710
1649 Ga0495650_0010946
1650 Ga0495650_0097659
1651 Ga0495650_0139438
1652 Ga0495580_0000044
1653 Ga0495580_0000077
1654 Ga0495580_0009356
1655 Ga0495580_0022615
1656 Ga0495580_0329989
1657 Ga0495582_0001360
1658 Ga0495582_0007169
1659 Ga0495582_0039912
1660 Ga0495582_0128612
1661 Ga0495605_0005792
1662 Ga0495605_0018793
1663 Ga0495605_0020633
1664 Ga0495605_0116392
1665 Ga0495639_0026261
1666 Ga0495639_0034271
1667 Ga0495662_0023637
1668 Ga0495662_0085189
1669 Ga0495664_0008582
1670 Ga0495664_0148769
1671 Ga0495584_0036642
1672 Ga0495584_0052569
1673 Ga0495585_0024735
1674 Ga0495594_0015849
1675 Ga0495594_0029153
1676 Ga0495594_0681772
1677 Ga0495596_0030361
1678 Ga0495596_0037859
1679 Ga0495596_0166945
1680 Ga0495583_0001664
1681 Ga0495583_0053072
1682 Ga0495606_0006969
1683 Ga0495606_0045509
1684 Ga0495606_0078152
1685 Ga0495606_0109983
1686 Ga0495606_0157378
1687 Ga0495608_0017380
1688 Ga0495608_0025361
1689 Ga0495610_0005022
1690 Ga0495616_0044849
1691 Ga0495618_0002030
1692 Ga0495618_0030999
1693 Ga0495618_0032691
1694 Ga0495620_0032890
1695 Ga0495628_0000465
1696 Ga0495628_0010859
1697 Ga0495628_0025779
1698 Ga0495628_0032338
1699 Ga0495628_0078933
1700 Ga0495628_0539512
1701 Ga0495630_0022645
1702 Ga0495630_0072444
1703 Ga0495630_0100902
1704 Ga0495631_0010977
1705 Ga0495632_0157043
1706 Ga0495643_0256551
1707 Ga0495644_0075231
1708 Ga0495644_0079796
1709 Ga0495648_0002071
1710 Ga0495648_0006898
1711 Ga0495648_0020990
1712 Ga0495648_0044939
1713 Ga0495648_0059667
1714 Ga0495663_0083028
1715 Ga0495666_0001112
1716 Ga0495666_0024284
1717 Ga0495666_0024491
1718 Ga0495666_0059038
1719 Ga0495666_0143864
1720 Ga0495666_0176872
1721 Ga0495652_0004163
1722 Ga0495652_0028128
1723 Ga0495652_0068263
1724 Ga0495652_0160785
1725 Ga0495652_0301000
1726 Ga0495654_0170967
1727 Ga0495654_0179643
1728 Ga0495665_0000850
1729 Ga0495665_0017710
1730 Ga0495665_0021493
1731 Ga0495640_0001559
1732 Ga0495640_0008215
1733 Ga0495640_0020447
1734 Ga0495586_0008023
1735 Ga0495586_0021049
1736 Ga0495586_0026197
1737 Ga0495586_0069560
1738 Ga0495586_0075782
1739 Ga0495586_0162303
1740 Ga0495587_0024617
1741 Ga0495598_0056286
1742 Ga0495598_0066898
1743 Ga0495609_0045280
1744 Ga0495609_0310458
1745 Ga0495621_0000732
1746 Ga0495621_0064524
1747 Ga0495597_0008426
1748 Ga0495597_0108794
1749 Ga0495645_0000711
1750 Ga0495645_0003632
1751 Ga0495645_0015497
1752 Ga0495645_0023969
1753 Ga0495645_0068067
1754 Ga0495645_0072339
1755 Ga0495645_0287650
1756 Ga0495645_0308308
1757 Ga0495622_0000189
1758 Ga0495667_0216812
1759 Ga0495656_0048401
1760 Ga0495634_0001118
1761 Ga0495634_0007356
1762 Ga0495634_0008158
1763 Ga0495634_0274929
1764 Ga0495634_0542168
1765 Ga0495611_0015759
1766 Ga0495611_0134781
1767 Ga0495611_0214817
1768 Ga0495625_0040113
1769 Ga0495625_0123096
1770 Ga0495625_0494377
1771 Ga0495635_0000924
1772 Ga0495635_0005087
1773 Ga0495635_0006417
1774 Ga0495635_0025331
1775 Ga0495635_0108500
1776 Ga0495661_0001617
1777 Ga0495661_0001859
1778 Ga0495661_0058089
1779 Ga0495661_0122549
1780 Ga0495588_0041802
1781 Ga0495588_0053373
1782 Ga0495588_0493313
1783 Ga0495657_0001839
1784 Ga0495599_0000917
1785 Ga0495599_0034409
1786 Ga0495599_0041991
1787 Ga0495599_0076810
1788 Ga0495599_0129328
1789 Ga0495599_0283673
1790 Ga0495623_0009207
1791 Ga0495623_0019217
1792 Ga0495623_0071804
1793 Ga0495623_0073752
1794 Ga0495623_0092311
1795 Ga0495646_0000424
1796 Ga0495646_0006533
1797 Ga0495646_0023783
1798 Ga0495646_0045096
1799 Ga0495646_0048065
1800 Ga0495646_0083694
1801 Ga0495646_0110389
1802 Ga0495646_0149975
1803 Ga0495658_0336598
1804 Ga0495669_0005719
1805 Ga0495669_0012713
1806 Ga0495669_0019182
1807 Ga0495613_0001024
1808 Ga0495613_0003572
1809 Ga0495613_0024382
1810 Ga0495624_0000544
1811 Ga0495624_0001568
1812 Ga0495624_0001962
1813 Ga0495624_0042459
1814 Ga0495624_0131535
1815 Ga0495670_0026506
1816 Ga0495670_0061688
1817 Ga0495670_0193473
1818 Ga0495671_0044223
1819 Ga0495671_0054316
1820 Ga0495649_0003771
1821 Ga0495649_0028474
1822 Ga0495649_0036378
1823 Ga0495649_0041101
1824 Ga0495649_0174811
1825 Ga0495649_0217053
1826 Ga0495649_0277097
1827 Ga0495589_0003472
1828 Ga0495589_0013450
1829 Ga0495589_0048408
1830 Ga0495589_0132776
1831 Ga0495589_0206111
1832 Ga0495600_0001799
1833 Ga0495600_0002478
1834 Ga0495600_0045719
1835 Ga0495660_0227926
1836 Ga0495581_0007999
1837 Ga0495581_0014840
1838 Ga0495581_0060722
1839 Ga0495581_0115974
1840 Ga0495604_0004577
1841 Ga0495604_0021854
1842 Ga0495604_0078136
1843 Ga0495604_0085938
1844 Ga0495604_0141166
1845 Ga0495674_0003975
1846 Ga0495674_0031845
1847 Ga0495674_0032399
1848 Ga0495674_0050637
1849 Ga0495674_0078963
1850 Ga0495674_0087977
1851 Ga0495672_0006332
1852 Ga0495672_0056663
1853 Ga0495672_0123667
1854 Ga0495676_0122394
1855 Ga0495680_0001352
1856 Ga0495680_0005702
1857 Ga0495680_0085384
1858 Ga0495680_0116425
1859 Ga0495683_0000509
1860 Ga0495683_0000736
1861 Ga0495683_0017227
1862 Ga0495683_0035934
1863 Ga0495683_0305225
1864 Ga0495687_000021
1865 Ga0495687_005610
1866 Ga0495687_024449
1867 Ga0495687_045320
1868 Ga0495687_100880
1869 Ga0495675_0003647
1870 Ga0495675_0006834
1871 Ga0495675_0020466
1872 Ga0495675_0040794
1873 Ga0495675_0045141
1874 Ga0495675_0230925
1875 Ga0495677_0309949
1876 Ga0495679_000948
1877 Ga0495679_001256
1878 Ga0495681_0012001
1879 Ga0495681_0023298
1880 Ga0495681_0102547
1881 Ga0495684_0049563
1882 Ga0495684_0098708
1883 Ga0495684_0358899
1884 Ga0495684_0429573
1885 Ga0495686_0000081
1886 Ga0495593_0000391
1887 Ga0495593_0002693
1888 Ga0495593_0003637
1889 Ga0495593_0024192
1890 Ga0495593_0077607
1891 Ga0495602_0000552
1892 Ga0495602_0034737
1893 Ga0495602_0114264
1894 Ga0495602_0561844
1895 Ga0495614_0003520
1896 Ga0495614_0052133
1897 Ga0495615_0058551
1898 Ga0495626_0011215
1899 Ga0495626_0028254
1900 Ga0495626_0095466
1901 Ga0495626_0097082
1902 Ga0495626_0220124
1903 Ga0496100_0000132
1904 Ga0496100_0011084
1905 Ga0496100_0151511
1906 Ga0496100_0201979
1907 Ga0496101_0000208
1908 Ga0496101_0013538
1909 Ga0496101_0099848
1910 Ga0496101_0102842
1911 Ga0496101_0154603
1912 Ga0496101_0221191
1913 Ga0496102_0000731
1914 Ga0496102_0005828
1915 Ga0496102_0009067
1916 Ga0496102_0018882
1917 Ga0496102_0019016
1918 Ga0496102_0581889
1919 Ga0496103_0000654
1920 Ga0496103_0005975
1921 Ga0496103_0021006
1922 Ga0496104_0031418
1923 Ga0496104_0087388
1924 Ga0496104_0088526
1925 Ga0496104_0103599
1926 Ga0496104_0129901
1927 Ga0496104_0283241
1928 Ga0496105_0009985
1929 Ga0496105_0246811
1930 Ga0496105_0328979
1931 Ga0496105_0581008
1932 Ga0496106_0000001
1933 Ga0496106_0004611
1934 Ga0496106_0064049
1935 Ga0496107_0000920
1936 Ga0496107_0035220
1937 Ga0496107_0072029
1938 Ga0496108_0023750
1939 Ga0496109_0178159
1940 Ga0496109_0660664
1941 Ga0496110_0007042
1942 Ga0496110_0132215
1943 Ga0496112_0006167
1944 Ga0496112_0045456
1945 Ga0496113_0003166
1946 Ga0496113_0003339
1947 Ga0496114_0004166
1948 Ga0496114_0057052
1949 Ga0496114_0469873
1950 Ga0496115_0201357
1951 Ga0496116_0006063
1952 Ga0496116_0069159
1953 Ga0496116_0133545
1954 Ga0496117_0000963
1955 Ga0496117_0007007
1956 Ga0496117_0019118
1957 Ga0496117_0096700
1958 Ga0496118_0000191
1959 Ga0496118_0000574
1960 Ga0496118_0002675
1961 Ga0496118_0005993
1962 Ga0496118_0016512
1963 Ga0496118_0068167
1964 Ga0496118_0071100
1965 Ga0496118_0227715
1966 Ga0496119_0135631
1967 Ga0496120_0042136
1968 Ga0496121_0000317
1969 Ga0496121_0000877
1970 Ga0496121_0005367
1971 Ga0496121_0005385
1972 Ga0496121_0015099
1973 Ga0496121_0015162
1974 Ga0496121_0096087
1975 Ga0496122_0083217
1976 Ga0496123_0011177
1977 Ga0496124_0004891
1978 Ga0496124_0059950
1979 Ga0496124_0253544
1980 Ga0496125_0026271
1981 Ga0496125_0139461
1982 Ga0496125_0168230
1983 Ga0496126_0000073
1984 Ga0496126_0000277
1985 Ga0496126_0001036
1986 Ga0496126_0001078
1987 Ga0496126_0001899
1988 Ga0496126_0028888
1989 Ga0496126_0036980
1990 Ga0496126_0291357
1991 Ga0496126_0550155
1992 Ga0495678_071923
1993 Ga0495678_091507
1994 Ga0495682_0015971
1995 Ga0495682_0019014
1996 Ga0495682_0029675
1997 Ga0501300_005221
1998 Ga0501034_0000487
1999 Ga0501034_0237096
2000 Ga0501039_0315998
2001 Ga0501039_0385636
2002 Ga0501046_0066998
2003 Ga0501047_0043522
2004 Ga0501047_0275803
2005 Ga0501047_0634970
2006 Ga0501068_0005351
2007 Ga0501070_0131012
2008 Ga0501072_0007929
2009 Ga0501073_0021357
2010 Ga0501074_0023124
2011 Ga0501074_0078119
2012 Ga0501074_0592580
2013 Ga0501076_0198954
2014 Ga0501080_0002146
2015 Ga0501080_0343018
2016 Ga0501083_0040217
2017 Ga0501280_000174
2018 Ga0501280_000496
2019 Ga0501282_000823
2020 Ga0501282_012358
2021 Ga0501044_0849008
2022 nmdc:mga06z11_261488_c1
2023 nmdc:mga05p37_35579_c1
2024 nmdc:mga09592_1644_c1
2025 nmdc:mga0qj67_102546_c1
2026 nmdc:mga06r32_275030_c1
2027 nmdc:mga06r32_4493_c1
2028 nmdc:mga08y16_30599_c1
2029 nmdc:mga08y16_40603_c1
2030 nmdc:mga08y16_67864_c1
2031 nmdc:mga08y16_71218_c1
2032 nmdc:mga0n895_95047_c1
2033 Ga0495601_0780583
2034 Ga0500578_0102136
2035 Ga0500583_0019736
2036 Ga0500583_0111166
2037 Ga0500641_0065286
2038 Ga0500595_047778
2039 Ga0500642_0171430
2040 Ga0500658_0146213
2041 Ga0500568_0002355
2042 Ga0500568_0036035
2043 Ga0500616_0000162
2044 Ga0500616_0017976
2045 Ga0500622_0001405
2046 Ga0500627_0280390
2047 Ga0500638_031106
2048 Ga0500637_0047752
2049 Ga0500637_0069842
2050 Ga0501084_0056439
2051 2501084753
2052 2509130585
2053 2510247899
2054 2511092387
2055 2512350229
2056 2513717204
2057 2513958610
2058 2514047218
2059 2515682252
2060 2515687302
2061 2527075899
2062 2563059080
2063 2574432007
2064 2596374388
2065 2600811886
2066 2713480641
2067 2719643668
2068 2738820486
2069 2738832966
2070 2738874493
2071 2739186123
2072 2739221091
2073 2753566970
2074 2792837109
2075 2819620580
2076 2824671129
2077 2829750893
2078 2861695809
2079 2885273811
2080 2894510903
2081 2902690772
2082 2904486583
2083 2904620143
2084 2919527914
2085 2921644770
2086 2928108821
2087 2928136045
2088 2928504175
2089 2945938733
2090 2990708732
2091 639786644
2092 642420880
2093 8055269178
2094 8055304590

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

169

225

0.97

PF00072

Response_reg

Response regulator receiver domain

27

139

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kju-assembly1.cif.gz_A huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors 0.985 121 181
6ugl-assembly1.cif.gz_A vqma bound to dpo 0.9846 122 181
6kju-assembly1.cif.gz_B huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors 0.9815 121 181
6ide-assembly1.cif.gz_B crystal structure of the vibrio cholera vqma-ligand-dna complex provides molecular mechanisms for drug design 0.9696 121 181
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.9672 122 182
ID Description Score Start End Superfamily
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9766 122 179 1.10.10.10
af_P52106_149_214_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9712 122 178 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9709 121 178 1.10.10.10
4if4B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9683 122 181 1.10.10.10
4if4C02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9664 122 182 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A158L5G1-F1-model_v4 Two component LuxR family transcriptional regulator 0.8018 37 204 GO:0000160
GO:0003677
GO:0006355
AF-A0A158L5G1-F1-model_v4 Two component LuxR family transcriptional regulator 0.7308 37 204 GO:0000160
GO:0003677
GO:0006355
AF-A0A0F9TQ05-F1-model_v4 DNA-binding response regulator 0.672 1 156 GO:0000160
GO:0003677
GO:0006355
AF-A0A1W9JTG1-F1-model_v4 HTH luxR-type domain-containing protein 0.6537 2 182 GO:0003677
GO:0006355
AF-A0A239BTJ6-F1-model_v4 Two component transcriptional regulator, LuxR family 0.652 2 181 GO:0000160
GO:0003677
GO:0006355

Map