F488979
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1047 | 455 | 2094 | 214 |
Family's Representative Sequence
| Representative Sequence | 3300044842|Ga0466957_0052130|Ga0466957_0052130_1669_2442 |
| Length | 239 |
| Sequence | MTAEMKTATTMSDNIAAAGVARAETSVLIVDDHAVVREGYRRLLEVSGNLRICGEAANATEAYQRFCALKPDVVVMDVSLPGASGIEAMRRVLAREPAARVLIFSVHEDALFVRRALDAGALGYVTKASAPDVLVEAVRTVARRASYLSPDVSQALAMRTTLSAGPPGRQLSAREFEVLRMLVQGYTLPTIAEKLGLSQKTVANHQSAIRHKFGADNGVQLAQIASRLGLHLTGSASPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 90 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 91 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 92 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 128 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 187 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 193 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 194 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 195 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 196 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 202 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 203 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 204 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 210 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 211 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 212 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 213 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 214 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 217 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 218 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 219 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 220 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 227 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 228 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 229 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 231 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 236 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 239 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 240 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 241 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 242 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 243 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 244 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 245 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 246 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 248 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 249 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 250 | 3300044668 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E2 | Metagenome | Unclassified |
| 251 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 252 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 255 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 256 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 257 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 258 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 350 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 351 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 352 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 353 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 354 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 355 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 356 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 357 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 358 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 359 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 360 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 361 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 362 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 363 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 364 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 365 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 366 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 367 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 368 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 369 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 370 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 371 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 372 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 373 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 376 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 379 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 389 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 390 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 392 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 400 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 401 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 402 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 404 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 405 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 406 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 407 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 408 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 409 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 411 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 412 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 413 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 414 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 415 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 416 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 417 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 418 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 419 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 420 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 421 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 422 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 423 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 424 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 425 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 426 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 427 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 428 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 429 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 430 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 431 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 432 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 433 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 434 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 435 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 436 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 437 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 438 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 439 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 440 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 441 | 2894510363 | Methylomonas sp. Kb3 | Isolate | Unclassified |
| 442 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 443 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 444 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 445 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 446 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 447 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 448 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 449 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 450 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 451 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 452 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 453 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 454 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 455 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.13 |
| Metatranscriptomes | 0.67 |
| Isolates | 4.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.82 |
| Nodule | 1.24 |
| Rhizoplane | 4.78 |
| Rhizosphere | 82.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466957_0052130 | 3300044842 | Bacteria | 2491 |
| 2 | JGI24740J21852_10054051 | 3300001979 | Bacteria | 1136 |
| 3 | JGI24739J22299_10017569 | 3300001989 | Bacteria | 2579 |
| 4 | JGI24737J22298_10019013 | 3300001990 | Bacteria | 2198 |
| 5 | JGI24735J21928_10001150 | 3300002067 | Bacteria | 9464 |
| 6 | JGI24735J21928_10001956 | 3300002067 | Bacteria | 7237 |
| 7 | JGI24738J21930_10003481 | 3300002075 | Bacteria | 3964 |
| 8 | JGI25156J39149_1001373 | 3300002705 | Bacteria | 10417 |
| 9 | JGI25156J39149_1002723 | 3300002705 | Bacteria | 6158 |
| 10 | JGI25165J46597_1002677 | 3300003214 | Bacteria | 5346 |
| 11 | rootL2_10123036 | 3300003322 | Bacteria | 1778 |
| 12 | rootH1_10138059 | 3300003323 | Bacteria | 2499 |
| 13 | rootH1_10211585 | 3300003323 | Bacteria | 1684 |
| 14 | JGI25160J50197_1000120 | 3300003354 | Bacteria | 71260 |
| 15 | Ga0006556J51387_1024168 | 3300003479 | Bacteria | 4133 |
| 16 | Ga0006554J51385_1022598 | 3300003567 | Bacteria | 4366 |
| 17 | Ga0055533_1000069 | 3300003756 | Bacteria | 153904 |
| 18 | Ga0055533_1001661 | 3300003756 | Bacteria | 5723 |
| 19 | Ga0055532_1000011 | 3300003758 | Bacteria | 385294 |
| 20 | Ga0055527_1000009 | 3300003760 | Bacteria | 385294 |
| 21 | Ga0055535_1000008 | 3300003761 | Bacteria | 385294 |
| 22 | Ga0055542_1000014 | 3300003762 | Bacteria | 385294 |
| 23 | Ga0055529_1000010 | 3300003763 | Bacteria | 385294 |
| 24 | Ga0065165_1000382 | 3300005262 | Bacteria | 71834 |
| 25 | Ga0070658_10174489 | 3300005327 | Unclassified | 1807 |
| 26 | Ga0070658_10216191 | 3300005327 | Bacteria | 1620 |
| 27 | Ga0070658_10267467 | 3300005327 | Bacteria | 1453 |
| 28 | Ga0070676_10048106 | 3300005328 | Bacteria | 2493 |
| 29 | Ga0070676_10130321 | 3300005328 | Bacteria | 1589 |
| 30 | Ga0070683_100010629 | 3300005329 | Bacteria | 7911 |
| 31 | Ga0070670_100074863 | 3300005331 | Bacteria | 2909 |
| 32 | Ga0070670_100144328 | 3300005331 | Bacteria | 2059 |
| 33 | Ga0070677_10000351 | 3300005333 | Bacteria | 16069 |
| 34 | Ga0068869_100018796 | 3300005334 | Bacteria | 4711 |
| 35 | Ga0068869_100029457 | 3300005334 | Bacteria | 3846 |
| 36 | Ga0068869_100156722 | 3300005334 | Bacteria | 1770 |
| 37 | Ga0068869_100474791 | 3300005334 | Bacteria | 1040 |
| 38 | Ga0068869_100517622 | 3300005334 | Unclassified | 998 |
| 39 | Ga0068869_100529748 | 3300005334 | Bacteria | 987 |
| 40 | Ga0070666_10047242 | 3300005335 | Bacteria | 2890 |
| 41 | Ga0070666_10084508 | 3300005335 | Bacteria | 2172 |
| 42 | Ga0070680_100028148 | 3300005336 | Bacteria | 4507 |
| 43 | Ga0070680_100029377 | 3300005336 | Unclassified | 4416 |
| 44 | Ga0068868_100013696 | 3300005338 | Bacteria | 5956 |
| 45 | Ga0068868_100020809 | 3300005338 | Bacteria | 4937 |
| 46 | Ga0068868_100046927 | 3300005338 | Bacteria | 3382 |
| 47 | Ga0070689_100019246 | 3300005340 | Bacteria | 5046 |
| 48 | Ga0070689_100027205 | 3300005340 | Bacteria | 4311 |
| 49 | Ga0070691_10023817 | 3300005341 | Bacteria | 2844 |
| 50 | Ga0070692_10002831 | 3300005345 | Bacteria | 6852 |
| 51 | Ga0070692_10056894 | 3300005345 | Bacteria | 2049 |
| 52 | Ga0070668_100030554 | 3300005347 | Bacteria | 4096 |
| 53 | Ga0070668_100128434 | 3300005347 | Bacteria | 2032 |
| 54 | Ga0070668_100167017 | 3300005347 | Bacteria | 1789 |
| 55 | Ga0070669_100118158 | 3300005353 | Bacteria | 2019 |
| 56 | Ga0070675_100009721 | 3300005354 | Bacteria | 7492 |
| 57 | Ga0070675_100055802 | 3300005354 | Bacteria | 3253 |
| 58 | Ga0070675_100901453 | 3300005354 | Bacteria | 810 |
| 59 | Ga0070671_100000338 | 3300005355 | Bacteria | 32240 |
| 60 | Ga0070674_100001615 | 3300005356 | Bacteria | 12104 |
| 61 | Ga0070674_100045777 | 3300005356 | Bacteria | 2990 |
| 62 | Ga0070674_100062933 | 3300005356 | Bacteria | 2595 |
| 63 | Ga0070673_100000839 | 3300005364 | Bacteria | 17232 |
| 64 | Ga0070673_100215208 | 3300005364 | Unclassified | 1661 |
| 65 | Ga0070673_100287134 | 3300005364 | Bacteria | 1445 |
| 66 | Ga0070688_100251181 | 3300005365 | Archaea | 1259 |
| 67 | Ga0070659_100169259 | 3300005366 | Bacteria | 1789 |
| 68 | Ga0070659_100714409 | 3300005366 | Bacteria | 867 |
| 69 | Ga0070667_100027313 | 3300005367 | Bacteria | 4748 |
| 70 | Ga0070667_100052700 | 3300005367 | Bacteria | 3434 |
| 71 | Ga0070667_100084929 | 3300005367 | Bacteria | 2714 |
| 72 | Ga0070667_100130646 | 3300005367 | Bacteria | 2191 |
| 73 | Ga0070667_100240358 | 3300005367 | Bacteria | 1617 |
| 74 | Ga0070667_100394856 | 3300005367 | Archaea | 1258 |
| 75 | Ga0070714_100108308 | 3300005435 | Unclassified | 2457 |
| 76 | Ga0070713_100000153 | 3300005436 | Bacteria | 46278 |
| 77 | Ga0070713_100062207 | 3300005436 | Unclassified | 3126 |
| 78 | Ga0070701_10001527 | 3300005438 | Bacteria | 8589 |
| 79 | Ga0070705_100085919 | 3300005440 | Unclassified | 1946 |
| 80 | Ga0070705_100385541 | 3300005440 | Bacteria | 1033 |
| 81 | Ga0070700_100001746 | 3300005441 | Bacteria | 10924 |
| 82 | Ga0070700_100006528 | 3300005441 | Bacteria | 6240 |
| 83 | Ga0070700_100191857 | 3300005441 | Archaea | 1429 |
| 84 | Ga0070694_100075617 | 3300005444 | Bacteria | 2330 |
| 85 | Ga0070663_100063430 | 3300005455 | Bacteria | 2668 |
| 86 | Ga0070663_100074045 | 3300005455 | Bacteria | 2486 |
| 87 | Ga0070663_100214623 | 3300005455 | Bacteria | 1508 |
| 88 | Ga0070663_100585163 | 3300005455 | Bacteria | 937 |
| 89 | Ga0070663_100645814 | 3300005455 | Bacteria | 894 |
| 90 | Ga0070678_100000181 | 3300005456 | Bacteria | 27394 |
| 91 | Ga0070678_100002694 | 3300005456 | Bacteria | 9795 |
| 92 | Ga0070678_100174321 | 3300005456 | Bacteria | 1755 |
| 93 | Ga0070678_100205645 | 3300005456 | Bacteria | 1628 |
| 94 | Ga0070678_100221381 | 3300005456 | Bacteria | 1573 |
| 95 | Ga0070678_100418737 | 3300005456 | Bacteria | 1167 |
| 96 | Ga0070662_100241069 | 3300005457 | Bacteria | 1450 |
| 97 | Ga0070662_100544280 | 3300005457 | Bacteria | 972 |
| 98 | Ga0070681_10025996 | 3300005458 | Bacteria | 5886 |
| 99 | Ga0070681_10035517 | 3300005458 | Bacteria | 5008 |
| 100 | Ga0070681_10039374 | 3300005458 | Unclassified | 4739 |
| 101 | Ga0068867_100002536 | 3300005459 | Bacteria | 12856 |
| 102 | Ga0068867_100007853 | 3300005459 | Bacteria | 7541 |
| 103 | Ga0068867_100021131 | 3300005459 | Bacteria | 4643 |
| 104 | Ga0068867_100030435 | 3300005459 | Bacteria | 3894 |
| 105 | Ga0070679_100045148 | 3300005530 | Unclassified | 4390 |
| 106 | Ga0070679_100081818 | 3300005530 | Bacteria | 3218 |
| 107 | Ga0070684_100205193 | 3300005535 | Bacteria | 1796 |
| 108 | Ga0068853_100014471 | 3300005539 | Bacteria | 6462 |
| 109 | Ga0068853_100033272 | 3300005539 | Bacteria | 4373 |
| 110 | Ga0068853_100194660 | 3300005539 | Bacteria | 1843 |
| 111 | Ga0070672_100008475 | 3300005543 | Bacteria | 7036 |
| 112 | Ga0070672_100032768 | 3300005543 | Bacteria | 3926 |
| 113 | Ga0070672_100112396 | 3300005543 | Bacteria | 2222 |
| 114 | Ga0070672_100440337 | 3300005543 | Bacteria | 1121 |
| 115 | Ga0070686_100036020 | 3300005544 | Bacteria | 3060 |
| 116 | Ga0070696_100140430 | 3300005546 | Unclassified | 1765 |
| 117 | Ga0070696_100142512 | 3300005546 | Bacteria | 1753 |
| 118 | Ga0070693_100157464 | 3300005547 | Bacteria | 1444 |
| 119 | Ga0070665_100002442 | 3300005548 | Bacteria | 20489 |
| 120 | Ga0070665_100006578 | 3300005548 | Bacteria | 11813 |
| 121 | Ga0070665_100008852 | 3300005548 | Bacteria | 10193 |
| 122 | Ga0070665_100024587 | 3300005548 | Bacteria | 6069 |
| 123 | Ga0070665_100042072 | 3300005548 | Bacteria | 4592 |
| 124 | Ga0070665_100059437 | 3300005548 | Bacteria | 3832 |
| 125 | Ga0070665_100195334 | 3300005548 | Bacteria | 2024 |
| 126 | Ga0070704_100091858 | 3300005549 | Bacteria | 2265 |
| 127 | Ga0068855_100022954 | 3300005563 | Bacteria | 7476 |
| 128 | Ga0068855_100117559 | 3300005563 | Bacteria | 3046 |
| 129 | Ga0068855_100153203 | 3300005563 | Bacteria | 2620 |
| 130 | Ga0068855_100248832 | 3300005563 | Bacteria | 1983 |
| 131 | Ga0068857_100093233 | 3300005577 | Bacteria | 2697 |
| 132 | Ga0068857_100587468 | 3300005577 | Bacteria | 1052 |
| 133 | Ga0068857_100675357 | 3300005577 | Bacteria | 980 |
| 134 | Ga0068854_100774360 | 3300005578 | Bacteria | 834 |
| 135 | Ga0070702_100173989 | 3300005615 | Bacteria | 1403 |
| 136 | Ga0068852_100126971 | 3300005616 | Bacteria | 2343 |
| 137 | Ga0068859_100076262 | 3300005617 | Bacteria | 3393 |
| 138 | Ga0068859_100228290 | 3300005617 | Bacteria | 1950 |
| 139 | Ga0068859_100505306 | 3300005617 | Archaea | 1304 |
| 140 | Ga0068859_101170093 | 3300005617 | Bacteria | 847 |
| 141 | Ga0068864_100003186 | 3300005618 | Bacteria | 13568 |
| 142 | Ga0068864_100045568 | 3300005618 | Bacteria | 3762 |
| 143 | Ga0068866_10014311 | 3300005718 | Bacteria | 3500 |
| 144 | Ga0068866_10021453 | 3300005718 | Bacteria | 2975 |
| 145 | Ga0068861_100005585 | 3300005719 | Bacteria | 8525 |
| 146 | Ga0068861_100010029 | 3300005719 | Bacteria | 6565 |
| 147 | Ga0068861_100050610 | 3300005719 | Bacteria | 3151 |
| 148 | Ga0068861_100201352 | 3300005719 | Unclassified | 1671 |
| 149 | Ga0068861_100225028 | 3300005719 | Unclassified | 1588 |
| 150 | Ga0068861_100919069 | 3300005719 | Bacteria | 830 |
| 151 | Ga0068851_10003036 | 3300005834 | Bacteria | 7420 |
| 152 | Ga0068851_10333053 | 3300005834 | Bacteria | 879 |
| 153 | Ga0068870_10016848 | 3300005840 | Bacteria | 3502 |
| 154 | Ga0068870_10027184 | 3300005840 | Bacteria | 2859 |
| 155 | Ga0068863_100094694 | 3300005841 | Bacteria | 2834 |
| 156 | Ga0068858_100013613 | 3300005842 | Bacteria | 7677 |
| 157 | Ga0068858_100041174 | 3300005842 | Unclassified | 4284 |
| 158 | Ga0068858_100413726 | 3300005842 | Bacteria | 1296 |
| 159 | Ga0068860_100004363 | 3300005843 | Bacteria | 14447 |
| 160 | Ga0068860_100031666 | 3300005843 | Bacteria | 5084 |
| 161 | Ga0068860_100045577 | 3300005843 | Bacteria | 4182 |
| 162 | Ga0068860_100548273 | 3300005843 | Bacteria | 1158 |
| 163 | Ga0068860_100669112 | 3300005843 | Unclassified | 1046 |
| 164 | Ga0068862_100031027 | 3300005844 | Bacteria | 4507 |
| 165 | Ga0068862_100253991 | 3300005844 | Bacteria | 1603 |
| 166 | Ga0068862_100466779 | 3300005844 | Unclassified | 1192 |
| 167 | Ga0068862_100727896 | 3300005844 | Unclassified | 963 |
| 168 | Ga0081539_10000159 | 3300005985 | Bacteria | 157561 |
| 169 | Ga0070712_100148848 | 3300006175 | Bacteria | 1795 |
| 170 | Ga0075367_10249451 | 3300006178 | Bacteria | 1113 |
| 171 | Ga0097621_100011909 | 3300006237 | Bacteria | 6432 |
| 172 | Ga0097621_100038168 | 3300006237 | Bacteria | 3854 |
| 173 | Ga0097621_100052279 | 3300006237 | Bacteria | 3328 |
| 174 | Ga0097621_100271903 | 3300006237 | Unclassified | 1489 |
| 175 | Ga0068871_100037560 | 3300006358 | Bacteria | 3863 |
| 176 | Ga0068871_100048205 | 3300006358 | Unclassified | 3438 |
| 177 | Ga0068871_100112594 | 3300006358 | Unclassified | 2290 |
| 178 | Ga0068871_100153916 | 3300006358 | Bacteria | 1962 |
| 179 | Ga0075428_100006300 | 3300006844 | Bacteria | 13190 |
| 180 | Ga0075428_100755954 | 3300006844 | Bacteria | 1034 |
| 181 | Ga0075430_100094685 | 3300006846 | Bacteria | 2497 |
| 182 | Ga0075431_100033265 | 3300006847 | Bacteria | 5314 |
| 183 | Ga0075434_100021209 | 3300006871 | Bacteria | 6314 |
| 184 | Ga0075429_100016275 | 3300006880 | Bacteria | 6445 |
| 185 | Ga0068865_100003361 | 3300006881 | Bacteria | 9581 |
| 186 | Ga0068865_100004597 | 3300006881 | Bacteria | 8331 |
| 187 | Ga0068865_100093990 | 3300006881 | Bacteria | 2181 |
| 188 | Ga0068865_100098777 | 3300006881 | Archaea | 2133 |
| 189 | Ga0068865_100262610 | 3300006881 | Bacteria | 1367 |
| 190 | Ga0097620_100076262 | 3300006931 | Bacteria | 3393 |
| 191 | Ga0097620_100228291 | 3300006931 | Bacteria | 1950 |
| 192 | Ga0097620_100505298 | 3300006931 | Archaea | 1304 |
| 193 | Ga0097620_101170166 | 3300006931 | Bacteria | 847 |
| 194 | Ga0075435_100051111 | 3300007076 | Bacteria | 3329 |
| 195 | Ga0099794_10067718 | 3300007265 | Unclassified | 1744 |
| 196 | Ga0099794_10222216 | 3300007265 | Bacteria | 970 |
| 197 | Ga0099795_10000120 | 3300007788 | Bacteria | 13107 |
| 198 | Ga0099795_10035530 | 3300007788 | Unclassified | 1743 |
| 199 | Ga0105251_10000072 | 3300009011 | Bacteria | 97611 |
| 200 | Ga0105251_10000295 | 3300009011 | Bacteria | 50007 |
| 201 | Ga0105244_10049780 | 3300009036 | Bacteria | 2139 |
| 202 | Ga0105240_10059434 | 3300009093 | Bacteria | 4771 |
| 203 | Ga0105240_10104035 | 3300009093 | Bacteria | 3448 |
| 204 | Ga0105240_10124025 | 3300009093 | Bacteria | 3107 |
| 205 | Ga0105240_10167188 | 3300009093 | Bacteria | 2608 |
| 206 | Ga0105240_10515445 | 3300009093 | Unclassified | 1328 |
| 207 | Ga0105240_10524544 | 3300009093 | Bacteria | 1314 |
| 208 | Ga0111539_10007194 | 3300009094 | Bacteria | 14261 |
| 209 | Ga0111539_10085810 | 3300009094 | Bacteria | 3700 |
| 210 | Ga0111539_10135393 | 3300009094 | Bacteria | 2885 |
| 211 | Ga0111539_10336370 | 3300009094 | Bacteria | 1757 |
| 212 | Ga0105245_10004734 | 3300009098 | Bacteria | 12017 |
| 213 | Ga0105247_10171600 | 3300009101 | Bacteria | 1442 |
| 214 | Ga0114129_10007843 | 3300009147 | Bacteria | 15190 |
| 215 | Ga0105243_10003015 | 3300009148 | Bacteria | 13897 |
| 216 | Ga0105243_10586516 | 3300009148 | Bacteria | 1071 |
| 217 | Ga0105241_10229904 | 3300009174 | Unclassified | 1563 |
| 218 | Ga0105242_10005521 | 3300009176 | Bacteria | 9761 |
| 219 | Ga0105242_10104211 | 3300009176 | Bacteria | 2408 |
| 220 | Ga0105242_10267039 | 3300009176 | Bacteria | 1548 |
| 221 | Ga0105248_10059415 | 3300009177 | Bacteria | 4295 |
| 222 | Ga0105248_10066595 | 3300009177 | Bacteria | 4044 |
| 223 | Ga0105248_10226308 | 3300009177 | Bacteria | 2105 |
| 224 | Ga0105248_10349742 | 3300009177 | Bacteria | 1664 |
| 225 | Ga0105237_10026511 | 3300009545 | Bacteria | 5923 |
| 226 | Ga0105237_10079351 | 3300009545 | Bacteria | 3272 |
| 227 | Ga0105237_10136375 | 3300009545 | Unclassified | 2448 |
| 228 | Ga0105238_10097485 | 3300009551 | Bacteria | 2926 |
| 229 | Ga0105238_10110252 | 3300009551 | Bacteria | 2733 |
| 230 | Ga0105238_10466247 | 3300009551 | Bacteria | 1261 |
| 231 | Ga0105238_10605905 | 3300009551 | Unclassified | 1103 |
| 232 | Ga0105238_10836203 | 3300009551 | Bacteria | 937 |
| 233 | Ga0105249_10126338 | 3300009553 | Bacteria | 2436 |
| 234 | Ga0105239_10409879 | 3300010375 | Bacteria | 1534 |
| 235 | Ga0105239_10544081 | 3300010375 | Bacteria | 1322 |
| 236 | Ga0105246_10191504 | 3300011119 | Bacteria | 1583 |
| 237 | Ga0157369_10009789 | 3300013105 | Bacteria | 10965 |
| 238 | Ga0157369_10062985 | 3300013105 | Bacteria | 3996 |
| 239 | Ga0157369_10108300 | 3300013105 | Bacteria | 2955 |
| 240 | Ga0157369_10137543 | 3300013105 | Bacteria | 2585 |
| 241 | Ga0157369_10347850 | 3300013105 | Bacteria | 1540 |
| 242 | Ga0157369_10955847 | 3300013105 | Bacteria | 878 |
| 243 | Ga0157374_10014152 | 3300013296 | Bacteria | 6975 |
| 244 | Ga0157374_10100947 | 3300013296 | Bacteria | 2766 |
| 245 | Ga0157374_10659498 | 3300013296 | Bacteria | 1058 |
| 246 | Ga0157378_10003237 | 3300013297 | Bacteria | 14493 |
| 247 | Ga0157378_10010149 | 3300013297 | Bacteria | 8213 |
| 248 | Ga0157378_10116295 | 3300013297 | Unclassified | 2459 |
| 249 | Ga0157378_10264173 | 3300013297 | Unclassified | 1653 |
| 250 | Ga0163162_10008237 | 3300013306 | Bacteria | 10175 |
| 251 | Ga0163162_10021095 | 3300013306 | Bacteria | 6408 |
| 252 | Ga0163162_10131139 | 3300013306 | Bacteria | 2615 |
| 253 | Ga0163162_10619850 | 3300013306 | Bacteria | 1207 |
| 254 | Ga0157372_10097140 | 3300013307 | Bacteria | 3359 |
| 255 | Ga0157375_10000068 | 3300013308 | Bacteria | 110172 |
| 256 | Ga0157375_10005514 | 3300013308 | Bacteria | 11010 |
| 257 | Ga0157375_10024005 | 3300013308 | Bacteria | 5637 |
| 258 | Ga0157375_10061887 | 3300013308 | Bacteria | 3718 |
| 259 | Ga0157375_10524684 | 3300013308 | Bacteria | 1347 |
| 260 | Ga0157375_10919525 | 3300013308 | Unclassified | 1018 |
| 261 | Ga0163163_10024773 | 3300014325 | Bacteria | 5714 |
| 262 | Ga0157380_10035257 | 3300014326 | Bacteria | 3864 |
| 263 | Ga0157380_10269691 | 3300014326 | Archaea | 1551 |
| 264 | Ga0182008_10173299 | 3300014497 | Bacteria | 1090 |
| 265 | Ga0157379_10002215 | 3300014968 | Bacteria | 16168 |
| 266 | Ga0157379_10013196 | 3300014968 | Bacteria | 7235 |
| 267 | Ga0157379_10384897 | 3300014968 | Bacteria | 1287 |
| 268 | Ga0157379_10688444 | 3300014968 | Bacteria | 959 |
| 269 | Ga0157376_10059846 | 3300014969 | Bacteria | 3195 |
| 270 | Ga0182007_10001285 | 3300015262 | Bacteria | 13587 |
| 271 | Ga0163161_10036566 | 3300017792 | Bacteria | 3516 |
| 272 | Ga0163161_10250311 | 3300017792 | Bacteria | 1381 |
| 273 | Ga0209435_107632 | 3300025206 | Bacteria | 1195 |
| 274 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 275 | Ga0209674_100029 | 3300025226 | Bacteria | 466683 |
| 276 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 277 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 278 | Ga0207427_100974 | 3300025231 | Bacteria | 12147 |
| 279 | Ga0209258_100005 | 3300025242 | Bacteria | 1087938 |
| 280 | Ga0209646_1015382 | 3300025246 | Bacteria | 1143 |
| 281 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 282 | Ga0209759_1000006 | 3300025256 | Bacteria | 492407 |
| 283 | Ga0209759_1000008 | 3300025256 | Bacteria | 461395 |
| 284 | Ga0209233_1000018 | 3300025261 | Bacteria | 886857 |
| 285 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 286 | Ga0209564_1016088 | 3300025295 | Bacteria | 3000 |
| 287 | Ga0207426_1000004 | 3300025302 | Bacteria | 1047900 |
| 288 | Ga0207426_1012265 | 3300025302 | Bacteria | 3226 |
| 289 | Ga0207656_10006515 | 3300025321 | Bacteria | 4203 |
| 290 | Ga0207655_1032000 | 3300025728 | Bacteria | 2412 |
| 291 | Ga0207713_1000651 | 3300025735 | Bacteria | 33250 |
| 292 | Ga0207713_1002352 | 3300025735 | Bacteria | 13865 |
| 293 | Ga0207682_10006350 | 3300025893 | Bacteria | 4770 |
| 294 | Ga0207642_10008072 | 3300025899 | Bacteria | 3591 |
| 295 | Ga0207642_10057598 | 3300025899 | Bacteria | 1788 |
| 296 | Ga0207642_10092002 | 3300025899 | Archaea | 1500 |
| 297 | Ga0207688_10114191 | 3300025901 | Bacteria | 1570 |
| 298 | Ga0207680_10010115 | 3300025903 | Bacteria | 4707 |
| 299 | Ga0207680_10237328 | 3300025903 | Bacteria | 1255 |
| 300 | Ga0207647_10019319 | 3300025904 | Bacteria | 4585 |
| 301 | Ga0207647_10061543 | 3300025904 | Bacteria | 2290 |
| 302 | Ga0207645_10011586 | 3300025907 | Bacteria | 6012 |
| 303 | Ga0207645_10317684 | 3300025907 | Bacteria | 1039 |
| 304 | Ga0207643_10011965 | 3300025908 | Bacteria | 4685 |
| 305 | Ga0207643_10012010 | 3300025908 | Bacteria | 4677 |
| 306 | Ga0207643_10248431 | 3300025908 | Bacteria | 1095 |
| 307 | Ga0207705_10090441 | 3300025909 | Bacteria | 2241 |
| 308 | Ga0207705_10196493 | 3300025909 | Bacteria | 1527 |
| 309 | Ga0207654_10208522 | 3300025911 | Bacteria | 1290 |
| 310 | Ga0207654_10414039 | 3300025911 | Bacteria | 939 |
| 311 | Ga0207707_10027860 | 3300025912 | Bacteria | 4940 |
| 312 | Ga0207707_10289554 | 3300025912 | Bacteria | 1417 |
| 313 | Ga0207707_10926660 | 3300025912 | Unclassified | 719 |
| 314 | Ga0207695_10029609 | 3300025913 | Bacteria | 6043 |
| 315 | Ga0207695_10038625 | 3300025913 | Bacteria | 5137 |
| 316 | Ga0207695_10043698 | 3300025913 | Bacteria | 4774 |
| 317 | Ga0207695_10292463 | 3300025913 | Unclassified | 1521 |
| 318 | Ga0207671_10073240 | 3300025914 | Bacteria | 2558 |
| 319 | Ga0207671_10589308 | 3300025914 | Bacteria | 886 |
| 320 | Ga0207660_10104114 | 3300025917 | Bacteria | 2124 |
| 321 | Ga0207660_10156095 | 3300025917 | Bacteria | 1757 |
| 322 | Ga0207660_10228151 | 3300025917 | Bacteria | 1463 |
| 323 | Ga0207657_10028819 | 3300025919 | Bacteria | 5059 |
| 324 | Ga0207652_10247527 | 3300025921 | Bacteria | 1607 |
| 325 | Ga0207681_10044962 | 3300025923 | Bacteria | 2962 |
| 326 | Ga0207694_11067664 | 3300025924 | Bacteria | 683 |
| 327 | Ga0207659_10027144 | 3300025926 | Bacteria | 3872 |
| 328 | Ga0207659_10711652 | 3300025926 | Unclassified | 860 |
| 329 | Ga0207687_10072238 | 3300025927 | Bacteria | 2468 |
| 330 | Ga0207700_10000047 | 3300025928 | Bacteria | 87205 |
| 331 | Ga0207700_10047061 | 3300025928 | Bacteria | 3195 |
| 332 | Ga0207700_10393319 | 3300025928 | Unclassified | 1214 |
| 333 | Ga0207644_10573841 | 3300025931 | Bacteria | 935 |
| 334 | Ga0207706_10246765 | 3300025933 | Bacteria | 1560 |
| 335 | Ga0207706_10565182 | 3300025933 | Bacteria | 978 |
| 336 | Ga0207686_10234281 | 3300025934 | Bacteria | 1333 |
| 337 | Ga0207670_10059524 | 3300025936 | Bacteria | 2598 |
| 338 | Ga0207669_10067251 | 3300025937 | Bacteria | 2232 |
| 339 | Ga0207669_10087505 | 3300025937 | Bacteria | 2018 |
| 340 | Ga0207669_10178774 | 3300025937 | Bacteria | 1519 |
| 341 | Ga0207669_10340893 | 3300025937 | Unclassified | 1154 |
| 342 | Ga0207704_10011712 | 3300025938 | Bacteria | 4331 |
| 343 | Ga0207704_10073221 | 3300025938 | Bacteria | 2181 |
| 344 | Ga0207704_10374864 | 3300025938 | Bacteria | 1115 |
| 345 | Ga0207704_10488889 | 3300025938 | Bacteria | 990 |
| 346 | Ga0207691_10000445 | 3300025940 | Bacteria | 40892 |
| 347 | Ga0207691_10024348 | 3300025940 | Bacteria | 5694 |
| 348 | Ga0207691_10319911 | 3300025940 | Bacteria | 1330 |
| 349 | Ga0207691_10870717 | 3300025940 | Unclassified | 755 |
| 350 | Ga0207711_10064107 | 3300025941 | Bacteria | 3173 |
| 351 | Ga0207711_10071543 | 3300025941 | Unclassified | 3009 |
| 352 | Ga0207711_10143482 | 3300025941 | Bacteria | 2150 |
| 353 | Ga0207711_10162086 | 3300025941 | Bacteria | 2025 |
| 354 | Ga0207711_10236356 | 3300025941 | Bacteria | 1675 |
| 355 | Ga0207689_10000498 | 3300025942 | Bacteria | 37073 |
| 356 | Ga0207689_10001020 | 3300025942 | Bacteria | 26905 |
| 357 | Ga0207689_10366949 | 3300025942 | Bacteria | 1198 |
| 358 | Ga0207689_10697380 | 3300025942 | Unclassified | 856 |
| 359 | Ga0207661_10046053 | 3300025944 | Bacteria | 3457 |
| 360 | Ga0207667_10043349 | 3300025949 | Bacteria | 4775 |
| 361 | Ga0207651_10319137 | 3300025960 | Bacteria | 1298 |
| 362 | Ga0207651_10537612 | 3300025960 | Archaea | 1015 |
| 363 | Ga0207712_10049841 | 3300025961 | Bacteria | 2921 |
| 364 | Ga0207668_10067307 | 3300025972 | Bacteria | 2542 |
| 365 | Ga0207668_10091729 | 3300025972 | Archaea | 2234 |
| 366 | Ga0207668_10188374 | 3300025972 | Bacteria | 1633 |
| 367 | Ga0207640_10218315 | 3300025981 | Bacteria | 1458 |
| 368 | Ga0207658_10062478 | 3300025986 | Bacteria | 2787 |
| 369 | Ga0207658_10096987 | 3300025986 | Bacteria | 2300 |
| 370 | Ga0207658_10292105 | 3300025986 | Bacteria | 1401 |
| 371 | Ga0207658_10348038 | 3300025986 | Archaea | 1290 |
| 372 | Ga0207658_10365578 | 3300025986 | Bacteria | 1260 |
| 373 | Ga0207658_10604588 | 3300025986 | Bacteria | 985 |
| 374 | Ga0207677_10047245 | 3300026023 | Bacteria | 2889 |
| 375 | Ga0207703_10029837 | 3300026035 | Bacteria | 4305 |
| 376 | Ga0207703_10033209 | 3300026035 | Bacteria | 4088 |
| 377 | Ga0207703_10083757 | 3300026035 | Unclassified | 2665 |
| 378 | Ga0207703_10086646 | 3300026035 | Bacteria | 2624 |
| 379 | Ga0207703_10165361 | 3300026035 | Bacteria | 1941 |
| 380 | Ga0207703_10515128 | 3300026035 | Bacteria | 1124 |
| 381 | Ga0207639_10094305 | 3300026041 | Bacteria | 2402 |
| 382 | Ga0207639_10712210 | 3300026041 | Bacteria | 932 |
| 383 | Ga0207678_10036583 | 3300026067 | Bacteria | 4273 |
| 384 | Ga0207678_10104480 | 3300026067 | Bacteria | 2417 |
| 385 | Ga0207678_10467084 | 3300026067 | Bacteria | 1098 |
| 386 | Ga0207708_10004000 | 3300026075 | Bacteria | 10847 |
| 387 | Ga0207708_10004970 | 3300026075 | Bacteria | 9794 |
| 388 | Ga0207708_10085503 | 3300026075 | Archaea | 2426 |
| 389 | Ga0207708_10460980 | 3300026075 | Bacteria | 1060 |
| 390 | Ga0207641_10061898 | 3300026088 | Bacteria | 3192 |
| 391 | Ga0207641_10508327 | 3300026088 | Bacteria | 1171 |
| 392 | Ga0207648_10004532 | 3300026089 | Bacteria | 14240 |
| 393 | Ga0207648_10004732 | 3300026089 | Bacteria | 13902 |
| 394 | Ga0207648_10013066 | 3300026089 | Bacteria | 7741 |
| 395 | Ga0207648_10031859 | 3300026089 | Bacteria | 4659 |
| 396 | Ga0207648_10034863 | 3300026089 | Bacteria | 4436 |
| 397 | Ga0207676_10055597 | 3300026095 | Bacteria | 3108 |
| 398 | Ga0207676_10212746 | 3300026095 | Bacteria | 1716 |
| 399 | Ga0207674_10066488 | 3300026116 | Bacteria | 3631 |
| 400 | Ga0207674_10726576 | 3300026116 | Bacteria | 958 |
| 401 | Ga0207675_100001881 | 3300026118 | Bacteria | 20975 |
| 402 | Ga0207675_100010665 | 3300026118 | Bacteria | 8609 |
| 403 | Ga0207675_100114497 | 3300026118 | Bacteria | 2547 |
| 404 | Ga0207675_100135759 | 3300026118 | Bacteria | 2334 |
| 405 | Ga0207675_100260001 | 3300026118 | Bacteria | 1682 |
| 406 | Ga0207675_101022904 | 3300026118 | Bacteria | 845 |
| 407 | Ga0207683_10000568 | 3300026121 | Bacteria | 34203 |
| 408 | Ga0207683_10005214 | 3300026121 | Bacteria | 11158 |
| 409 | Ga0207683_10125795 | 3300026121 | Bacteria | 2304 |
| 410 | Ga0207683_10132900 | 3300026121 | Bacteria | 2238 |
| 411 | Ga0207683_10616848 | 3300026121 | Unclassified | 1004 |
| 412 | Ga0207698_10214500 | 3300026142 | Bacteria | 1734 |
| 413 | Ga0209371_1006863 | 3300027312 | Bacteria | 4113 |
| 414 | Ga0207428_10050472 | 3300027907 | Bacteria | 3328 |
| 415 | Ga0207428_10344976 | 3300027907 | Bacteria | 1096 |
| 416 | Ga0265354_1002352 | 3300028016 | Bacteria | 2369 |
| 417 | Ga0268266_10000572 | 3300028379 | Bacteria | 50809 |
| 418 | Ga0268266_10002990 | 3300028379 | Bacteria | 17432 |
| 419 | Ga0268266_10064935 | 3300028379 | Bacteria | 3154 |
| 420 | Ga0268266_10067015 | 3300028379 | Bacteria | 3106 |
| 421 | Ga0268266_10105119 | 3300028379 | Bacteria | 2494 |
| 422 | Ga0268266_10197071 | 3300028379 | Bacteria | 1842 |
| 423 | Ga0268266_10604474 | 3300028379 | Bacteria | 1053 |
| 424 | Ga0268265_10042291 | 3300028380 | Bacteria | 3380 |
| 425 | Ga0268265_10048302 | 3300028380 | Bacteria | 3194 |
| 426 | Ga0268265_11227967 | 3300028380 | Bacteria | 748 |
| 427 | Ga0268264_10320542 | 3300028381 | Bacteria | 1465 |
| 428 | Ga0268264_10398949 | 3300028381 | Bacteria | 1321 |
| 429 | Ga0265337_1100367 | 3300028556 | Bacteria | 788 |
| 430 | Ga0265334_10001462 | 3300028573 | Bacteria | 11372 |
| 431 | Ga0265334_10020034 | 3300028573 | Bacteria | 2743 |
| 432 | Ga0265318_10022970 | 3300028577 | Bacteria | 2489 |
| 433 | Ga0265323_10002683 | 3300028653 | Bacteria | 8041 |
| 434 | Ga0265323_10058555 | 3300028653 | Bacteria | 1345 |
| 435 | Ga0307515_10030456 | 3300028794 | Bacteria | 9058 |
| 436 | Ga0265338_10042471 | 3300028800 | Bacteria | 4233 |
| 437 | Ga0265338_10045686 | 3300028800 | Bacteria | 4023 |
| 438 | Ga0265338_10115264 | 3300028800 | Bacteria | 2154 |
| 439 | Ga0265338_10227645 | 3300028800 | Bacteria | 1388 |
| 440 | Ga0268256_1003422 | 3300030500 | Bacteria | 7151 |
| 441 | Ga0265762_1011265 | 3300030760 | Bacteria | 1600 |
| 442 | Ga0265760_10000144 | 3300031090 | Bacteria | 18264 |
| 443 | Ga0265330_10030371 | 3300031235 | Bacteria | 2426 |
| 444 | Ga0265332_10001019 | 3300031238 | Bacteria | 16538 |
| 445 | Ga0265332_10010047 | 3300031238 | Bacteria | 4215 |
| 446 | Ga0265332_10039408 | 3300031238 | Bacteria | 2046 |
| 447 | Ga0265320_10000602 | 3300031240 | Bacteria | 27546 |
| 448 | Ga0265320_10083500 | 3300031240 | Bacteria | 1488 |
| 449 | Ga0265325_10042429 | 3300031241 | Bacteria | 2378 |
| 450 | Ga0265329_10002719 | 3300031242 | Bacteria | 7939 |
| 451 | Ga0265340_10180690 | 3300031247 | Bacteria | 954 |
| 452 | Ga0265340_10210306 | 3300031247 | Bacteria | 873 |
| 453 | Ga0265339_10011690 | 3300031249 | Bacteria | 5393 |
| 454 | Ga0265331_10001819 | 3300031250 | Bacteria | 15112 |
| 455 | Ga0265331_10002369 | 3300031250 | Bacteria | 12804 |
| 456 | Ga0265331_10011222 | 3300031250 | Bacteria | 4914 |
| 457 | Ga0265327_10016362 | 3300031251 | Unclassified | 4713 |
| 458 | Ga0307513_10314729 | 3300031456 | Bacteria | 1326 |
| 459 | Ga0307513_10496151 | 3300031456 | Bacteria | 939 |
| 460 | Ga0307509_10000080 | 3300031507 | Bacteria | 134551 |
| 461 | Ga0307509_10000109 | 3300031507 | Bacteria | 117520 |
| 462 | Ga0307509_10000138 | 3300031507 | Bacteria | 108694 |
| 463 | Ga0307509_10003473 | 3300031507 | Bacteria | 23867 |
| 464 | Ga0265313_10002432 | 3300031595 | Bacteria | 16073 |
| 465 | Ga0307508_10013259 | 3300031616 | Bacteria | 7541 |
| 466 | Ga0316575_10018727 | 3300031665 | Bacteria | 2642 |
| 467 | Ga0316575_10066616 | 3300031665 | Bacteria | 1443 |
| 468 | Ga0316575_10116421 | 3300031665 | Unclassified | 1092 |
| 469 | Ga0316575_10238337 | 3300031665 | Unclassified | 761 |
| 470 | Ga0316579_10031990 | 3300031691 | Bacteria | 2411 |
| 471 | Ga0316579_10089283 | 3300031691 | Bacteria | 1471 |
| 472 | Ga0265342_10209958 | 3300031712 | Bacteria | 1053 |
| 473 | Ga0265342_10323080 | 3300031712 | Bacteria | 808 |
| 474 | Ga0316576_10012263 | 3300031727 | Bacteria | 5657 |
| 475 | Ga0316576_10017687 | 3300031727 | Bacteria | 4849 |
| 476 | Ga0316576_10048489 | 3300031727 | Bacteria | 3081 |
| 477 | Ga0316576_10158196 | 3300031727 | Unclassified | 1708 |
| 478 | Ga0316576_10307432 | 3300031727 | Bacteria | 1184 |
| 479 | Ga0316576_10353179 | 3300031727 | Bacteria | 1094 |
| 480 | Ga0316578_10052083 | 3300031728 | Bacteria | 2398 |
| 481 | Ga0316578_10083573 | 3300031728 | Bacteria | 1902 |
| 482 | Ga0316578_10176319 | 3300031728 | Bacteria | 1288 |
| 483 | Ga0316578_10217971 | 3300031728 | Bacteria | 1147 |
| 484 | Ga0307516_10028617 | 3300031730 | Bacteria | 5637 |
| 485 | Ga0316577_10006757 | 3300031733 | Bacteria | 6086 |
| 486 | Ga0316577_10012463 | 3300031733 | Bacteria | 4632 |
| 487 | Ga0307413_10583864 | 3300031824 | Unclassified | 912 |
| 488 | Ga0307410_10077398 | 3300031852 | Unclassified | 2325 |
| 489 | Ga0307412_10000002 | 3300031911 | Bacteria | 743446 |
| 490 | Ga0307409_100929650 | 3300031995 | Bacteria | 885 |
| 491 | Ga0307416_100163760 | 3300032002 | Unclassified | 2060 |
| 492 | Ga0307411_10789175 | 3300032005 | Bacteria | 835 |
| 493 | Ga0316583_10006750 | 3300032133 | Bacteria | 4137 |
| 494 | Ga0316583_10051104 | 3300032133 | Bacteria | 1454 |
| 495 | Ga0316583_10125201 | 3300032133 | Bacteria | 895 |
| 496 | Ga0316585_10000289 | 3300032137 | Bacteria | 11123 |
| 497 | Ga0316585_10119428 | 3300032137 | Unclassified | 867 |
| 498 | Ga0316580_10002263 | 3300032139 | Bacteria | 5266 |
| 499 | Ga0316580_10023246 | 3300032139 | Bacteria | 1914 |
| 500 | Ga0316593_10001799 | 3300032168 | Bacteria | 4887 |
| 501 | Ga0307510_10080879 | 3300033180 | Bacteria | 3156 |
| 502 | Ga0316588_1001564 | 3300033528 | Bacteria | 3801 |
| 503 | Ga0316596_1002628 | 3300033541 | Unclassified | 3852 |
| 504 | Ga0373944_0072616 | 3300035089 | Bacteria | 1123 |
| 505 | Ga0373946_0215688 | 3300035171 | Bacteria | 925 |
| 506 | Ga0373946_0238776 | 3300035171 | Bacteria | 883 |
| 507 | Ga0316574_0001317 | 3300035398 | Bacteria | 11623 |
| 508 | Ga0316574_0010561 | 3300035398 | Bacteria | 5224 |
| 509 | Ga0316574_0023977 | 3300035398 | Bacteria | 3647 |
| 510 | Ga0316574_0030810 | 3300035398 | Bacteria | 3251 |
| 511 | Ga0316574_0063325 | 3300035398 | Bacteria | 2325 |
| 512 | Ga0316574_0066234 | 3300035398 | Bacteria | 2275 |
| 513 | Ga0316574_0117580 | 3300035398 | Bacteria | 1706 |
| 514 | Ga0316574_0138912 | 3300035398 | Bacteria | 1565 |
| 515 | Ga0316574_0216124 | 3300035398 | Bacteria | 1229 |
| 516 | Ga0316574_0368876 | 3300035398 | Bacteria | 907 |
| 517 | Ga0373924_0065757 | 3300035410 | Bacteria | 1523 |
| 518 | Ga0373937_0570215 | 3300036401 | Bacteria | 1075 |
| 519 | Ga0316582_0012654 | 3300036647 | Bacteria | 4718 |
| 520 | Ga0316582_0020698 | 3300036647 | Bacteria | 3873 |
| 521 | Ga0316582_0051419 | 3300036647 | Bacteria | 2614 |
| 522 | Ga0316582_0095343 | 3300036647 | Bacteria | 1964 |
| 523 | Ga0316582_0117772 | 3300036647 | Bacteria | 1775 |
| 524 | Ga0316582_0476292 | 3300036647 | Bacteria | 860 |
| 525 | Ga0316584_0016214 | 3300036712 | Bacteria | 5341 |
| 526 | Ga0316584_0042188 | 3300036712 | Unclassified | 3401 |
| 527 | Ga0316584_0165192 | 3300036712 | Bacteria | 1644 |
| 528 | Ga0316584_0173216 | 3300036712 | Bacteria | 1599 |
| 529 | Ga0316584_0246198 | 3300036712 | Unclassified | 1307 |
| 530 | Ga0316584_0271739 | 3300036712 | Bacteria | 1234 |
| 531 | Ga0316584_0300229 | 3300036712 | Bacteria | 1163 |
| 532 | Ga0316584_0322941 | 3300036712 | Bacteria | 1113 |
| 533 | Ga0316584_0324744 | 3300036712 | Bacteria | 1109 |
| 534 | Ga0373925_0001698 | 3300037068 | Bacteria | 18538 |
| 535 | Ga0373925_0224329 | 3300037068 | Unclassified | 1501 |
| 536 | Ga0395899_0017299 | 3300037312 | Bacteria | 5494 |
| 537 | Ga0395899_0282377 | 3300037312 | Bacteria | 1129 |
| 538 | Ga0395899_0430239 | 3300037312 | Bacteria | 868 |
| 539 | Ga0395900_0006153 | 3300037418 | Bacteria | 12529 |
| 540 | Ga0395898_0003979 | 3300037466 | Bacteria | 16267 |
| 541 | Ga0395898_0132432 | 3300037466 | Bacteria | 2387 |
| 542 | Ga0395898_0240898 | 3300037466 | Unclassified | 1725 |
| 543 | Ga0395905_0000039 | 3300037471 | Bacteria | 253197 |
| 544 | Ga0395905_0001775 | 3300037471 | Bacteria | 25025 |
| 545 | Ga0395905_0003191 | 3300037471 | Bacteria | 17656 |
| 546 | Ga0395905_0056879 | 3300037471 | Bacteria | 3658 |
| 547 | Ga0395901_0402083 | 3300038443 | Bacteria | 1407 |
| 548 | Ga0451789_0229899 | 3300041443 | Bacteria | 1453 |
| 549 | Ga0451837_0547275 | 3300041494 | Bacteria | 1284 |
| 550 | Ga0451577_0518880 | 3300042876 | Bacteria | 1082 |
| 551 | Ga0466969_0017880 | 3300044656 | Bacteria | 3698 |
| 552 | Ga0466980_0179952 | 3300044668 | Bacteria | 1377 |
| 553 | Ga0466965_0142776 | 3300044683 | Bacteria | 1248 |
| 554 | Ga0466966_0020736 | 3300044684 | Bacteria | 4319 |
| 555 | Ga0466966_0090039 | 3300044684 | Bacteria | 1905 |
| 556 | Ga0466966_0413324 | 3300044684 | Bacteria | 811 |
| 557 | Ga0466961_0014233 | 3300044693 | Bacteria | 5106 |
| 558 | Ga0466961_0016640 | 3300044693 | Bacteria | 4728 |
| 559 | Ga0466971_0053406 | 3300044719 | Bacteria | 1821 |
| 560 | Ga0466959_0003650 | 3300045049 | Bacteria | 10153 |
| 561 | Ga0466959_0063359 | 3300045049 | Bacteria | 2685 |
| 562 | Ga0466959_0137981 | 3300045049 | Bacteria | 1725 |
| 563 | Ga0466959_0198179 | 3300045049 | Bacteria | 1399 |
| 564 | Ga0451576_0000591 | 3300045051 | Bacteria | 76735 |
| 565 | Ga0451576_0217638 | 3300045051 | Bacteria | 1994 |
| 566 | Ga0451576_0541048 | 3300045051 | Bacteria | 1224 |
| 567 | Ga0466967_0135264 | 3300045976 | Bacteria | 2292 |
| 568 | Ga0466967_0293141 | 3300045976 | Bacteria | 1563 |
| 569 | Ga0466967_0730155 | 3300045976 | Bacteria | 982 |
| 570 | Ga0495592_0000035 | 3300046454 | Bacteria | 125802 |
| 571 | Ga0495592_0006627 | 3300046454 | Bacteria | 8634 |
| 572 | Ga0495592_0084501 | 3300046454 | Bacteria | 2290 |
| 573 | Ga0495603_0000247 | 3300046455 | Bacteria | 28211 |
| 574 | Ga0495603_0001296 | 3300046455 | Bacteria | 14581 |
| 575 | Ga0495603_0020727 | 3300046455 | Bacteria | 3981 |
| 576 | Ga0495603_0081926 | 3300046455 | Bacteria | 1890 |
| 577 | Ga0495603_0203051 | 3300046455 | Bacteria | 1145 |
| 578 | Ga0495590_0001367 | 3300046457 | Bacteria | 10596 |
| 579 | Ga0495590_0001683 | 3300046457 | Bacteria | 9401 |
| 580 | Ga0495590_0043304 | 3300046457 | Bacteria | 1570 |
| 581 | Ga0495590_0337422 | 3300046457 | Bacteria | 571 |
| 582 | Ga0495591_003664 | 3300046458 | Bacteria | 7816 |
| 583 | Ga0495629_0001266 | 3300046459 | Bacteria | 19862 |
| 584 | Ga0495629_0014967 | 3300046459 | Bacteria | 5573 |
| 585 | Ga0495629_0015967 | 3300046459 | Bacteria | 5395 |
| 586 | Ga0495638_0003399 | 3300046460 | Bacteria | 12549 |
| 587 | Ga0495638_0277393 | 3300046460 | Bacteria | 912 |
| 588 | Ga0495638_0352523 | 3300046460 | Bacteria | 777 |
| 589 | Ga0495641_0014732 | 3300046461 | Bacteria | 4218 |
| 590 | Ga0495641_0211065 | 3300046461 | Bacteria | 870 |
| 591 | Ga0495651_0060103 | 3300046462 | Bacteria | 2912 |
| 592 | Ga0495653_0003596 | 3300046463 | Bacteria | 12498 |
| 593 | Ga0495653_0005250 | 3300046463 | Bacteria | 10537 |
| 594 | Ga0495653_0030739 | 3300046463 | Bacteria | 4274 |
| 595 | Ga0495653_0044728 | 3300046463 | Bacteria | 3435 |
| 596 | Ga0495653_0075309 | 3300046463 | Bacteria | 2512 |
| 597 | Ga0495653_0172741 | 3300046463 | Bacteria | 1490 |
| 598 | Ga0495650_0001275 | 3300046471 | Bacteria | 25910 |
| 599 | Ga0495650_0002047 | 3300046471 | Bacteria | 17583 |
| 600 | Ga0495650_0003633 | 3300046471 | Bacteria | 11089 |
| 601 | Ga0495650_0004710 | 3300046471 | Bacteria | 9197 |
| 602 | Ga0495650_0010946 | 3300046471 | Bacteria | 5018 |
| 603 | Ga0495650_0097659 | 3300046471 | Unclassified | 1107 |
| 604 | Ga0495650_0139438 | 3300046471 | Bacteria | 878 |
| 605 | Ga0495580_0000044 | 3300046472 | Bacteria | 69950 |
| 606 | Ga0495580_0000077 | 3300046472 | Bacteria | 61724 |
| 607 | Ga0495580_0009356 | 3300046472 | Bacteria | 7708 |
| 608 | Ga0495580_0022615 | 3300046472 | Bacteria | 4624 |
| 609 | Ga0495580_0329989 | 3300046472 | Bacteria | 1036 |
| 610 | Ga0495582_0001360 | 3300046473 | Bacteria | 13761 |
| 611 | Ga0495582_0007169 | 3300046473 | Bacteria | 6189 |
| 612 | Ga0495582_0039912 | 3300046473 | Bacteria | 2584 |
| 613 | Ga0495582_0128612 | 3300046473 | Bacteria | 1430 |
| 614 | Ga0495605_0005792 | 3300046474 | Bacteria | 7149 |
| 615 | Ga0495605_0018793 | 3300046474 | Bacteria | 3699 |
| 616 | Ga0495605_0020633 | 3300046474 | Bacteria | 3500 |
| 617 | Ga0495605_0116392 | 3300046474 | Bacteria | 1215 |
| 618 | Ga0495639_0026261 | 3300046475 | Bacteria | 2573 |
| 619 | Ga0495639_0034271 | 3300046475 | Bacteria | 2271 |
| 620 | Ga0495662_0023637 | 3300046476 | Bacteria | 2967 |
| 621 | Ga0495662_0085189 | 3300046476 | Bacteria | 1539 |
| 622 | Ga0495664_0008582 | 3300046477 | Bacteria | 5700 |
| 623 | Ga0495664_0148769 | 3300046477 | Bacteria | 1420 |
| 624 | Ga0495584_0036642 | 3300046491 | Bacteria | 2478 |
| 625 | Ga0495584_0052569 | 3300046491 | Bacteria | 2050 |
| 626 | Ga0495585_0024735 | 3300046492 | Bacteria | 3442 |
| 627 | Ga0495594_0015849 | 3300046499 | Bacteria | 3965 |
| 628 | Ga0495594_0029153 | 3300046499 | Bacteria | 2982 |
| 629 | Ga0495594_0681772 | 3300046499 | Bacteria | 581 |
| 630 | Ga0495596_0030361 | 3300046500 | Bacteria | 2164 |
| 631 | Ga0495596_0037859 | 3300046500 | Bacteria | 1907 |
| 632 | Ga0495596_0166945 | 3300046500 | Bacteria | 856 |
| 633 | Ga0495583_0001664 | 3300046506 | Bacteria | 21537 |
| 634 | Ga0495583_0053072 | 3300046506 | Bacteria | 1841 |
| 635 | Ga0495606_0006969 | 3300046507 | Bacteria | 10275 |
| 636 | Ga0495606_0045509 | 3300046507 | Bacteria | 2907 |
| 637 | Ga0495606_0078152 | 3300046507 | Bacteria | 2064 |
| 638 | Ga0495606_0109983 | 3300046507 | Bacteria | 1664 |
| 639 | Ga0495606_0157378 | 3300046507 | Bacteria | 1328 |
| 640 | Ga0495608_0017380 | 3300046511 | Bacteria | 4976 |
| 641 | Ga0495608_0025361 | 3300046511 | Bacteria | 4047 |
| 642 | Ga0495610_0005022 | 3300046512 | Bacteria | 9573 |
| 643 | Ga0495616_0044849 | 3300046513 | Bacteria | 2241 |
| 644 | Ga0495618_0002030 | 3300046514 | Bacteria | 13282 |
| 645 | Ga0495618_0030999 | 3300046514 | Bacteria | 3342 |
| 646 | Ga0495618_0032691 | 3300046514 | Bacteria | 3258 |
| 647 | Ga0495620_0032890 | 3300046515 | Bacteria | 2359 |
| 648 | Ga0495628_0000465 | 3300046516 | Bacteria | 37158 |
| 649 | Ga0495628_0010859 | 3300046516 | Bacteria | 7709 |
| 650 | Ga0495628_0025779 | 3300046516 | Bacteria | 4800 |
| 651 | Ga0495628_0032338 | 3300046516 | Bacteria | 4223 |
| 652 | Ga0495628_0078933 | 3300046516 | Bacteria | 2559 |
| 653 | Ga0495628_0539512 | 3300046516 | Bacteria | 838 |
| 654 | Ga0495630_0022645 | 3300046517 | Bacteria | 4641 |
| 655 | Ga0495630_0072444 | 3300046517 | Bacteria | 2593 |
| 656 | Ga0495630_0100902 | 3300046517 | Bacteria | 2183 |
| 657 | Ga0495631_0010977 | 3300046518 | Bacteria | 4472 |
| 658 | Ga0495632_0157043 | 3300046519 | Bacteria | 1049 |
| 659 | Ga0495643_0256551 | 3300046522 | Bacteria | 814 |
| 660 | Ga0495644_0075231 | 3300046523 | Bacteria | 1271 |
| 661 | Ga0495644_0079796 | 3300046523 | Bacteria | 1233 |
| 662 | Ga0495648_0002071 | 3300046524 | Bacteria | 18980 |
| 663 | Ga0495648_0006898 | 3300046524 | Bacteria | 9161 |
| 664 | Ga0495648_0020990 | 3300046524 | Bacteria | 4537 |
| 665 | Ga0495648_0044939 | 3300046524 | Bacteria | 2752 |
| 666 | Ga0495648_0059667 | 3300046524 | Bacteria | 2274 |
| 667 | Ga0495663_0083028 | 3300046525 | Bacteria | 1034 |
| 668 | Ga0495666_0001112 | 3300046526 | Bacteria | 12872 |
| 669 | Ga0495666_0024284 | 3300046526 | Bacteria | 2995 |
| 670 | Ga0495666_0024491 | 3300046526 | Bacteria | 2981 |
| 671 | Ga0495666_0059038 | 3300046526 | Bacteria | 1834 |
| 672 | Ga0495666_0143864 | 3300046526 | Bacteria | 1110 |
| 673 | Ga0495666_0176872 | 3300046526 | Bacteria | 986 |
| 674 | Ga0495652_0004163 | 3300046529 | Bacteria | 13951 |
| 675 | Ga0495652_0028128 | 3300046529 | Bacteria | 4951 |
| 676 | Ga0495652_0068263 | 3300046529 | Bacteria | 2978 |
| 677 | Ga0495652_0160785 | 3300046529 | Bacteria | 1744 |
| 678 | Ga0495652_0301000 | 3300046529 | Bacteria | 1166 |
| 679 | Ga0495654_0170967 | 3300046530 | Bacteria | 947 |
| 680 | Ga0495654_0179643 | 3300046530 | Bacteria | 917 |
| 681 | Ga0495665_0000850 | 3300046531 | Bacteria | 15980 |
| 682 | Ga0495665_0017710 | 3300046531 | Bacteria | 3830 |
| 683 | Ga0495665_0021493 | 3300046531 | Bacteria | 3466 |
| 684 | Ga0495640_0001559 | 3300046533 | Bacteria | 18045 |
| 685 | Ga0495640_0008215 | 3300046533 | Bacteria | 8190 |
| 686 | Ga0495640_0020447 | 3300046533 | Bacteria | 4871 |
| 687 | Ga0495586_0008023 | 3300046535 | Bacteria | 5632 |
| 688 | Ga0495586_0021049 | 3300046535 | Bacteria | 3475 |
| 689 | Ga0495586_0026197 | 3300046535 | Bacteria | 3119 |
| 690 | Ga0495586_0069560 | 3300046535 | Unclassified | 1921 |
| 691 | Ga0495586_0075782 | 3300046535 | Bacteria | 1842 |
| 692 | Ga0495586_0162303 | 3300046535 | Bacteria | 1261 |
| 693 | Ga0495587_0024617 | 3300046536 | Bacteria | 3687 |
| 694 | Ga0495598_0056286 | 3300046537 | Bacteria | 1200 |
| 695 | Ga0495598_0066898 | 3300046537 | Bacteria | 1122 |
| 696 | Ga0495609_0045280 | 3300046538 | Bacteria | 1972 |
| 697 | Ga0495609_0310458 | 3300046538 | Bacteria | 641 |
| 698 | Ga0495621_0000732 | 3300046539 | Bacteria | 8328 |
| 699 | Ga0495621_0064524 | 3300046539 | Bacteria | 1336 |
| 700 | Ga0495597_0008426 | 3300046542 | Bacteria | 5169 |
| 701 | Ga0495597_0108794 | 3300046542 | Bacteria | 1164 |
| 702 | Ga0495645_0000711 | 3300046543 | Bacteria | 22852 |
| 703 | Ga0495645_0003632 | 3300046543 | Bacteria | 10479 |
| 704 | Ga0495645_0015497 | 3300046543 | Bacteria | 5421 |
| 705 | Ga0495645_0023969 | 3300046543 | Bacteria | 4423 |
| 706 | Ga0495645_0068067 | 3300046543 | Bacteria | 2571 |
| 707 | Ga0495645_0072339 | 3300046543 | Bacteria | 2484 |
| 708 | Ga0495645_0287650 | 3300046543 | Bacteria | 1078 |
| 709 | Ga0495645_0308308 | 3300046543 | Bacteria | 1032 |
| 710 | Ga0495622_0000189 | 3300046557 | Bacteria | 49512 |
| 711 | Ga0495667_0216812 | 3300046559 | Bacteria | 1222 |
| 712 | Ga0495656_0048401 | 3300046615 | Bacteria | 1806 |
| 713 | Ga0495634_0001118 | 3300046642 | Bacteria | 24827 |
| 714 | Ga0495634_0007356 | 3300046642 | Bacteria | 8284 |
| 715 | Ga0495634_0008158 | 3300046642 | Bacteria | 7803 |
| 716 | Ga0495634_0274929 | 3300046642 | Unclassified | 1024 |
| 717 | Ga0495634_0542168 | 3300046642 | Bacteria | 679 |
| 718 | Ga0495611_0015759 | 3300046648 | Bacteria | 3230 |
| 719 | Ga0495611_0134781 | 3300046648 | Bacteria | 1153 |
| 720 | Ga0495611_0214817 | 3300046648 | Bacteria | 895 |
| 721 | Ga0495625_0040113 | 3300046660 | Bacteria | 3417 |
| 722 | Ga0495625_0123096 | 3300046660 | Bacteria | 1763 |
| 723 | Ga0495625_0494377 | 3300046660 | Bacteria | 749 |
| 724 | Ga0495635_0000924 | 3300046663 | Bacteria | 19353 |
| 725 | Ga0495635_0005087 | 3300046663 | Bacteria | 9143 |
| 726 | Ga0495635_0006417 | 3300046663 | Bacteria | 8200 |
| 727 | Ga0495635_0025331 | 3300046663 | Bacteria | 4131 |
| 728 | Ga0495635_0108500 | 3300046663 | Bacteria | 1897 |
| 729 | Ga0495661_0001617 | 3300046665 | Bacteria | 18461 |
| 730 | Ga0495661_0001859 | 3300046665 | Bacteria | 16869 |
| 731 | Ga0495661_0058089 | 3300046665 | Bacteria | 2307 |
| 732 | Ga0495661_0122549 | 3300046665 | Bacteria | 1434 |
| 733 | Ga0495588_0041802 | 3300046674 | Bacteria | 2342 |
| 734 | Ga0495588_0053373 | 3300046674 | Bacteria | 2084 |
| 735 | Ga0495588_0493313 | 3300046674 | Bacteria | 642 |
| 736 | Ga0495657_0001839 | 3300046675 | Bacteria | 18127 |
| 737 | Ga0495599_0000917 | 3300046678 | Bacteria | 16486 |
| 738 | Ga0495599_0034409 | 3300046678 | Bacteria | 3183 |
| 739 | Ga0495599_0041991 | 3300046678 | Bacteria | 2870 |
| 740 | Ga0495599_0076810 | 3300046678 | Bacteria | 2085 |
| 741 | Ga0495599_0129328 | 3300046678 | Bacteria | 1569 |
| 742 | Ga0495599_0283673 | 3300046678 | Bacteria | 1002 |
| 743 | Ga0495623_0009207 | 3300046679 | Bacteria | 6406 |
| 744 | Ga0495623_0019217 | 3300046679 | Bacteria | 4417 |
| 745 | Ga0495623_0071804 | 3300046679 | Bacteria | 2153 |
| 746 | Ga0495623_0073752 | 3300046679 | Bacteria | 2121 |
| 747 | Ga0495623_0092311 | 3300046679 | Bacteria | 1856 |
| 748 | Ga0495646_0000424 | 3300046680 | Bacteria | 22356 |
| 749 | Ga0495646_0006533 | 3300046680 | Bacteria | 7397 |
| 750 | Ga0495646_0023783 | 3300046680 | Bacteria | 3857 |
| 751 | Ga0495646_0045096 | 3300046680 | Bacteria | 2694 |
| 752 | Ga0495646_0048065 | 3300046680 | Bacteria | 2594 |
| 753 | Ga0495646_0083694 | 3300046680 | Bacteria | 1854 |
| 754 | Ga0495646_0110389 | 3300046680 | Bacteria | 1567 |
| 755 | Ga0495646_0149975 | 3300046680 | Bacteria | 1297 |
| 756 | Ga0495658_0336598 | 3300046683 | Bacteria | 958 |
| 757 | Ga0495669_0005719 | 3300046684 | Bacteria | 5185 |
| 758 | Ga0495669_0012713 | 3300046684 | Bacteria | 3584 |
| 759 | Ga0495669_0019182 | 3300046684 | Bacteria | 2950 |
| 760 | Ga0495613_0001024 | 3300046689 | Bacteria | 21296 |
| 761 | Ga0495613_0003572 | 3300046689 | Bacteria | 11655 |
| 762 | Ga0495613_0024382 | 3300046689 | Bacteria | 4508 |
| 763 | Ga0495624_0000544 | 3300046690 | Bacteria | 29457 |
| 764 | Ga0495624_0001568 | 3300046690 | Bacteria | 17628 |
| 765 | Ga0495624_0001962 | 3300046690 | Bacteria | 15648 |
| 766 | Ga0495624_0042459 | 3300046690 | Bacteria | 2906 |
| 767 | Ga0495624_0131535 | 3300046690 | Bacteria | 1534 |
| 768 | Ga0495670_0026506 | 3300046691 | Bacteria | 2869 |
| 769 | Ga0495670_0061688 | 3300046691 | Bacteria | 1885 |
| 770 | Ga0495670_0193473 | 3300046691 | Bacteria | 1076 |
| 771 | Ga0495671_0044223 | 3300046692 | Bacteria | 2234 |
| 772 | Ga0495671_0054316 | 3300046692 | Bacteria | 1986 |
| 773 | Ga0495649_0003771 | 3300046694 | Bacteria | 10053 |
| 774 | Ga0495649_0028474 | 3300046694 | Bacteria | 3096 |
| 775 | Ga0495649_0036378 | 3300046694 | Bacteria | 2705 |
| 776 | Ga0495649_0041101 | 3300046694 | Bacteria | 2529 |
| 777 | Ga0495649_0174811 | 3300046694 | Bacteria | 1122 |
| 778 | Ga0495649_0217053 | 3300046694 | Bacteria | 990 |
| 779 | Ga0495649_0277097 | 3300046694 | Bacteria | 857 |
| 780 | Ga0495589_0003472 | 3300046794 | Bacteria | 8528 |
| 781 | Ga0495589_0013450 | 3300046794 | Bacteria | 4221 |
| 782 | Ga0495589_0048408 | 3300046794 | Bacteria | 2105 |
| 783 | Ga0495589_0132776 | 3300046794 | Bacteria | 1195 |
| 784 | Ga0495589_0206111 | 3300046794 | Bacteria | 927 |
| 785 | Ga0495600_0001799 | 3300046809 | Bacteria | 11988 |
| 786 | Ga0495600_0002478 | 3300046809 | Bacteria | 10598 |
| 787 | Ga0495600_0045719 | 3300046809 | Bacteria | 2857 |
| 788 | Ga0495660_0227926 | 3300046810 | Bacteria | 875 |
| 789 | Ga0495581_0007999 | 3300047315 | Bacteria | 6126 |
| 790 | Ga0495581_0014840 | 3300047315 | Bacteria | 4518 |
| 791 | Ga0495581_0060722 | 3300047315 | Bacteria | 2184 |
| 792 | Ga0495581_0115974 | 3300047315 | Bacteria | 1557 |
| 793 | Ga0495604_0004577 | 3300047317 | Bacteria | 10955 |
| 794 | Ga0495604_0021854 | 3300047317 | Bacteria | 5108 |
| 795 | Ga0495604_0078136 | 3300047317 | Bacteria | 2484 |
| 796 | Ga0495604_0085938 | 3300047317 | Bacteria | 2346 |
| 797 | Ga0495604_0141166 | 3300047317 | Bacteria | 1721 |
| 798 | Ga0495674_0003975 | 3300047319 | Bacteria | 14336 |
| 799 | Ga0495674_0031845 | 3300047319 | Bacteria | 4785 |
| 800 | Ga0495674_0032399 | 3300047319 | Bacteria | 4740 |
| 801 | Ga0495674_0050637 | 3300047319 | Bacteria | 3664 |
| 802 | Ga0495674_0078963 | 3300047319 | Bacteria | 2827 |
| 803 | Ga0495674_0087977 | 3300047319 | Bacteria | 2657 |
| 804 | Ga0495672_0006332 | 3300047320 | Bacteria | 9197 |
| 805 | Ga0495672_0056663 | 3300047320 | Bacteria | 2278 |
| 806 | Ga0495672_0123667 | 3300047320 | Bacteria | 1371 |
| 807 | Ga0495676_0122394 | 3300047321 | Bacteria | 1890 |
| 808 | Ga0495680_0001352 | 3300047322 | Bacteria | 26627 |
| 809 | Ga0495680_0005702 | 3300047322 | Bacteria | 11657 |
| 810 | Ga0495680_0085384 | 3300047322 | Bacteria | 2376 |
| 811 | Ga0495680_0116425 | 3300047322 | Bacteria | 1976 |
| 812 | Ga0495683_0000509 | 3300047323 | Bacteria | 29948 |
| 813 | Ga0495683_0000736 | 3300047323 | Bacteria | 23733 |
| 814 | Ga0495683_0017227 | 3300047323 | Bacteria | 3746 |
| 815 | Ga0495683_0035934 | 3300047323 | Bacteria | 2517 |
| 816 | Ga0495683_0305225 | 3300047323 | Bacteria | 682 |
| 817 | Ga0495687_000021 | 3300047443 | Bacteria | 334681 |
| 818 | Ga0495687_005610 | 3300047443 | Bacteria | 7934 |
| 819 | Ga0495687_024449 | 3300047443 | Bacteria | 2870 |
| 820 | Ga0495687_045320 | 3300047443 | Bacteria | 1905 |
| 821 | Ga0495687_100880 | 3300047443 | Bacteria | 1083 |
| 822 | Ga0495675_0003647 | 3300047444 | Bacteria | 9300 |
| 823 | Ga0495675_0006834 | 3300047444 | Bacteria | 7001 |
| 824 | Ga0495675_0020466 | 3300047444 | Bacteria | 4208 |
| 825 | Ga0495675_0040794 | 3300047444 | Bacteria | 2959 |
| 826 | Ga0495675_0045141 | 3300047444 | Bacteria | 2806 |
| 827 | Ga0495675_0230925 | 3300047444 | Bacteria | 1116 |
| 828 | Ga0495677_0309949 | 3300047445 | Bacteria | 621 |
| 829 | Ga0495679_000948 | 3300047446 | Bacteria | 18029 |
| 830 | Ga0495679_001256 | 3300047446 | Bacteria | 14951 |
| 831 | Ga0495681_0012001 | 3300047470 | Bacteria | 5115 |
| 832 | Ga0495681_0023298 | 3300047470 | Bacteria | 3293 |
| 833 | Ga0495681_0102547 | 3300047470 | Bacteria | 1249 |
| 834 | Ga0495684_0049563 | 3300047471 | Bacteria | 3208 |
| 835 | Ga0495684_0098708 | 3300047471 | Bacteria | 2208 |
| 836 | Ga0495684_0358899 | 3300047471 | Bacteria | 1033 |
| 837 | Ga0495684_0429573 | 3300047471 | Bacteria | 922 |
| 838 | Ga0495686_0000081 | 3300047472 | Bacteria | 201295 |
| 839 | Ga0495593_0000391 | 3300047673 | Bacteria | 24317 |
| 840 | Ga0495593_0002693 | 3300047673 | Bacteria | 10692 |
| 841 | Ga0495593_0003637 | 3300047673 | Bacteria | 9209 |
| 842 | Ga0495593_0024192 | 3300047673 | Bacteria | 3368 |
| 843 | Ga0495593_0077607 | 3300047673 | Bacteria | 1721 |
| 844 | Ga0495602_0000552 | 3300048088 | Bacteria | 34944 |
| 845 | Ga0495602_0034737 | 3300048088 | Bacteria | 4710 |
| 846 | Ga0495602_0114264 | 3300048088 | Bacteria | 2186 |
| 847 | Ga0495602_0561844 | 3300048088 | Bacteria | 789 |
| 848 | Ga0495614_0003520 | 3300048089 | Bacteria | 7014 |
| 849 | Ga0495614_0052133 | 3300048089 | Bacteria | 1753 |
| 850 | Ga0495615_0058551 | 3300048090 | Bacteria | 1011 |
| 851 | Ga0495626_0011215 | 3300048091 | Bacteria | 4747 |
| 852 | Ga0495626_0028254 | 3300048091 | Bacteria | 2721 |
| 853 | Ga0495626_0095466 | 3300048091 | Bacteria | 1302 |
| 854 | Ga0495626_0097082 | 3300048091 | Bacteria | 1289 |
| 855 | Ga0495626_0220124 | 3300048091 | Unclassified | 772 |
| 856 | Ga0496100_0000132 | 3300048903 | Bacteria | 41949 |
| 857 | Ga0496100_0011084 | 3300048903 | Bacteria | 5117 |
| 858 | Ga0496100_0151511 | 3300048903 | Bacteria | 1654 |
| 859 | Ga0496100_0201979 | 3300048903 | Bacteria | 1449 |
| 860 | Ga0496101_0000208 | 3300048904 | Bacteria | 44706 |
| 861 | Ga0496101_0013538 | 3300048904 | Bacteria | 5468 |
| 862 | Ga0496101_0099848 | 3300048904 | Bacteria | 2170 |
| 863 | Ga0496101_0102842 | 3300048904 | Bacteria | 2140 |
| 864 | Ga0496101_0154603 | 3300048904 | Bacteria | 1756 |
| 865 | Ga0496101_0221191 | 3300048904 | Bacteria | 1469 |
| 866 | Ga0496102_0000731 | 3300048905 | Bacteria | 32282 |
| 867 | Ga0496102_0005828 | 3300048905 | Bacteria | 10481 |
| 868 | Ga0496102_0009067 | 3300048905 | Bacteria | 8536 |
| 869 | Ga0496102_0018882 | 3300048905 | Bacteria | 6066 |
| 870 | Ga0496102_0019016 | 3300048905 | Bacteria | 6045 |
| 871 | Ga0496102_0581889 | 3300048905 | Bacteria | 1042 |
| 872 | Ga0496103_0000654 | 3300048906 | Bacteria | 26241 |
| 873 | Ga0496103_0005975 | 3300048906 | Bacteria | 7281 |
| 874 | Ga0496103_0021006 | 3300048906 | Bacteria | 3926 |
| 875 | Ga0496104_0031418 | 3300048907 | Bacteria | 4938 |
| 876 | Ga0496104_0087388 | 3300048907 | Bacteria | 2977 |
| 877 | Ga0496104_0088526 | 3300048907 | Bacteria | 2958 |
| 878 | Ga0496104_0103599 | 3300048907 | Bacteria | 2726 |
| 879 | Ga0496104_0129901 | 3300048907 | Bacteria | 2420 |
| 880 | Ga0496104_0283241 | 3300048907 | Bacteria | 1570 |
| 881 | Ga0496105_0009985 | 3300048908 | Bacteria | 7448 |
| 882 | Ga0496105_0246811 | 3300048908 | Bacteria | 1447 |
| 883 | Ga0496105_0328979 | 3300048908 | Bacteria | 1223 |
| 884 | Ga0496105_0581008 | 3300048908 | Bacteria | 872 |
| 885 | Ga0496106_0000001 | 3300048909 | Bacteria | 497458 |
| 886 | Ga0496106_0004611 | 3300048909 | Bacteria | 10222 |
| 887 | Ga0496106_0064049 | 3300048909 | Bacteria | 2796 |
| 888 | Ga0496107_0000920 | 3300048910 | Bacteria | 17331 |
| 889 | Ga0496107_0035220 | 3300048910 | Bacteria | 3588 |
| 890 | Ga0496107_0072029 | 3300048910 | Bacteria | 2512 |
| 891 | Ga0496108_0023750 | 3300048911 | Bacteria | 5046 |
| 892 | Ga0496109_0178159 | 3300048912 | Bacteria | 1996 |
| 893 | Ga0496109_0660664 | 3300048912 | Bacteria | 982 |
| 894 | Ga0496110_0007042 | 3300048913 | Bacteria | 8948 |
| 895 | Ga0496110_0132215 | 3300048913 | Bacteria | 2254 |
| 896 | Ga0496112_0006167 | 3300048915 | Bacteria | 10485 |
| 897 | Ga0496112_0045456 | 3300048915 | Bacteria | 4304 |
| 898 | Ga0496113_0003166 | 3300048916 | Bacteria | 9799 |
| 899 | Ga0496113_0003339 | 3300048916 | Bacteria | 9585 |
| 900 | Ga0496114_0004166 | 3300048917 | Bacteria | 11192 |
| 901 | Ga0496114_0057052 | 3300048917 | Bacteria | 3260 |
| 902 | Ga0496114_0469873 | 3300048917 | Bacteria | 1113 |
| 903 | Ga0496115_0201357 | 3300048918 | Bacteria | 1645 |
| 904 | Ga0496116_0006063 | 3300048919 | Bacteria | 11058 |
| 905 | Ga0496116_0069159 | 3300048919 | Bacteria | 2246 |
| 906 | Ga0496116_0133545 | 3300048919 | Bacteria | 1410 |
| 907 | Ga0496117_0000963 | 3300048920 | Bacteria | 44072 |
| 908 | Ga0496117_0007007 | 3300048920 | Bacteria | 11169 |
| 909 | Ga0496117_0019118 | 3300048920 | Bacteria | 5640 |
| 910 | Ga0496117_0096700 | 3300048920 | Bacteria | 1883 |
| 911 | Ga0496118_0000191 | 3300048921 | Bacteria | 107968 |
| 912 | Ga0496118_0000574 | 3300048921 | Bacteria | 60884 |
| 913 | Ga0496118_0002675 | 3300048921 | Bacteria | 23557 |
| 914 | Ga0496118_0005993 | 3300048921 | Bacteria | 13566 |
| 915 | Ga0496118_0016512 | 3300048921 | Bacteria | 6771 |
| 916 | Ga0496118_0068167 | 3300048921 | Bacteria | 2586 |
| 917 | Ga0496118_0071100 | 3300048921 | Bacteria | 2507 |
| 918 | Ga0496118_0227715 | 3300048921 | Bacteria | 1079 |
| 919 | Ga0496119_0135631 | 3300048922 | Bacteria | 1335 |
| 920 | Ga0496120_0042136 | 3300048923 | Bacteria | 2668 |
| 921 | Ga0496121_0000317 | 3300048924 | Bacteria | 100867 |
| 922 | Ga0496121_0000877 | 3300048924 | Bacteria | 54435 |
| 923 | Ga0496121_0005367 | 3300048924 | Bacteria | 16474 |
| 924 | Ga0496121_0005385 | 3300048924 | Bacteria | 16442 |
| 925 | Ga0496121_0015099 | 3300048924 | Bacteria | 8124 |
| 926 | Ga0496121_0015162 | 3300048924 | Bacteria | 8105 |
| 927 | Ga0496121_0096087 | 3300048924 | Bacteria | 2301 |
| 928 | Ga0496122_0083217 | 3300048925 | Bacteria | 2219 |
| 929 | Ga0496123_0011177 | 3300048926 | Bacteria | 7816 |
| 930 | Ga0496124_0004891 | 3300048927 | Bacteria | 15411 |
| 931 | Ga0496124_0059950 | 3300048927 | Bacteria | 3195 |
| 932 | Ga0496124_0253544 | 3300048927 | Bacteria | 1300 |
| 933 | Ga0496125_0026271 | 3300048928 | Bacteria | 5310 |
| 934 | Ga0496125_0139461 | 3300048928 | Bacteria | 1689 |
| 935 | Ga0496125_0168230 | 3300048928 | Bacteria | 1478 |
| 936 | Ga0496126_0000073 | 3300048929 | Bacteria | 236027 |
| 937 | Ga0496126_0000277 | 3300048929 | Bacteria | 108040 |
| 938 | Ga0496126_0001036 | 3300048929 | Bacteria | 47014 |
| 939 | Ga0496126_0001078 | 3300048929 | Bacteria | 45930 |
| 940 | Ga0496126_0001899 | 3300048929 | Bacteria | 30092 |
| 941 | Ga0496126_0028888 | 3300048929 | Bacteria | 5276 |
| 942 | Ga0496126_0036980 | 3300048929 | Bacteria | 4560 |
| 943 | Ga0496126_0291357 | 3300048929 | Bacteria | 1350 |
| 944 | Ga0496126_0550155 | 3300048929 | Bacteria | 916 |
| 945 | Ga0495678_071923 | 3300049459 | Bacteria | 1265 |
| 946 | Ga0495678_091507 | 3300049459 | Bacteria | 1070 |
| 947 | Ga0495682_0015971 | 3300049460 | Bacteria | 2841 |
| 948 | Ga0495682_0019014 | 3300049460 | Bacteria | 2586 |
| 949 | Ga0495682_0029675 | 3300049460 | Bacteria | 2026 |
| 950 | Ga0501300_005221 | 3300049523 | Bacteria | 1922 |
| 951 | Ga0501034_0000487 | 3300049571 | Bacteria | 64548 |
| 952 | Ga0501034_0237096 | 3300049571 | Bacteria | 1771 |
| 953 | Ga0501039_0315998 | 3300049575 | Bacteria | 1228 |
| 954 | Ga0501039_0385636 | 3300049575 | Bacteria | 1101 |
| 955 | Ga0501046_0066998 | 3300049580 | Bacteria | 2797 |
| 956 | Ga0501047_0043522 | 3300049581 | Bacteria | 4338 |
| 957 | Ga0501047_0275803 | 3300049581 | Bacteria | 1527 |
| 958 | Ga0501047_0634970 | 3300049581 | Unclassified | 888 |
| 959 | Ga0501068_0005351 | 3300049584 | Bacteria | 7016 |
| 960 | Ga0501070_0131012 | 3300049586 | Bacteria | 2071 |
| 961 | Ga0501072_0007929 | 3300049588 | Bacteria | 8063 |
| 962 | Ga0501073_0021357 | 3300049589 | Bacteria | 4666 |
| 963 | Ga0501074_0023124 | 3300049590 | Bacteria | 4520 |
| 964 | Ga0501074_0078119 | 3300049590 | Bacteria | 2375 |
| 965 | Ga0501074_0592580 | 3300049590 | Bacteria | 784 |
| 966 | Ga0501076_0198954 | 3300049592 | Bacteria | 1636 |
| 967 | Ga0501080_0002146 | 3300049742 | Bacteria | 17124 |
| 968 | Ga0501080_0343018 | 3300049742 | Bacteria | 1350 |
| 969 | Ga0501083_0040217 | 3300049744 | Bacteria | 3174 |
| 970 | Ga0501280_000174 | 3300049776 | Bacteria | 16446 |
| 971 | Ga0501280_000496 | 3300049776 | Bacteria | 9321 |
| 972 | Ga0501282_000823 | 3300049778 | Bacteria | 3537 |
| 973 | Ga0501282_012358 | 3300049778 | Bacteria | 921 |
| 974 | Ga0501044_0849008 | 3300049823 | Bacteria | 790 |
| 975 | nmdc:mga06z11_261488_c1 | 3300050494 | Bacteria | 1021 |
| 976 | nmdc:mga05p37_35579_c1 | 3300050507 | Bacteria | 6107 |
| 977 | nmdc:mga09592_1644_c1 | 3300050508 | Bacteria | 18003 |
| 978 | nmdc:mga0qj67_102546_c1 | 3300050509 | Bacteria | 2307 |
| 979 | nmdc:mga06r32_275030_c1 | 3300050510 | Bacteria | 1671 |
| 980 | nmdc:mga06r32_4493_c1 | 3300050510 | Bacteria | 12489 |
| 981 | nmdc:mga08y16_30599_c1 | 3300050511 | Bacteria | 5664 |
| 982 | nmdc:mga08y16_40603_c1 | 3300050511 | Bacteria | 4875 |
| 983 | nmdc:mga08y16_67864_c1 | 3300050511 | Bacteria | 3720 |
| 984 | nmdc:mga08y16_71218_c1 | 3300050511 | Bacteria | 3623 |
| 985 | nmdc:mga0n895_95047_c1 | 3300050512 | Bacteria | 2985 |
| 986 | Ga0495601_0780583 | 3300053077 | Bacteria | 607 |
| 987 | Ga0500578_0102136 | 3300053086 | Bacteria | 1814 |
| 988 | Ga0500583_0019736 | 3300053092 | Bacteria | 2769 |
| 989 | Ga0500583_0111166 | 3300053092 | Bacteria | 1349 |
| 990 | Ga0500641_0065286 | 3300053096 | Bacteria | 1522 |
| 991 | Ga0500595_047778 | 3300053119 | Unclassified | 1339 |
| 992 | Ga0500642_0171430 | 3300053130 | Unclassified | 1016 |
| 993 | Ga0500658_0146213 | 3300053134 | Bacteria | 1063 |
| 994 | Ga0500568_0002355 | 3300053139 | Bacteria | 11190 |
| 995 | Ga0500568_0036035 | 3300053139 | Bacteria | 2016 |
| 996 | Ga0500616_0000162 | 3300053153 | Bacteria | 111421 |
| 997 | Ga0500616_0017976 | 3300053153 | Bacteria | 4003 |
| 998 | Ga0500622_0001405 | 3300053156 | Bacteria | 19406 |
| 999 | Ga0500627_0280390 | 3300053158 | Bacteria | 732 |
| 1000 | Ga0500638_031106 | 3300053162 | Bacteria | 2573 |
| 1001 | Ga0500637_0047752 | 3300053178 | Bacteria | 2433 |
| 1002 | Ga0500637_0069842 | 3300053178 | Bacteria | 2020 |
| 1003 | Ga0501084_0056439 | 3300054114 | Bacteria | 3286 |
| 1004 | 2501084753 | 2501025502 | Bacteria | 9641094 |
| 1005 | 2509130585 | 2508501125 | Bacteria | 7208311 |
| 1006 | 2510247899 | 2510065045 | Bacteria | 7761063 |
| 1007 | 2511092387 | 2510917013 | Bacteria | 9951648 |
| 1008 | 2512350229 | 2512047030 | Bacteria | 9031815 |
| 1009 | 2513717204 | 2513237104 | Bacteria | 10034502 |
| 1010 | 2513958610 | 2513237151 | Bacteria | 6309801 |
| 1011 | 2514047218 | 2513237166 | Bacteria | 10373764 |
| 1012 | 2515682252 | 2515154122 | Bacteria | 8609520 |
| 1013 | 2515687302 | 2515154123 | Bacteria | 6387382 |
| 1014 | 2527075899 | 2526164713 | Bacteria | 6780608 |
| 1015 | 2563059080 | 2562617112 | Bacteria | 10918404 |
| 1016 | 2574432007 | 2574179768 | Bacteria | 4907129 |
| 1017 | 2596374388 | 2595698237 | Bacteria | 6712432 |
| 1018 | 2600811886 | 2600255067 | Bacteria | 6795583 |
| 1019 | 2713480641 | 2711768613 | Bacteria | 11048459 |
| 1020 | 2719643668 | 2718217991 | Bacteria | 7829542 |
| 1021 | 2738820486 | 2738541296 | Bacteria | 7285013 |
| 1022 | 2738832966 | 2738541298 | Bacteria | 7286732 |
| 1023 | 2738874493 | 2738541306 | Bacteria | 7284992 |
| 1024 | 2739186123 | 2738543002 | Bacteria | 7284546 |
| 1025 | 2739221091 | 2738543008 | Bacteria | 7282815 |
| 1026 | 2753566970 | 2751185846 | Bacteria | 7242164 |
| 1027 | 2792837109 | 2791355137 | Bacteria | 9654227 |
| 1028 | 2819620580 | 2818991450 | Bacteria | 6962147 |
| 1029 | 2824671129 | 2824661429 | Bacteria | 9877870 |
| 1030 | 2829750893 | 2829745981 | Bacteria | 5406054 |
| 1031 | 2861695809 | 2861691609 | Bacteria | 5628931 |
| 1032 | 2885273811 | 2885270888 | Bacteria | 9831543 |
| 1033 | 2894510903 | 2894510363 | Bacteria | 5121143 |
| 1034 | 2902690772 | 2902682994 | Bacteria | 8951596 |
| 1035 | 2904486583 | 2904483920 | Bacteria | 7545285 |
| 1036 | 2904620143 | 2904615490 | Bacteria | 10047340 |
| 1037 | 2919527914 | 2919527303 | Bacteria | 7718827 |
| 1038 | 2921644770 | 2921643360 | Bacteria | 11448031 |
| 1039 | 2928108821 | 2928108538 | Bacteria | 7360024 |
| 1040 | 2928136045 | 2928135762 | Bacteria | 7259641 |
| 1041 | 2928504175 | 2928503688 | Bacteria | 7268108 |
| 1042 | 2945938733 | 2945934425 | Bacteria | 7444609 |
| 1043 | 2990708732 | 2990703756 | Bacteria | 7715990 |
| 1044 | 639786644 | 639633007 | Bacteria | 4376040 |
| 1045 | 642420880 | 641736151 | Bacteria | 7477263 |
| 1046 | 8055269178 | 8055266321 | Bacteria | 7999742 |
| 1047 | 8055304590 | 8055301274 | Bacteria | 8587385 |
| 1048 | Ga0466957_0052130 | |||
| 1049 | JGI24740J21852_10054051 | |||
| 1050 | JGI24739J22299_10017569 | |||
| 1051 | JGI24737J22298_10019013 | |||
| 1052 | JGI24735J21928_10001150 | |||
| 1053 | JGI24735J21928_10001956 | |||
| 1054 | JGI24738J21930_10003481 | |||
| 1055 | JGI25156J39149_1001373 | |||
| 1056 | JGI25156J39149_1002723 | |||
| 1057 | JGI25165J46597_1002677 | |||
| 1058 | rootL2_10123036 | |||
| 1059 | rootH1_10138059 | |||
| 1060 | rootH1_10211585 | |||
| 1061 | JGI25160J50197_1000120 | |||
| 1062 | Ga0006556J51387_1024168 | |||
| 1063 | Ga0006554J51385_1022598 | |||
| 1064 | Ga0055533_1000069 | |||
| 1065 | Ga0055533_1001661 | |||
| 1066 | Ga0055532_1000011 | |||
| 1067 | Ga0055527_1000009 | |||
| 1068 | Ga0055535_1000008 | |||
| 1069 | Ga0055542_1000014 | |||
| 1070 | Ga0055529_1000010 | |||
| 1071 | Ga0065165_1000382 | |||
| 1072 | Ga0070658_10174489 | |||
| 1073 | Ga0070658_10216191 | |||
| 1074 | Ga0070658_10267467 | |||
| 1075 | Ga0070676_10048106 | |||
| 1076 | Ga0070676_10130321 | |||
| 1077 | Ga0070683_100010629 | |||
| 1078 | Ga0070670_100074863 | |||
| 1079 | Ga0070670_100144328 | |||
| 1080 | Ga0070677_10000351 | |||
| 1081 | Ga0068869_100018796 | |||
| 1082 | Ga0068869_100029457 | |||
| 1083 | Ga0068869_100156722 | |||
| 1084 | Ga0068869_100474791 | |||
| 1085 | Ga0068869_100517622 | |||
| 1086 | Ga0068869_100529748 | |||
| 1087 | Ga0070666_10047242 | |||
| 1088 | Ga0070666_10084508 | |||
| 1089 | Ga0070680_100028148 | |||
| 1090 | Ga0070680_100029377 | |||
| 1091 | Ga0068868_100013696 | |||
| 1092 | Ga0068868_100020809 | |||
| 1093 | Ga0068868_100046927 | |||
| 1094 | Ga0070689_100019246 | |||
| 1095 | Ga0070689_100027205 | |||
| 1096 | Ga0070691_10023817 | |||
| 1097 | Ga0070692_10002831 | |||
| 1098 | Ga0070692_10056894 | |||
| 1099 | Ga0070668_100030554 | |||
| 1100 | Ga0070668_100128434 | |||
| 1101 | Ga0070668_100167017 | |||
| 1102 | Ga0070669_100118158 | |||
| 1103 | Ga0070675_100009721 | |||
| 1104 | Ga0070675_100055802 | |||
| 1105 | Ga0070675_100901453 | |||
| 1106 | Ga0070671_100000338 | |||
| 1107 | Ga0070674_100001615 | |||
| 1108 | Ga0070674_100045777 | |||
| 1109 | Ga0070674_100062933 | |||
| 1110 | Ga0070673_100000839 | |||
| 1111 | Ga0070673_100215208 | |||
| 1112 | Ga0070673_100287134 | |||
| 1113 | Ga0070688_100251181 | |||
| 1114 | Ga0070659_100169259 | |||
| 1115 | Ga0070659_100714409 | |||
| 1116 | Ga0070667_100027313 | |||
| 1117 | Ga0070667_100052700 | |||
| 1118 | Ga0070667_100084929 | |||
| 1119 | Ga0070667_100130646 | |||
| 1120 | Ga0070667_100240358 | |||
| 1121 | Ga0070667_100394856 | |||
| 1122 | Ga0070714_100108308 | |||
| 1123 | Ga0070713_100000153 | |||
| 1124 | Ga0070713_100062207 | |||
| 1125 | Ga0070701_10001527 | |||
| 1126 | Ga0070705_100085919 | |||
| 1127 | Ga0070705_100385541 | |||
| 1128 | Ga0070700_100001746 | |||
| 1129 | Ga0070700_100006528 | |||
| 1130 | Ga0070700_100191857 | |||
| 1131 | Ga0070694_100075617 | |||
| 1132 | Ga0070663_100063430 | |||
| 1133 | Ga0070663_100074045 | |||
| 1134 | Ga0070663_100214623 | |||
| 1135 | Ga0070663_100585163 | |||
| 1136 | Ga0070663_100645814 | |||
| 1137 | Ga0070678_100000181 | |||
| 1138 | Ga0070678_100002694 | |||
| 1139 | Ga0070678_100174321 | |||
| 1140 | Ga0070678_100205645 | |||
| 1141 | Ga0070678_100221381 | |||
| 1142 | Ga0070678_100418737 | |||
| 1143 | Ga0070662_100241069 | |||
| 1144 | Ga0070662_100544280 | |||
| 1145 | Ga0070681_10025996 | |||
| 1146 | Ga0070681_10035517 | |||
| 1147 | Ga0070681_10039374 | |||
| 1148 | Ga0068867_100002536 | |||
| 1149 | Ga0068867_100007853 | |||
| 1150 | Ga0068867_100021131 | |||
| 1151 | Ga0068867_100030435 | |||
| 1152 | Ga0070679_100045148 | |||
| 1153 | Ga0070679_100081818 | |||
| 1154 | Ga0070684_100205193 | |||
| 1155 | Ga0068853_100014471 | |||
| 1156 | Ga0068853_100033272 | |||
| 1157 | Ga0068853_100194660 | |||
| 1158 | Ga0070672_100008475 | |||
| 1159 | Ga0070672_100032768 | |||
| 1160 | Ga0070672_100112396 | |||
| 1161 | Ga0070672_100440337 | |||
| 1162 | Ga0070686_100036020 | |||
| 1163 | Ga0070696_100140430 | |||
| 1164 | Ga0070696_100142512 | |||
| 1165 | Ga0070693_100157464 | |||
| 1166 | Ga0070665_100002442 | |||
| 1167 | Ga0070665_100006578 | |||
| 1168 | Ga0070665_100008852 | |||
| 1169 | Ga0070665_100024587 | |||
| 1170 | Ga0070665_100042072 | |||
| 1171 | Ga0070665_100059437 | |||
| 1172 | Ga0070665_100195334 | |||
| 1173 | Ga0070704_100091858 | |||
| 1174 | Ga0068855_100022954 | |||
| 1175 | Ga0068855_100117559 | |||
| 1176 | Ga0068855_100153203 | |||
| 1177 | Ga0068855_100248832 | |||
| 1178 | Ga0068857_100093233 | |||
| 1179 | Ga0068857_100587468 | |||
| 1180 | Ga0068857_100675357 | |||
| 1181 | Ga0068854_100774360 | |||
| 1182 | Ga0070702_100173989 | |||
| 1183 | Ga0068852_100126971 | |||
| 1184 | Ga0068859_100076262 | |||
| 1185 | Ga0068859_100228290 | |||
| 1186 | Ga0068859_100505306 | |||
| 1187 | Ga0068859_101170093 | |||
| 1188 | Ga0068864_100003186 | |||
| 1189 | Ga0068864_100045568 | |||
| 1190 | Ga0068866_10014311 | |||
| 1191 | Ga0068866_10021453 | |||
| 1192 | Ga0068861_100005585 | |||
| 1193 | Ga0068861_100010029 | |||
| 1194 | Ga0068861_100050610 | |||
| 1195 | Ga0068861_100201352 | |||
| 1196 | Ga0068861_100225028 | |||
| 1197 | Ga0068861_100919069 | |||
| 1198 | Ga0068851_10003036 | |||
| 1199 | Ga0068851_10333053 | |||
| 1200 | Ga0068870_10016848 | |||
| 1201 | Ga0068870_10027184 | |||
| 1202 | Ga0068863_100094694 | |||
| 1203 | Ga0068858_100013613 | |||
| 1204 | Ga0068858_100041174 | |||
| 1205 | Ga0068858_100413726 | |||
| 1206 | Ga0068860_100004363 | |||
| 1207 | Ga0068860_100031666 | |||
| 1208 | Ga0068860_100045577 | |||
| 1209 | Ga0068860_100548273 | |||
| 1210 | Ga0068860_100669112 | |||
| 1211 | Ga0068862_100031027 | |||
| 1212 | Ga0068862_100253991 | |||
| 1213 | Ga0068862_100466779 | |||
| 1214 | Ga0068862_100727896 | |||
| 1215 | Ga0081539_10000159 | |||
| 1216 | Ga0070712_100148848 | |||
| 1217 | Ga0075367_10249451 | |||
| 1218 | Ga0097621_100011909 | |||
| 1219 | Ga0097621_100038168 | |||
| 1220 | Ga0097621_100052279 | |||
| 1221 | Ga0097621_100271903 | |||
| 1222 | Ga0068871_100037560 | |||
| 1223 | Ga0068871_100048205 | |||
| 1224 | Ga0068871_100112594 | |||
| 1225 | Ga0068871_100153916 | |||
| 1226 | Ga0075428_100006300 | |||
| 1227 | Ga0075428_100755954 | |||
| 1228 | Ga0075430_100094685 | |||
| 1229 | Ga0075431_100033265 | |||
| 1230 | Ga0075434_100021209 | |||
| 1231 | Ga0075429_100016275 | |||
| 1232 | Ga0068865_100003361 | |||
| 1233 | Ga0068865_100004597 | |||
| 1234 | Ga0068865_100093990 | |||
| 1235 | Ga0068865_100098777 | |||
| 1236 | Ga0068865_100262610 | |||
| 1237 | Ga0097620_100076262 | |||
| 1238 | Ga0097620_100228291 | |||
| 1239 | Ga0097620_100505298 | |||
| 1240 | Ga0097620_101170166 | |||
| 1241 | Ga0075435_100051111 | |||
| 1242 | Ga0099794_10067718 | |||
| 1243 | Ga0099794_10222216 | |||
| 1244 | Ga0099795_10000120 | |||
| 1245 | Ga0099795_10035530 | |||
| 1246 | Ga0105251_10000072 | |||
| 1247 | Ga0105251_10000295 | |||
| 1248 | Ga0105244_10049780 | |||
| 1249 | Ga0105240_10059434 | |||
| 1250 | Ga0105240_10104035 | |||
| 1251 | Ga0105240_10124025 | |||
| 1252 | Ga0105240_10167188 | |||
| 1253 | Ga0105240_10515445 | |||
| 1254 | Ga0105240_10524544 | |||
| 1255 | Ga0111539_10007194 | |||
| 1256 | Ga0111539_10085810 | |||
| 1257 | Ga0111539_10135393 | |||
| 1258 | Ga0111539_10336370 | |||
| 1259 | Ga0105245_10004734 | |||
| 1260 | Ga0105247_10171600 | |||
| 1261 | Ga0114129_10007843 | |||
| 1262 | Ga0105243_10003015 | |||
| 1263 | Ga0105243_10586516 | |||
| 1264 | Ga0105241_10229904 | |||
| 1265 | Ga0105242_10005521 | |||
| 1266 | Ga0105242_10104211 | |||
| 1267 | Ga0105242_10267039 | |||
| 1268 | Ga0105248_10059415 | |||
| 1269 | Ga0105248_10066595 | |||
| 1270 | Ga0105248_10226308 | |||
| 1271 | Ga0105248_10349742 | |||
| 1272 | Ga0105237_10026511 | |||
| 1273 | Ga0105237_10079351 | |||
| 1274 | Ga0105237_10136375 | |||
| 1275 | Ga0105238_10097485 | |||
| 1276 | Ga0105238_10110252 | |||
| 1277 | Ga0105238_10466247 | |||
| 1278 | Ga0105238_10605905 | |||
| 1279 | Ga0105238_10836203 | |||
| 1280 | Ga0105249_10126338 | |||
| 1281 | Ga0105239_10409879 | |||
| 1282 | Ga0105239_10544081 | |||
| 1283 | Ga0105246_10191504 | |||
| 1284 | Ga0157369_10009789 | |||
| 1285 | Ga0157369_10062985 | |||
| 1286 | Ga0157369_10108300 | |||
| 1287 | Ga0157369_10137543 | |||
| 1288 | Ga0157369_10347850 | |||
| 1289 | Ga0157369_10955847 | |||
| 1290 | Ga0157374_10014152 | |||
| 1291 | Ga0157374_10100947 | |||
| 1292 | Ga0157374_10659498 | |||
| 1293 | Ga0157378_10003237 | |||
| 1294 | Ga0157378_10010149 | |||
| 1295 | Ga0157378_10116295 | |||
| 1296 | Ga0157378_10264173 | |||
| 1297 | Ga0163162_10008237 | |||
| 1298 | Ga0163162_10021095 | |||
| 1299 | Ga0163162_10131139 | |||
| 1300 | Ga0163162_10619850 | |||
| 1301 | Ga0157372_10097140 | |||
| 1302 | Ga0157375_10000068 | |||
| 1303 | Ga0157375_10005514 | |||
| 1304 | Ga0157375_10024005 | |||
| 1305 | Ga0157375_10061887 | |||
| 1306 | Ga0157375_10524684 | |||
| 1307 | Ga0157375_10919525 | |||
| 1308 | Ga0163163_10024773 | |||
| 1309 | Ga0157380_10035257 | |||
| 1310 | Ga0157380_10269691 | |||
| 1311 | Ga0182008_10173299 | |||
| 1312 | Ga0157379_10002215 | |||
| 1313 | Ga0157379_10013196 | |||
| 1314 | Ga0157379_10384897 | |||
| 1315 | Ga0157379_10688444 | |||
| 1316 | Ga0157376_10059846 | |||
| 1317 | Ga0182007_10001285 | |||
| 1318 | Ga0163161_10036566 | |||
| 1319 | Ga0163161_10250311 | |||
| 1320 | Ga0209435_107632 | |||
| 1321 | Ga0209674_100011 | |||
| 1322 | Ga0209674_100029 | |||
| 1323 | Ga0209672_100002 | |||
| 1324 | Ga0209147_100003 | |||
| 1325 | Ga0207427_100974 | |||
| 1326 | Ga0209258_100005 | |||
| 1327 | Ga0209646_1015382 | |||
| 1328 | Ga0209148_1000006 | |||
| 1329 | Ga0209759_1000006 | |||
| 1330 | Ga0209759_1000008 | |||
| 1331 | Ga0209233_1000018 | |||
| 1332 | Ga0209455_1000003 | |||
| 1333 | Ga0209564_1016088 | |||
| 1334 | Ga0207426_1000004 | |||
| 1335 | Ga0207426_1012265 | |||
| 1336 | Ga0207656_10006515 | |||
| 1337 | Ga0207655_1032000 | |||
| 1338 | Ga0207713_1000651 | |||
| 1339 | Ga0207713_1002352 | |||
| 1340 | Ga0207682_10006350 | |||
| 1341 | Ga0207642_10008072 | |||
| 1342 | Ga0207642_10057598 | |||
| 1343 | Ga0207642_10092002 | |||
| 1344 | Ga0207688_10114191 | |||
| 1345 | Ga0207680_10010115 | |||
| 1346 | Ga0207680_10237328 | |||
| 1347 | Ga0207647_10019319 | |||
| 1348 | Ga0207647_10061543 | |||
| 1349 | Ga0207645_10011586 | |||
| 1350 | Ga0207645_10317684 | |||
| 1351 | Ga0207643_10011965 | |||
| 1352 | Ga0207643_10012010 | |||
| 1353 | Ga0207643_10248431 | |||
| 1354 | Ga0207705_10090441 | |||
| 1355 | Ga0207705_10196493 | |||
| 1356 | Ga0207654_10208522 | |||
| 1357 | Ga0207654_10414039 | |||
| 1358 | Ga0207707_10027860 | |||
| 1359 | Ga0207707_10289554 | |||
| 1360 | Ga0207707_10926660 | |||
| 1361 | Ga0207695_10029609 | |||
| 1362 | Ga0207695_10038625 | |||
| 1363 | Ga0207695_10043698 | |||
| 1364 | Ga0207695_10292463 | |||
| 1365 | Ga0207671_10073240 | |||
| 1366 | Ga0207671_10589308 | |||
| 1367 | Ga0207660_10104114 | |||
| 1368 | Ga0207660_10156095 | |||
| 1369 | Ga0207660_10228151 | |||
| 1370 | Ga0207657_10028819 | |||
| 1371 | Ga0207652_10247527 | |||
| 1372 | Ga0207681_10044962 | |||
| 1373 | Ga0207694_11067664 | |||
| 1374 | Ga0207659_10027144 | |||
| 1375 | Ga0207659_10711652 | |||
| 1376 | Ga0207687_10072238 | |||
| 1377 | Ga0207700_10000047 | |||
| 1378 | Ga0207700_10047061 | |||
| 1379 | Ga0207700_10393319 | |||
| 1380 | Ga0207644_10573841 | |||
| 1381 | Ga0207706_10246765 | |||
| 1382 | Ga0207706_10565182 | |||
| 1383 | Ga0207686_10234281 | |||
| 1384 | Ga0207670_10059524 | |||
| 1385 | Ga0207669_10067251 | |||
| 1386 | Ga0207669_10087505 | |||
| 1387 | Ga0207669_10178774 | |||
| 1388 | Ga0207669_10340893 | |||
| 1389 | Ga0207704_10011712 | |||
| 1390 | Ga0207704_10073221 | |||
| 1391 | Ga0207704_10374864 | |||
| 1392 | Ga0207704_10488889 | |||
| 1393 | Ga0207691_10000445 | |||
| 1394 | Ga0207691_10024348 | |||
| 1395 | Ga0207691_10319911 | |||
| 1396 | Ga0207691_10870717 | |||
| 1397 | Ga0207711_10064107 | |||
| 1398 | Ga0207711_10071543 | |||
| 1399 | Ga0207711_10143482 | |||
| 1400 | Ga0207711_10162086 | |||
| 1401 | Ga0207711_10236356 | |||
| 1402 | Ga0207689_10000498 | |||
| 1403 | Ga0207689_10001020 | |||
| 1404 | Ga0207689_10366949 | |||
| 1405 | Ga0207689_10697380 | |||
| 1406 | Ga0207661_10046053 | |||
| 1407 | Ga0207667_10043349 | |||
| 1408 | Ga0207651_10319137 | |||
| 1409 | Ga0207651_10537612 | |||
| 1410 | Ga0207712_10049841 | |||
| 1411 | Ga0207668_10067307 | |||
| 1412 | Ga0207668_10091729 | |||
| 1413 | Ga0207668_10188374 | |||
| 1414 | Ga0207640_10218315 | |||
| 1415 | Ga0207658_10062478 | |||
| 1416 | Ga0207658_10096987 | |||
| 1417 | Ga0207658_10292105 | |||
| 1418 | Ga0207658_10348038 | |||
| 1419 | Ga0207658_10365578 | |||
| 1420 | Ga0207658_10604588 | |||
| 1421 | Ga0207677_10047245 | |||
| 1422 | Ga0207703_10029837 | |||
| 1423 | Ga0207703_10033209 | |||
| 1424 | Ga0207703_10083757 | |||
| 1425 | Ga0207703_10086646 | |||
| 1426 | Ga0207703_10165361 | |||
| 1427 | Ga0207703_10515128 | |||
| 1428 | Ga0207639_10094305 | |||
| 1429 | Ga0207639_10712210 | |||
| 1430 | Ga0207678_10036583 | |||
| 1431 | Ga0207678_10104480 | |||
| 1432 | Ga0207678_10467084 | |||
| 1433 | Ga0207708_10004000 | |||
| 1434 | Ga0207708_10004970 | |||
| 1435 | Ga0207708_10085503 | |||
| 1436 | Ga0207708_10460980 | |||
| 1437 | Ga0207641_10061898 | |||
| 1438 | Ga0207641_10508327 | |||
| 1439 | Ga0207648_10004532 | |||
| 1440 | Ga0207648_10004732 | |||
| 1441 | Ga0207648_10013066 | |||
| 1442 | Ga0207648_10031859 | |||
| 1443 | Ga0207648_10034863 | |||
| 1444 | Ga0207676_10055597 | |||
| 1445 | Ga0207676_10212746 | |||
| 1446 | Ga0207674_10066488 | |||
| 1447 | Ga0207674_10726576 | |||
| 1448 | Ga0207675_100001881 | |||
| 1449 | Ga0207675_100010665 | |||
| 1450 | Ga0207675_100114497 | |||
| 1451 | Ga0207675_100135759 | |||
| 1452 | Ga0207675_100260001 | |||
| 1453 | Ga0207675_101022904 | |||
| 1454 | Ga0207683_10000568 | |||
| 1455 | Ga0207683_10005214 | |||
| 1456 | Ga0207683_10125795 | |||
| 1457 | Ga0207683_10132900 | |||
| 1458 | Ga0207683_10616848 | |||
| 1459 | Ga0207698_10214500 | |||
| 1460 | Ga0209371_1006863 | |||
| 1461 | Ga0207428_10050472 | |||
| 1462 | Ga0207428_10344976 | |||
| 1463 | Ga0265354_1002352 | |||
| 1464 | Ga0268266_10000572 | |||
| 1465 | Ga0268266_10002990 | |||
| 1466 | Ga0268266_10064935 | |||
| 1467 | Ga0268266_10067015 | |||
| 1468 | Ga0268266_10105119 | |||
| 1469 | Ga0268266_10197071 | |||
| 1470 | Ga0268266_10604474 | |||
| 1471 | Ga0268265_10042291 | |||
| 1472 | Ga0268265_10048302 | |||
| 1473 | Ga0268265_11227967 | |||
| 1474 | Ga0268264_10320542 | |||
| 1475 | Ga0268264_10398949 | |||
| 1476 | Ga0265337_1100367 | |||
| 1477 | Ga0265334_10001462 | |||
| 1478 | Ga0265334_10020034 | |||
| 1479 | Ga0265318_10022970 | |||
| 1480 | Ga0265323_10002683 | |||
| 1481 | Ga0265323_10058555 | |||
| 1482 | Ga0307515_10030456 | |||
| 1483 | Ga0265338_10042471 | |||
| 1484 | Ga0265338_10045686 | |||
| 1485 | Ga0265338_10115264 | |||
| 1486 | Ga0265338_10227645 | |||
| 1487 | Ga0268256_1003422 | |||
| 1488 | Ga0265762_1011265 | |||
| 1489 | Ga0265760_10000144 | |||
| 1490 | Ga0265330_10030371 | |||
| 1491 | Ga0265332_10001019 | |||
| 1492 | Ga0265332_10010047 | |||
| 1493 | Ga0265332_10039408 | |||
| 1494 | Ga0265320_10000602 | |||
| 1495 | Ga0265320_10083500 | |||
| 1496 | Ga0265325_10042429 | |||
| 1497 | Ga0265329_10002719 | |||
| 1498 | Ga0265340_10180690 | |||
| 1499 | Ga0265340_10210306 | |||
| 1500 | Ga0265339_10011690 | |||
| 1501 | Ga0265331_10001819 | |||
| 1502 | Ga0265331_10002369 | |||
| 1503 | Ga0265331_10011222 | |||
| 1504 | Ga0265327_10016362 | |||
| 1505 | Ga0307513_10314729 | |||
| 1506 | Ga0307513_10496151 | |||
| 1507 | Ga0307509_10000080 | |||
| 1508 | Ga0307509_10000109 | |||
| 1509 | Ga0307509_10000138 | |||
| 1510 | Ga0307509_10003473 | |||
| 1511 | Ga0265313_10002432 | |||
| 1512 | Ga0307508_10013259 | |||
| 1513 | Ga0316575_10018727 | |||
| 1514 | Ga0316575_10066616 | |||
| 1515 | Ga0316575_10116421 | |||
| 1516 | Ga0316575_10238337 | |||
| 1517 | Ga0316579_10031990 | |||
| 1518 | Ga0316579_10089283 | |||
| 1519 | Ga0265342_10209958 | |||
| 1520 | Ga0265342_10323080 | |||
| 1521 | Ga0316576_10012263 | |||
| 1522 | Ga0316576_10017687 | |||
| 1523 | Ga0316576_10048489 | |||
| 1524 | Ga0316576_10158196 | |||
| 1525 | Ga0316576_10307432 | |||
| 1526 | Ga0316576_10353179 | |||
| 1527 | Ga0316578_10052083 | |||
| 1528 | Ga0316578_10083573 | |||
| 1529 | Ga0316578_10176319 | |||
| 1530 | Ga0316578_10217971 | |||
| 1531 | Ga0307516_10028617 | |||
| 1532 | Ga0316577_10006757 | |||
| 1533 | Ga0316577_10012463 | |||
| 1534 | Ga0307413_10583864 | |||
| 1535 | Ga0307410_10077398 | |||
| 1536 | Ga0307412_10000002 | |||
| 1537 | Ga0307409_100929650 | |||
| 1538 | Ga0307416_100163760 | |||
| 1539 | Ga0307411_10789175 | |||
| 1540 | Ga0316583_10006750 | |||
| 1541 | Ga0316583_10051104 | |||
| 1542 | Ga0316583_10125201 | |||
| 1543 | Ga0316585_10000289 | |||
| 1544 | Ga0316585_10119428 | |||
| 1545 | Ga0316580_10002263 | |||
| 1546 | Ga0316580_10023246 | |||
| 1547 | Ga0316593_10001799 | |||
| 1548 | Ga0307510_10080879 | |||
| 1549 | Ga0316588_1001564 | |||
| 1550 | Ga0316596_1002628 | |||
| 1551 | Ga0373944_0072616 | |||
| 1552 | Ga0373946_0215688 | |||
| 1553 | Ga0373946_0238776 | |||
| 1554 | Ga0316574_0001317 | |||
| 1555 | Ga0316574_0010561 | |||
| 1556 | Ga0316574_0023977 | |||
| 1557 | Ga0316574_0030810 | |||
| 1558 | Ga0316574_0063325 | |||
| 1559 | Ga0316574_0066234 | |||
| 1560 | Ga0316574_0117580 | |||
| 1561 | Ga0316574_0138912 | |||
| 1562 | Ga0316574_0216124 | |||
| 1563 | Ga0316574_0368876 | |||
| 1564 | Ga0373924_0065757 | |||
| 1565 | Ga0373937_0570215 | |||
| 1566 | Ga0316582_0012654 | |||
| 1567 | Ga0316582_0020698 | |||
| 1568 | Ga0316582_0051419 | |||
| 1569 | Ga0316582_0095343 | |||
| 1570 | Ga0316582_0117772 | |||
| 1571 | Ga0316582_0476292 | |||
| 1572 | Ga0316584_0016214 | |||
| 1573 | Ga0316584_0042188 | |||
| 1574 | Ga0316584_0165192 | |||
| 1575 | Ga0316584_0173216 | |||
| 1576 | Ga0316584_0246198 | |||
| 1577 | Ga0316584_0271739 | |||
| 1578 | Ga0316584_0300229 | |||
| 1579 | Ga0316584_0322941 | |||
| 1580 | Ga0316584_0324744 | |||
| 1581 | Ga0373925_0001698 | |||
| 1582 | Ga0373925_0224329 | |||
| 1583 | Ga0395899_0017299 | |||
| 1584 | Ga0395899_0282377 | |||
| 1585 | Ga0395899_0430239 | |||
| 1586 | Ga0395900_0006153 | |||
| 1587 | Ga0395898_0003979 | |||
| 1588 | Ga0395898_0132432 | |||
| 1589 | Ga0395898_0240898 | |||
| 1590 | Ga0395905_0000039 | |||
| 1591 | Ga0395905_0001775 | |||
| 1592 | Ga0395905_0003191 | |||
| 1593 | Ga0395905_0056879 | |||
| 1594 | Ga0395901_0402083 | |||
| 1595 | Ga0451789_0229899 | |||
| 1596 | Ga0451837_0547275 | |||
| 1597 | Ga0451577_0518880 | |||
| 1598 | Ga0466969_0017880 | |||
| 1599 | Ga0466980_0179952 | |||
| 1600 | Ga0466965_0142776 | |||
| 1601 | Ga0466966_0020736 | |||
| 1602 | Ga0466966_0090039 | |||
| 1603 | Ga0466966_0413324 | |||
| 1604 | Ga0466961_0014233 | |||
| 1605 | Ga0466961_0016640 | |||
| 1606 | Ga0466971_0053406 | |||
| 1607 | Ga0466959_0003650 | |||
| 1608 | Ga0466959_0063359 | |||
| 1609 | Ga0466959_0137981 | |||
| 1610 | Ga0466959_0198179 | |||
| 1611 | Ga0451576_0000591 | |||
| 1612 | Ga0451576_0217638 | |||
| 1613 | Ga0451576_0541048 | |||
| 1614 | Ga0466967_0135264 | |||
| 1615 | Ga0466967_0293141 | |||
| 1616 | Ga0466967_0730155 | |||
| 1617 | Ga0495592_0000035 | |||
| 1618 | Ga0495592_0006627 | |||
| 1619 | Ga0495592_0084501 | |||
| 1620 | Ga0495603_0000247 | |||
| 1621 | Ga0495603_0001296 | |||
| 1622 | Ga0495603_0020727 | |||
| 1623 | Ga0495603_0081926 | |||
| 1624 | Ga0495603_0203051 | |||
| 1625 | Ga0495590_0001367 | |||
| 1626 | Ga0495590_0001683 | |||
| 1627 | Ga0495590_0043304 | |||
| 1628 | Ga0495590_0337422 | |||
| 1629 | Ga0495591_003664 | |||
| 1630 | Ga0495629_0001266 | |||
| 1631 | Ga0495629_0014967 | |||
| 1632 | Ga0495629_0015967 | |||
| 1633 | Ga0495638_0003399 | |||
| 1634 | Ga0495638_0277393 | |||
| 1635 | Ga0495638_0352523 | |||
| 1636 | Ga0495641_0014732 | |||
| 1637 | Ga0495641_0211065 | |||
| 1638 | Ga0495651_0060103 | |||
| 1639 | Ga0495653_0003596 | |||
| 1640 | Ga0495653_0005250 | |||
| 1641 | Ga0495653_0030739 | |||
| 1642 | Ga0495653_0044728 | |||
| 1643 | Ga0495653_0075309 | |||
| 1644 | Ga0495653_0172741 | |||
| 1645 | Ga0495650_0001275 | |||
| 1646 | Ga0495650_0002047 | |||
| 1647 | Ga0495650_0003633 | |||
| 1648 | Ga0495650_0004710 | |||
| 1649 | Ga0495650_0010946 | |||
| 1650 | Ga0495650_0097659 | |||
| 1651 | Ga0495650_0139438 | |||
| 1652 | Ga0495580_0000044 | |||
| 1653 | Ga0495580_0000077 | |||
| 1654 | Ga0495580_0009356 | |||
| 1655 | Ga0495580_0022615 | |||
| 1656 | Ga0495580_0329989 | |||
| 1657 | Ga0495582_0001360 | |||
| 1658 | Ga0495582_0007169 | |||
| 1659 | Ga0495582_0039912 | |||
| 1660 | Ga0495582_0128612 | |||
| 1661 | Ga0495605_0005792 | |||
| 1662 | Ga0495605_0018793 | |||
| 1663 | Ga0495605_0020633 | |||
| 1664 | Ga0495605_0116392 | |||
| 1665 | Ga0495639_0026261 | |||
| 1666 | Ga0495639_0034271 | |||
| 1667 | Ga0495662_0023637 | |||
| 1668 | Ga0495662_0085189 | |||
| 1669 | Ga0495664_0008582 | |||
| 1670 | Ga0495664_0148769 | |||
| 1671 | Ga0495584_0036642 | |||
| 1672 | Ga0495584_0052569 | |||
| 1673 | Ga0495585_0024735 | |||
| 1674 | Ga0495594_0015849 | |||
| 1675 | Ga0495594_0029153 | |||
| 1676 | Ga0495594_0681772 | |||
| 1677 | Ga0495596_0030361 | |||
| 1678 | Ga0495596_0037859 | |||
| 1679 | Ga0495596_0166945 | |||
| 1680 | Ga0495583_0001664 | |||
| 1681 | Ga0495583_0053072 | |||
| 1682 | Ga0495606_0006969 | |||
| 1683 | Ga0495606_0045509 | |||
| 1684 | Ga0495606_0078152 | |||
| 1685 | Ga0495606_0109983 | |||
| 1686 | Ga0495606_0157378 | |||
| 1687 | Ga0495608_0017380 | |||
| 1688 | Ga0495608_0025361 | |||
| 1689 | Ga0495610_0005022 | |||
| 1690 | Ga0495616_0044849 | |||
| 1691 | Ga0495618_0002030 | |||
| 1692 | Ga0495618_0030999 | |||
| 1693 | Ga0495618_0032691 | |||
| 1694 | Ga0495620_0032890 | |||
| 1695 | Ga0495628_0000465 | |||
| 1696 | Ga0495628_0010859 | |||
| 1697 | Ga0495628_0025779 | |||
| 1698 | Ga0495628_0032338 | |||
| 1699 | Ga0495628_0078933 | |||
| 1700 | Ga0495628_0539512 | |||
| 1701 | Ga0495630_0022645 | |||
| 1702 | Ga0495630_0072444 | |||
| 1703 | Ga0495630_0100902 | |||
| 1704 | Ga0495631_0010977 | |||
| 1705 | Ga0495632_0157043 | |||
| 1706 | Ga0495643_0256551 | |||
| 1707 | Ga0495644_0075231 | |||
| 1708 | Ga0495644_0079796 | |||
| 1709 | Ga0495648_0002071 | |||
| 1710 | Ga0495648_0006898 | |||
| 1711 | Ga0495648_0020990 | |||
| 1712 | Ga0495648_0044939 | |||
| 1713 | Ga0495648_0059667 | |||
| 1714 | Ga0495663_0083028 | |||
| 1715 | Ga0495666_0001112 | |||
| 1716 | Ga0495666_0024284 | |||
| 1717 | Ga0495666_0024491 | |||
| 1718 | Ga0495666_0059038 | |||
| 1719 | Ga0495666_0143864 | |||
| 1720 | Ga0495666_0176872 | |||
| 1721 | Ga0495652_0004163 | |||
| 1722 | Ga0495652_0028128 | |||
| 1723 | Ga0495652_0068263 | |||
| 1724 | Ga0495652_0160785 | |||
| 1725 | Ga0495652_0301000 | |||
| 1726 | Ga0495654_0170967 | |||
| 1727 | Ga0495654_0179643 | |||
| 1728 | Ga0495665_0000850 | |||
| 1729 | Ga0495665_0017710 | |||
| 1730 | Ga0495665_0021493 | |||
| 1731 | Ga0495640_0001559 | |||
| 1732 | Ga0495640_0008215 | |||
| 1733 | Ga0495640_0020447 | |||
| 1734 | Ga0495586_0008023 | |||
| 1735 | Ga0495586_0021049 | |||
| 1736 | Ga0495586_0026197 | |||
| 1737 | Ga0495586_0069560 | |||
| 1738 | Ga0495586_0075782 | |||
| 1739 | Ga0495586_0162303 | |||
| 1740 | Ga0495587_0024617 | |||
| 1741 | Ga0495598_0056286 | |||
| 1742 | Ga0495598_0066898 | |||
| 1743 | Ga0495609_0045280 | |||
| 1744 | Ga0495609_0310458 | |||
| 1745 | Ga0495621_0000732 | |||
| 1746 | Ga0495621_0064524 | |||
| 1747 | Ga0495597_0008426 | |||
| 1748 | Ga0495597_0108794 | |||
| 1749 | Ga0495645_0000711 | |||
| 1750 | Ga0495645_0003632 | |||
| 1751 | Ga0495645_0015497 | |||
| 1752 | Ga0495645_0023969 | |||
| 1753 | Ga0495645_0068067 | |||
| 1754 | Ga0495645_0072339 | |||
| 1755 | Ga0495645_0287650 | |||
| 1756 | Ga0495645_0308308 | |||
| 1757 | Ga0495622_0000189 | |||
| 1758 | Ga0495667_0216812 | |||
| 1759 | Ga0495656_0048401 | |||
| 1760 | Ga0495634_0001118 | |||
| 1761 | Ga0495634_0007356 | |||
| 1762 | Ga0495634_0008158 | |||
| 1763 | Ga0495634_0274929 | |||
| 1764 | Ga0495634_0542168 | |||
| 1765 | Ga0495611_0015759 | |||
| 1766 | Ga0495611_0134781 | |||
| 1767 | Ga0495611_0214817 | |||
| 1768 | Ga0495625_0040113 | |||
| 1769 | Ga0495625_0123096 | |||
| 1770 | Ga0495625_0494377 | |||
| 1771 | Ga0495635_0000924 | |||
| 1772 | Ga0495635_0005087 | |||
| 1773 | Ga0495635_0006417 | |||
| 1774 | Ga0495635_0025331 | |||
| 1775 | Ga0495635_0108500 | |||
| 1776 | Ga0495661_0001617 | |||
| 1777 | Ga0495661_0001859 | |||
| 1778 | Ga0495661_0058089 | |||
| 1779 | Ga0495661_0122549 | |||
| 1780 | Ga0495588_0041802 | |||
| 1781 | Ga0495588_0053373 | |||
| 1782 | Ga0495588_0493313 | |||
| 1783 | Ga0495657_0001839 | |||
| 1784 | Ga0495599_0000917 | |||
| 1785 | Ga0495599_0034409 | |||
| 1786 | Ga0495599_0041991 | |||
| 1787 | Ga0495599_0076810 | |||
| 1788 | Ga0495599_0129328 | |||
| 1789 | Ga0495599_0283673 | |||
| 1790 | Ga0495623_0009207 | |||
| 1791 | Ga0495623_0019217 | |||
| 1792 | Ga0495623_0071804 | |||
| 1793 | Ga0495623_0073752 | |||
| 1794 | Ga0495623_0092311 | |||
| 1795 | Ga0495646_0000424 | |||
| 1796 | Ga0495646_0006533 | |||
| 1797 | Ga0495646_0023783 | |||
| 1798 | Ga0495646_0045096 | |||
| 1799 | Ga0495646_0048065 | |||
| 1800 | Ga0495646_0083694 | |||
| 1801 | Ga0495646_0110389 | |||
| 1802 | Ga0495646_0149975 | |||
| 1803 | Ga0495658_0336598 | |||
| 1804 | Ga0495669_0005719 | |||
| 1805 | Ga0495669_0012713 | |||
| 1806 | Ga0495669_0019182 | |||
| 1807 | Ga0495613_0001024 | |||
| 1808 | Ga0495613_0003572 | |||
| 1809 | Ga0495613_0024382 | |||
| 1810 | Ga0495624_0000544 | |||
| 1811 | Ga0495624_0001568 | |||
| 1812 | Ga0495624_0001962 | |||
| 1813 | Ga0495624_0042459 | |||
| 1814 | Ga0495624_0131535 | |||
| 1815 | Ga0495670_0026506 | |||
| 1816 | Ga0495670_0061688 | |||
| 1817 | Ga0495670_0193473 | |||
| 1818 | Ga0495671_0044223 | |||
| 1819 | Ga0495671_0054316 | |||
| 1820 | Ga0495649_0003771 | |||
| 1821 | Ga0495649_0028474 | |||
| 1822 | Ga0495649_0036378 | |||
| 1823 | Ga0495649_0041101 | |||
| 1824 | Ga0495649_0174811 | |||
| 1825 | Ga0495649_0217053 | |||
| 1826 | Ga0495649_0277097 | |||
| 1827 | Ga0495589_0003472 | |||
| 1828 | Ga0495589_0013450 | |||
| 1829 | Ga0495589_0048408 | |||
| 1830 | Ga0495589_0132776 | |||
| 1831 | Ga0495589_0206111 | |||
| 1832 | Ga0495600_0001799 | |||
| 1833 | Ga0495600_0002478 | |||
| 1834 | Ga0495600_0045719 | |||
| 1835 | Ga0495660_0227926 | |||
| 1836 | Ga0495581_0007999 | |||
| 1837 | Ga0495581_0014840 | |||
| 1838 | Ga0495581_0060722 | |||
| 1839 | Ga0495581_0115974 | |||
| 1840 | Ga0495604_0004577 | |||
| 1841 | Ga0495604_0021854 | |||
| 1842 | Ga0495604_0078136 | |||
| 1843 | Ga0495604_0085938 | |||
| 1844 | Ga0495604_0141166 | |||
| 1845 | Ga0495674_0003975 | |||
| 1846 | Ga0495674_0031845 | |||
| 1847 | Ga0495674_0032399 | |||
| 1848 | Ga0495674_0050637 | |||
| 1849 | Ga0495674_0078963 | |||
| 1850 | Ga0495674_0087977 | |||
| 1851 | Ga0495672_0006332 | |||
| 1852 | Ga0495672_0056663 | |||
| 1853 | Ga0495672_0123667 | |||
| 1854 | Ga0495676_0122394 | |||
| 1855 | Ga0495680_0001352 | |||
| 1856 | Ga0495680_0005702 | |||
| 1857 | Ga0495680_0085384 | |||
| 1858 | Ga0495680_0116425 | |||
| 1859 | Ga0495683_0000509 | |||
| 1860 | Ga0495683_0000736 | |||
| 1861 | Ga0495683_0017227 | |||
| 1862 | Ga0495683_0035934 | |||
| 1863 | Ga0495683_0305225 | |||
| 1864 | Ga0495687_000021 | |||
| 1865 | Ga0495687_005610 | |||
| 1866 | Ga0495687_024449 | |||
| 1867 | Ga0495687_045320 | |||
| 1868 | Ga0495687_100880 | |||
| 1869 | Ga0495675_0003647 | |||
| 1870 | Ga0495675_0006834 | |||
| 1871 | Ga0495675_0020466 | |||
| 1872 | Ga0495675_0040794 | |||
| 1873 | Ga0495675_0045141 | |||
| 1874 | Ga0495675_0230925 | |||
| 1875 | Ga0495677_0309949 | |||
| 1876 | Ga0495679_000948 | |||
| 1877 | Ga0495679_001256 | |||
| 1878 | Ga0495681_0012001 | |||
| 1879 | Ga0495681_0023298 | |||
| 1880 | Ga0495681_0102547 | |||
| 1881 | Ga0495684_0049563 | |||
| 1882 | Ga0495684_0098708 | |||
| 1883 | Ga0495684_0358899 | |||
| 1884 | Ga0495684_0429573 | |||
| 1885 | Ga0495686_0000081 | |||
| 1886 | Ga0495593_0000391 | |||
| 1887 | Ga0495593_0002693 | |||
| 1888 | Ga0495593_0003637 | |||
| 1889 | Ga0495593_0024192 | |||
| 1890 | Ga0495593_0077607 | |||
| 1891 | Ga0495602_0000552 | |||
| 1892 | Ga0495602_0034737 | |||
| 1893 | Ga0495602_0114264 | |||
| 1894 | Ga0495602_0561844 | |||
| 1895 | Ga0495614_0003520 | |||
| 1896 | Ga0495614_0052133 | |||
| 1897 | Ga0495615_0058551 | |||
| 1898 | Ga0495626_0011215 | |||
| 1899 | Ga0495626_0028254 | |||
| 1900 | Ga0495626_0095466 | |||
| 1901 | Ga0495626_0097082 | |||
| 1902 | Ga0495626_0220124 | |||
| 1903 | Ga0496100_0000132 | |||
| 1904 | Ga0496100_0011084 | |||
| 1905 | Ga0496100_0151511 | |||
| 1906 | Ga0496100_0201979 | |||
| 1907 | Ga0496101_0000208 | |||
| 1908 | Ga0496101_0013538 | |||
| 1909 | Ga0496101_0099848 | |||
| 1910 | Ga0496101_0102842 | |||
| 1911 | Ga0496101_0154603 | |||
| 1912 | Ga0496101_0221191 | |||
| 1913 | Ga0496102_0000731 | |||
| 1914 | Ga0496102_0005828 | |||
| 1915 | Ga0496102_0009067 | |||
| 1916 | Ga0496102_0018882 | |||
| 1917 | Ga0496102_0019016 | |||
| 1918 | Ga0496102_0581889 | |||
| 1919 | Ga0496103_0000654 | |||
| 1920 | Ga0496103_0005975 | |||
| 1921 | Ga0496103_0021006 | |||
| 1922 | Ga0496104_0031418 | |||
| 1923 | Ga0496104_0087388 | |||
| 1924 | Ga0496104_0088526 | |||
| 1925 | Ga0496104_0103599 | |||
| 1926 | Ga0496104_0129901 | |||
| 1927 | Ga0496104_0283241 | |||
| 1928 | Ga0496105_0009985 | |||
| 1929 | Ga0496105_0246811 | |||
| 1930 | Ga0496105_0328979 | |||
| 1931 | Ga0496105_0581008 | |||
| 1932 | Ga0496106_0000001 | |||
| 1933 | Ga0496106_0004611 | |||
| 1934 | Ga0496106_0064049 | |||
| 1935 | Ga0496107_0000920 | |||
| 1936 | Ga0496107_0035220 | |||
| 1937 | Ga0496107_0072029 | |||
| 1938 | Ga0496108_0023750 | |||
| 1939 | Ga0496109_0178159 | |||
| 1940 | Ga0496109_0660664 | |||
| 1941 | Ga0496110_0007042 | |||
| 1942 | Ga0496110_0132215 | |||
| 1943 | Ga0496112_0006167 | |||
| 1944 | Ga0496112_0045456 | |||
| 1945 | Ga0496113_0003166 | |||
| 1946 | Ga0496113_0003339 | |||
| 1947 | Ga0496114_0004166 | |||
| 1948 | Ga0496114_0057052 | |||
| 1949 | Ga0496114_0469873 | |||
| 1950 | Ga0496115_0201357 | |||
| 1951 | Ga0496116_0006063 | |||
| 1952 | Ga0496116_0069159 | |||
| 1953 | Ga0496116_0133545 | |||
| 1954 | Ga0496117_0000963 | |||
| 1955 | Ga0496117_0007007 | |||
| 1956 | Ga0496117_0019118 | |||
| 1957 | Ga0496117_0096700 | |||
| 1958 | Ga0496118_0000191 | |||
| 1959 | Ga0496118_0000574 | |||
| 1960 | Ga0496118_0002675 | |||
| 1961 | Ga0496118_0005993 | |||
| 1962 | Ga0496118_0016512 | |||
| 1963 | Ga0496118_0068167 | |||
| 1964 | Ga0496118_0071100 | |||
| 1965 | Ga0496118_0227715 | |||
| 1966 | Ga0496119_0135631 | |||
| 1967 | Ga0496120_0042136 | |||
| 1968 | Ga0496121_0000317 | |||
| 1969 | Ga0496121_0000877 | |||
| 1970 | Ga0496121_0005367 | |||
| 1971 | Ga0496121_0005385 | |||
| 1972 | Ga0496121_0015099 | |||
| 1973 | Ga0496121_0015162 | |||
| 1974 | Ga0496121_0096087 | |||
| 1975 | Ga0496122_0083217 | |||
| 1976 | Ga0496123_0011177 | |||
| 1977 | Ga0496124_0004891 | |||
| 1978 | Ga0496124_0059950 | |||
| 1979 | Ga0496124_0253544 | |||
| 1980 | Ga0496125_0026271 | |||
| 1981 | Ga0496125_0139461 | |||
| 1982 | Ga0496125_0168230 | |||
| 1983 | Ga0496126_0000073 | |||
| 1984 | Ga0496126_0000277 | |||
| 1985 | Ga0496126_0001036 | |||
| 1986 | Ga0496126_0001078 | |||
| 1987 | Ga0496126_0001899 | |||
| 1988 | Ga0496126_0028888 | |||
| 1989 | Ga0496126_0036980 | |||
| 1990 | Ga0496126_0291357 | |||
| 1991 | Ga0496126_0550155 | |||
| 1992 | Ga0495678_071923 | |||
| 1993 | Ga0495678_091507 | |||
| 1994 | Ga0495682_0015971 | |||
| 1995 | Ga0495682_0019014 | |||
| 1996 | Ga0495682_0029675 | |||
| 1997 | Ga0501300_005221 | |||
| 1998 | Ga0501034_0000487 | |||
| 1999 | Ga0501034_0237096 | |||
| 2000 | Ga0501039_0315998 | |||
| 2001 | Ga0501039_0385636 | |||
| 2002 | Ga0501046_0066998 | |||
| 2003 | Ga0501047_0043522 | |||
| 2004 | Ga0501047_0275803 | |||
| 2005 | Ga0501047_0634970 | |||
| 2006 | Ga0501068_0005351 | |||
| 2007 | Ga0501070_0131012 | |||
| 2008 | Ga0501072_0007929 | |||
| 2009 | Ga0501073_0021357 | |||
| 2010 | Ga0501074_0023124 | |||
| 2011 | Ga0501074_0078119 | |||
| 2012 | Ga0501074_0592580 | |||
| 2013 | Ga0501076_0198954 | |||
| 2014 | Ga0501080_0002146 | |||
| 2015 | Ga0501080_0343018 | |||
| 2016 | Ga0501083_0040217 | |||
| 2017 | Ga0501280_000174 | |||
| 2018 | Ga0501280_000496 | |||
| 2019 | Ga0501282_000823 | |||
| 2020 | Ga0501282_012358 | |||
| 2021 | Ga0501044_0849008 | |||
| 2022 | nmdc:mga06z11_261488_c1 | |||
| 2023 | nmdc:mga05p37_35579_c1 | |||
| 2024 | nmdc:mga09592_1644_c1 | |||
| 2025 | nmdc:mga0qj67_102546_c1 | |||
| 2026 | nmdc:mga06r32_275030_c1 | |||
| 2027 | nmdc:mga06r32_4493_c1 | |||
| 2028 | nmdc:mga08y16_30599_c1 | |||
| 2029 | nmdc:mga08y16_40603_c1 | |||
| 2030 | nmdc:mga08y16_67864_c1 | |||
| 2031 | nmdc:mga08y16_71218_c1 | |||
| 2032 | nmdc:mga0n895_95047_c1 | |||
| 2033 | Ga0495601_0780583 | |||
| 2034 | Ga0500578_0102136 | |||
| 2035 | Ga0500583_0019736 | |||
| 2036 | Ga0500583_0111166 | |||
| 2037 | Ga0500641_0065286 | |||
| 2038 | Ga0500595_047778 | |||
| 2039 | Ga0500642_0171430 | |||
| 2040 | Ga0500658_0146213 | |||
| 2041 | Ga0500568_0002355 | |||
| 2042 | Ga0500568_0036035 | |||
| 2043 | Ga0500616_0000162 | |||
| 2044 | Ga0500616_0017976 | |||
| 2045 | Ga0500622_0001405 | |||
| 2046 | Ga0500627_0280390 | |||
| 2047 | Ga0500638_031106 | |||
| 2048 | Ga0500637_0047752 | |||
| 2049 | Ga0500637_0069842 | |||
| 2050 | Ga0501084_0056439 | |||
| 2051 | 2501084753 | |||
| 2052 | 2509130585 | |||
| 2053 | 2510247899 | |||
| 2054 | 2511092387 | |||
| 2055 | 2512350229 | |||
| 2056 | 2513717204 | |||
| 2057 | 2513958610 | |||
| 2058 | 2514047218 | |||
| 2059 | 2515682252 | |||
| 2060 | 2515687302 | |||
| 2061 | 2527075899 | |||
| 2062 | 2563059080 | |||
| 2063 | 2574432007 | |||
| 2064 | 2596374388 | |||
| 2065 | 2600811886 | |||
| 2066 | 2713480641 | |||
| 2067 | 2719643668 | |||
| 2068 | 2738820486 | |||
| 2069 | 2738832966 | |||
| 2070 | 2738874493 | |||
| 2071 | 2739186123 | |||
| 2072 | 2739221091 | |||
| 2073 | 2753566970 | |||
| 2074 | 2792837109 | |||
| 2075 | 2819620580 | |||
| 2076 | 2824671129 | |||
| 2077 | 2829750893 | |||
| 2078 | 2861695809 | |||
| 2079 | 2885273811 | |||
| 2080 | 2894510903 | |||
| 2081 | 2902690772 | |||
| 2082 | 2904486583 | |||
| 2083 | 2904620143 | |||
| 2084 | 2919527914 | |||
| 2085 | 2921644770 | |||
| 2086 | 2928108821 | |||
| 2087 | 2928136045 | |||
| 2088 | 2928504175 | |||
| 2089 | 2945938733 | |||
| 2090 | 2990708732 | |||
| 2091 | 639786644 | |||
| 2092 | 642420880 | |||
| 2093 | 8055269178 | |||
| 2094 | 8055304590 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6kju-assembly1.cif.gz_A | huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors | 0.985 | 121 | 181 |
| 6ugl-assembly1.cif.gz_A | vqma bound to dpo | 0.9846 | 122 | 181 |
| 6kju-assembly1.cif.gz_B | huge conformation shift of vibrio cholerae vqma dimer in the absence of target dna provides insight into dna-binding mechanisms of luxr-type receptors | 0.9815 | 121 | 181 |
| 6ide-assembly1.cif.gz_B | crystal structure of the vibrio cholera vqma-ligand-dna complex provides molecular mechanisms for drug design | 0.9696 | 121 | 181 |
| 7ve5-assembly1.cif.gz_B | c-terminal domain of vrar | 0.9672 | 122 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P06993_830_894_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9766 | 122 | 179 | 1.10.10.10 |
| af_P52106_149_214_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9712 | 122 | 178 | 1.10.10.10 |
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9709 | 121 | 178 | 1.10.10.10 |
| 4if4B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9683 | 122 | 181 | 1.10.10.10 |
| 4if4C02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9664 | 122 | 182 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A158L5G1-F1-model_v4 | Two component LuxR family transcriptional regulator | 0.8018 | 37 | 204 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A158L5G1-F1-model_v4 | Two component LuxR family transcriptional regulator | 0.7308 | 37 | 204 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A0F9TQ05-F1-model_v4 | DNA-binding response regulator | 0.672 | 1 | 156 |
GO:0000160
GO:0003677 GO:0006355 |
| AF-A0A1W9JTG1-F1-model_v4 | HTH luxR-type domain-containing protein | 0.6537 | 2 | 182 |
GO:0003677
GO:0006355 |
| AF-A0A239BTJ6-F1-model_v4 | Two component transcriptional regulator, LuxR family | 0.652 | 2 | 181 |
GO:0000160
GO:0003677 GO:0006355 |