F488975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1047 | 368 | 2094 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300005295|Ga0065707_10224014|Ga0065707_102240142 |
| Length | 132 |
| Sequence | LRFDKRRASLLSKYKGSRREQAMSADQLDLPQGTLDLLILKTLTLEPRHGWAISERLHQISSATLNIRQGSLYPALHRLERRGWIKASWGTSDNNRRAKYYELTKRGRARLDQEISAWRKLSAVVSQVIESV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 83 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 88 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 89 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Metagenome | Rhizosphere |
| 119 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 138 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 205 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 206 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 211 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 213 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 216 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 219 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 220 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 222 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 225 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 226 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 229 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 234 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 236 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 237 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 239 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 244 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 245 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 246 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 247 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 248 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 249 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 250 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 251 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 254 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 255 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 256 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 259 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 260 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 261 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 262 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 263 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 264 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 265 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 266 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 267 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 305 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 306 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 307 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 308 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 309 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 311 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 336 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 337 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 338 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 343 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 348 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 349 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 350 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 354 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 362 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 363 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 364 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 366 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 368 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.9 |
| Metatranscriptomes | 0.1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.53 |
| Nodule | 0 |
| Rhizoplane | 1.24 |
| Rhizosphere | 95.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10224014 | 3300005295 | Bacteria | 1214 |
| 2 | JGI24750J21931_1095716 | 3300002070 | Unclassified | 506 |
| 3 | JGI24751J29686_10082345 | 3300002459 | Bacteria | 667 |
| 4 | rootH2_10067077 | 3300003320 | Bacteria | 8192 |
| 5 | Ga0065712_10008986 | 3300005290 | Bacteria | 2494 |
| 6 | Ga0065715_10000528 | 3300005293 | Bacteria | 10956 |
| 7 | Ga0065715_10030082 | 3300005293 | Bacteria | 1751 |
| 8 | Ga0065715_10105476 | 3300005293 | Bacteria | 2879 |
| 9 | Ga0065715_10635319 | 3300005293 | Unclassified | 687 |
| 10 | Ga0065707_10872246 | 3300005295 | Bacteria | 575 |
| 11 | Ga0070658_10293373 | 3300005327 | Unclassified | 1386 |
| 12 | Ga0070658_10428648 | 3300005327 | Bacteria | 1138 |
| 13 | Ga0070676_10079983 | 3300005328 | Bacteria | 1980 |
| 14 | Ga0070676_10086320 | 3300005328 | Bacteria | 1914 |
| 15 | Ga0070676_10423557 | 3300005328 | Bacteria | 931 |
| 16 | Ga0070683_100017950 | 3300005329 | Bacteria | 6255 |
| 17 | Ga0070683_100030348 | 3300005329 | Bacteria | 4906 |
| 18 | Ga0070683_100719561 | 3300005329 | Unclassified | 956 |
| 19 | Ga0070670_100023932 | 3300005331 | Bacteria | 5254 |
| 20 | Ga0070670_100112650 | 3300005331 | Bacteria | 2345 |
| 21 | Ga0070670_100175439 | 3300005331 | Bacteria | 1860 |
| 22 | Ga0070677_10000517 | 3300005333 | Bacteria | 13231 |
| 23 | Ga0070677_10005745 | 3300005333 | Bacteria | 4101 |
| 24 | Ga0070677_10042858 | 3300005333 | Bacteria | 1794 |
| 25 | Ga0070677_10121210 | 3300005333 | Bacteria | 1181 |
| 26 | Ga0070677_10290627 | 3300005333 | Bacteria | 827 |
| 27 | Ga0068869_100007497 | 3300005334 | Bacteria | 6978 |
| 28 | Ga0068869_100073239 | 3300005334 | Bacteria | 2539 |
| 29 | Ga0068869_101159658 | 3300005334 | Unclassified | 678 |
| 30 | Ga0070666_10025214 | 3300005335 | Bacteria | 3875 |
| 31 | Ga0070666_10124835 | 3300005335 | Bacteria | 1786 |
| 32 | Ga0070666_10654098 | 3300005335 | Bacteria | 769 |
| 33 | Ga0070680_100023619 | 3300005336 | Unclassified | 4906 |
| 34 | Ga0070680_100048523 | 3300005336 | Unclassified | 3460 |
| 35 | Ga0070680_101397115 | 3300005336 | Unclassified | 606 |
| 36 | Ga0070682_100331249 | 3300005337 | Bacteria | 1128 |
| 37 | Ga0068868_100106433 | 3300005338 | Bacteria | 2275 |
| 38 | Ga0068868_100245145 | 3300005338 | Bacteria | 1507 |
| 39 | Ga0068868_100448471 | 3300005338 | Bacteria | 1122 |
| 40 | Ga0068868_100568513 | 3300005338 | Bacteria | 1001 |
| 41 | Ga0070660_100713059 | 3300005339 | Unclassified | 841 |
| 42 | Ga0070689_100037428 | 3300005340 | Bacteria | 3709 |
| 43 | Ga0070691_10524809 | 3300005341 | Bacteria | 688 |
| 44 | Ga0070691_10738721 | 3300005341 | Bacteria | 594 |
| 45 | Ga0070687_100000906 | 3300005343 | Bacteria | 9984 |
| 46 | Ga0070661_100210627 | 3300005344 | Bacteria | 1488 |
| 47 | Ga0070692_10184611 | 3300005345 | Unclassified | 1211 |
| 48 | Ga0070692_10300763 | 3300005345 | Unclassified | 979 |
| 49 | Ga0070668_100026107 | 3300005347 | Bacteria | 4430 |
| 50 | Ga0070668_100029145 | 3300005347 | Unclassified | 4191 |
| 51 | Ga0070668_100152431 | 3300005347 | Bacteria | 1870 |
| 52 | Ga0070668_100679349 | 3300005347 | Bacteria | 907 |
| 53 | Ga0070669_100006962 | 3300005353 | Bacteria | 8123 |
| 54 | Ga0070669_100034115 | 3300005353 | Bacteria | 3684 |
| 55 | Ga0070669_100091583 | 3300005353 | Unclassified | 2280 |
| 56 | Ga0070669_100124488 | 3300005353 | Bacteria | 1971 |
| 57 | Ga0070675_100003728 | 3300005354 | Bacteria | 11583 |
| 58 | Ga0070675_100024220 | 3300005354 | Unclassified | 4861 |
| 59 | Ga0070675_100080323 | 3300005354 | Bacteria | 2718 |
| 60 | Ga0070675_100559332 | 3300005354 | Bacteria | 1035 |
| 61 | Ga0070675_101007301 | 3300005354 | Bacteria | 765 |
| 62 | Ga0070675_102241166 | 3300005354 | Bacteria | 503 |
| 63 | Ga0070671_100039363 | 3300005355 | Bacteria | 3924 |
| 64 | Ga0070674_100000057 | 3300005356 | Bacteria | 49618 |
| 65 | Ga0070674_100273586 | 3300005356 | Unclassified | 1336 |
| 66 | Ga0070674_100722259 | 3300005356 | Unclassified | 853 |
| 67 | Ga0070673_100028407 | 3300005364 | Bacteria | 4160 |
| 68 | Ga0070673_100361144 | 3300005364 | Bacteria | 1291 |
| 69 | Ga0070673_100569939 | 3300005364 | Bacteria | 1030 |
| 70 | Ga0070688_100472170 | 3300005365 | Bacteria | 941 |
| 71 | Ga0070688_100652667 | 3300005365 | Bacteria | 810 |
| 72 | Ga0070659_100193267 | 3300005366 | Bacteria | 1673 |
| 73 | Ga0070659_100383087 | 3300005366 | Bacteria | 1185 |
| 74 | Ga0070659_100415133 | 3300005366 | Bacteria | 1138 |
| 75 | Ga0070659_101228697 | 3300005366 | Unclassified | 663 |
| 76 | Ga0070659_101542556 | 3300005366 | Unclassified | 592 |
| 77 | Ga0070667_100011834 | 3300005367 | Bacteria | 7213 |
| 78 | Ga0070667_100377746 | 3300005367 | Bacteria | 1287 |
| 79 | Ga0070667_101980378 | 3300005367 | Bacteria | 549 |
| 80 | Ga0070703_10057840 | 3300005406 | Bacteria | 1260 |
| 81 | Ga0070709_10000036 | 3300005434 | Bacteria | 109782 |
| 82 | Ga0070709_10167626 | 3300005434 | Unclassified | 1532 |
| 83 | Ga0070714_100051515 | 3300005435 | Bacteria | 3510 |
| 84 | Ga0070714_101197156 | 3300005435 | Bacteria | 741 |
| 85 | Ga0070713_100127403 | 3300005436 | Bacteria | 2241 |
| 86 | Ga0070713_100241834 | 3300005436 | Bacteria | 1644 |
| 87 | Ga0070713_100475718 | 3300005436 | Bacteria | 1176 |
| 88 | Ga0070713_100927547 | 3300005436 | Unclassified | 838 |
| 89 | Ga0070713_101049551 | 3300005436 | Unclassified | 787 |
| 90 | Ga0070710_10743372 | 3300005437 | Bacteria | 696 |
| 91 | Ga0070710_10976496 | 3300005437 | Bacteria | 616 |
| 92 | Ga0070701_10021370 | 3300005438 | Bacteria | 3087 |
| 93 | Ga0070711_100106216 | 3300005439 | Bacteria | 2052 |
| 94 | Ga0070711_100372310 | 3300005439 | Bacteria | 1153 |
| 95 | Ga0070711_100428966 | 3300005439 | Bacteria | 1079 |
| 96 | Ga0070711_101930806 | 3300005439 | Bacteria | 519 |
| 97 | Ga0070705_101852837 | 3300005440 | Unclassified | 512 |
| 98 | Ga0070700_100143028 | 3300005441 | Bacteria | 1628 |
| 99 | Ga0070700_100149789 | 3300005441 | Bacteria | 1594 |
| 100 | Ga0070700_100176611 | 3300005441 | Bacteria | 1483 |
| 101 | Ga0070700_100361348 | 3300005441 | Bacteria | 1080 |
| 102 | Ga0070700_100383335 | 3300005441 | Unclassified | 1052 |
| 103 | Ga0070694_100218682 | 3300005444 | Bacteria | 1428 |
| 104 | Ga0070694_101090233 | 3300005444 | Bacteria | 666 |
| 105 | Ga0070708_100009804 | 3300005445 | Bacteria | 7733 |
| 106 | Ga0070708_100455951 | 3300005445 | Bacteria | 1206 |
| 107 | Ga0070708_100503189 | 3300005445 | Bacteria | 1143 |
| 108 | Ga0070708_101876329 | 3300005445 | Unclassified | 556 |
| 109 | Ga0070663_101668871 | 3300005455 | Unclassified | 569 |
| 110 | Ga0070678_100023036 | 3300005456 | Bacteria | 4142 |
| 111 | Ga0070678_100100185 | 3300005456 | Bacteria | 2243 |
| 112 | Ga0070678_100169889 | 3300005456 | Bacteria | 1775 |
| 113 | Ga0070678_100229035 | 3300005456 | Bacteria | 1548 |
| 114 | Ga0070678_100330833 | 3300005456 | Bacteria | 1304 |
| 115 | Ga0070678_101824415 | 3300005456 | Bacteria | 573 |
| 116 | Ga0070678_101830884 | 3300005456 | Bacteria | 572 |
| 117 | Ga0070662_100002253 | 3300005457 | Bacteria | 11828 |
| 118 | Ga0070662_100065245 | 3300005457 | Bacteria | 2668 |
| 119 | Ga0070662_100260960 | 3300005457 | Bacteria | 1396 |
| 120 | Ga0070662_101969784 | 3300005457 | Bacteria | 505 |
| 121 | Ga0070681_10003060 | 3300005458 | Bacteria | 15508 |
| 122 | Ga0070681_10287352 | 3300005458 | Archaea | 1555 |
| 123 | Ga0070681_10370226 | 3300005458 | Unclassified | 1343 |
| 124 | Ga0070681_10597353 | 3300005458 | Unclassified | 1018 |
| 125 | Ga0070681_11301113 | 3300005458 | Unclassified | 650 |
| 126 | Ga0070681_11622199 | 3300005458 | Unclassified | 572 |
| 127 | Ga0068867_100095304 | 3300005459 | Bacteria | 2264 |
| 128 | Ga0068867_100139767 | 3300005459 | Bacteria | 1892 |
| 129 | Ga0068867_100162128 | 3300005459 | Bacteria | 1764 |
| 130 | Ga0068867_101869641 | 3300005459 | Unclassified | 566 |
| 131 | Ga0070685_10027013 | 3300005466 | Bacteria | 3169 |
| 132 | Ga0070685_10031706 | 3300005466 | Unclassified | 2955 |
| 133 | Ga0070685_10219375 | 3300005466 | Bacteria | 1245 |
| 134 | Ga0070685_11092516 | 3300005466 | Unclassified | 602 |
| 135 | Ga0070706_100086880 | 3300005467 | Bacteria | 2898 |
| 136 | Ga0070707_100000092 | 3300005468 | Bacteria | 80536 |
| 137 | Ga0070707_102269440 | 3300005468 | Bacteria | 510 |
| 138 | Ga0070698_100020885 | 3300005471 | Bacteria | 6862 |
| 139 | Ga0070698_100042136 | 3300005471 | Bacteria | 4683 |
| 140 | Ga0070698_100095834 | 3300005471 | Unclassified | 2944 |
| 141 | Ga0070698_100311197 | 3300005471 | Bacteria | 1506 |
| 142 | Ga0070698_100925586 | 3300005471 | Unclassified | 818 |
| 143 | Ga0070699_100006680 | 3300005518 | Bacteria | 10034 |
| 144 | Ga0070699_100023661 | 3300005518 | Bacteria | 5293 |
| 145 | Ga0070699_100128042 | 3300005518 | Bacteria | 2237 |
| 146 | Ga0070699_100228303 | 3300005518 | Bacteria | 1660 |
| 147 | Ga0070679_100003140 | 3300005530 | Bacteria | 15100 |
| 148 | Ga0070679_100043529 | 3300005530 | Bacteria | 4471 |
| 149 | Ga0070679_100046125 | 3300005530 | Bacteria | 4343 |
| 150 | Ga0070679_100171857 | 3300005530 | Unclassified | 2140 |
| 151 | Ga0070679_100310352 | 3300005530 | Unclassified | 1527 |
| 152 | Ga0070679_101375151 | 3300005530 | Bacteria | 652 |
| 153 | Ga0070684_100026969 | 3300005535 | Bacteria | 4844 |
| 154 | Ga0070684_100032650 | 3300005535 | Bacteria | 4438 |
| 155 | Ga0070684_100876171 | 3300005535 | Bacteria | 841 |
| 156 | Ga0068853_100109010 | 3300005539 | Bacteria | 2457 |
| 157 | Ga0070672_100061490 | 3300005543 | Bacteria | 2960 |
| 158 | Ga0070672_100242542 | 3300005543 | Bacteria | 1516 |
| 159 | Ga0070686_100036783 | 3300005544 | Bacteria | 3034 |
| 160 | Ga0070686_100159925 | 3300005544 | Bacteria | 1585 |
| 161 | Ga0070686_101191173 | 3300005544 | Unclassified | 632 |
| 162 | Ga0070695_100080168 | 3300005545 | Unclassified | 2157 |
| 163 | Ga0070695_100786727 | 3300005545 | Unclassified | 761 |
| 164 | Ga0070696_100161752 | 3300005546 | Bacteria | 1650 |
| 165 | Ga0070696_101900110 | 3300005546 | Unclassified | 516 |
| 166 | Ga0070693_101216727 | 3300005547 | Unclassified | 579 |
| 167 | Ga0070665_100027604 | 3300005548 | Bacteria | 5717 |
| 168 | Ga0070665_100033026 | 3300005548 | Bacteria | 5207 |
| 169 | Ga0070665_100052831 | 3300005548 | Bacteria | 4075 |
| 170 | Ga0070665_100132334 | 3300005548 | Bacteria | 2496 |
| 171 | Ga0070665_100794507 | 3300005548 | Bacteria | 959 |
| 172 | Ga0070665_101837548 | 3300005548 | Bacteria | 612 |
| 173 | Ga0070704_101178135 | 3300005549 | Bacteria | 698 |
| 174 | Ga0068855_100023228 | 3300005563 | Bacteria | 7428 |
| 175 | Ga0068855_100056662 | 3300005563 | Bacteria | 4597 |
| 176 | Ga0068855_100153859 | 3300005563 | Bacteria | 2614 |
| 177 | Ga0068855_100466980 | 3300005563 | Bacteria | 1375 |
| 178 | Ga0068855_101207653 | 3300005563 | Unclassified | 786 |
| 179 | Ga0070664_100038035 | 3300005564 | Unclassified | 4048 |
| 180 | Ga0070664_100494161 | 3300005564 | Unclassified | 1127 |
| 181 | Ga0070664_100813419 | 3300005564 | Bacteria | 874 |
| 182 | Ga0070664_101119713 | 3300005564 | Bacteria | 742 |
| 183 | Ga0068857_100240073 | 3300005577 | Bacteria | 1659 |
| 184 | Ga0068857_100426389 | 3300005577 | Bacteria | 1237 |
| 185 | Ga0068854_100637639 | 3300005578 | Bacteria | 913 |
| 186 | Ga0068854_100738543 | 3300005578 | Bacteria | 853 |
| 187 | Ga0068854_100913387 | 3300005578 | Bacteria | 772 |
| 188 | Ga0068856_100259480 | 3300005614 | Bacteria | 1753 |
| 189 | Ga0068856_101775361 | 3300005614 | Bacteria | 629 |
| 190 | Ga0068856_102553071 | 3300005614 | Unclassified | 517 |
| 191 | Ga0070702_100853211 | 3300005615 | Unclassified | 709 |
| 192 | Ga0070702_100892510 | 3300005615 | Unclassified | 695 |
| 193 | Ga0068852_100055328 | 3300005616 | Bacteria | 3424 |
| 194 | Ga0068852_100217773 | 3300005616 | Bacteria | 1814 |
| 195 | Ga0068852_101743802 | 3300005616 | Bacteria | 645 |
| 196 | Ga0068859_100007573 | 3300005617 | Bacteria | 11030 |
| 197 | Ga0068859_100023134 | 3300005617 | Bacteria | 6234 |
| 198 | Ga0068859_100897402 | 3300005617 | Bacteria | 971 |
| 199 | Ga0068859_101062153 | 3300005617 | Bacteria | 890 |
| 200 | Ga0068864_100183744 | 3300005618 | Bacteria | 1913 |
| 201 | Ga0068864_102506906 | 3300005618 | Bacteria | 522 |
| 202 | Ga0068866_10786783 | 3300005718 | Bacteria | 660 |
| 203 | Ga0068861_100183239 | 3300005719 | Bacteria | 1745 |
| 204 | Ga0068861_100342545 | 3300005719 | Bacteria | 1309 |
| 205 | Ga0068861_100420411 | 3300005719 | Bacteria | 1191 |
| 206 | Ga0068870_10002083 | 3300005840 | Bacteria | 8293 |
| 207 | Ga0068870_10029157 | 3300005840 | Unclassified | 2777 |
| 208 | Ga0068863_100010960 | 3300005841 | Bacteria | 8791 |
| 209 | Ga0068863_100031354 | 3300005841 | Bacteria | 5073 |
| 210 | Ga0068863_100086906 | 3300005841 | Unclassified | 2963 |
| 211 | Ga0068863_100844256 | 3300005841 | Unclassified | 915 |
| 212 | Ga0068858_100007421 | 3300005842 | Bacteria | 10607 |
| 213 | Ga0068858_100014367 | 3300005842 | Bacteria | 7466 |
| 214 | Ga0068858_100076014 | 3300005842 | Unclassified | 3120 |
| 215 | Ga0068858_100142563 | 3300005842 | Bacteria | 2250 |
| 216 | Ga0068858_100515438 | 3300005842 | Bacteria | 1156 |
| 217 | Ga0068858_101305777 | 3300005842 | Bacteria | 714 |
| 218 | Ga0068858_102330297 | 3300005842 | Unclassified | 529 |
| 219 | Ga0068860_100056053 | 3300005843 | Bacteria | 3748 |
| 220 | Ga0068860_100106519 | 3300005843 | Bacteria | 2678 |
| 221 | Ga0068860_100514604 | 3300005843 | Bacteria | 1196 |
| 222 | Ga0068860_101273772 | 3300005843 | Bacteria | 756 |
| 223 | Ga0068860_101577655 | 3300005843 | Bacteria | 678 |
| 224 | Ga0068860_101708924 | 3300005843 | Unclassified | 651 |
| 225 | Ga0068860_102074870 | 3300005843 | Unclassified | 590 |
| 226 | Ga0068860_102135462 | 3300005843 | Bacteria | 581 |
| 227 | Ga0068860_102207298 | 3300005843 | Unclassified | 571 |
| 228 | Ga0068862_100002124 | 3300005844 | Bacteria | 17861 |
| 229 | Ga0068862_100440094 | 3300005844 | Bacteria | 1227 |
| 230 | Ga0068862_100532779 | 3300005844 | Bacteria | 1119 |
| 231 | Ga0081455_10035298 | 3300005937 | Unclassified | 4471 |
| 232 | Ga0081455_10111218 | 3300005937 | Bacteria | 2176 |
| 233 | Ga0081455_10123796 | 3300005937 | Bacteria | 2033 |
| 234 | Ga0070717_10389181 | 3300006028 | Bacteria | 1251 |
| 235 | Ga0075368_10021596 | 3300006042 | Bacteria | 2447 |
| 236 | Ga0075364_10705033 | 3300006051 | Bacteria | 689 |
| 237 | Ga0075432_10112341 | 3300006058 | Bacteria | 1016 |
| 238 | Ga0075432_10290625 | 3300006058 | Unclassified | 675 |
| 239 | Ga0070715_10980283 | 3300006163 | Unclassified | 525 |
| 240 | Ga0070716_100056351 | 3300006173 | Bacteria | 2253 |
| 241 | Ga0070716_100083318 | 3300006173 | Bacteria | 1915 |
| 242 | Ga0070716_100853681 | 3300006173 | Bacteria | 709 |
| 243 | Ga0070712_100271305 | 3300006175 | Bacteria | 1363 |
| 244 | Ga0070712_100560296 | 3300006175 | Archaea | 964 |
| 245 | Ga0075367_10233765 | 3300006178 | Bacteria | 1151 |
| 246 | Ga0075367_10489586 | 3300006178 | Bacteria | 780 |
| 247 | Ga0075427_10108665 | 3300006194 | Unclassified | 521 |
| 248 | Ga0075366_10055459 | 3300006195 | Bacteria | 2354 |
| 249 | Ga0097621_100027205 | 3300006237 | Bacteria | 4496 |
| 250 | Ga0097621_100042384 | 3300006237 | Bacteria | 3666 |
| 251 | Ga0097621_100119537 | 3300006237 | Bacteria | 2234 |
| 252 | Ga0097621_100918797 | 3300006237 | Bacteria | 816 |
| 253 | Ga0097621_101886776 | 3300006237 | Bacteria | 570 |
| 254 | Ga0075370_10247507 | 3300006353 | Bacteria | 1056 |
| 255 | Ga0068871_100041192 | 3300006358 | Unclassified | 3702 |
| 256 | Ga0068871_100050971 | 3300006358 | Bacteria | 3350 |
| 257 | Ga0068871_100122962 | 3300006358 | Bacteria | 2194 |
| 258 | Ga0068871_100257009 | 3300006358 | Bacteria | 1523 |
| 259 | Ga0068871_100334722 | 3300006358 | Bacteria | 1336 |
| 260 | Ga0068871_101114379 | 3300006358 | Bacteria | 738 |
| 261 | Ga0068871_102356431 | 3300006358 | Unclassified | 508 |
| 262 | Ga0075428_100040802 | 3300006844 | Bacteria | 5105 |
| 263 | Ga0075428_100226859 | 3300006844 | Bacteria | 2016 |
| 264 | Ga0075428_100406453 | 3300006844 | Bacteria | 1459 |
| 265 | Ga0075428_100661859 | 3300006844 | Unclassified | 1113 |
| 266 | Ga0075428_101123682 | 3300006844 | Bacteria | 829 |
| 267 | Ga0075428_101437683 | 3300006844 | Unclassified | 723 |
| 268 | Ga0075430_100007332 | 3300006846 | Bacteria | 9316 |
| 269 | Ga0075430_100038764 | 3300006846 | Bacteria | 4035 |
| 270 | Ga0075430_100197532 | 3300006846 | Unclassified | 1671 |
| 271 | Ga0075430_100243983 | 3300006846 | Bacteria | 1488 |
| 272 | Ga0075430_100257061 | 3300006846 | Unclassified | 1447 |
| 273 | Ga0075430_100265409 | 3300006846 | Unclassified | 1421 |
| 274 | Ga0075430_101262904 | 3300006846 | Unclassified | 608 |
| 275 | Ga0075430_101418571 | 3300006846 | Bacteria | 571 |
| 276 | Ga0075431_100017739 | 3300006847 | Bacteria | 7237 |
| 277 | Ga0075431_100071462 | 3300006847 | Bacteria | 3581 |
| 278 | Ga0075431_100087247 | 3300006847 | Bacteria | 3220 |
| 279 | Ga0075431_100186291 | 3300006847 | Unclassified | 2128 |
| 280 | Ga0075431_100211360 | 3300006847 | Bacteria | 1981 |
| 281 | Ga0075431_100358009 | 3300006847 | Bacteria | 1466 |
| 282 | Ga0075431_100409802 | 3300006847 | Bacteria | 1355 |
| 283 | Ga0075431_100461033 | 3300006847 | Bacteria | 1265 |
| 284 | Ga0075431_100524752 | 3300006847 | Unclassified | 1173 |
| 285 | Ga0075431_100735130 | 3300006847 | Bacteria | 963 |
| 286 | Ga0075431_100803524 | 3300006847 | Unclassified | 914 |
| 287 | Ga0075431_101061375 | 3300006847 | Unclassified | 776 |
| 288 | Ga0075431_101114336 | 3300006847 | Unclassified | 754 |
| 289 | Ga0075431_101725795 | 3300006847 | Unclassified | 583 |
| 290 | Ga0075433_10002417 | 3300006852 | Bacteria | 14194 |
| 291 | Ga0075433_10004965 | 3300006852 | Bacteria | 10414 |
| 292 | Ga0075433_10434976 | 3300006852 | Bacteria | 1157 |
| 293 | Ga0075433_11028543 | 3300006852 | Unclassified | 717 |
| 294 | Ga0075433_11542355 | 3300006852 | Bacteria | 573 |
| 295 | Ga0075434_100000951 | 3300006871 | Bacteria | 23325 |
| 296 | Ga0075434_100019186 | 3300006871 | Bacteria | 6614 |
| 297 | Ga0075434_100025389 | 3300006871 | Bacteria | 5797 |
| 298 | Ga0075434_100030985 | 3300006871 | Bacteria | 5271 |
| 299 | Ga0075434_100973109 | 3300006871 | Unclassified | 863 |
| 300 | Ga0075429_100001380 | 3300006880 | Bacteria | 19865 |
| 301 | Ga0075429_100002352 | 3300006880 | Bacteria | 15906 |
| 302 | Ga0075429_100034218 | 3300006880 | Bacteria | 4414 |
| 303 | Ga0075429_100039292 | 3300006880 | Bacteria | 4119 |
| 304 | Ga0075429_100218479 | 3300006880 | Unclassified | 1670 |
| 305 | Ga0075429_101894274 | 3300006880 | Unclassified | 517 |
| 306 | Ga0068865_100346737 | 3300006881 | Unclassified | 1202 |
| 307 | Ga0068865_100675833 | 3300006881 | Bacteria | 880 |
| 308 | Ga0075436_100018232 | 3300006914 | Unclassified | 4807 |
| 309 | Ga0075436_100152410 | 3300006914 | Bacteria | 1627 |
| 310 | Ga0075436_100253283 | 3300006914 | Bacteria | 1254 |
| 311 | Ga0075436_100987880 | 3300006914 | Bacteria | 631 |
| 312 | Ga0097620_100007573 | 3300006931 | Bacteria | 11030 |
| 313 | Ga0097620_100023132 | 3300006931 | Bacteria | 6234 |
| 314 | Ga0097620_100897497 | 3300006931 | Bacteria | 971 |
| 315 | Ga0097620_101062310 | 3300006931 | Bacteria | 890 |
| 316 | Ga0075435_100006825 | 3300007076 | Bacteria | 8101 |
| 317 | Ga0075435_100044112 | 3300007076 | Bacteria | 3571 |
| 318 | Ga0075435_100227811 | 3300007076 | Unclassified | 1583 |
| 319 | Ga0075435_100340093 | 3300007076 | Unclassified | 1286 |
| 320 | Ga0075435_100455335 | 3300007076 | Bacteria | 1104 |
| 321 | Ga0075435_100888873 | 3300007076 | Unclassified | 777 |
| 322 | Ga0075435_101153974 | 3300007076 | Bacteria | 678 |
| 323 | Ga0099794_10163165 | 3300007265 | Bacteria | 1134 |
| 324 | Ga0099794_10304925 | 3300007265 | Bacteria | 825 |
| 325 | Ga0105240_10130245 | 3300009093 | Bacteria | 3018 |
| 326 | Ga0111539_10000424 | 3300009094 | Bacteria | 53001 |
| 327 | Ga0111539_10005348 | 3300009094 | Bacteria | 16612 |
| 328 | Ga0111539_10006468 | 3300009094 | Bacteria | 15090 |
| 329 | Ga0111539_10009970 | 3300009094 | Bacteria | 11975 |
| 330 | Ga0111539_10037916 | 3300009094 | Bacteria | 5815 |
| 331 | Ga0111539_10103148 | 3300009094 | Unclassified | 3347 |
| 332 | Ga0111539_10133161 | 3300009094 | Bacteria | 2910 |
| 333 | Ga0111539_10266928 | 3300009094 | Bacteria | 1992 |
| 334 | Ga0111539_10269164 | 3300009094 | Bacteria | 1983 |
| 335 | Ga0105245_10010086 | 3300009098 | Bacteria | 8228 |
| 336 | Ga0105245_10017219 | 3300009098 | Bacteria | 6305 |
| 337 | Ga0105245_10038669 | 3300009098 | Bacteria | 4245 |
| 338 | Ga0105245_10057091 | 3300009098 | Bacteria | 3510 |
| 339 | Ga0105245_10123427 | 3300009098 | Bacteria | 2422 |
| 340 | Ga0105245_10375278 | 3300009098 | Unclassified | 1415 |
| 341 | Ga0105245_10396227 | 3300009098 | Bacteria | 1378 |
| 342 | Ga0105245_10562422 | 3300009098 | Bacteria | 1163 |
| 343 | Ga0105245_13095434 | 3300009098 | Bacteria | 515 |
| 344 | Ga0105247_10029612 | 3300009101 | Bacteria | 3319 |
| 345 | Ga0105247_10071674 | 3300009101 | Bacteria | 2168 |
| 346 | Ga0105247_10526982 | 3300009101 | Bacteria | 865 |
| 347 | Ga0114129_10045369 | 3300009147 | Bacteria | 6179 |
| 348 | Ga0114129_10063972 | 3300009147 | Bacteria | 5134 |
| 349 | Ga0114129_10204026 | 3300009147 | Bacteria | 2676 |
| 350 | Ga0114129_10205810 | 3300009147 | Bacteria | 2663 |
| 351 | Ga0114129_10241084 | 3300009147 | Bacteria | 2430 |
| 352 | Ga0114129_10501497 | 3300009147 | Bacteria | 1585 |
| 353 | Ga0114129_10673315 | 3300009147 | Bacteria | 1333 |
| 354 | Ga0114129_10767285 | 3300009147 | Unclassified | 1233 |
| 355 | Ga0114129_11000668 | 3300009147 | Bacteria | 1053 |
| 356 | Ga0114129_11150074 | 3300009147 | Unclassified | 969 |
| 357 | Ga0114129_11306401 | 3300009147 | Unclassified | 899 |
| 358 | Ga0114129_11950165 | 3300009147 | Bacteria | 711 |
| 359 | Ga0114129_12084708 | 3300009147 | Unclassified | 684 |
| 360 | Ga0114129_12485970 | 3300009147 | Unclassified | 619 |
| 361 | Ga0114129_12932971 | 3300009147 | Bacteria | 563 |
| 362 | Ga0105243_10077611 | 3300009148 | Bacteria | 2702 |
| 363 | Ga0105243_10789101 | 3300009148 | Bacteria | 935 |
| 364 | Ga0105243_11985197 | 3300009148 | Unclassified | 616 |
| 365 | Ga0105241_10003232 | 3300009174 | Bacteria | 12121 |
| 366 | Ga0105241_10899634 | 3300009174 | Unclassified | 822 |
| 367 | Ga0105242_10026425 | 3300009176 | Bacteria | 4602 |
| 368 | Ga0105242_10187705 | 3300009176 | Bacteria | 1828 |
| 369 | Ga0105242_10236891 | 3300009176 | Bacteria | 1639 |
| 370 | Ga0105242_10349787 | 3300009176 | Unclassified | 1365 |
| 371 | Ga0105242_10962231 | 3300009176 | Unclassified | 859 |
| 372 | Ga0105242_11183979 | 3300009176 | Unclassified | 783 |
| 373 | Ga0105242_12785101 | 3300009176 | Unclassified | 539 |
| 374 | Ga0105248_10000003 | 3300009177 | Bacteria | 1019601 |
| 375 | Ga0105248_10067384 | 3300009177 | Bacteria | 4019 |
| 376 | Ga0105248_10260256 | 3300009177 | Bacteria | 1953 |
| 377 | Ga0105248_10272655 | 3300009177 | Bacteria | 1905 |
| 378 | Ga0105248_10279319 | 3300009177 | Bacteria | 1880 |
| 379 | Ga0105248_10606612 | 3300009177 | Bacteria | 1235 |
| 380 | Ga0105248_11383301 | 3300009177 | Bacteria | 796 |
| 381 | Ga0105248_11558922 | 3300009177 | Unclassified | 748 |
| 382 | Ga0105248_11629518 | 3300009177 | Bacteria | 731 |
| 383 | Ga0105248_12721308 | 3300009177 | Unclassified | 564 |
| 384 | Ga0105238_10652626 | 3300009551 | Bacteria | 1062 |
| 385 | Ga0105238_11207167 | 3300009551 | Bacteria | 781 |
| 386 | Ga0105238_11848188 | 3300009551 | Bacteria | 636 |
| 387 | Ga0105238_12999896 | 3300009551 | Bacteria | 507 |
| 388 | Ga0105249_10011692 | 3300009553 | Bacteria | 7719 |
| 389 | Ga0105249_10067044 | 3300009553 | Unclassified | 3305 |
| 390 | Ga0105249_10919391 | 3300009553 | Bacteria | 942 |
| 391 | Ga0105249_10939476 | 3300009553 | Unclassified | 932 |
| 392 | Ga0099796_10111626 | 3300010159 | Unclassified | 1041 |
| 393 | Ga0105239_10016583 | 3300010375 | Bacteria | 8143 |
| 394 | Ga0105239_10390214 | 3300010375 | Bacteria | 1575 |
| 395 | Ga0105239_10695726 | 3300010375 | Bacteria | 1162 |
| 396 | Ga0105239_11908396 | 3300010375 | Unclassified | 689 |
| 397 | Ga0105239_12751486 | 3300010375 | Unclassified | 574 |
| 398 | Ga0105239_12754545 | 3300010375 | Bacteria | 574 |
| 399 | Ga0105246_10099177 | 3300011119 | Bacteria | 2117 |
| 400 | Ga0105246_10763362 | 3300011119 | Unclassified | 854 |
| 401 | Ga0105246_11002575 | 3300011119 | Unclassified | 756 |
| 402 | Ga0157325_1030379 | 3300012485 | Bacteria | 538 |
| 403 | Ga0157315_1050702 | 3300012508 | Unclassified | 557 |
| 404 | Ga0157373_10037173 | 3300013100 | Bacteria | 3492 |
| 405 | Ga0157371_10789839 | 3300013102 | Bacteria | 715 |
| 406 | Ga0157371_10795343 | 3300013102 | Unclassified | 712 |
| 407 | Ga0157370_10014358 | 3300013104 | Bacteria | 8100 |
| 408 | Ga0157370_10068365 | 3300013104 | Bacteria | 3357 |
| 409 | Ga0157370_10323643 | 3300013104 | Unclassified | 1422 |
| 410 | Ga0157370_10881918 | 3300013104 | Bacteria | 812 |
| 411 | Ga0157369_10053053 | 3300013105 | Bacteria | 4383 |
| 412 | Ga0157369_10068414 | 3300013105 | Unclassified | 3815 |
| 413 | Ga0157374_10001955 | 3300013296 | Bacteria | 17297 |
| 414 | Ga0157374_10006310 | 3300013296 | Bacteria | 10051 |
| 415 | Ga0157374_10270803 | 3300013296 | Bacteria | 1674 |
| 416 | Ga0157374_10379599 | 3300013296 | Bacteria | 1408 |
| 417 | Ga0157374_10464749 | 3300013296 | Bacteria | 1267 |
| 418 | Ga0157374_10709442 | 3300013296 | Unclassified | 1019 |
| 419 | Ga0157374_11000461 | 3300013296 | Unclassified | 855 |
| 420 | Ga0157374_11932547 | 3300013296 | Unclassified | 616 |
| 421 | Ga0157378_10009064 | 3300013297 | Bacteria | 8660 |
| 422 | Ga0157378_10037196 | 3300013297 | Bacteria | 4310 |
| 423 | Ga0157378_10430568 | 3300013297 | Bacteria | 1306 |
| 424 | Ga0163162_10017236 | 3300013306 | Bacteria | 7067 |
| 425 | Ga0163162_11156557 | 3300013306 | Unclassified | 878 |
| 426 | Ga0163162_11342281 | 3300013306 | Unclassified | 813 |
| 427 | Ga0163162_11931852 | 3300013306 | Bacteria | 676 |
| 428 | Ga0163162_12241426 | 3300013306 | Bacteria | 627 |
| 429 | Ga0157372_10111251 | 3300013307 | Bacteria | 3138 |
| 430 | Ga0157372_10683778 | 3300013307 | Bacteria | 1194 |
| 431 | Ga0157372_10986815 | 3300013307 | Bacteria | 976 |
| 432 | Ga0157372_11718559 | 3300013307 | Unclassified | 722 |
| 433 | Ga0157375_10010134 | 3300013308 | Bacteria | 8289 |
| 434 | Ga0157375_10142546 | 3300013308 | Bacteria | 2524 |
| 435 | Ga0157375_10214383 | 3300013308 | Bacteria | 2083 |
| 436 | Ga0157375_10396756 | 3300013308 | Unclassified | 1546 |
| 437 | Ga0157375_12061241 | 3300013308 | Bacteria | 678 |
| 438 | Ga0157375_12617870 | 3300013308 | Bacteria | 603 |
| 439 | Ga0163163_10046060 | 3300014325 | Bacteria | 4283 |
| 440 | Ga0163163_10101854 | 3300014325 | Unclassified | 2894 |
| 441 | Ga0163163_10287357 | 3300014325 | Bacteria | 1696 |
| 442 | Ga0163163_10302428 | 3300014325 | Unclassified | 1652 |
| 443 | Ga0163163_10729402 | 3300014325 | Unclassified | 1054 |
| 444 | Ga0163163_11548828 | 3300014325 | Unclassified | 724 |
| 445 | Ga0157380_10005070 | 3300014326 | Bacteria | 9197 |
| 446 | Ga0157380_10009877 | 3300014326 | Bacteria | 6852 |
| 447 | Ga0157380_10038848 | 3300014326 | Bacteria | 3698 |
| 448 | Ga0157380_10192774 | 3300014326 | Bacteria | 1801 |
| 449 | Ga0157380_10492065 | 3300014326 | Unclassified | 1189 |
| 450 | Ga0157380_11792553 | 3300014326 | Bacteria | 673 |
| 451 | Ga0157380_12318873 | 3300014326 | Bacteria | 601 |
| 452 | Ga0157377_10037788 | 3300014745 | Bacteria | 2662 |
| 453 | Ga0157379_10030339 | 3300014968 | Unclassified | 4812 |
| 454 | Ga0157379_10081470 | 3300014968 | Bacteria | 2899 |
| 455 | Ga0157379_10177973 | 3300014968 | Unclassified | 1921 |
| 456 | Ga0157376_10194019 | 3300014969 | Bacteria | 1864 |
| 457 | Ga0157376_10713301 | 3300014969 | Unclassified | 1009 |
| 458 | Ga0163161_10039643 | 3300017792 | Bacteria | 3382 |
| 459 | Ga0163161_10050135 | 3300017792 | Bacteria | 3020 |
| 460 | Ga0163161_10313943 | 3300017792 | Bacteria | 1237 |
| 461 | Ga0163161_10413263 | 3300017792 | Bacteria | 1084 |
| 462 | Ga0213876_10001835 | 3300021384 | Bacteria | 12811 |
| 463 | Ga0213875_10000015 | 3300021388 | Bacteria | 280499 |
| 464 | Ga0213875_10002728 | 3300021388 | Bacteria | 10420 |
| 465 | Ga0213875_10007939 | 3300021388 | Bacteria | 5457 |
| 466 | Ga0213875_10361282 | 3300021388 | Bacteria | 690 |
| 467 | Ga0224572_1111194 | 3300024225 | Unclassified | 507 |
| 468 | Ga0207666_1076820 | 3300025271 | Bacteria | 539 |
| 469 | Ga0207673_1009002 | 3300025290 | Bacteria | 1271 |
| 470 | Ga0207697_10007740 | 3300025315 | Bacteria | 4762 |
| 471 | Ga0207697_10080622 | 3300025315 | Bacteria | 1371 |
| 472 | Ga0207697_10081828 | 3300025315 | Bacteria | 1361 |
| 473 | Ga0207697_10102269 | 3300025315 | Bacteria | 1222 |
| 474 | Ga0207682_10000160 | 3300025893 | Bacteria | 30608 |
| 475 | Ga0207682_10011105 | 3300025893 | Bacteria | 3525 |
| 476 | Ga0207682_10035195 | 3300025893 | Unclassified | 2022 |
| 477 | Ga0207682_10205031 | 3300025893 | Bacteria | 908 |
| 478 | Ga0207682_10354935 | 3300025893 | Bacteria | 691 |
| 479 | Ga0207642_10246171 | 3300025899 | Unclassified | 1012 |
| 480 | Ga0207710_10037668 | 3300025900 | Bacteria | 2136 |
| 481 | Ga0207688_10195266 | 3300025901 | Bacteria | 1212 |
| 482 | Ga0207680_10113336 | 3300025903 | Bacteria | 1762 |
| 483 | Ga0207680_10115714 | 3300025903 | Bacteria | 1747 |
| 484 | Ga0207680_10436671 | 3300025903 | Unclassified | 928 |
| 485 | Ga0207647_10037223 | 3300025904 | Bacteria | 3086 |
| 486 | Ga0207647_10115365 | 3300025904 | Bacteria | 1586 |
| 487 | Ga0207699_10000078 | 3300025906 | Bacteria | 76220 |
| 488 | Ga0207645_10157678 | 3300025907 | Bacteria | 1484 |
| 489 | Ga0207643_10004382 | 3300025908 | Bacteria | 7588 |
| 490 | Ga0207643_10015677 | 3300025908 | Bacteria | 4127 |
| 491 | Ga0207643_10036283 | 3300025908 | Unclassified | 2764 |
| 492 | Ga0207705_11109241 | 3300025909 | Bacteria | 609 |
| 493 | Ga0207684_10070387 | 3300025910 | Bacteria | 2973 |
| 494 | Ga0207707_10060310 | 3300025912 | Bacteria | 3300 |
| 495 | Ga0207707_10102488 | 3300025912 | Bacteria | 2502 |
| 496 | Ga0207707_10207765 | 3300025912 | Unclassified | 1706 |
| 497 | Ga0207707_10282575 | 3300025912 | Bacteria | 1437 |
| 498 | Ga0207707_10400728 | 3300025912 | Unclassified | 1178 |
| 499 | Ga0207707_10577423 | 3300025912 | Bacteria | 953 |
| 500 | Ga0207695_10011402 | 3300025913 | Bacteria | 10774 |
| 501 | Ga0207695_10067569 | 3300025913 | Bacteria | 3666 |
| 502 | Ga0207695_10087196 | 3300025913 | Bacteria | 3145 |
| 503 | Ga0207695_10813392 | 3300025913 | Bacteria | 815 |
| 504 | Ga0207693_10075798 | 3300025915 | Bacteria | 2634 |
| 505 | Ga0207693_10243687 | 3300025915 | Bacteria | 1411 |
| 506 | Ga0207693_10450694 | 3300025915 | Archaea | 1005 |
| 507 | Ga0207663_10420713 | 3300025916 | Bacteria | 1025 |
| 508 | Ga0207663_11193728 | 3300025916 | Unclassified | 612 |
| 509 | Ga0207663_11308079 | 3300025916 | Unclassified | 584 |
| 510 | Ga0207663_11380201 | 3300025916 | Bacteria | 567 |
| 511 | Ga0207660_10020030 | 3300025917 | Bacteria | 4483 |
| 512 | Ga0207660_10362872 | 3300025917 | Unclassified | 1162 |
| 513 | Ga0207660_10439333 | 3300025917 | Bacteria | 1054 |
| 514 | Ga0207660_10680361 | 3300025917 | Bacteria | 839 |
| 515 | Ga0207662_10028486 | 3300025918 | Bacteria | 3229 |
| 516 | Ga0207657_10617411 | 3300025919 | Unclassified | 845 |
| 517 | Ga0207657_10821011 | 3300025919 | Bacteria | 718 |
| 518 | Ga0207649_10159352 | 3300025920 | Bacteria | 1562 |
| 519 | Ga0207652_10023134 | 3300025921 | Bacteria | 5146 |
| 520 | Ga0207652_10190503 | 3300025921 | Bacteria | 1845 |
| 521 | Ga0207652_10310141 | 3300025921 | Bacteria | 1424 |
| 522 | Ga0207652_10395297 | 3300025921 | Unclassified | 1247 |
| 523 | Ga0207652_10553379 | 3300025921 | Bacteria | 1034 |
| 524 | Ga0207652_11160314 | 3300025921 | Bacteria | 674 |
| 525 | Ga0207652_11345979 | 3300025921 | Unclassified | 617 |
| 526 | Ga0207646_10000047 | 3300025922 | Bacteria | 172446 |
| 527 | Ga0207646_10571274 | 3300025922 | Bacteria | 1016 |
| 528 | Ga0207646_11105812 | 3300025922 | Bacteria | 697 |
| 529 | Ga0207681_10002951 | 3300025923 | Bacteria | 10725 |
| 530 | Ga0207681_10037376 | 3300025923 | Bacteria | 3208 |
| 531 | Ga0207694_10227477 | 3300025924 | Unclassified | 1523 |
| 532 | Ga0207650_10030199 | 3300025925 | Bacteria | 3902 |
| 533 | Ga0207659_10006283 | 3300025926 | Bacteria | 7270 |
| 534 | Ga0207659_10026774 | 3300025926 | Unclassified | 3895 |
| 535 | Ga0207659_10369345 | 3300025926 | Bacteria | 1194 |
| 536 | Ga0207659_11856497 | 3300025926 | Unclassified | 511 |
| 537 | Ga0207687_10041701 | 3300025927 | Bacteria | 3153 |
| 538 | Ga0207687_10061991 | 3300025927 | Bacteria | 2642 |
| 539 | Ga0207687_10225994 | 3300025927 | Bacteria | 1476 |
| 540 | Ga0207687_10382923 | 3300025927 | Bacteria | 1153 |
| 541 | Ga0207687_11379006 | 3300025927 | Bacteria | 606 |
| 542 | Ga0207700_10138171 | 3300025928 | Bacteria | 1999 |
| 543 | Ga0207700_10347159 | 3300025928 | Bacteria | 1291 |
| 544 | Ga0207700_10491814 | 3300025928 | Bacteria | 1085 |
| 545 | Ga0207700_10677657 | 3300025928 | Bacteria | 920 |
| 546 | Ga0207700_10774457 | 3300025928 | Bacteria | 858 |
| 547 | Ga0207700_10954753 | 3300025928 | Bacteria | 767 |
| 548 | Ga0207700_11373972 | 3300025928 | Bacteria | 628 |
| 549 | Ga0207664_10588115 | 3300025929 | Unclassified | 999 |
| 550 | Ga0207664_10902750 | 3300025929 | Unclassified | 793 |
| 551 | Ga0207644_10623190 | 3300025931 | Bacteria | 897 |
| 552 | Ga0207644_10676777 | 3300025931 | Unclassified | 860 |
| 553 | Ga0207690_10150955 | 3300025932 | Bacteria | 1722 |
| 554 | Ga0207690_11290658 | 3300025932 | Unclassified | 610 |
| 555 | Ga0207690_11830208 | 3300025932 | Bacteria | 507 |
| 556 | Ga0207706_10068666 | 3300025933 | Unclassified | 3118 |
| 557 | Ga0207706_10296289 | 3300025933 | Unclassified | 1410 |
| 558 | Ga0207706_10462305 | 3300025933 | Bacteria | 1097 |
| 559 | Ga0207706_10881313 | 3300025933 | Bacteria | 757 |
| 560 | Ga0207686_10047907 | 3300025934 | Bacteria | 2644 |
| 561 | Ga0207686_10087588 | 3300025934 | Bacteria | 2048 |
| 562 | Ga0207686_10521428 | 3300025934 | Unclassified | 925 |
| 563 | Ga0207686_10748663 | 3300025934 | Unclassified | 780 |
| 564 | Ga0207686_10899934 | 3300025934 | Bacteria | 714 |
| 565 | Ga0207686_10913140 | 3300025934 | Unclassified | 709 |
| 566 | Ga0207709_10806343 | 3300025935 | Bacteria | 758 |
| 567 | Ga0207709_11166594 | 3300025935 | Bacteria | 634 |
| 568 | Ga0207670_10019311 | 3300025936 | Bacteria | 4161 |
| 569 | Ga0207669_10000478 | 3300025937 | Bacteria | 17466 |
| 570 | Ga0207669_10037665 | 3300025937 | Bacteria | 2777 |
| 571 | Ga0207669_10204265 | 3300025937 | Bacteria | 1437 |
| 572 | Ga0207669_10317790 | 3300025937 | Unclassified | 1190 |
| 573 | Ga0207704_10008068 | 3300025938 | Bacteria | 5011 |
| 574 | Ga0207704_10173557 | 3300025938 | Bacteria | 1549 |
| 575 | Ga0207704_10515262 | 3300025938 | Bacteria | 966 |
| 576 | Ga0207704_10537646 | 3300025938 | Unclassified | 948 |
| 577 | Ga0207665_10061008 | 3300025939 | Bacteria | 2555 |
| 578 | Ga0207665_10076220 | 3300025939 | Bacteria | 2299 |
| 579 | Ga0207665_10270537 | 3300025939 | Unclassified | 1261 |
| 580 | Ga0207691_10006233 | 3300025940 | Bacteria | 11519 |
| 581 | Ga0207691_10116379 | 3300025940 | Unclassified | 2372 |
| 582 | Ga0207691_11448200 | 3300025940 | Unclassified | 563 |
| 583 | Ga0207711_10000012 | 3300025941 | Bacteria | 515147 |
| 584 | Ga0207711_10484447 | 3300025941 | Bacteria | 1152 |
| 585 | Ga0207711_10558324 | 3300025941 | Bacteria | 1068 |
| 586 | Ga0207711_11334026 | 3300025941 | Unclassified | 660 |
| 587 | Ga0207689_10005413 | 3300025942 | Bacteria | 11426 |
| 588 | Ga0207689_10041674 | 3300025942 | Bacteria | 3799 |
| 589 | Ga0207689_10617592 | 3300025942 | Unclassified | 912 |
| 590 | Ga0207689_11116400 | 3300025942 | Unclassified | 664 |
| 591 | Ga0207661_10532102 | 3300025944 | Bacteria | 1075 |
| 592 | Ga0207679_10008532 | 3300025945 | Bacteria | 6528 |
| 593 | Ga0207679_10051456 | 3300025945 | Unclassified | 3015 |
| 594 | Ga0207679_11051048 | 3300025945 | Unclassified | 747 |
| 595 | Ga0207667_10014528 | 3300025949 | Bacteria | 8973 |
| 596 | Ga0207667_10360696 | 3300025949 | Bacteria | 1482 |
| 597 | Ga0207651_10038575 | 3300025960 | Bacteria | 3141 |
| 598 | Ga0207651_11588599 | 3300025960 | Unclassified | 589 |
| 599 | Ga0207712_10004313 | 3300025961 | Bacteria | 8980 |
| 600 | Ga0207712_10266248 | 3300025961 | Bacteria | 1392 |
| 601 | Ga0207712_10727083 | 3300025961 | Bacteria | 868 |
| 602 | Ga0207712_11853114 | 3300025961 | Bacteria | 540 |
| 603 | Ga0207668_10032267 | 3300025972 | Bacteria | 3459 |
| 604 | Ga0207668_10062515 | 3300025972 | Bacteria | 2622 |
| 605 | Ga0207668_10431715 | 3300025972 | Bacteria | 1120 |
| 606 | Ga0207668_10643750 | 3300025972 | Bacteria | 927 |
| 607 | Ga0207640_10017630 | 3300025981 | Bacteria | 4182 |
| 608 | Ga0207640_10028832 | 3300025981 | Bacteria | 3399 |
| 609 | Ga0207658_10027849 | 3300025986 | Bacteria | 3975 |
| 610 | Ga0207658_10808983 | 3300025986 | Bacteria | 851 |
| 611 | Ga0207677_10036258 | 3300026023 | Bacteria | 3212 |
| 612 | Ga0207677_10088141 | 3300026023 | Bacteria | 2249 |
| 613 | Ga0207677_10121131 | 3300026023 | Bacteria | 1968 |
| 614 | Ga0207703_10027190 | 3300026035 | Bacteria | 4505 |
| 615 | Ga0207703_10230489 | 3300026035 | Bacteria | 1660 |
| 616 | Ga0207703_10487705 | 3300026035 | Unclassified | 1155 |
| 617 | Ga0207703_10710464 | 3300026035 | Bacteria | 956 |
| 618 | Ga0207703_11258629 | 3300026035 | Bacteria | 711 |
| 619 | Ga0207703_11524708 | 3300026035 | Unclassified | 643 |
| 620 | Ga0207703_11967004 | 3300026035 | Bacteria | 561 |
| 621 | Ga0207703_12172110 | 3300026035 | Bacteria | 531 |
| 622 | Ga0207639_10409965 | 3300026041 | Bacteria | 1223 |
| 623 | Ga0207678_10087139 | 3300026067 | Bacteria | 2668 |
| 624 | Ga0207678_10244639 | 3300026067 | Bacteria | 1536 |
| 625 | Ga0207678_10561983 | 3300026067 | Bacteria | 998 |
| 626 | Ga0207708_10032804 | 3300026075 | Bacteria | 3943 |
| 627 | Ga0207708_10035736 | 3300026075 | Unclassified | 3781 |
| 628 | Ga0207708_10095631 | 3300026075 | Bacteria | 2294 |
| 629 | Ga0207708_10316311 | 3300026075 | Bacteria | 1273 |
| 630 | Ga0207708_10445639 | 3300026075 | Unclassified | 1077 |
| 631 | Ga0207702_10181047 | 3300026078 | Bacteria | 1941 |
| 632 | Ga0207702_10441763 | 3300026078 | Unclassified | 1261 |
| 633 | Ga0207702_11634928 | 3300026078 | Bacteria | 637 |
| 634 | Ga0207641_10015240 | 3300026088 | Bacteria | 6299 |
| 635 | Ga0207641_10108790 | 3300026088 | Bacteria | 2454 |
| 636 | Ga0207641_10126069 | 3300026088 | Bacteria | 2292 |
| 637 | Ga0207641_10225738 | 3300026088 | Bacteria | 1739 |
| 638 | Ga0207641_10779474 | 3300026088 | Unclassified | 945 |
| 639 | Ga0207648_10022397 | 3300026089 | Bacteria | 5674 |
| 640 | Ga0207648_10070306 | 3300026089 | Unclassified | 3051 |
| 641 | Ga0207648_10317442 | 3300026089 | Bacteria | 1400 |
| 642 | Ga0207676_12081160 | 3300026095 | Bacteria | 566 |
| 643 | Ga0207676_12311271 | 3300026095 | Unclassified | 535 |
| 644 | Ga0207674_10021855 | 3300026116 | Bacteria | 6884 |
| 645 | Ga0207674_10104503 | 3300026116 | Bacteria | 2811 |
| 646 | Ga0207674_10359545 | 3300026116 | Bacteria | 1407 |
| 647 | Ga0207675_100194400 | 3300026118 | Bacteria | 1947 |
| 648 | Ga0207675_100463960 | 3300026118 | Unclassified | 1257 |
| 649 | Ga0207675_100675176 | 3300026118 | Bacteria | 1040 |
| 650 | Ga0207675_100909882 | 3300026118 | Bacteria | 896 |
| 651 | Ga0207683_10033946 | 3300026121 | Bacteria | 4433 |
| 652 | Ga0207683_10230666 | 3300026121 | Unclassified | 1688 |
| 653 | Ga0207683_10378532 | 3300026121 | Bacteria | 1301 |
| 654 | Ga0207683_10482822 | 3300026121 | Bacteria | 1144 |
| 655 | Ga0207683_10553226 | 3300026121 | Bacteria | 1064 |
| 656 | Ga0207683_10669034 | 3300026121 | Bacteria | 962 |
| 657 | Ga0207698_10457733 | 3300026142 | Bacteria | 1233 |
| 658 | Ga0207698_10482111 | 3300026142 | Bacteria | 1203 |
| 659 | Ga0207698_11378395 | 3300026142 | Bacteria | 720 |
| 660 | Ga0209813_10064180 | 3300027866 | Bacteria | 1180 |
| 661 | Ga0209974_10164541 | 3300027876 | Unclassified | 806 |
| 662 | Ga0207428_10000709 | 3300027907 | Bacteria | 38575 |
| 663 | Ga0207428_10000898 | 3300027907 | Bacteria | 33207 |
| 664 | Ga0207428_10003389 | 3300027907 | Bacteria | 15491 |
| 665 | Ga0207428_10010157 | 3300027907 | Bacteria | 8418 |
| 666 | Ga0207428_10039581 | 3300027907 | Bacteria | 3828 |
| 667 | Ga0207428_10052429 | 3300027907 | Bacteria | 3258 |
| 668 | Ga0265357_1027068 | 3300028023 | Unclassified | 646 |
| 669 | Ga0268266_10004232 | 3300028379 | Bacteria | 13819 |
| 670 | Ga0268266_10006293 | 3300028379 | Bacteria | 10883 |
| 671 | Ga0268266_10008531 | 3300028379 | Bacteria | 9105 |
| 672 | Ga0268266_10940288 | 3300028379 | Bacteria | 836 |
| 673 | Ga0268266_11135889 | 3300028379 | Unclassified | 756 |
| 674 | Ga0268265_10027491 | 3300028380 | Bacteria | 4061 |
| 675 | Ga0268265_10030095 | 3300028380 | Bacteria | 3906 |
| 676 | Ga0268265_10185006 | 3300028380 | Bacteria | 1794 |
| 677 | Ga0268265_10200790 | 3300028380 | Bacteria | 1730 |
| 678 | Ga0268265_10454213 | 3300028380 | Bacteria | 1197 |
| 679 | Ga0268265_10740749 | 3300028380 | Bacteria | 953 |
| 680 | Ga0268264_10022631 | 3300028381 | Bacteria | 5129 |
| 681 | Ga0268264_10056263 | 3300028381 | Bacteria | 3288 |
| 682 | Ga0268264_10076051 | 3300028381 | Bacteria | 2856 |
| 683 | Ga0268264_11146074 | 3300028381 | Bacteria | 787 |
| 684 | Ga0265338_10021966 | 3300028800 | Bacteria | 6630 |
| 685 | Ga0265338_10958714 | 3300028800 | Unclassified | 580 |
| 686 | Ga0265324_10013527 | 3300029957 | Bacteria | 3041 |
| 687 | Ga0265760_10017585 | 3300031090 | Bacteria | 2054 |
| 688 | Ga0265328_10210037 | 3300031239 | Bacteria | 740 |
| 689 | Ga0265329_10270386 | 3300031242 | Unclassified | 570 |
| 690 | Ga0265339_10000493 | 3300031249 | Bacteria | 30791 |
| 691 | Ga0265339_10073987 | 3300031249 | Unclassified | 1811 |
| 692 | Ga0307408_100940061 | 3300031548 | Unclassified | 793 |
| 693 | Ga0265314_10000923 | 3300031711 | Bacteria | 34627 |
| 694 | Ga0265314_10009936 | 3300031711 | Bacteria | 7978 |
| 695 | Ga0265314_10055797 | 3300031711 | Bacteria | 2724 |
| 696 | Ga0265342_10045514 | 3300031712 | Bacteria | 2641 |
| 697 | Ga0307406_10095804 | 3300031901 | Bacteria | 2009 |
| 698 | Ga0307407_10489049 | 3300031903 | Bacteria | 900 |
| 699 | Ga0307412_10029426 | 3300031911 | Unclassified | 3447 |
| 700 | Ga0307409_101107377 | 3300031995 | Unclassified | 813 |
| 701 | Ga0307416_100086568 | 3300032002 | Bacteria | 2671 |
| 702 | Ga0307416_100790245 | 3300032002 | Bacteria | 1044 |
| 703 | Ga0307416_103039982 | 3300032002 | Unclassified | 561 |
| 704 | Ga0307411_11313397 | 3300032005 | Unclassified | 659 |
| 705 | Ga0307510_10047766 | 3300033180 | Bacteria | 4579 |
| 706 | Ga0307510_10105822 | 3300033180 | Bacteria | 2580 |
| 707 | Ga0373926_0006841 | 3300035083 | Bacteria | 3791 |
| 708 | Ga0373940_0011780 | 3300035088 | Bacteria | 2084 |
| 709 | Ga0373944_0002843 | 3300035089 | Bacteria | 4429 |
| 710 | Ga0373944_0253865 | 3300035089 | Unclassified | 650 |
| 711 | Ga0373936_0009522 | 3300035113 | Bacteria | 3662 |
| 712 | Ga0373939_0005715 | 3300035114 | Unclassified | 2966 |
| 713 | Ga0373945_0004990 | 3300035116 | Bacteria | 4228 |
| 714 | Ga0373953_0186416 | 3300035117 | Bacteria | 896 |
| 715 | Ga0373956_0076663 | 3300035119 | Bacteria | 1530 |
| 716 | Ga0373957_0171316 | 3300035120 | Bacteria | 897 |
| 717 | Ga0373957_0207342 | 3300035120 | Bacteria | 818 |
| 718 | Ga0373960_0087758 | 3300035121 | Unclassified | 990 |
| 719 | Ga0373943_0009601 | 3300035170 | Unclassified | 4338 |
| 720 | Ga0373943_0137695 | 3300035170 | Bacteria | 1312 |
| 721 | Ga0373946_0008598 | 3300035171 | Bacteria | 3747 |
| 722 | Ga0373946_0009163 | 3300035171 | Unclassified | 3643 |
| 723 | Ga0373946_0013641 | 3300035171 | Bacteria | 3056 |
| 724 | Ga0373955_0786320 | 3300035172 | Bacteria | 585 |
| 725 | Ga0373942_0195165 | 3300035207 | Unclassified | 669 |
| 726 | Ga0373924_0004044 | 3300035410 | Bacteria | 5097 |
| 727 | Ga0373924_0342831 | 3300035410 | Bacteria | 665 |
| 728 | Ga0373931_0196357 | 3300035691 | Unclassified | 1203 |
| 729 | Ga0373935_0097209 | 3300035692 | Bacteria | 1936 |
| 730 | Ga0373935_0828968 | 3300035692 | Unclassified | 683 |
| 731 | Ga0373927_0108797 | 3300035695 | Bacteria | 1806 |
| 732 | Ga0373927_0114180 | 3300035695 | Bacteria | 1760 |
| 733 | Ga0373927_0463311 | 3300035695 | Bacteria | 837 |
| 734 | Ga0373927_0516031 | 3300035695 | Bacteria | 790 |
| 735 | Ga0373933_0125375 | 3300035724 | Bacteria | 1611 |
| 736 | Ga0373933_0183463 | 3300035724 | Bacteria | 1335 |
| 737 | Ga0373933_0324031 | 3300035724 | Unclassified | 999 |
| 738 | Ga0373933_1185519 | 3300035724 | Bacteria | 503 |
| 739 | Ga0373947_0007950 | 3300035725 | Bacteria | 6115 |
| 740 | Ga0373947_0293362 | 3300035725 | Bacteria | 1083 |
| 741 | Ga0373947_1142496 | 3300035725 | Bacteria | 531 |
| 742 | Ga0373937_0407937 | 3300036401 | Bacteria | 1289 |
| 743 | Ga0373937_0529452 | 3300036401 | Unclassified | 1120 |
| 744 | Ga0373937_0565478 | 3300036401 | Bacteria | 1080 |
| 745 | Ga0373937_0666211 | 3300036401 | Bacteria | 986 |
| 746 | Ga0373937_0959594 | 3300036401 | Bacteria | 804 |
| 747 | Ga0373925_0010454 | 3300037068 | Bacteria | 6730 |
| 748 | Ga0395900_0937514 | 3300037418 | Bacteria | 788 |
| 749 | Ga0395898_0025084 | 3300037466 | Bacteria | 6011 |
| 750 | Ga0436364_0337811 | 3300037853 | Bacteria | 12746 |
| 751 | Ga0436364_0354654 | 3300037853 | Bacteria | 6604 |
| 752 | Ga0436364_0634548 | 3300037853 | Bacteria | 2347 |
| 753 | Ga0436364_0988131 | 3300037853 | Unclassified | 2101 |
| 754 | Ga0436364_1113127 | 3300037853 | Bacteria | 158393 |
| 755 | Ga0436364_1263905 | 3300037853 | Bacteria | 943 |
| 756 | Ga0395901_0339675 | 3300038443 | Unclassified | 1552 |
| 757 | Ga0436365_1337643 | 3300039437 | Bacteria | 2320 |
| 758 | Ga0436365_1799897 | 3300039437 | Unclassified | 653 |
| 759 | Ga0436360_0769958 | 3300039438 | Unclassified | 1576 |
| 760 | Ga0436363_0518015 | 3300039450 | Unclassified | 1404 |
| 761 | Ga0436362_0522880 | 3300039453 | Unclassified | 611 |
| 762 | Ga0439453_0022555 | 3300041408 | Bacteria | 1142 |
| 763 | Ga0451789_0498126 | 3300041443 | Unclassified | 588 |
| 764 | Ga0451793_0888004 | 3300041452 | Unclassified | 704 |
| 765 | Ga0451845_0463185 | 3300041501 | Bacteria | 594 |
| 766 | Ga0439443_103049 | 3300042003 | Unclassified | 548 |
| 767 | Ga0439440_0082566 | 3300042993 | Unclassified | 852 |
| 768 | Ga0439440_0169661 | 3300042993 | Unclassified | 634 |
| 769 | Ga0453683_1139489 | 3300044673 | Bacteria | 521 |
| 770 | Ga0466957_0556474 | 3300044842 | Bacteria | 800 |
| 771 | Ga0466959_0006604 | 3300045049 | Bacteria | 8053 |
| 772 | Ga0451576_0023025 | 3300045051 | Bacteria | 6750 |
| 773 | Ga0451576_1323591 | 3300045051 | Bacteria | 751 |
| 774 | Ga0466958_0361404 | 3300045836 | Unclassified | 935 |
| 775 | Ga0466967_0285162 | 3300045976 | Bacteria | 1585 |
| 776 | Ga0466967_0316383 | 3300045976 | Bacteria | 1505 |
| 777 | Ga0466967_0723948 | 3300045976 | Unclassified | 986 |
| 778 | Ga0466967_1567220 | 3300045976 | Unclassified | 656 |
| 779 | Ga0495603_0013872 | 3300046455 | Unclassified | 4876 |
| 780 | Ga0495603_0290833 | 3300046455 | Unclassified | 939 |
| 781 | Ga0495651_0164523 | 3300046462 | Unclassified | 1586 |
| 782 | Ga0495650_0001169 | 3300046471 | Bacteria | 28045 |
| 783 | Ga0495650_0164225 | 3300046471 | Bacteria | 790 |
| 784 | Ga0495580_0065275 | 3300046472 | Bacteria | 2550 |
| 785 | Ga0495580_0221377 | 3300046472 | Unclassified | 1300 |
| 786 | Ga0495580_0988432 | 3300046472 | Bacteria | 537 |
| 787 | Ga0495582_0030867 | 3300046473 | Bacteria | 2944 |
| 788 | Ga0495639_0011514 | 3300046475 | Bacteria | 3814 |
| 789 | Ga0495639_0105754 | 3300046475 | Unclassified | 1332 |
| 790 | Ga0495639_0210080 | 3300046475 | Bacteria | 955 |
| 791 | Ga0495606_0393118 | 3300046507 | Bacteria | 724 |
| 792 | Ga0495628_0113754 | 3300046516 | Bacteria | 2080 |
| 793 | Ga0495630_0338829 | 3300046517 | Bacteria | 1150 |
| 794 | Ga0495643_0227520 | 3300046522 | Unclassified | 881 |
| 795 | Ga0495665_0085234 | 3300046531 | Bacteria | 1660 |
| 796 | Ga0495586_0128068 | 3300046535 | Bacteria | 1421 |
| 797 | Ga0495587_0041307 | 3300046536 | Unclassified | 2752 |
| 798 | Ga0495656_0166686 | 3300046615 | Bacteria | 1074 |
| 799 | Ga0495668_0353152 | 3300046616 | Bacteria | 807 |
| 800 | Ga0495625_0000440 | 3300046660 | Bacteria | 62404 |
| 801 | Ga0495625_0088876 | 3300046660 | Bacteria | 2140 |
| 802 | Ga0495635_0023703 | 3300046663 | Bacteria | 4276 |
| 803 | Ga0495588_0001264 | 3300046674 | Bacteria | 10848 |
| 804 | Ga0495623_0355028 | 3300046679 | Unclassified | 798 |
| 805 | Ga0495647_0105939 | 3300046681 | Bacteria | 1168 |
| 806 | Ga0495658_0008008 | 3300046683 | Bacteria | 5235 |
| 807 | Ga0495658_0279790 | 3300046683 | Bacteria | 1053 |
| 808 | Ga0495658_0309989 | 3300046683 | Bacteria | 999 |
| 809 | Ga0495669_0164526 | 3300046684 | Bacteria | 1054 |
| 810 | Ga0495669_0591645 | 3300046684 | Bacteria | 540 |
| 811 | Ga0495613_0230469 | 3300046689 | Bacteria | 1298 |
| 812 | Ga0495624_0243182 | 3300046690 | Bacteria | 1089 |
| 813 | Ga0495670_0391114 | 3300046691 | Bacteria | 751 |
| 814 | Ga0495671_0553171 | 3300046692 | Bacteria | 548 |
| 815 | Ga0495649_0338688 | 3300046694 | Unclassified | 761 |
| 816 | Ga0495581_0026697 | 3300047315 | Bacteria | 3348 |
| 817 | Ga0495672_0012702 | 3300047320 | Bacteria | 5856 |
| 818 | Ga0495683_0281984 | 3300047323 | Unclassified | 719 |
| 819 | Ga0495687_139114 | 3300047443 | Unclassified | 847 |
| 820 | Ga0495684_0114211 | 3300047471 | Bacteria | 2036 |
| 821 | Ga0495614_0292125 | 3300048089 | Bacteria | 752 |
| 822 | Ga0496102_1447214 | 3300048905 | Bacteria | 606 |
| 823 | Ga0496104_0000032 | 3300048907 | Bacteria | 191998 |
| 824 | Ga0496104_0020962 | 3300048907 | Bacteria | 5996 |
| 825 | Ga0496105_0038601 | 3300048908 | Unclassified | 3935 |
| 826 | Ga0496105_0062123 | 3300048908 | Bacteria | 3083 |
| 827 | Ga0496108_0136753 | 3300048911 | Bacteria | 2109 |
| 828 | Ga0496110_1165293 | 3300048913 | Unclassified | 679 |
| 829 | Ga0496111_0767356 | 3300048914 | Bacteria | 699 |
| 830 | Ga0496112_0005683 | 3300048915 | Bacteria | 10833 |
| 831 | Ga0496112_0031641 | 3300048915 | Bacteria | 5133 |
| 832 | Ga0496113_0003763 | 3300048916 | Bacteria | 9154 |
| 833 | Ga0496126_0086548 | 3300048929 | Bacteria | 2762 |
| 834 | Ga0496126_0095345 | 3300048929 | Bacteria | 2610 |
| 835 | Ga0495682_0013384 | 3300049460 | Bacteria | 3125 |
| 836 | Ga0501298_113595 | 3300049521 | Bacteria | 630 |
| 837 | Ga0501031_0785796 | 3300049568 | Bacteria | 610 |
| 838 | Ga0501031_1129593 | 3300049568 | Bacteria | 500 |
| 839 | Ga0501032_0007431 | 3300049569 | Bacteria | 8006 |
| 840 | Ga0501032_0015736 | 3300049569 | Bacteria | 5333 |
| 841 | Ga0501032_0107240 | 3300049569 | Unclassified | 1850 |
| 842 | Ga0501032_0163651 | 3300049569 | Unclassified | 1460 |
| 843 | Ga0501033_0025231 | 3300049570 | Bacteria | 4478 |
| 844 | Ga0501033_0030919 | 3300049570 | Bacteria | 4024 |
| 845 | Ga0501033_0874056 | 3300049570 | Bacteria | 605 |
| 846 | Ga0501034_0020790 | 3300049571 | Bacteria | 6698 |
| 847 | Ga0501034_0094792 | 3300049571 | Unclassified | 2981 |
| 848 | Ga0501034_0175598 | 3300049571 | Bacteria | 2108 |
| 849 | Ga0501034_0265753 | 3300049571 | Bacteria | 1657 |
| 850 | Ga0501034_0317403 | 3300049571 | Bacteria | 1491 |
| 851 | Ga0501034_0505146 | 3300049571 | Bacteria | 1122 |
| 852 | Ga0501036_0022371 | 3300049572 | Bacteria | 5317 |
| 853 | Ga0501036_0092184 | 3300049572 | Bacteria | 2559 |
| 854 | Ga0501036_0095380 | 3300049572 | Bacteria | 2514 |
| 855 | Ga0501036_0125835 | 3300049572 | Unclassified | 2164 |
| 856 | Ga0501036_0316849 | 3300049572 | Bacteria | 1303 |
| 857 | Ga0501036_0358722 | 3300049572 | Bacteria | 1217 |
| 858 | Ga0501036_0518790 | 3300049572 | Unclassified | 991 |
| 859 | Ga0501036_0782553 | 3300049572 | Unclassified | 786 |
| 860 | Ga0501037_0027153 | 3300049573 | Bacteria | 4229 |
| 861 | Ga0501037_0030645 | 3300049573 | Bacteria | 3974 |
| 862 | Ga0501037_0057198 | 3300049573 | Bacteria | 2848 |
| 863 | Ga0501037_0305039 | 3300049573 | Bacteria | 1105 |
| 864 | Ga0501037_0411664 | 3300049573 | Bacteria | 926 |
| 865 | Ga0501038_0004265 | 3300049574 | Bacteria | 13298 |
| 866 | Ga0501038_0091268 | 3300049574 | Bacteria | 2552 |
| 867 | Ga0501038_0262224 | 3300049574 | Bacteria | 1365 |
| 868 | Ga0501038_0287006 | 3300049574 | Unclassified | 1294 |
| 869 | Ga0501039_0006137 | 3300049575 | Bacteria | 9122 |
| 870 | Ga0501039_0068970 | 3300049575 | Bacteria | 2745 |
| 871 | Ga0501039_1175007 | 3300049575 | Unclassified | 594 |
| 872 | Ga0501040_0001914 | 3300049576 | Bacteria | 13378 |
| 873 | Ga0501040_0134895 | 3300049576 | Unclassified | 1738 |
| 874 | Ga0501040_0195186 | 3300049576 | Unclassified | 1437 |
| 875 | Ga0501040_0999686 | 3300049576 | Unclassified | 606 |
| 876 | Ga0501040_1399170 | 3300049576 | Bacteria | 508 |
| 877 | Ga0501041_0054709 | 3300049577 | Unclassified | 2435 |
| 878 | Ga0501042_0235512 | 3300049578 | Unclassified | 1321 |
| 879 | Ga0501042_0335220 | 3300049578 | Bacteria | 1093 |
| 880 | Ga0501043_0015584 | 3300049579 | Bacteria | 5957 |
| 881 | Ga0501043_0052667 | 3300049579 | Bacteria | 3196 |
| 882 | Ga0501043_0187993 | 3300049579 | Bacteria | 1607 |
| 883 | Ga0501043_0304815 | 3300049579 | Bacteria | 1216 |
| 884 | Ga0501043_0361040 | 3300049579 | Bacteria | 1102 |
| 885 | Ga0501043_0768109 | 3300049579 | Bacteria | 699 |
| 886 | Ga0501043_1027533 | 3300049579 | Bacteria | 585 |
| 887 | Ga0501046_0003067 | 3300049580 | Bacteria | 15421 |
| 888 | Ga0501046_0021750 | 3300049580 | Bacteria | 5289 |
| 889 | Ga0501046_0133134 | 3300049580 | Bacteria | 1884 |
| 890 | Ga0501046_0850077 | 3300049580 | Unclassified | 638 |
| 891 | Ga0501047_0006391 | 3300049581 | Bacteria | 11080 |
| 892 | Ga0501047_0014262 | 3300049581 | Bacteria | 7557 |
| 893 | Ga0501047_0033411 | 3300049581 | Bacteria | 4965 |
| 894 | Ga0501047_0058983 | 3300049581 | Bacteria | 3706 |
| 895 | Ga0501047_0085137 | 3300049581 | Bacteria | 3037 |
| 896 | Ga0501047_0555218 | 3300049581 | Bacteria | 972 |
| 897 | Ga0501048_0032432 | 3300049582 | Bacteria | 3775 |
| 898 | Ga0501048_0035446 | 3300049582 | Unclassified | 3592 |
| 899 | Ga0501048_0460000 | 3300049582 | Unclassified | 911 |
| 900 | Ga0501048_0865153 | 3300049582 | Bacteria | 650 |
| 901 | Ga0501068_0000823 | 3300049584 | Bacteria | 16109 |
| 902 | Ga0501068_0013752 | 3300049584 | Bacteria | 4611 |
| 903 | Ga0501069_0052377 | 3300049585 | Bacteria | 2272 |
| 904 | Ga0501069_0059479 | 3300049585 | Unclassified | 2132 |
| 905 | Ga0501070_0056484 | 3300049586 | Bacteria | 3254 |
| 906 | Ga0501070_0190936 | 3300049586 | Bacteria | 1684 |
| 907 | Ga0501070_0742042 | 3300049586 | Unclassified | 774 |
| 908 | Ga0501071_0001203 | 3300049587 | Bacteria | 14627 |
| 909 | Ga0501071_0133363 | 3300049587 | Bacteria | 1846 |
| 910 | Ga0501071_0340907 | 3300049587 | Unclassified | 1140 |
| 911 | Ga0501071_0446537 | 3300049587 | Bacteria | 990 |
| 912 | Ga0501071_0712511 | 3300049587 | Unclassified | 773 |
| 913 | Ga0501072_0019173 | 3300049588 | Bacteria | 5284 |
| 914 | Ga0501072_0050973 | 3300049588 | Bacteria | 3259 |
| 915 | Ga0501072_0118448 | 3300049588 | Unclassified | 2110 |
| 916 | Ga0501072_0214705 | 3300049588 | Bacteria | 1533 |
| 917 | Ga0501073_0006738 | 3300049589 | Bacteria | 8556 |
| 918 | Ga0501073_0012305 | 3300049589 | Bacteria | 6243 |
| 919 | Ga0501073_0017444 | 3300049589 | Bacteria | 5200 |
| 920 | Ga0501073_0049327 | 3300049589 | Bacteria | 2952 |
| 921 | Ga0501073_0273921 | 3300049589 | Unclassified | 1165 |
| 922 | Ga0501073_0428301 | 3300049589 | Unclassified | 914 |
| 923 | Ga0501074_0251381 | 3300049590 | Unclassified | 1257 |
| 924 | Ga0501074_0439392 | 3300049590 | Viruses | 925 |
| 925 | Ga0501075_0002594 | 3300049591 | Bacteria | 12062 |
| 926 | Ga0501075_0047462 | 3300049591 | Unclassified | 3227 |
| 927 | Ga0501075_0519355 | 3300049591 | Unclassified | 909 |
| 928 | Ga0501075_0873292 | 3300049591 | Unclassified | 684 |
| 929 | Ga0501076_0000859 | 3300049592 | Bacteria | 19720 |
| 930 | Ga0501076_0042227 | 3300049592 | Unclassified | 3590 |
| 931 | Ga0501076_0601690 | 3300049592 | Unclassified | 907 |
| 932 | Ga0501076_0864836 | 3300049592 | Bacteria | 746 |
| 933 | Ga0501076_0986668 | 3300049592 | Unclassified | 694 |
| 934 | Ga0501249_009167 | 3300049679 | Unclassified | 2058 |
| 935 | Ga0501258_011889 | 3300049687 | Unclassified | 938 |
| 936 | Ga0501221_222164 | 3300049704 | Bacteria | 533 |
| 937 | Ga0501079_0006423 | 3300049741 | Bacteria | 8826 |
| 938 | Ga0501079_1121447 | 3300049741 | Bacteria | 620 |
| 939 | Ga0501080_0018533 | 3300049742 | Bacteria | 6439 |
| 940 | Ga0501080_0041074 | 3300049742 | Bacteria | 4312 |
| 941 | Ga0501080_0087262 | 3300049742 | Bacteria | 2898 |
| 942 | Ga0501080_0240343 | 3300049742 | Unclassified | 1653 |
| 943 | Ga0501080_0340853 | 3300049742 | Unclassified | 1354 |
| 944 | Ga0501080_0540182 | 3300049742 | Unclassified | 1039 |
| 945 | Ga0501080_0802203 | 3300049742 | Unclassified | 826 |
| 946 | Ga0501080_0924877 | 3300049742 | Bacteria | 759 |
| 947 | Ga0501081_0007200 | 3300049743 | Bacteria | 7237 |
| 948 | Ga0501081_0012806 | 3300049743 | Bacteria | 5515 |
| 949 | Ga0501081_0306831 | 3300049743 | Unclassified | 1165 |
| 950 | Ga0501083_0000203 | 3300049744 | Bacteria | 38264 |
| 951 | Ga0501083_0042744 | 3300049744 | Bacteria | 3071 |
| 952 | Ga0501083_0077311 | 3300049744 | Bacteria | 2209 |
| 953 | Ga0501083_0495698 | 3300049744 | Bacteria | 795 |
| 954 | Ga0501283_004962 | 3300049779 | Unclassified | 1813 |
| 955 | Ga0501035_0036773 | 3300049822 | Bacteria | 4436 |
| 956 | Ga0501035_0101001 | 3300049822 | Bacteria | 2532 |
| 957 | Ga0501035_0155900 | 3300049822 | Unclassified | 1979 |
| 958 | Ga0501035_0302797 | 3300049822 | Bacteria | 1346 |
| 959 | Ga0501035_0317965 | 3300049822 | Bacteria | 1308 |
| 960 | Ga0501044_0030807 | 3300049823 | Bacteria | 5650 |
| 961 | Ga0501044_0084310 | 3300049823 | Bacteria | 3212 |
| 962 | Ga0501044_0303954 | 3300049823 | Bacteria | 1523 |
| 963 | Ga0501045_0007781 | 3300049824 | Bacteria | 7454 |
| 964 | Ga0501045_0784908 | 3300049824 | Bacteria | 702 |
| 965 | nmdc:mga00v17_662330_c1 | 3300050491 | Bacteria | 671 |
| 966 | nmdc:mga0k408_98792_c1 | 3300050493 | Bacteria | 1720 |
| 967 | nmdc:mga06z11_42929_c1 | 3300050494 | Bacteria | 2271 |
| 968 | nmdc:mga04h51_72766_c1 | 3300050495 | Bacteria | 1204 |
| 969 | nmdc:mga07m45_328533_c1 | 3300050496 | Bacteria | 889 |
| 970 | nmdc:mga05p37_1210112_c1 | 3300050507 | Unclassified | 779 |
| 971 | nmdc:mga05p37_1335554_c1 | 3300050507 | Bacteria | 728 |
| 972 | nmdc:mga05p37_156794_c1 | 3300050507 | Bacteria | 2782 |
| 973 | nmdc:mga05p37_251025_c1 | 3300050507 | Bacteria | 2122 |
| 974 | nmdc:mga05p37_359575_c1 | 3300050507 | Bacteria | 1712 |
| 975 | nmdc:mga05p37_64469_c1 | 3300050507 | Bacteria | 4508 |
| 976 | nmdc:mga05p37_770284_c1 | 3300050507 | Bacteria | 1057 |
| 977 | nmdc:mga05p37_822214_c1 | 3300050507 | Bacteria | 1013 |
| 978 | nmdc:mga05p37_9042_c1 | 3300050507 | Bacteria | 11777 |
| 979 | nmdc:mga09592_1020448_c1 | 3300050508 | Unclassified | 691 |
| 980 | nmdc:mga09592_137109_c1 | 3300050508 | Bacteria | 2108 |
| 981 | nmdc:mga09592_274_c1 | 3300050508 | Bacteria | 37392 |
| 982 | nmdc:mga09592_4193_c1 | 3300050508 | Bacteria | 11645 |
| 983 | nmdc:mga09592_482757_c1 | 3300050508 | Unclassified | 1068 |
| 984 | nmdc:mga0qj67_1248433_c1 | 3300050509 | Bacteria | 577 |
| 985 | nmdc:mga0qj67_13107_c1 | 3300050509 | Bacteria | 6261 |
| 986 | nmdc:mga0qj67_179849_c1 | 3300050509 | Bacteria | 1718 |
| 987 | nmdc:mga0qj67_191623_c1 | 3300050509 | Bacteria | 1661 |
| 988 | nmdc:mga0qj67_19190_c1 | 3300050509 | Bacteria | 1928 |
| 989 | nmdc:mga06r32_117299_c1 | 3300050510 | Bacteria | 2623 |
| 990 | nmdc:mga06r32_1551457_c1 | 3300050510 | Unclassified | 602 |
| 991 | nmdc:mga06r32_1769883_c1 | 3300050510 | Unclassified | 554 |
| 992 | nmdc:mga06r32_184470_c1 | 3300050510 | Unclassified | 2073 |
| 993 | nmdc:mga06r32_276709_c1 | 3300050510 | Bacteria | 1666 |
| 994 | nmdc:mga06r32_440806_c1 | 3300050510 | Bacteria | 1283 |
| 995 | nmdc:mga06r32_5140_c1 | 3300050510 | Bacteria | 11770 |
| 996 | nmdc:mga06r32_607589_c1 | 3300050510 | Bacteria | 1064 |
| 997 | nmdc:mga06r32_6471_c1 | 3300050510 | Bacteria | 10524 |
| 998 | nmdc:mga06r32_82885_c1 | 3300050510 | Bacteria | 3125 |
| 999 | nmdc:mga06r32_944080_c1 | 3300050510 | Bacteria | 817 |
| 1000 | nmdc:mga06r32_99745_c1 | 3300050510 | Bacteria | 2849 |
| 1001 | nmdc:mga08y16_109_c1 | 3300050511 | Bacteria | 69745 |
| 1002 | nmdc:mga08y16_1204598_c1 | 3300050511 | Bacteria | 728 |
| 1003 | nmdc:mga08y16_126466_c1 | 3300050511 | Bacteria | 2659 |
| 1004 | nmdc:mga08y16_1708986_c1 | 3300050511 | Unclassified | 584 |
| 1005 | nmdc:mga08y16_18150_c1 | 3300050511 | Bacteria | 7413 |
| 1006 | nmdc:mga08y16_1979_c1 | 3300050511 | Bacteria | 20895 |
| 1007 | nmdc:mga08y16_50254_c1 | 3300050511 | Bacteria | 4364 |
| 1008 | nmdc:mga08y16_602904_c1 | 3300050511 | Bacteria | 1107 |
| 1009 | nmdc:mga08y16_7084_c1 | 3300050511 | Bacteria | 11768 |
| 1010 | nmdc:mga08y16_752123_c1 | 3300050511 | Bacteria | 971 |
| 1011 | nmdc:mga08y16_772984_c1 | 3300050511 | Bacteria | 955 |
| 1012 | nmdc:mga0n895_317294_c1 | 3300050512 | Bacteria | 1579 |
| 1013 | nmdc:mga0n895_51280_c1 | 3300050512 | Bacteria | 4048 |
| 1014 | nmdc:mga0n895_5622_c1 | 3300050512 | Bacteria | 10503 |
| 1015 | nmdc:mga0n895_56716_c1 | 3300050512 | Bacteria | 3860 |
| 1016 | nmdc:mga0n895_6025_c1 | 3300050512 | Bacteria | 10217 |
| 1017 | nmdc:mga0rr50_1323749_c1 | 3300050513 | Bacteria | 611 |
| 1018 | nmdc:mga0rr50_331611_c1 | 3300050513 | Unclassified | 1277 |
| 1019 | nmdc:mga0rr50_339614_c1 | 3300050513 | Unclassified | 1262 |
| 1020 | nmdc:mga0rr50_454023_c1 | 3300050513 | Bacteria | 1087 |
| 1021 | nmdc:mga0rr50_515204_c1 | 3300050513 | Unclassified | 1017 |
| 1022 | nmdc:mga0rr50_941081_c1 | 3300050513 | Bacteria | 736 |
| 1023 | nmdc:mga08x19_38168_c1 | 3300050514 | Unclassified | 3050 |
| 1024 | nmdc:mga08x19_630985_c1 | 3300050514 | Bacteria | 760 |
| 1025 | nmdc:mga08x19_78067_c1 | 3300050514 | Bacteria | 2169 |
| 1026 | nmdc:mga0a205_184_c1 | 3300050515 | Bacteria | 42908 |
| 1027 | nmdc:mga0a205_283_c1 | 3300050515 | Bacteria | 37189 |
| 1028 | nmdc:mga0a205_68566_c1 | 3300050515 | Unclassified | 3425 |
| 1029 | nmdc:mga0a205_8778_c1 | 3300050515 | Bacteria | 9208 |
| 1030 | nmdc:mga0a205_947284_c1 | 3300050515 | Unclassified | 708 |
| 1031 | Ga0495612_0486739 | 3300053078 | Bacteria | 565 |
| 1032 | Ga0500578_0440115 | 3300053086 | Unclassified | 744 |
| 1033 | Ga0500641_0306089 | 3300053096 | Unclassified | 651 |
| 1034 | Ga0500595_151321 | 3300053119 | Unclassified | 648 |
| 1035 | Ga0501084_0074269 | 3300054114 | Bacteria | 2847 |
| 1036 | Ga0501084_0659159 | 3300054114 | Bacteria | 883 |
| 1037 | Ga0500661_000332 | 3300055283 | Bacteria | 8579 |
| 1038 | Ga0501082_0009121 | 3300060353 | Bacteria | 8551 |
| 1039 | Ga0501082_0011610 | 3300060353 | Bacteria | 7573 |
| 1040 | Ga0501082_0026613 | 3300060353 | Bacteria | 4986 |
| 1041 | Ga0501082_0089124 | 3300060353 | Bacteria | 2663 |
| 1042 | Ga0501082_0268364 | 3300060353 | Bacteria | 1485 |
| 1043 | Ga0501082_0934722 | 3300060353 | Viruses | 758 |
| 1044 | Ga0501082_1515010 | 3300060353 | Unclassified | 586 |
| 1045 | Ga0466962_0444151 | 3300061719 | Bacteria | 653 |
| 1046 | Ga0530510_0005997 | 3300061734 | Bacteria | 8431 |
| 1047 | Ga0530510_0036019 | 3300061734 | Bacteria | 3567 |
| 1048 | Ga0065707_10224014 | |||
| 1049 | JGI24750J21931_1095716 | |||
| 1050 | JGI24751J29686_10082345 | |||
| 1051 | rootH2_10067077 | |||
| 1052 | Ga0065712_10008986 | |||
| 1053 | Ga0065715_10000528 | |||
| 1054 | Ga0065715_10030082 | |||
| 1055 | Ga0065715_10105476 | |||
| 1056 | Ga0065715_10635319 | |||
| 1057 | Ga0065707_10872246 | |||
| 1058 | Ga0070658_10293373 | |||
| 1059 | Ga0070658_10428648 | |||
| 1060 | Ga0070676_10079983 | |||
| 1061 | Ga0070676_10086320 | |||
| 1062 | Ga0070676_10423557 | |||
| 1063 | Ga0070683_100017950 | |||
| 1064 | Ga0070683_100030348 | |||
| 1065 | Ga0070683_100719561 | |||
| 1066 | Ga0070670_100023932 | |||
| 1067 | Ga0070670_100112650 | |||
| 1068 | Ga0070670_100175439 | |||
| 1069 | Ga0070677_10000517 | |||
| 1070 | Ga0070677_10005745 | |||
| 1071 | Ga0070677_10042858 | |||
| 1072 | Ga0070677_10121210 | |||
| 1073 | Ga0070677_10290627 | |||
| 1074 | Ga0068869_100007497 | |||
| 1075 | Ga0068869_100073239 | |||
| 1076 | Ga0068869_101159658 | |||
| 1077 | Ga0070666_10025214 | |||
| 1078 | Ga0070666_10124835 | |||
| 1079 | Ga0070666_10654098 | |||
| 1080 | Ga0070680_100023619 | |||
| 1081 | Ga0070680_100048523 | |||
| 1082 | Ga0070680_101397115 | |||
| 1083 | Ga0070682_100331249 | |||
| 1084 | Ga0068868_100106433 | |||
| 1085 | Ga0068868_100245145 | |||
| 1086 | Ga0068868_100448471 | |||
| 1087 | Ga0068868_100568513 | |||
| 1088 | Ga0070660_100713059 | |||
| 1089 | Ga0070689_100037428 | |||
| 1090 | Ga0070691_10524809 | |||
| 1091 | Ga0070691_10738721 | |||
| 1092 | Ga0070687_100000906 | |||
| 1093 | Ga0070661_100210627 | |||
| 1094 | Ga0070692_10184611 | |||
| 1095 | Ga0070692_10300763 | |||
| 1096 | Ga0070668_100026107 | |||
| 1097 | Ga0070668_100029145 | |||
| 1098 | Ga0070668_100152431 | |||
| 1099 | Ga0070668_100679349 | |||
| 1100 | Ga0070669_100006962 | |||
| 1101 | Ga0070669_100034115 | |||
| 1102 | Ga0070669_100091583 | |||
| 1103 | Ga0070669_100124488 | |||
| 1104 | Ga0070675_100003728 | |||
| 1105 | Ga0070675_100024220 | |||
| 1106 | Ga0070675_100080323 | |||
| 1107 | Ga0070675_100559332 | |||
| 1108 | Ga0070675_101007301 | |||
| 1109 | Ga0070675_102241166 | |||
| 1110 | Ga0070671_100039363 | |||
| 1111 | Ga0070674_100000057 | |||
| 1112 | Ga0070674_100273586 | |||
| 1113 | Ga0070674_100722259 | |||
| 1114 | Ga0070673_100028407 | |||
| 1115 | Ga0070673_100361144 | |||
| 1116 | Ga0070673_100569939 | |||
| 1117 | Ga0070688_100472170 | |||
| 1118 | Ga0070688_100652667 | |||
| 1119 | Ga0070659_100193267 | |||
| 1120 | Ga0070659_100383087 | |||
| 1121 | Ga0070659_100415133 | |||
| 1122 | Ga0070659_101228697 | |||
| 1123 | Ga0070659_101542556 | |||
| 1124 | Ga0070667_100011834 | |||
| 1125 | Ga0070667_100377746 | |||
| 1126 | Ga0070667_101980378 | |||
| 1127 | Ga0070703_10057840 | |||
| 1128 | Ga0070709_10000036 | |||
| 1129 | Ga0070709_10167626 | |||
| 1130 | Ga0070714_100051515 | |||
| 1131 | Ga0070714_101197156 | |||
| 1132 | Ga0070713_100127403 | |||
| 1133 | Ga0070713_100241834 | |||
| 1134 | Ga0070713_100475718 | |||
| 1135 | Ga0070713_100927547 | |||
| 1136 | Ga0070713_101049551 | |||
| 1137 | Ga0070710_10743372 | |||
| 1138 | Ga0070710_10976496 | |||
| 1139 | Ga0070701_10021370 | |||
| 1140 | Ga0070711_100106216 | |||
| 1141 | Ga0070711_100372310 | |||
| 1142 | Ga0070711_100428966 | |||
| 1143 | Ga0070711_101930806 | |||
| 1144 | Ga0070705_101852837 | |||
| 1145 | Ga0070700_100143028 | |||
| 1146 | Ga0070700_100149789 | |||
| 1147 | Ga0070700_100176611 | |||
| 1148 | Ga0070700_100361348 | |||
| 1149 | Ga0070700_100383335 | |||
| 1150 | Ga0070694_100218682 | |||
| 1151 | Ga0070694_101090233 | |||
| 1152 | Ga0070708_100009804 | |||
| 1153 | Ga0070708_100455951 | |||
| 1154 | Ga0070708_100503189 | |||
| 1155 | Ga0070708_101876329 | |||
| 1156 | Ga0070663_101668871 | |||
| 1157 | Ga0070678_100023036 | |||
| 1158 | Ga0070678_100100185 | |||
| 1159 | Ga0070678_100169889 | |||
| 1160 | Ga0070678_100229035 | |||
| 1161 | Ga0070678_100330833 | |||
| 1162 | Ga0070678_101824415 | |||
| 1163 | Ga0070678_101830884 | |||
| 1164 | Ga0070662_100002253 | |||
| 1165 | Ga0070662_100065245 | |||
| 1166 | Ga0070662_100260960 | |||
| 1167 | Ga0070662_101969784 | |||
| 1168 | Ga0070681_10003060 | |||
| 1169 | Ga0070681_10287352 | |||
| 1170 | Ga0070681_10370226 | |||
| 1171 | Ga0070681_10597353 | |||
| 1172 | Ga0070681_11301113 | |||
| 1173 | Ga0070681_11622199 | |||
| 1174 | Ga0068867_100095304 | |||
| 1175 | Ga0068867_100139767 | |||
| 1176 | Ga0068867_100162128 | |||
| 1177 | Ga0068867_101869641 | |||
| 1178 | Ga0070685_10027013 | |||
| 1179 | Ga0070685_10031706 | |||
| 1180 | Ga0070685_10219375 | |||
| 1181 | Ga0070685_11092516 | |||
| 1182 | Ga0070706_100086880 | |||
| 1183 | Ga0070707_100000092 | |||
| 1184 | Ga0070707_102269440 | |||
| 1185 | Ga0070698_100020885 | |||
| 1186 | Ga0070698_100042136 | |||
| 1187 | Ga0070698_100095834 | |||
| 1188 | Ga0070698_100311197 | |||
| 1189 | Ga0070698_100925586 | |||
| 1190 | Ga0070699_100006680 | |||
| 1191 | Ga0070699_100023661 | |||
| 1192 | Ga0070699_100128042 | |||
| 1193 | Ga0070699_100228303 | |||
| 1194 | Ga0070679_100003140 | |||
| 1195 | Ga0070679_100043529 | |||
| 1196 | Ga0070679_100046125 | |||
| 1197 | Ga0070679_100171857 | |||
| 1198 | Ga0070679_100310352 | |||
| 1199 | Ga0070679_101375151 | |||
| 1200 | Ga0070684_100026969 | |||
| 1201 | Ga0070684_100032650 | |||
| 1202 | Ga0070684_100876171 | |||
| 1203 | Ga0068853_100109010 | |||
| 1204 | Ga0070672_100061490 | |||
| 1205 | Ga0070672_100242542 | |||
| 1206 | Ga0070686_100036783 | |||
| 1207 | Ga0070686_100159925 | |||
| 1208 | Ga0070686_101191173 | |||
| 1209 | Ga0070695_100080168 | |||
| 1210 | Ga0070695_100786727 | |||
| 1211 | Ga0070696_100161752 | |||
| 1212 | Ga0070696_101900110 | |||
| 1213 | Ga0070693_101216727 | |||
| 1214 | Ga0070665_100027604 | |||
| 1215 | Ga0070665_100033026 | |||
| 1216 | Ga0070665_100052831 | |||
| 1217 | Ga0070665_100132334 | |||
| 1218 | Ga0070665_100794507 | |||
| 1219 | Ga0070665_101837548 | |||
| 1220 | Ga0070704_101178135 | |||
| 1221 | Ga0068855_100023228 | |||
| 1222 | Ga0068855_100056662 | |||
| 1223 | Ga0068855_100153859 | |||
| 1224 | Ga0068855_100466980 | |||
| 1225 | Ga0068855_101207653 | |||
| 1226 | Ga0070664_100038035 | |||
| 1227 | Ga0070664_100494161 | |||
| 1228 | Ga0070664_100813419 | |||
| 1229 | Ga0070664_101119713 | |||
| 1230 | Ga0068857_100240073 | |||
| 1231 | Ga0068857_100426389 | |||
| 1232 | Ga0068854_100637639 | |||
| 1233 | Ga0068854_100738543 | |||
| 1234 | Ga0068854_100913387 | |||
| 1235 | Ga0068856_100259480 | |||
| 1236 | Ga0068856_101775361 | |||
| 1237 | Ga0068856_102553071 | |||
| 1238 | Ga0070702_100853211 | |||
| 1239 | Ga0070702_100892510 | |||
| 1240 | Ga0068852_100055328 | |||
| 1241 | Ga0068852_100217773 | |||
| 1242 | Ga0068852_101743802 | |||
| 1243 | Ga0068859_100007573 | |||
| 1244 | Ga0068859_100023134 | |||
| 1245 | Ga0068859_100897402 | |||
| 1246 | Ga0068859_101062153 | |||
| 1247 | Ga0068864_100183744 | |||
| 1248 | Ga0068864_102506906 | |||
| 1249 | Ga0068866_10786783 | |||
| 1250 | Ga0068861_100183239 | |||
| 1251 | Ga0068861_100342545 | |||
| 1252 | Ga0068861_100420411 | |||
| 1253 | Ga0068870_10002083 | |||
| 1254 | Ga0068870_10029157 | |||
| 1255 | Ga0068863_100010960 | |||
| 1256 | Ga0068863_100031354 | |||
| 1257 | Ga0068863_100086906 | |||
| 1258 | Ga0068863_100844256 | |||
| 1259 | Ga0068858_100007421 | |||
| 1260 | Ga0068858_100014367 | |||
| 1261 | Ga0068858_100076014 | |||
| 1262 | Ga0068858_100142563 | |||
| 1263 | Ga0068858_100515438 | |||
| 1264 | Ga0068858_101305777 | |||
| 1265 | Ga0068858_102330297 | |||
| 1266 | Ga0068860_100056053 | |||
| 1267 | Ga0068860_100106519 | |||
| 1268 | Ga0068860_100514604 | |||
| 1269 | Ga0068860_101273772 | |||
| 1270 | Ga0068860_101577655 | |||
| 1271 | Ga0068860_101708924 | |||
| 1272 | Ga0068860_102074870 | |||
| 1273 | Ga0068860_102135462 | |||
| 1274 | Ga0068860_102207298 | |||
| 1275 | Ga0068862_100002124 | |||
| 1276 | Ga0068862_100440094 | |||
| 1277 | Ga0068862_100532779 | |||
| 1278 | Ga0081455_10035298 | |||
| 1279 | Ga0081455_10111218 | |||
| 1280 | Ga0081455_10123796 | |||
| 1281 | Ga0070717_10389181 | |||
| 1282 | Ga0075368_10021596 | |||
| 1283 | Ga0075364_10705033 | |||
| 1284 | Ga0075432_10112341 | |||
| 1285 | Ga0075432_10290625 | |||
| 1286 | Ga0070715_10980283 | |||
| 1287 | Ga0070716_100056351 | |||
| 1288 | Ga0070716_100083318 | |||
| 1289 | Ga0070716_100853681 | |||
| 1290 | Ga0070712_100271305 | |||
| 1291 | Ga0070712_100560296 | |||
| 1292 | Ga0075367_10233765 | |||
| 1293 | Ga0075367_10489586 | |||
| 1294 | Ga0075427_10108665 | |||
| 1295 | Ga0075366_10055459 | |||
| 1296 | Ga0097621_100027205 | |||
| 1297 | Ga0097621_100042384 | |||
| 1298 | Ga0097621_100119537 | |||
| 1299 | Ga0097621_100918797 | |||
| 1300 | Ga0097621_101886776 | |||
| 1301 | Ga0075370_10247507 | |||
| 1302 | Ga0068871_100041192 | |||
| 1303 | Ga0068871_100050971 | |||
| 1304 | Ga0068871_100122962 | |||
| 1305 | Ga0068871_100257009 | |||
| 1306 | Ga0068871_100334722 | |||
| 1307 | Ga0068871_101114379 | |||
| 1308 | Ga0068871_102356431 | |||
| 1309 | Ga0075428_100040802 | |||
| 1310 | Ga0075428_100226859 | |||
| 1311 | Ga0075428_100406453 | |||
| 1312 | Ga0075428_100661859 | |||
| 1313 | Ga0075428_101123682 | |||
| 1314 | Ga0075428_101437683 | |||
| 1315 | Ga0075430_100007332 | |||
| 1316 | Ga0075430_100038764 | |||
| 1317 | Ga0075430_100197532 | |||
| 1318 | Ga0075430_100243983 | |||
| 1319 | Ga0075430_100257061 | |||
| 1320 | Ga0075430_100265409 | |||
| 1321 | Ga0075430_101262904 | |||
| 1322 | Ga0075430_101418571 | |||
| 1323 | Ga0075431_100017739 | |||
| 1324 | Ga0075431_100071462 | |||
| 1325 | Ga0075431_100087247 | |||
| 1326 | Ga0075431_100186291 | |||
| 1327 | Ga0075431_100211360 | |||
| 1328 | Ga0075431_100358009 | |||
| 1329 | Ga0075431_100409802 | |||
| 1330 | Ga0075431_100461033 | |||
| 1331 | Ga0075431_100524752 | |||
| 1332 | Ga0075431_100735130 | |||
| 1333 | Ga0075431_100803524 | |||
| 1334 | Ga0075431_101061375 | |||
| 1335 | Ga0075431_101114336 | |||
| 1336 | Ga0075431_101725795 | |||
| 1337 | Ga0075433_10002417 | |||
| 1338 | Ga0075433_10004965 | |||
| 1339 | Ga0075433_10434976 | |||
| 1340 | Ga0075433_11028543 | |||
| 1341 | Ga0075433_11542355 | |||
| 1342 | Ga0075434_100000951 | |||
| 1343 | Ga0075434_100019186 | |||
| 1344 | Ga0075434_100025389 | |||
| 1345 | Ga0075434_100030985 | |||
| 1346 | Ga0075434_100973109 | |||
| 1347 | Ga0075429_100001380 | |||
| 1348 | Ga0075429_100002352 | |||
| 1349 | Ga0075429_100034218 | |||
| 1350 | Ga0075429_100039292 | |||
| 1351 | Ga0075429_100218479 | |||
| 1352 | Ga0075429_101894274 | |||
| 1353 | Ga0068865_100346737 | |||
| 1354 | Ga0068865_100675833 | |||
| 1355 | Ga0075436_100018232 | |||
| 1356 | Ga0075436_100152410 | |||
| 1357 | Ga0075436_100253283 | |||
| 1358 | Ga0075436_100987880 | |||
| 1359 | Ga0097620_100007573 | |||
| 1360 | Ga0097620_100023132 | |||
| 1361 | Ga0097620_100897497 | |||
| 1362 | Ga0097620_101062310 | |||
| 1363 | Ga0075435_100006825 | |||
| 1364 | Ga0075435_100044112 | |||
| 1365 | Ga0075435_100227811 | |||
| 1366 | Ga0075435_100340093 | |||
| 1367 | Ga0075435_100455335 | |||
| 1368 | Ga0075435_100888873 | |||
| 1369 | Ga0075435_101153974 | |||
| 1370 | Ga0099794_10163165 | |||
| 1371 | Ga0099794_10304925 | |||
| 1372 | Ga0105240_10130245 | |||
| 1373 | Ga0111539_10000424 | |||
| 1374 | Ga0111539_10005348 | |||
| 1375 | Ga0111539_10006468 | |||
| 1376 | Ga0111539_10009970 | |||
| 1377 | Ga0111539_10037916 | |||
| 1378 | Ga0111539_10103148 | |||
| 1379 | Ga0111539_10133161 | |||
| 1380 | Ga0111539_10266928 | |||
| 1381 | Ga0111539_10269164 | |||
| 1382 | Ga0105245_10010086 | |||
| 1383 | Ga0105245_10017219 | |||
| 1384 | Ga0105245_10038669 | |||
| 1385 | Ga0105245_10057091 | |||
| 1386 | Ga0105245_10123427 | |||
| 1387 | Ga0105245_10375278 | |||
| 1388 | Ga0105245_10396227 | |||
| 1389 | Ga0105245_10562422 | |||
| 1390 | Ga0105245_13095434 | |||
| 1391 | Ga0105247_10029612 | |||
| 1392 | Ga0105247_10071674 | |||
| 1393 | Ga0105247_10526982 | |||
| 1394 | Ga0114129_10045369 | |||
| 1395 | Ga0114129_10063972 | |||
| 1396 | Ga0114129_10204026 | |||
| 1397 | Ga0114129_10205810 | |||
| 1398 | Ga0114129_10241084 | |||
| 1399 | Ga0114129_10501497 | |||
| 1400 | Ga0114129_10673315 | |||
| 1401 | Ga0114129_10767285 | |||
| 1402 | Ga0114129_11000668 | |||
| 1403 | Ga0114129_11150074 | |||
| 1404 | Ga0114129_11306401 | |||
| 1405 | Ga0114129_11950165 | |||
| 1406 | Ga0114129_12084708 | |||
| 1407 | Ga0114129_12485970 | |||
| 1408 | Ga0114129_12932971 | |||
| 1409 | Ga0105243_10077611 | |||
| 1410 | Ga0105243_10789101 | |||
| 1411 | Ga0105243_11985197 | |||
| 1412 | Ga0105241_10003232 | |||
| 1413 | Ga0105241_10899634 | |||
| 1414 | Ga0105242_10026425 | |||
| 1415 | Ga0105242_10187705 | |||
| 1416 | Ga0105242_10236891 | |||
| 1417 | Ga0105242_10349787 | |||
| 1418 | Ga0105242_10962231 | |||
| 1419 | Ga0105242_11183979 | |||
| 1420 | Ga0105242_12785101 | |||
| 1421 | Ga0105248_10000003 | |||
| 1422 | Ga0105248_10067384 | |||
| 1423 | Ga0105248_10260256 | |||
| 1424 | Ga0105248_10272655 | |||
| 1425 | Ga0105248_10279319 | |||
| 1426 | Ga0105248_10606612 | |||
| 1427 | Ga0105248_11383301 | |||
| 1428 | Ga0105248_11558922 | |||
| 1429 | Ga0105248_11629518 | |||
| 1430 | Ga0105248_12721308 | |||
| 1431 | Ga0105238_10652626 | |||
| 1432 | Ga0105238_11207167 | |||
| 1433 | Ga0105238_11848188 | |||
| 1434 | Ga0105238_12999896 | |||
| 1435 | Ga0105249_10011692 | |||
| 1436 | Ga0105249_10067044 | |||
| 1437 | Ga0105249_10919391 | |||
| 1438 | Ga0105249_10939476 | |||
| 1439 | Ga0099796_10111626 | |||
| 1440 | Ga0105239_10016583 | |||
| 1441 | Ga0105239_10390214 | |||
| 1442 | Ga0105239_10695726 | |||
| 1443 | Ga0105239_11908396 | |||
| 1444 | Ga0105239_12751486 | |||
| 1445 | Ga0105239_12754545 | |||
| 1446 | Ga0105246_10099177 | |||
| 1447 | Ga0105246_10763362 | |||
| 1448 | Ga0105246_11002575 | |||
| 1449 | Ga0157325_1030379 | |||
| 1450 | Ga0157315_1050702 | |||
| 1451 | Ga0157373_10037173 | |||
| 1452 | Ga0157371_10789839 | |||
| 1453 | Ga0157371_10795343 | |||
| 1454 | Ga0157370_10014358 | |||
| 1455 | Ga0157370_10068365 | |||
| 1456 | Ga0157370_10323643 | |||
| 1457 | Ga0157370_10881918 | |||
| 1458 | Ga0157369_10053053 | |||
| 1459 | Ga0157369_10068414 | |||
| 1460 | Ga0157374_10001955 | |||
| 1461 | Ga0157374_10006310 | |||
| 1462 | Ga0157374_10270803 | |||
| 1463 | Ga0157374_10379599 | |||
| 1464 | Ga0157374_10464749 | |||
| 1465 | Ga0157374_10709442 | |||
| 1466 | Ga0157374_11000461 | |||
| 1467 | Ga0157374_11932547 | |||
| 1468 | Ga0157378_10009064 | |||
| 1469 | Ga0157378_10037196 | |||
| 1470 | Ga0157378_10430568 | |||
| 1471 | Ga0163162_10017236 | |||
| 1472 | Ga0163162_11156557 | |||
| 1473 | Ga0163162_11342281 | |||
| 1474 | Ga0163162_11931852 | |||
| 1475 | Ga0163162_12241426 | |||
| 1476 | Ga0157372_10111251 | |||
| 1477 | Ga0157372_10683778 | |||
| 1478 | Ga0157372_10986815 | |||
| 1479 | Ga0157372_11718559 | |||
| 1480 | Ga0157375_10010134 | |||
| 1481 | Ga0157375_10142546 | |||
| 1482 | Ga0157375_10214383 | |||
| 1483 | Ga0157375_10396756 | |||
| 1484 | Ga0157375_12061241 | |||
| 1485 | Ga0157375_12617870 | |||
| 1486 | Ga0163163_10046060 | |||
| 1487 | Ga0163163_10101854 | |||
| 1488 | Ga0163163_10287357 | |||
| 1489 | Ga0163163_10302428 | |||
| 1490 | Ga0163163_10729402 | |||
| 1491 | Ga0163163_11548828 | |||
| 1492 | Ga0157380_10005070 | |||
| 1493 | Ga0157380_10009877 | |||
| 1494 | Ga0157380_10038848 | |||
| 1495 | Ga0157380_10192774 | |||
| 1496 | Ga0157380_10492065 | |||
| 1497 | Ga0157380_11792553 | |||
| 1498 | Ga0157380_12318873 | |||
| 1499 | Ga0157377_10037788 | |||
| 1500 | Ga0157379_10030339 | |||
| 1501 | Ga0157379_10081470 | |||
| 1502 | Ga0157379_10177973 | |||
| 1503 | Ga0157376_10194019 | |||
| 1504 | Ga0157376_10713301 | |||
| 1505 | Ga0163161_10039643 | |||
| 1506 | Ga0163161_10050135 | |||
| 1507 | Ga0163161_10313943 | |||
| 1508 | Ga0163161_10413263 | |||
| 1509 | Ga0213876_10001835 | |||
| 1510 | Ga0213875_10000015 | |||
| 1511 | Ga0213875_10002728 | |||
| 1512 | Ga0213875_10007939 | |||
| 1513 | Ga0213875_10361282 | |||
| 1514 | Ga0224572_1111194 | |||
| 1515 | Ga0207666_1076820 | |||
| 1516 | Ga0207673_1009002 | |||
| 1517 | Ga0207697_10007740 | |||
| 1518 | Ga0207697_10080622 | |||
| 1519 | Ga0207697_10081828 | |||
| 1520 | Ga0207697_10102269 | |||
| 1521 | Ga0207682_10000160 | |||
| 1522 | Ga0207682_10011105 | |||
| 1523 | Ga0207682_10035195 | |||
| 1524 | Ga0207682_10205031 | |||
| 1525 | Ga0207682_10354935 | |||
| 1526 | Ga0207642_10246171 | |||
| 1527 | Ga0207710_10037668 | |||
| 1528 | Ga0207688_10195266 | |||
| 1529 | Ga0207680_10113336 | |||
| 1530 | Ga0207680_10115714 | |||
| 1531 | Ga0207680_10436671 | |||
| 1532 | Ga0207647_10037223 | |||
| 1533 | Ga0207647_10115365 | |||
| 1534 | Ga0207699_10000078 | |||
| 1535 | Ga0207645_10157678 | |||
| 1536 | Ga0207643_10004382 | |||
| 1537 | Ga0207643_10015677 | |||
| 1538 | Ga0207643_10036283 | |||
| 1539 | Ga0207705_11109241 | |||
| 1540 | Ga0207684_10070387 | |||
| 1541 | Ga0207707_10060310 | |||
| 1542 | Ga0207707_10102488 | |||
| 1543 | Ga0207707_10207765 | |||
| 1544 | Ga0207707_10282575 | |||
| 1545 | Ga0207707_10400728 | |||
| 1546 | Ga0207707_10577423 | |||
| 1547 | Ga0207695_10011402 | |||
| 1548 | Ga0207695_10067569 | |||
| 1549 | Ga0207695_10087196 | |||
| 1550 | Ga0207695_10813392 | |||
| 1551 | Ga0207693_10075798 | |||
| 1552 | Ga0207693_10243687 | |||
| 1553 | Ga0207693_10450694 | |||
| 1554 | Ga0207663_10420713 | |||
| 1555 | Ga0207663_11193728 | |||
| 1556 | Ga0207663_11308079 | |||
| 1557 | Ga0207663_11380201 | |||
| 1558 | Ga0207660_10020030 | |||
| 1559 | Ga0207660_10362872 | |||
| 1560 | Ga0207660_10439333 | |||
| 1561 | Ga0207660_10680361 | |||
| 1562 | Ga0207662_10028486 | |||
| 1563 | Ga0207657_10617411 | |||
| 1564 | Ga0207657_10821011 | |||
| 1565 | Ga0207649_10159352 | |||
| 1566 | Ga0207652_10023134 | |||
| 1567 | Ga0207652_10190503 | |||
| 1568 | Ga0207652_10310141 | |||
| 1569 | Ga0207652_10395297 | |||
| 1570 | Ga0207652_10553379 | |||
| 1571 | Ga0207652_11160314 | |||
| 1572 | Ga0207652_11345979 | |||
| 1573 | Ga0207646_10000047 | |||
| 1574 | Ga0207646_10571274 | |||
| 1575 | Ga0207646_11105812 | |||
| 1576 | Ga0207681_10002951 | |||
| 1577 | Ga0207681_10037376 | |||
| 1578 | Ga0207694_10227477 | |||
| 1579 | Ga0207650_10030199 | |||
| 1580 | Ga0207659_10006283 | |||
| 1581 | Ga0207659_10026774 | |||
| 1582 | Ga0207659_10369345 | |||
| 1583 | Ga0207659_11856497 | |||
| 1584 | Ga0207687_10041701 | |||
| 1585 | Ga0207687_10061991 | |||
| 1586 | Ga0207687_10225994 | |||
| 1587 | Ga0207687_10382923 | |||
| 1588 | Ga0207687_11379006 | |||
| 1589 | Ga0207700_10138171 | |||
| 1590 | Ga0207700_10347159 | |||
| 1591 | Ga0207700_10491814 | |||
| 1592 | Ga0207700_10677657 | |||
| 1593 | Ga0207700_10774457 | |||
| 1594 | Ga0207700_10954753 | |||
| 1595 | Ga0207700_11373972 | |||
| 1596 | Ga0207664_10588115 | |||
| 1597 | Ga0207664_10902750 | |||
| 1598 | Ga0207644_10623190 | |||
| 1599 | Ga0207644_10676777 | |||
| 1600 | Ga0207690_10150955 | |||
| 1601 | Ga0207690_11290658 | |||
| 1602 | Ga0207690_11830208 | |||
| 1603 | Ga0207706_10068666 | |||
| 1604 | Ga0207706_10296289 | |||
| 1605 | Ga0207706_10462305 | |||
| 1606 | Ga0207706_10881313 | |||
| 1607 | Ga0207686_10047907 | |||
| 1608 | Ga0207686_10087588 | |||
| 1609 | Ga0207686_10521428 | |||
| 1610 | Ga0207686_10748663 | |||
| 1611 | Ga0207686_10899934 | |||
| 1612 | Ga0207686_10913140 | |||
| 1613 | Ga0207709_10806343 | |||
| 1614 | Ga0207709_11166594 | |||
| 1615 | Ga0207670_10019311 | |||
| 1616 | Ga0207669_10000478 | |||
| 1617 | Ga0207669_10037665 | |||
| 1618 | Ga0207669_10204265 | |||
| 1619 | Ga0207669_10317790 | |||
| 1620 | Ga0207704_10008068 | |||
| 1621 | Ga0207704_10173557 | |||
| 1622 | Ga0207704_10515262 | |||
| 1623 | Ga0207704_10537646 | |||
| 1624 | Ga0207665_10061008 | |||
| 1625 | Ga0207665_10076220 | |||
| 1626 | Ga0207665_10270537 | |||
| 1627 | Ga0207691_10006233 | |||
| 1628 | Ga0207691_10116379 | |||
| 1629 | Ga0207691_11448200 | |||
| 1630 | Ga0207711_10000012 | |||
| 1631 | Ga0207711_10484447 | |||
| 1632 | Ga0207711_10558324 | |||
| 1633 | Ga0207711_11334026 | |||
| 1634 | Ga0207689_10005413 | |||
| 1635 | Ga0207689_10041674 | |||
| 1636 | Ga0207689_10617592 | |||
| 1637 | Ga0207689_11116400 | |||
| 1638 | Ga0207661_10532102 | |||
| 1639 | Ga0207679_10008532 | |||
| 1640 | Ga0207679_10051456 | |||
| 1641 | Ga0207679_11051048 | |||
| 1642 | Ga0207667_10014528 | |||
| 1643 | Ga0207667_10360696 | |||
| 1644 | Ga0207651_10038575 | |||
| 1645 | Ga0207651_11588599 | |||
| 1646 | Ga0207712_10004313 | |||
| 1647 | Ga0207712_10266248 | |||
| 1648 | Ga0207712_10727083 | |||
| 1649 | Ga0207712_11853114 | |||
| 1650 | Ga0207668_10032267 | |||
| 1651 | Ga0207668_10062515 | |||
| 1652 | Ga0207668_10431715 | |||
| 1653 | Ga0207668_10643750 | |||
| 1654 | Ga0207640_10017630 | |||
| 1655 | Ga0207640_10028832 | |||
| 1656 | Ga0207658_10027849 | |||
| 1657 | Ga0207658_10808983 | |||
| 1658 | Ga0207677_10036258 | |||
| 1659 | Ga0207677_10088141 | |||
| 1660 | Ga0207677_10121131 | |||
| 1661 | Ga0207703_10027190 | |||
| 1662 | Ga0207703_10230489 | |||
| 1663 | Ga0207703_10487705 | |||
| 1664 | Ga0207703_10710464 | |||
| 1665 | Ga0207703_11258629 | |||
| 1666 | Ga0207703_11524708 | |||
| 1667 | Ga0207703_11967004 | |||
| 1668 | Ga0207703_12172110 | |||
| 1669 | Ga0207639_10409965 | |||
| 1670 | Ga0207678_10087139 | |||
| 1671 | Ga0207678_10244639 | |||
| 1672 | Ga0207678_10561983 | |||
| 1673 | Ga0207708_10032804 | |||
| 1674 | Ga0207708_10035736 | |||
| 1675 | Ga0207708_10095631 | |||
| 1676 | Ga0207708_10316311 | |||
| 1677 | Ga0207708_10445639 | |||
| 1678 | Ga0207702_10181047 | |||
| 1679 | Ga0207702_10441763 | |||
| 1680 | Ga0207702_11634928 | |||
| 1681 | Ga0207641_10015240 | |||
| 1682 | Ga0207641_10108790 | |||
| 1683 | Ga0207641_10126069 | |||
| 1684 | Ga0207641_10225738 | |||
| 1685 | Ga0207641_10779474 | |||
| 1686 | Ga0207648_10022397 | |||
| 1687 | Ga0207648_10070306 | |||
| 1688 | Ga0207648_10317442 | |||
| 1689 | Ga0207676_12081160 | |||
| 1690 | Ga0207676_12311271 | |||
| 1691 | Ga0207674_10021855 | |||
| 1692 | Ga0207674_10104503 | |||
| 1693 | Ga0207674_10359545 | |||
| 1694 | Ga0207675_100194400 | |||
| 1695 | Ga0207675_100463960 | |||
| 1696 | Ga0207675_100675176 | |||
| 1697 | Ga0207675_100909882 | |||
| 1698 | Ga0207683_10033946 | |||
| 1699 | Ga0207683_10230666 | |||
| 1700 | Ga0207683_10378532 | |||
| 1701 | Ga0207683_10482822 | |||
| 1702 | Ga0207683_10553226 | |||
| 1703 | Ga0207683_10669034 | |||
| 1704 | Ga0207698_10457733 | |||
| 1705 | Ga0207698_10482111 | |||
| 1706 | Ga0207698_11378395 | |||
| 1707 | Ga0209813_10064180 | |||
| 1708 | Ga0209974_10164541 | |||
| 1709 | Ga0207428_10000709 | |||
| 1710 | Ga0207428_10000898 | |||
| 1711 | Ga0207428_10003389 | |||
| 1712 | Ga0207428_10010157 | |||
| 1713 | Ga0207428_10039581 | |||
| 1714 | Ga0207428_10052429 | |||
| 1715 | Ga0265357_1027068 | |||
| 1716 | Ga0268266_10004232 | |||
| 1717 | Ga0268266_10006293 | |||
| 1718 | Ga0268266_10008531 | |||
| 1719 | Ga0268266_10940288 | |||
| 1720 | Ga0268266_11135889 | |||
| 1721 | Ga0268265_10027491 | |||
| 1722 | Ga0268265_10030095 | |||
| 1723 | Ga0268265_10185006 | |||
| 1724 | Ga0268265_10200790 | |||
| 1725 | Ga0268265_10454213 | |||
| 1726 | Ga0268265_10740749 | |||
| 1727 | Ga0268264_10022631 | |||
| 1728 | Ga0268264_10056263 | |||
| 1729 | Ga0268264_10076051 | |||
| 1730 | Ga0268264_11146074 | |||
| 1731 | Ga0265338_10021966 | |||
| 1732 | Ga0265338_10958714 | |||
| 1733 | Ga0265324_10013527 | |||
| 1734 | Ga0265760_10017585 | |||
| 1735 | Ga0265328_10210037 | |||
| 1736 | Ga0265329_10270386 | |||
| 1737 | Ga0265339_10000493 | |||
| 1738 | Ga0265339_10073987 | |||
| 1739 | Ga0307408_100940061 | |||
| 1740 | Ga0265314_10000923 | |||
| 1741 | Ga0265314_10009936 | |||
| 1742 | Ga0265314_10055797 | |||
| 1743 | Ga0265342_10045514 | |||
| 1744 | Ga0307406_10095804 | |||
| 1745 | Ga0307407_10489049 | |||
| 1746 | Ga0307412_10029426 | |||
| 1747 | Ga0307409_101107377 | |||
| 1748 | Ga0307416_100086568 | |||
| 1749 | Ga0307416_100790245 | |||
| 1750 | Ga0307416_103039982 | |||
| 1751 | Ga0307411_11313397 | |||
| 1752 | Ga0307510_10047766 | |||
| 1753 | Ga0307510_10105822 | |||
| 1754 | Ga0373926_0006841 | |||
| 1755 | Ga0373940_0011780 | |||
| 1756 | Ga0373944_0002843 | |||
| 1757 | Ga0373944_0253865 | |||
| 1758 | Ga0373936_0009522 | |||
| 1759 | Ga0373939_0005715 | |||
| 1760 | Ga0373945_0004990 | |||
| 1761 | Ga0373953_0186416 | |||
| 1762 | Ga0373956_0076663 | |||
| 1763 | Ga0373957_0171316 | |||
| 1764 | Ga0373957_0207342 | |||
| 1765 | Ga0373960_0087758 | |||
| 1766 | Ga0373943_0009601 | |||
| 1767 | Ga0373943_0137695 | |||
| 1768 | Ga0373946_0008598 | |||
| 1769 | Ga0373946_0009163 | |||
| 1770 | Ga0373946_0013641 | |||
| 1771 | Ga0373955_0786320 | |||
| 1772 | Ga0373942_0195165 | |||
| 1773 | Ga0373924_0004044 | |||
| 1774 | Ga0373924_0342831 | |||
| 1775 | Ga0373931_0196357 | |||
| 1776 | Ga0373935_0097209 | |||
| 1777 | Ga0373935_0828968 | |||
| 1778 | Ga0373927_0108797 | |||
| 1779 | Ga0373927_0114180 | |||
| 1780 | Ga0373927_0463311 | |||
| 1781 | Ga0373927_0516031 | |||
| 1782 | Ga0373933_0125375 | |||
| 1783 | Ga0373933_0183463 | |||
| 1784 | Ga0373933_0324031 | |||
| 1785 | Ga0373933_1185519 | |||
| 1786 | Ga0373947_0007950 | |||
| 1787 | Ga0373947_0293362 | |||
| 1788 | Ga0373947_1142496 | |||
| 1789 | Ga0373937_0407937 | |||
| 1790 | Ga0373937_0529452 | |||
| 1791 | Ga0373937_0565478 | |||
| 1792 | Ga0373937_0666211 | |||
| 1793 | Ga0373937_0959594 | |||
| 1794 | Ga0373925_0010454 | |||
| 1795 | Ga0395900_0937514 | |||
| 1796 | Ga0395898_0025084 | |||
| 1797 | Ga0436364_0337811 | |||
| 1798 | Ga0436364_0354654 | |||
| 1799 | Ga0436364_0634548 | |||
| 1800 | Ga0436364_0988131 | |||
| 1801 | Ga0436364_1113127 | |||
| 1802 | Ga0436364_1263905 | |||
| 1803 | Ga0395901_0339675 | |||
| 1804 | Ga0436365_1337643 | |||
| 1805 | Ga0436365_1799897 | |||
| 1806 | Ga0436360_0769958 | |||
| 1807 | Ga0436363_0518015 | |||
| 1808 | Ga0436362_0522880 | |||
| 1809 | Ga0439453_0022555 | |||
| 1810 | Ga0451789_0498126 | |||
| 1811 | Ga0451793_0888004 | |||
| 1812 | Ga0451845_0463185 | |||
| 1813 | Ga0439443_103049 | |||
| 1814 | Ga0439440_0082566 | |||
| 1815 | Ga0439440_0169661 | |||
| 1816 | Ga0453683_1139489 | |||
| 1817 | Ga0466957_0556474 | |||
| 1818 | Ga0466959_0006604 | |||
| 1819 | Ga0451576_0023025 | |||
| 1820 | Ga0451576_1323591 | |||
| 1821 | Ga0466958_0361404 | |||
| 1822 | Ga0466967_0285162 | |||
| 1823 | Ga0466967_0316383 | |||
| 1824 | Ga0466967_0723948 | |||
| 1825 | Ga0466967_1567220 | |||
| 1826 | Ga0495603_0013872 | |||
| 1827 | Ga0495603_0290833 | |||
| 1828 | Ga0495651_0164523 | |||
| 1829 | Ga0495650_0001169 | |||
| 1830 | Ga0495650_0164225 | |||
| 1831 | Ga0495580_0065275 | |||
| 1832 | Ga0495580_0221377 | |||
| 1833 | Ga0495580_0988432 | |||
| 1834 | Ga0495582_0030867 | |||
| 1835 | Ga0495639_0011514 | |||
| 1836 | Ga0495639_0105754 | |||
| 1837 | Ga0495639_0210080 | |||
| 1838 | Ga0495606_0393118 | |||
| 1839 | Ga0495628_0113754 | |||
| 1840 | Ga0495630_0338829 | |||
| 1841 | Ga0495643_0227520 | |||
| 1842 | Ga0495665_0085234 | |||
| 1843 | Ga0495586_0128068 | |||
| 1844 | Ga0495587_0041307 | |||
| 1845 | Ga0495656_0166686 | |||
| 1846 | Ga0495668_0353152 | |||
| 1847 | Ga0495625_0000440 | |||
| 1848 | Ga0495625_0088876 | |||
| 1849 | Ga0495635_0023703 | |||
| 1850 | Ga0495588_0001264 | |||
| 1851 | Ga0495623_0355028 | |||
| 1852 | Ga0495647_0105939 | |||
| 1853 | Ga0495658_0008008 | |||
| 1854 | Ga0495658_0279790 | |||
| 1855 | Ga0495658_0309989 | |||
| 1856 | Ga0495669_0164526 | |||
| 1857 | Ga0495669_0591645 | |||
| 1858 | Ga0495613_0230469 | |||
| 1859 | Ga0495624_0243182 | |||
| 1860 | Ga0495670_0391114 | |||
| 1861 | Ga0495671_0553171 | |||
| 1862 | Ga0495649_0338688 | |||
| 1863 | Ga0495581_0026697 | |||
| 1864 | Ga0495672_0012702 | |||
| 1865 | Ga0495683_0281984 | |||
| 1866 | Ga0495687_139114 | |||
| 1867 | Ga0495684_0114211 | |||
| 1868 | Ga0495614_0292125 | |||
| 1869 | Ga0496102_1447214 | |||
| 1870 | Ga0496104_0000032 | |||
| 1871 | Ga0496104_0020962 | |||
| 1872 | Ga0496105_0038601 | |||
| 1873 | Ga0496105_0062123 | |||
| 1874 | Ga0496108_0136753 | |||
| 1875 | Ga0496110_1165293 | |||
| 1876 | Ga0496111_0767356 | |||
| 1877 | Ga0496112_0005683 | |||
| 1878 | Ga0496112_0031641 | |||
| 1879 | Ga0496113_0003763 | |||
| 1880 | Ga0496126_0086548 | |||
| 1881 | Ga0496126_0095345 | |||
| 1882 | Ga0495682_0013384 | |||
| 1883 | Ga0501298_113595 | |||
| 1884 | Ga0501031_0785796 | |||
| 1885 | Ga0501031_1129593 | |||
| 1886 | Ga0501032_0007431 | |||
| 1887 | Ga0501032_0015736 | |||
| 1888 | Ga0501032_0107240 | |||
| 1889 | Ga0501032_0163651 | |||
| 1890 | Ga0501033_0025231 | |||
| 1891 | Ga0501033_0030919 | |||
| 1892 | Ga0501033_0874056 | |||
| 1893 | Ga0501034_0020790 | |||
| 1894 | Ga0501034_0094792 | |||
| 1895 | Ga0501034_0175598 | |||
| 1896 | Ga0501034_0265753 | |||
| 1897 | Ga0501034_0317403 | |||
| 1898 | Ga0501034_0505146 | |||
| 1899 | Ga0501036_0022371 | |||
| 1900 | Ga0501036_0092184 | |||
| 1901 | Ga0501036_0095380 | |||
| 1902 | Ga0501036_0125835 | |||
| 1903 | Ga0501036_0316849 | |||
| 1904 | Ga0501036_0358722 | |||
| 1905 | Ga0501036_0518790 | |||
| 1906 | Ga0501036_0782553 | |||
| 1907 | Ga0501037_0027153 | |||
| 1908 | Ga0501037_0030645 | |||
| 1909 | Ga0501037_0057198 | |||
| 1910 | Ga0501037_0305039 | |||
| 1911 | Ga0501037_0411664 | |||
| 1912 | Ga0501038_0004265 | |||
| 1913 | Ga0501038_0091268 | |||
| 1914 | Ga0501038_0262224 | |||
| 1915 | Ga0501038_0287006 | |||
| 1916 | Ga0501039_0006137 | |||
| 1917 | Ga0501039_0068970 | |||
| 1918 | Ga0501039_1175007 | |||
| 1919 | Ga0501040_0001914 | |||
| 1920 | Ga0501040_0134895 | |||
| 1921 | Ga0501040_0195186 | |||
| 1922 | Ga0501040_0999686 | |||
| 1923 | Ga0501040_1399170 | |||
| 1924 | Ga0501041_0054709 | |||
| 1925 | Ga0501042_0235512 | |||
| 1926 | Ga0501042_0335220 | |||
| 1927 | Ga0501043_0015584 | |||
| 1928 | Ga0501043_0052667 | |||
| 1929 | Ga0501043_0187993 | |||
| 1930 | Ga0501043_0304815 | |||
| 1931 | Ga0501043_0361040 | |||
| 1932 | Ga0501043_0768109 | |||
| 1933 | Ga0501043_1027533 | |||
| 1934 | Ga0501046_0003067 | |||
| 1935 | Ga0501046_0021750 | |||
| 1936 | Ga0501046_0133134 | |||
| 1937 | Ga0501046_0850077 | |||
| 1938 | Ga0501047_0006391 | |||
| 1939 | Ga0501047_0014262 | |||
| 1940 | Ga0501047_0033411 | |||
| 1941 | Ga0501047_0058983 | |||
| 1942 | Ga0501047_0085137 | |||
| 1943 | Ga0501047_0555218 | |||
| 1944 | Ga0501048_0032432 | |||
| 1945 | Ga0501048_0035446 | |||
| 1946 | Ga0501048_0460000 | |||
| 1947 | Ga0501048_0865153 | |||
| 1948 | Ga0501068_0000823 | |||
| 1949 | Ga0501068_0013752 | |||
| 1950 | Ga0501069_0052377 | |||
| 1951 | Ga0501069_0059479 | |||
| 1952 | Ga0501070_0056484 | |||
| 1953 | Ga0501070_0190936 | |||
| 1954 | Ga0501070_0742042 | |||
| 1955 | Ga0501071_0001203 | |||
| 1956 | Ga0501071_0133363 | |||
| 1957 | Ga0501071_0340907 | |||
| 1958 | Ga0501071_0446537 | |||
| 1959 | Ga0501071_0712511 | |||
| 1960 | Ga0501072_0019173 | |||
| 1961 | Ga0501072_0050973 | |||
| 1962 | Ga0501072_0118448 | |||
| 1963 | Ga0501072_0214705 | |||
| 1964 | Ga0501073_0006738 | |||
| 1965 | Ga0501073_0012305 | |||
| 1966 | Ga0501073_0017444 | |||
| 1967 | Ga0501073_0049327 | |||
| 1968 | Ga0501073_0273921 | |||
| 1969 | Ga0501073_0428301 | |||
| 1970 | Ga0501074_0251381 | |||
| 1971 | Ga0501074_0439392 | |||
| 1972 | Ga0501075_0002594 | |||
| 1973 | Ga0501075_0047462 | |||
| 1974 | Ga0501075_0519355 | |||
| 1975 | Ga0501075_0873292 | |||
| 1976 | Ga0501076_0000859 | |||
| 1977 | Ga0501076_0042227 | |||
| 1978 | Ga0501076_0601690 | |||
| 1979 | Ga0501076_0864836 | |||
| 1980 | Ga0501076_0986668 | |||
| 1981 | Ga0501249_009167 | |||
| 1982 | Ga0501258_011889 | |||
| 1983 | Ga0501221_222164 | |||
| 1984 | Ga0501079_0006423 | |||
| 1985 | Ga0501079_1121447 | |||
| 1986 | Ga0501080_0018533 | |||
| 1987 | Ga0501080_0041074 | |||
| 1988 | Ga0501080_0087262 | |||
| 1989 | Ga0501080_0240343 | |||
| 1990 | Ga0501080_0340853 | |||
| 1991 | Ga0501080_0540182 | |||
| 1992 | Ga0501080_0802203 | |||
| 1993 | Ga0501080_0924877 | |||
| 1994 | Ga0501081_0007200 | |||
| 1995 | Ga0501081_0012806 | |||
| 1996 | Ga0501081_0306831 | |||
| 1997 | Ga0501083_0000203 | |||
| 1998 | Ga0501083_0042744 | |||
| 1999 | Ga0501083_0077311 | |||
| 2000 | Ga0501083_0495698 | |||
| 2001 | Ga0501283_004962 | |||
| 2002 | Ga0501035_0036773 | |||
| 2003 | Ga0501035_0101001 | |||
| 2004 | Ga0501035_0155900 | |||
| 2005 | Ga0501035_0302797 | |||
| 2006 | Ga0501035_0317965 | |||
| 2007 | Ga0501044_0030807 | |||
| 2008 | Ga0501044_0084310 | |||
| 2009 | Ga0501044_0303954 | |||
| 2010 | Ga0501045_0007781 | |||
| 2011 | Ga0501045_0784908 | |||
| 2012 | nmdc:mga00v17_662330_c1 | |||
| 2013 | nmdc:mga0k408_98792_c1 | |||
| 2014 | nmdc:mga06z11_42929_c1 | |||
| 2015 | nmdc:mga04h51_72766_c1 | |||
| 2016 | nmdc:mga07m45_328533_c1 | |||
| 2017 | nmdc:mga05p37_1210112_c1 | |||
| 2018 | nmdc:mga05p37_1335554_c1 | |||
| 2019 | nmdc:mga05p37_156794_c1 | |||
| 2020 | nmdc:mga05p37_251025_c1 | |||
| 2021 | nmdc:mga05p37_359575_c1 | |||
| 2022 | nmdc:mga05p37_64469_c1 | |||
| 2023 | nmdc:mga05p37_770284_c1 | |||
| 2024 | nmdc:mga05p37_822214_c1 | |||
| 2025 | nmdc:mga05p37_9042_c1 | |||
| 2026 | nmdc:mga09592_1020448_c1 | |||
| 2027 | nmdc:mga09592_137109_c1 | |||
| 2028 | nmdc:mga09592_274_c1 | |||
| 2029 | nmdc:mga09592_4193_c1 | |||
| 2030 | nmdc:mga09592_482757_c1 | |||
| 2031 | nmdc:mga0qj67_1248433_c1 | |||
| 2032 | nmdc:mga0qj67_13107_c1 | |||
| 2033 | nmdc:mga0qj67_179849_c1 | |||
| 2034 | nmdc:mga0qj67_191623_c1 | |||
| 2035 | nmdc:mga0qj67_19190_c1 | |||
| 2036 | nmdc:mga06r32_117299_c1 | |||
| 2037 | nmdc:mga06r32_1551457_c1 | |||
| 2038 | nmdc:mga06r32_1769883_c1 | |||
| 2039 | nmdc:mga06r32_184470_c1 | |||
| 2040 | nmdc:mga06r32_276709_c1 | |||
| 2041 | nmdc:mga06r32_440806_c1 | |||
| 2042 | nmdc:mga06r32_5140_c1 | |||
| 2043 | nmdc:mga06r32_607589_c1 | |||
| 2044 | nmdc:mga06r32_6471_c1 | |||
| 2045 | nmdc:mga06r32_82885_c1 | |||
| 2046 | nmdc:mga06r32_944080_c1 | |||
| 2047 | nmdc:mga06r32_99745_c1 | |||
| 2048 | nmdc:mga08y16_109_c1 | |||
| 2049 | nmdc:mga08y16_1204598_c1 | |||
| 2050 | nmdc:mga08y16_126466_c1 | |||
| 2051 | nmdc:mga08y16_1708986_c1 | |||
| 2052 | nmdc:mga08y16_18150_c1 | |||
| 2053 | nmdc:mga08y16_1979_c1 | |||
| 2054 | nmdc:mga08y16_50254_c1 | |||
| 2055 | nmdc:mga08y16_602904_c1 | |||
| 2056 | nmdc:mga08y16_7084_c1 | |||
| 2057 | nmdc:mga08y16_752123_c1 | |||
| 2058 | nmdc:mga08y16_772984_c1 | |||
| 2059 | nmdc:mga0n895_317294_c1 | |||
| 2060 | nmdc:mga0n895_51280_c1 | |||
| 2061 | nmdc:mga0n895_5622_c1 | |||
| 2062 | nmdc:mga0n895_56716_c1 | |||
| 2063 | nmdc:mga0n895_6025_c1 | |||
| 2064 | nmdc:mga0rr50_1323749_c1 | |||
| 2065 | nmdc:mga0rr50_331611_c1 | |||
| 2066 | nmdc:mga0rr50_339614_c1 | |||
| 2067 | nmdc:mga0rr50_454023_c1 | |||
| 2068 | nmdc:mga0rr50_515204_c1 | |||
| 2069 | nmdc:mga0rr50_941081_c1 | |||
| 2070 | nmdc:mga08x19_38168_c1 | |||
| 2071 | nmdc:mga08x19_630985_c1 | |||
| 2072 | nmdc:mga08x19_78067_c1 | |||
| 2073 | nmdc:mga0a205_184_c1 | |||
| 2074 | nmdc:mga0a205_283_c1 | |||
| 2075 | nmdc:mga0a205_68566_c1 | |||
| 2076 | nmdc:mga0a205_8778_c1 | |||
| 2077 | nmdc:mga0a205_947284_c1 | |||
| 2078 | Ga0495612_0486739 | |||
| 2079 | Ga0500578_0440115 | |||
| 2080 | Ga0500641_0306089 | |||
| 2081 | Ga0500595_151321 | |||
| 2082 | Ga0501084_0074269 | |||
| 2083 | Ga0501084_0659159 | |||
| 2084 | Ga0500661_000332 | |||
| 2085 | Ga0501082_0009121 | |||
| 2086 | Ga0501082_0011610 | |||
| 2087 | Ga0501082_0026613 | |||
| 2088 | Ga0501082_0089124 | |||
| 2089 | Ga0501082_0268364 | |||
| 2090 | Ga0501082_0934722 | |||
| 2091 | Ga0501082_1515010 | |||
| 2092 | Ga0466962_0444151 | |||
| 2093 | Ga0530510_0005997 | |||
| 2094 | Ga0530510_0036019 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.944 | 10 | 105 |
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9415 | 11 | 106 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9396 | 10 | 105 |
| 6abq-assembly1.cif.gz_A | crystal structure of transcription factor from listeria monocytogenes | 0.9367 | 10 | 106 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.914 | 10 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9396 | 10 | 105 | 1.10.10.10 |
| af_Q2FUS4_1_110_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9286 | 10 | 106 | 1.10.10.10 |
| 3l7wA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8985 | 6 | 109 | 1.10.10.10 |
| af_Q57682_5_95_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8947 | 13 | 83 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8888 | 13 | 93 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C7SNV7-F1-model_v4 | PadR family transcriptional regulator | 0.9946 | 10 | 108 |
|
| AF-A0A6L4ZKY0-F1-model_v4 | Transcriptional regulator PadR-family | 0.9945 | 1 | 107 |
|
| AF-A0A7V8VPK0-F1-model_v4 | PadR family transcriptional regulator | 0.9935 | 10 | 107 |
|
| AF-A0A2V8EA09-F1-model_v4 | PadR family transcriptional regulator | 0.9932 | 10 | 88 |
|
| AF-A0A3N5LHC2-F1-model_v4 | PadR family transcriptional regulator | 0.9931 | 12 | 107 |
|