F488970

General Info

Members Datasets Scaffolds Average Seq Length
1046 391 1035 240

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0116546|Ga0496104_0116546_331_1176
Length 281
Sequence MTGVLEMRAVSKTYLDGADEVHALRDVDLTVEPGKMVAVMGPSGSGKSTLLTIAGALETPTAGDVLIAGHSLAAMSRDDRARLRRRAIGYVFQDFNLLPGLTAAENVALPLELDGLSAGKARAAGLRALDELGLADRAARFPDQLSGGERQRVAIARAVVGDRRLVLADEPTGALDTDTGEAVMRLILTACKAGVGAVVVTHDAQLASWADRVVFIRDGRVVDRTAPRPGPDSLLAGEAARCVSRCRIHRWRSAPDTAGCRRGSPSRAGPGGYSGASGGSN

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2517572101 Frankia sp. DC12 Isolate Nodule
3 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
4 2619618881 Frankia sp. ACN1ag Isolate Unclassified
5 2619619003 Frankia sp. CpI1-P Isolate Nodule
6 2643221604 Nocardioides sp. Root190 Isolate Unclassified
7 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
8 2687453737 Frankia sp. BMG5.36 Isolate Nodule
9 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
10 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
111 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
200 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
201 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
202 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
203 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
204 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
205 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
206 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
216 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
219 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
220 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
221 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
222 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
225 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
226 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
227 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
228 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
229 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
230 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
242 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
243 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
244 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
245 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
248 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
249 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
250 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
258 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
259 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
263 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
264 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
265 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
270 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
275 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
276 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
277 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
278 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
279 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
282 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
286 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
289 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
290 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
291 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
292 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
293 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
300 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
306 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
307 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
308 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
309 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
310 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
311 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
312 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
313 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
314 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
315 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
320 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
321 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
322 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
323 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
324 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
325 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
326 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
327 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
328 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
329 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
330 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
331 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
332 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
333 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
334 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
335 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
336 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
339 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
340 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
341 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
357 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
358 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
359 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
360 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
363 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
364 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
365 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
366 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
367 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
370 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
371 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
372 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
373 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
374 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
375 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
376 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
377 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
382 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
383 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
384 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
385 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
386 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
387 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
388 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
391 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 0.96
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.24
Nodule 0.67
Rhizoplane 2.96
Rhizosphere 91.78
Stem 0
Stem Tuber 0
Unclassified 3.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1006588 3300002076 Bacteria 1617
2 rootH2_10176451 3300003320 Bacteria 3605
3 JGI25407J50210_10000245 3300003373 Bacteria 9544
4 JGI25407J50210_10020236 3300003373 Bacteria 1731
5 Ga0070658_10005200 3300005327 Bacteria 10588
6 Ga0070658_10050435 3300005327 Bacteria 3374
7 Ga0070676_10142107 3300005328 Bacteria 1529
8 Ga0070683_100001043 3300005329 Bacteria 20818
9 Ga0070683_100002200 3300005329 Bacteria 15436
10 Ga0070683_100035577 3300005329 Bacteria 4552
11 Ga0070683_100051708 3300005329 Bacteria 3804
12 Ga0070683_100081477 3300005329 Bacteria 3030
13 Ga0070683_100126188 3300005329 Bacteria 2419
14 Ga0070683_100222354 3300005329 Bacteria 1794
15 Ga0070683_100463212 3300005329 Bacteria 1210
16 Ga0070683_100690999 3300005329 Bacteria 977
17 Ga0070670_100057963 3300005331 Bacteria 3324
18 Ga0070670_100077924 3300005331 Bacteria 2847
19 Ga0070670_100464998 3300005331 Bacteria 1122
20 Ga0068869_100002294 3300005334 Bacteria 11509
21 Ga0068869_100093717 3300005334 Bacteria 2263
22 Ga0068869_100182309 3300005334 Bacteria 1647
23 Ga0070666_10057061 3300005335 Bacteria 2638
24 Ga0070680_100084670 3300005336 Bacteria 2619
25 Ga0070680_100275660 3300005336 Bacteria 1424
26 Ga0070682_100037652 3300005337 Bacteria 2963
27 Ga0070682_100182060 3300005337 Bacteria 1469
28 Ga0068868_100004349 3300005338 Bacteria 9933
29 Ga0070660_100077757 3300005339 Bacteria 2601
30 Ga0070660_100244985 3300005339 Bacteria 1460
31 Ga0070689_100190115 3300005340 Bacteria 1672
32 Ga0070691_10092880 3300005341 Bacteria 1490
33 Ga0070661_100007295 3300005344 Bacteria 7626
34 Ga0070661_100012215 3300005344 Bacteria 6005
35 Ga0070661_100082474 3300005344 Bacteria 2375
36 Ga0070661_100528106 3300005344 Bacteria 947
37 Ga0070692_10058082 3300005345 Bacteria 2031
38 Ga0070668_100053649 3300005347 Bacteria 3109
39 Ga0070668_100402865 3300005347 Bacteria 1168
40 Ga0070675_100009075 3300005354 Bacteria 7724
41 Ga0070675_100084216 3300005354 Bacteria 2655
42 Ga0070675_100542894 3300005354 Bacteria 1051
43 Ga0070671_100005711 3300005355 Bacteria 9913
44 Ga0070674_100135371 3300005356 Bacteria 1842
45 Ga0070674_100154153 3300005356 Bacteria 1737
46 Ga0070674_100236079 3300005356 Bacteria 1429
47 Ga0070673_100031282 3300005364 Bacteria 3992
48 Ga0070673_100191314 3300005364 Bacteria 1758
49 Ga0070673_100221662 3300005364 Bacteria 1637
50 Ga0070659_100070598 3300005366 Bacteria 2775
51 Ga0070659_100079788 3300005366 Bacteria 2612
52 Ga0070667_100366100 3300005367 Bacteria 1307
53 Ga0070667_100420322 3300005367 Bacteria 1218
54 Ga0070709_10000377 3300005434 Bacteria 27511
55 Ga0070709_10008315 3300005434 Bacteria 5697
56 Ga0070709_10019524 3300005434 Bacteria 3920
57 Ga0070709_10161910 3300005434 Bacteria 1557
58 Ga0070709_10169751 3300005434 Bacteria 1523
59 Ga0070709_10218351 3300005434 Bacteria 1358
60 Ga0070714_100001403 3300005435 Bacteria 17466
61 Ga0070714_100040608 3300005435 Bacteria 3921
62 Ga0070714_100057222 3300005435 Bacteria 3336
63 Ga0070714_100058509 3300005435 Bacteria 3302
64 Ga0070714_100104044 3300005435 Bacteria 2505
65 Ga0070714_100114912 3300005435 Bacteria 2388
66 Ga0070714_100159369 3300005435 Bacteria 2040
67 Ga0070714_100192371 3300005435 Bacteria 1862
68 Ga0070714_100270072 3300005435 Bacteria 1577
69 Ga0070714_100273041 3300005435 Bacteria 1568
70 Ga0070714_100383567 3300005435 Bacteria 1325
71 Ga0070713_100007612 3300005436 Bacteria 7620
72 Ga0070713_100044011 3300005436 Bacteria 3652
73 Ga0070713_100054601 3300005436 Bacteria 3315
74 Ga0070713_100130636 3300005436 Bacteria 2214
75 Ga0070713_100192960 3300005436 Bacteria 1836
76 Ga0070713_100200460 3300005436 Bacteria 1802
77 Ga0070713_100209417 3300005436 Bacteria 1764
78 Ga0070713_100217711 3300005436 Bacteria 1731
79 Ga0070713_100272080 3300005436 Bacteria 1551
80 Ga0070713_100297780 3300005436 Bacteria 1484
81 Ga0070713_100323588 3300005436 Bacteria 1424
82 Ga0070710_10000960 3300005437 Bacteria 13669
83 Ga0070710_10009633 3300005437 Bacteria 4730
84 Ga0070710_10024616 3300005437 Bacteria 3178
85 Ga0070710_10044370 3300005437 Bacteria 2466
86 Ga0070710_10054984 3300005437 Bacteria 2247
87 Ga0070701_10018169 3300005438 Bacteria 3301
88 Ga0070701_10039250 3300005438 Bacteria 2401
89 Ga0070711_100022050 3300005439 Bacteria 4124
90 Ga0070711_100025523 3300005439 Bacteria 3867
91 Ga0070711_100034450 3300005439 Bacteria 3377
92 Ga0070711_100096145 3300005439 Bacteria 2145
93 Ga0070711_100102343 3300005439 Bacteria 2086
94 Ga0070711_100141980 3300005439 Bacteria 1802
95 Ga0070705_100028799 3300005440 Bacteria 3046
96 Ga0070700_100009766 3300005441 Bacteria 5276
97 Ga0070700_100082525 3300005441 Bacteria 2079
98 Ga0070700_100105175 3300005441 Bacteria 1866
99 Ga0070694_100070536 3300005444 Bacteria 2406
100 Ga0070708_100053014 3300005445 Bacteria 3598
101 Ga0070708_100132755 3300005445 Bacteria 2305
102 Ga0070663_100019012 3300005455 Bacteria 4518
103 Ga0070678_100057307 3300005456 Bacteria 2854
104 Ga0070678_100368515 3300005456 Bacteria 1240
105 Ga0070678_100446528 3300005456 Bacteria 1132
106 Ga0070662_100079467 3300005457 Bacteria 2439
107 Ga0070662_100467645 3300005457 Bacteria 1049
108 Ga0070681_10110721 3300005458 Bacteria 2685
109 Ga0070681_10116504 3300005458 Bacteria 2608
110 Ga0070681_10142579 3300005458 Bacteria 2325
111 Ga0068867_100088736 3300005459 Bacteria 2344
112 Ga0068867_100199803 3300005459 Bacteria 1600
113 Ga0070685_10010560 3300005466 Bacteria 4802
114 Ga0070685_10011144 3300005466 Bacteria 4699
115 Ga0070706_100001268 3300005467 Bacteria 26964
116 Ga0070706_100046766 3300005467 Bacteria 3994
117 Ga0070706_100077044 3300005467 Bacteria 3086
118 Ga0070706_100196192 3300005467 Bacteria 1886
119 Ga0070706_100200175 3300005467 Bacteria 1866
120 Ga0070706_100490959 3300005467 Bacteria 1142
121 Ga0070707_100004358 3300005468 Bacteria 13265
122 Ga0070707_100030808 3300005468 Bacteria 5109
123 Ga0070707_100056451 3300005468 Bacteria 3766
124 Ga0070707_100252220 3300005468 Bacteria 1717
125 Ga0070707_100716432 3300005468 Bacteria 963
126 Ga0070698_100010296 3300005471 Bacteria 9983
127 Ga0070698_100031059 3300005471 Bacteria 5539
128 Ga0070698_100038664 3300005471 Bacteria 4916
129 Ga0070698_100054421 3300005471 Bacteria 4062
130 Ga0070698_100071852 3300005471 Bacteria 3469
131 Ga0070699_100000213 3300005518 Bacteria 57419
132 Ga0070699_100001774 3300005518 Bacteria 19648
133 Ga0070699_100079743 3300005518 Bacteria 2852
134 Ga0070699_100609628 3300005518 Bacteria 996
135 Ga0070679_100052992 3300005530 Bacteria 4038
136 Ga0070679_100089352 3300005530 Bacteria 3068
137 Ga0070679_100093281 3300005530 Bacteria 2998
138 Ga0070679_100167176 3300005530 Bacteria 2172
139 Ga0070684_100003000 3300005535 Bacteria 12566
140 Ga0070684_100016381 3300005535 Bacteria 6057
141 Ga0070684_100049353 3300005535 Bacteria 3652
142 Ga0070684_100078319 3300005535 Bacteria 2920
143 Ga0070684_100083131 3300005535 Bacteria 2836
144 Ga0070684_100127799 3300005535 Bacteria 2291
145 Ga0070684_100181385 3300005535 Bacteria 1914
146 Ga0070684_100678884 3300005535 Bacteria 960
147 Ga0070697_100003375 3300005536 Bacteria 12283
148 Ga0070697_100099589 3300005536 Bacteria 2413
149 Ga0068853_100203242 3300005539 Bacteria 1803
150 Ga0070672_100057779 3300005543 Bacteria 3047
151 Ga0070672_100252363 3300005543 Bacteria 1486
152 Ga0070695_100045435 3300005545 Bacteria 2799
153 Ga0070696_100053585 3300005546 Bacteria 2808
154 Ga0070665_100549680 3300005548 Bacteria 1167
155 Ga0070704_100164797 3300005549 Bacteria 1756
156 Ga0068855_100045099 3300005563 Bacteria 5215
157 Ga0068855_100107528 3300005563 Bacteria 3204
158 Ga0068855_100143516 3300005563 Bacteria 2719
159 Ga0070664_100000709 3300005564 Bacteria 25499
160 Ga0070664_100044700 3300005564 Bacteria 3739
161 Ga0070664_100065752 3300005564 Bacteria 3095
162 Ga0070664_100347134 3300005564 Bacteria 1349
163 Ga0068857_100070859 3300005577 Bacteria 3105
164 Ga0068854_100027007 3300005578 Bacteria 3951
165 Ga0068856_100721979 3300005614 Bacteria 1017
166 Ga0068852_100009879 3300005616 Bacteria 7101
167 Ga0068852_100323149 3300005616 Bacteria 1499
168 Ga0068852_100539514 3300005616 Bacteria 1166
169 Ga0068859_100089640 3300005617 Bacteria 3126
170 Ga0068864_100091147 3300005618 Bacteria 2688
171 Ga0068866_10122035 3300005718 Bacteria 1469
172 Ga0068866_10197441 3300005718 Bacteria 1200
173 Ga0068861_100058068 3300005719 Bacteria 2958
174 Ga0068861_100205677 3300005719 Bacteria 1655
175 Ga0068861_100248628 3300005719 Bacteria 1516
176 Ga0068861_100301036 3300005719 Bacteria 1389
177 Ga0068861_100576841 3300005719 Bacteria 1029
178 Ga0068870_10046740 3300005840 Bacteria 2272
179 Ga0068863_100007563 3300005841 Bacteria 10626
180 Ga0068858_100000141 3300005842 Bacteria 76388
181 Ga0068858_100108445 3300005842 Bacteria 2592
182 Ga0068858_100116606 3300005842 Bacteria 2495
183 Ga0068860_100106372 3300005843 Bacteria 2679
184 Ga0068862_100000004 3300005844 Bacteria 365124
185 Ga0068862_100015926 3300005844 Bacteria 6250
186 Ga0068862_100372978 3300005844 Bacteria 1329
187 Ga0081455_10001616 3300005937 Bacteria 27541
188 Ga0081455_10002768 3300005937 Bacteria 20669
189 Ga0081455_10016246 3300005937 Bacteria 7193
190 Ga0081455_10027643 3300005937 Bacteria 5197
191 Ga0081455_10070163 3300005937 Bacteria 2911
192 Ga0081455_10096067 3300005937 Bacteria 2390
193 Ga0081455_10137893 3300005937 Bacteria 1898
194 Ga0081538_10000258 3300005981 Bacteria 60142
195 Ga0081538_10000506 3300005981 Bacteria 43569
196 Ga0081538_10001127 3300005981 Bacteria 28300
197 Ga0081538_10004909 3300005981 Bacteria 12185
198 Ga0081538_10011657 3300005981 Bacteria 7107
199 Ga0081538_10013643 3300005981 Bacteria 6426
200 Ga0081538_10017309 3300005981 Bacteria 5476
201 Ga0081538_10022452 3300005981 Bacteria 4571
202 Ga0081538_10030481 3300005981 Bacteria 3661
203 Ga0081538_10182342 3300005981 Bacteria 896
204 Ga0081540_1000356 3300005983 Bacteria 46150
205 Ga0081540_1001036 3300005983 Bacteria 24897
206 Ga0081540_1003879 3300005983 Bacteria 11663
207 Ga0081540_1047547 3300005983 Bacteria 2156
208 Ga0081540_1047614 3300005983 Bacteria 2154
209 Ga0081539_10002139 3300005985 Bacteria 29179
210 Ga0081539_10011478 3300005985 Bacteria 6995
211 Ga0081539_10015588 3300005985 Bacteria 5512
212 Ga0081539_10022338 3300005985 Bacteria 4191
213 Ga0070717_10010846 3300006028 Bacteria 6896
214 Ga0070717_10013112 3300006028 Bacteria 6335
215 Ga0070717_10017077 3300006028 Bacteria 5637
216 Ga0070717_10031359 3300006028 Bacteria 4276
217 Ga0070717_10042424 3300006028 Bacteria 3710
218 Ga0070717_10045250 3300006028 Bacteria 3598
219 Ga0070717_10082041 3300006028 Bacteria 2708
220 Ga0070717_10145174 3300006028 Bacteria 2049
221 Ga0070717_10177527 3300006028 Bacteria 1855
222 Ga0070717_10224397 3300006028 Bacteria 1652
223 Ga0070717_10322108 3300006028 Bacteria 1377
224 Ga0075365_10051109 3300006038 Bacteria 2728
225 Ga0075364_10047373 3300006051 Bacteria 2800
226 Ga0075364_10229186 3300006051 Bacteria 1262
227 Ga0075432_10039653 3300006058 Bacteria 1643
228 Ga0070715_10059557 3300006163 Bacteria 1671
229 Ga0070715_10091588 3300006163 Bacteria 1400
230 Ga0070715_10099582 3300006163 Bacteria 1353
231 Ga0070716_100000082 3300006173 Bacteria 37745
232 Ga0070716_100009847 3300006173 Bacteria 4777
233 Ga0070716_100216927 3300006173 Bacteria 1283
234 Ga0070712_100004947 3300006175 Bacteria 8241
235 Ga0070712_100030262 3300006175 Bacteria 3636
236 Ga0070712_100038520 3300006175 Bacteria 3267
237 Ga0070712_100049629 3300006175 Bacteria 2915
238 Ga0070712_100060383 3300006175 Bacteria 2674
239 Ga0070712_100148320 3300006175 Bacteria 1798
240 Ga0070712_100209192 3300006175 Bacteria 1537
241 Ga0075367_10087053 3300006178 Bacteria 1897
242 Ga0075367_10274723 3300006178 Bacteria 1059
243 Ga0075370_10014533 3300006353 Bacteria 4202
244 Ga0068871_100108858 3300006358 Bacteria 2329
245 Ga0068871_100112352 3300006358 Bacteria 2293
246 Ga0075428_100180406 3300006844 Bacteria 2286
247 Ga0075428_100393168 3300006844 Bacteria 1486
248 Ga0075430_100001691 3300006846 Bacteria 18031
249 Ga0075430_100007329 3300006846 Bacteria 9317
250 Ga0075431_100172451 3300006847 Bacteria 2222
251 Ga0075431_100236671 3300006847 Bacteria 1859
252 Ga0075431_100544165 3300006847 Bacteria 1149
253 Ga0075433_10043000 3300006852 Bacteria 3921
254 Ga0075433_10048975 3300006852 Bacteria 3675
255 Ga0075434_100031601 3300006871 Bacteria 5220
256 Ga0075434_100090563 3300006871 Bacteria 3060
257 Ga0075434_100219036 3300006871 Bacteria 1923
258 Ga0075434_100439088 3300006871 Bacteria 1326
259 Ga0075429_100139334 3300006880 Bacteria 2123
260 Ga0075429_100149226 3300006880 Bacteria 2047
261 Ga0068865_100040620 3300006881 Bacteria 3163
262 Ga0068865_100111232 3300006881 Bacteria 2021
263 Ga0068865_100492920 3300006881 Bacteria 1020
264 Ga0075436_100125385 3300006914 Bacteria 1799
265 Ga0097620_100089640 3300006931 Bacteria 3126
266 Ga0075435_100024919 3300007076 Bacteria 4650
267 Ga0075435_100046476 3300007076 Bacteria 3482
268 Ga0075435_100295112 3300007076 Bacteria 1386
269 Ga0105251_10016785 3300009011 Bacteria 3943
270 Ga0105251_10133634 3300009011 Bacteria 1124
271 Ga0105240_10019152 3300009093 Bacteria 9151
272 Ga0105240_11098461 3300009093 Bacteria 846
273 Ga0111539_10001616 3300009094 Bacteria 30103
274 Ga0111539_10025348 3300009094 Bacteria 7269
275 Ga0111539_10090372 3300009094 Bacteria 3598
276 Ga0111539_10790100 3300009094 Bacteria 1105
277 Ga0105245_10002942 3300009098 Bacteria 15290
278 Ga0105245_10024872 3300009098 Bacteria 5263
279 Ga0105245_10104769 3300009098 Bacteria 2623
280 Ga0105247_10001021 3300009101 Bacteria 21079
281 Ga0105247_10001810 3300009101 Bacteria 14995
282 Ga0105247_10101128 3300009101 Bacteria 1843
283 Ga0114129_10032040 3300009147 Bacteria 7430
284 Ga0114129_10073744 3300009147 Bacteria 4755
285 Ga0114129_10150784 3300009147 Bacteria 3182
286 Ga0114129_10236923 3300009147 Bacteria 2455
287 Ga0114129_10281565 3300009147 Bacteria 2221
288 Ga0114129_11160773 3300009147 Bacteria 964
289 Ga0105243_10045283 3300009148 Bacteria 3456
290 Ga0105243_10076310 3300009148 Bacteria 2723
291 Ga0105243_10085493 3300009148 Bacteria 2586
292 Ga0105243_10297540 3300009148 Bacteria 1461
293 Ga0105241_10395020 3300009174 Bacteria 1212
294 Ga0105242_10115680 3300009176 Bacteria 2293
295 Ga0105242_10165076 3300009176 Bacteria 1942
296 Ga0105242_10510574 3300009176 Bacteria 1145
297 Ga0105242_10786904 3300009176 Bacteria 940
298 Ga0105248_10089093 3300009177 Bacteria 3473
299 Ga0105248_10137082 3300009177 Bacteria 2761
300 Ga0105248_10312941 3300009177 Bacteria 1768
301 Ga0105248_10610682 3300009177 Bacteria 1230
302 Ga0105237_10032375 3300009545 Bacteria 5294
303 Ga0105238_10108612 3300009551 Bacteria 2755
304 Ga0105238_10721806 3300009551 Bacteria 1009
305 Ga0105238_10772992 3300009551 Bacteria 975
306 Ga0105249_10316215 3300009553 Bacteria 1571
307 Ga0105249_10376849 3300009553 Bacteria 1444
308 Ga0105249_10705820 3300009553 Bacteria 1069
309 Ga0099796_10024654 3300010159 Bacteria 1890
310 Ga0105239_10056981 3300010375 Bacteria 4286
311 Ga0105239_10094558 3300010375 Bacteria 3301
312 Ga0105239_10684727 3300010375 Bacteria 1172
313 Ga0105239_10804189 3300010375 Bacteria 1077
314 Ga0105246_10031222 3300011119 Bacteria 3524
315 Ga0105246_10469086 3300011119 Bacteria 1062
316 Ga0157373_10068066 3300013100 Bacteria 2517
317 Ga0157369_10015933 3300013105 Bacteria 8460
318 Ga0157369_10089018 3300013105 Bacteria 3296
319 Ga0157378_10085791 3300013297 Bacteria 2853
320 Ga0157378_10338367 3300013297 Bacteria 1467
321 Ga0157375_10037718 3300013308 Bacteria 4633
322 Ga0157375_10463115 3300013308 Bacteria 1433
323 Ga0157375_10537222 3300013308 Bacteria 1332
324 Ga0163163_10004683 3300014325 Bacteria 11708
325 Ga0163163_10009790 3300014325 Bacteria 8587
326 Ga0163163_10026392 3300014325 Bacteria 5552
327 Ga0163163_10093464 3300014325 Bacteria 3024
328 Ga0163163_10105533 3300014325 Bacteria 2843
329 Ga0163163_10291902 3300014325 Bacteria 1683
330 Ga0157380_10282069 3300014326 Bacteria 1521
331 Ga0182008_10148930 3300014497 Bacteria 1173
332 Ga0182008_10173991 3300014497 Bacteria 1088
333 Ga0157377_10028182 3300014745 Bacteria 3021
334 Ga0157379_10005115 3300014968 Bacteria 11247
335 Ga0157379_10035817 3300014968 Bacteria 4425
336 Ga0163161_10384634 3300017792 Bacteria 1122
337 Ga0163161_10732795 3300017792 Bacteria 825
338 Ga0197907_10517940 3300020069 Bacteria 3242
339 Ga0206356_11280802 3300020070 Bacteria 2869
340 Ga0206349_1062031 3300020075 Bacteria 2663
341 Ga0206351_10211465 3300020077 Bacteria 2199
342 Ga0206350_10944510 3300020080 Bacteria 3518
343 Ga0206353_10705757 3300020082 Bacteria 1617
344 Ga0206353_11280236 3300020082 Bacteria 975
345 Ga0213875_10004191 3300021388 Bacteria 7975
346 Ga0213875_10008337 3300021388 Bacteria 5314
347 Ga0213875_10026180 3300021388 Bacteria 2776
348 Ga0224712_10001526 3300022467 Bacteria 5376
349 Ga0224712_10021779 3300022467 Bacteria 2199
350 Ga0224572_1007130 3300024225 Bacteria 2039
351 Ga0224572_1012941 3300024225 Bacteria 1590
352 Ga0207692_10000682 3300025898 Bacteria 11994
353 Ga0207692_10003168 3300025898 Bacteria 6384
354 Ga0207692_10033109 3300025898 Bacteria 2490
355 Ga0207692_10041370 3300025898 Bacteria 2281
356 Ga0207692_10068382 3300025898 Bacteria 1862
357 Ga0207642_10032509 3300025899 Bacteria 2198
358 Ga0207710_10000092 3300025900 Bacteria 121199
359 Ga0207710_10000813 3300025900 Bacteria 16912
360 Ga0207688_10008728 3300025901 Bacteria 5514
361 Ga0207688_10012315 3300025901 Bacteria 4655
362 Ga0207647_10169420 3300025904 Bacteria 1272
363 Ga0207685_10012497 3300025905 Bacteria 2593
364 Ga0207685_10023159 3300025905 Bacteria 2110
365 Ga0207685_10074177 3300025905 Bacteria 1388
366 Ga0207685_10079620 3300025905 Bacteria 1352
367 Ga0207699_10001559 3300025906 Bacteria 10861
368 Ga0207699_10422676 3300025906 Bacteria 952
369 Ga0207645_10132391 3300025907 Bacteria 1623
370 Ga0207645_10145447 3300025907 Bacteria 1545
371 Ga0207643_10044881 3300025908 Bacteria 2495
372 Ga0207643_10055822 3300025908 Bacteria 2246
373 Ga0207705_10047595 3300025909 Bacteria 3084
374 Ga0207684_10000654 3300025910 Bacteria 40954
375 Ga0207684_10036597 3300025910 Bacteria 4166
376 Ga0207684_10259450 3300025910 Bacteria 1499
377 Ga0207684_10384661 3300025910 Bacteria 1207
378 Ga0207707_10060284 3300025912 Bacteria 3301
379 Ga0207707_10101432 3300025912 Bacteria 2515
380 Ga0207671_10031440 3300025914 Bacteria 3956
381 Ga0207693_10014890 3300025915 Bacteria 6247
382 Ga0207693_10026412 3300025915 Bacteria 4596
383 Ga0207693_10036715 3300025915 Bacteria 3863
384 Ga0207693_10083098 3300025915 Bacteria 2508
385 Ga0207693_10083216 3300025915 Bacteria 2506
386 Ga0207663_10050524 3300025916 Bacteria 2584
387 Ga0207663_10052237 3300025916 Bacteria 2548
388 Ga0207663_10108674 3300025916 Bacteria 1878
389 Ga0207663_10328496 3300025916 Bacteria 1151
390 Ga0207660_10131688 3300025917 Bacteria 1904
391 Ga0207662_10020450 3300025918 Bacteria 3777
392 Ga0207662_10073979 3300025918 Bacteria 2068
393 Ga0207657_10028616 3300025919 Bacteria 5080
394 Ga0207657_10093624 3300025919 Bacteria 2502
395 Ga0207649_10071903 3300025920 Bacteria 2211
396 Ga0207649_10074921 3300025920 Bacteria 2173
397 Ga0207649_10202082 3300025920 Bacteria 1404
398 Ga0207652_10013580 3300025921 Bacteria 6586
399 Ga0207652_10058565 3300025921 Bacteria 3319
400 Ga0207652_10244407 3300025921 Bacteria 1618
401 Ga0207646_10013433 3300025922 Bacteria 7832
402 Ga0207646_10051775 3300025922 Bacteria 3673
403 Ga0207646_10076459 3300025922 Bacteria 2992
404 Ga0207646_10103806 3300025922 Bacteria 2549
405 Ga0207681_10266403 3300025923 Bacteria 1343
406 Ga0207650_10039344 3300025925 Bacteria 3456
407 Ga0207650_10145297 3300025925 Bacteria 1867
408 Ga0207659_10004425 3300025926 Bacteria 8495
409 Ga0207659_10184386 3300025926 Bacteria 1656
410 Ga0207659_10247677 3300025926 Bacteria 1444
411 Ga0207659_10279483 3300025926 Bacteria 1364
412 Ga0207687_10163193 3300025927 Bacteria 1712
413 Ga0207700_10000879 3300025928 Bacteria 17301
414 Ga0207700_10005311 3300025928 Bacteria 7686
415 Ga0207700_10006552 3300025928 Bacteria 7044
416 Ga0207700_10009432 3300025928 Bacteria 6096
417 Ga0207700_10012259 3300025928 Bacteria 5519
418 Ga0207700_10013326 3300025928 Bacteria 5344
419 Ga0207700_10025128 3300025928 Bacteria 4132
420 Ga0207700_10027814 3300025928 Bacteria 3966
421 Ga0207700_10028916 3300025928 Bacteria 3906
422 Ga0207700_10039159 3300025928 Bacteria 3447
423 Ga0207700_10107439 3300025928 Bacteria 2239
424 Ga0207700_10176240 3300025928 Bacteria 1787
425 Ga0207700_10192514 3300025928 Bacteria 1714
426 Ga0207664_10000515 3300025929 Bacteria 27496
427 Ga0207664_10008588 3300025929 Bacteria 7138
428 Ga0207664_10009335 3300025929 Bacteria 6878
429 Ga0207664_10014115 3300025929 Bacteria 5760
430 Ga0207664_10017462 3300025929 Bacteria 5262
431 Ga0207664_10020134 3300025929 Bacteria 4940
432 Ga0207664_10026482 3300025929 Bacteria 4384
433 Ga0207664_10044574 3300025929 Bacteria 3474
434 Ga0207664_10046601 3300025929 Bacteria 3403
435 Ga0207664_10056124 3300025929 Bacteria 3127
436 Ga0207664_10071442 3300025929 Bacteria 2796
437 Ga0207664_10093066 3300025929 Bacteria 2475
438 Ga0207664_10114611 3300025929 Bacteria 2246
439 Ga0207664_10142995 3300025929 Bacteria 2026
440 Ga0207664_10160133 3300025929 Bacteria 1919
441 Ga0207664_10190259 3300025929 Bacteria 1766
442 Ga0207664_10197286 3300025929 Bacteria 1736
443 Ga0207664_10231130 3300025929 Bacteria 1607
444 Ga0207664_10315930 3300025929 Bacteria 1377
445 Ga0207706_10004178 3300025933 Bacteria 13594
446 Ga0207706_10040701 3300025933 Bacteria 4119
447 Ga0207686_10647108 3300025934 Bacteria 836
448 Ga0207670_10034163 3300025936 Bacteria 3283
449 Ga0207670_10250084 3300025936 Bacteria 1369
450 Ga0207669_10023945 3300025937 Bacteria 3272
451 Ga0207669_10317924 3300025937 Bacteria 1190
452 Ga0207669_10435211 3300025937 Bacteria 1036
453 Ga0207704_10038018 3300025938 Bacteria 2786
454 Ga0207665_10000100 3300025939 Bacteria 55652
455 Ga0207665_10005314 3300025939 Bacteria 8606
456 Ga0207665_10007468 3300025939 Bacteria 7225
457 Ga0207665_10016388 3300025939 Bacteria 4865
458 Ga0207665_10036332 3300025939 Bacteria 3276
459 Ga0207665_10076898 3300025939 Bacteria 2290
460 Ga0207665_10197034 3300025939 Bacteria 1466
461 Ga0207691_10057293 3300025940 Bacteria 3546
462 Ga0207691_10299901 3300025940 Bacteria 1381
463 Ga0207711_10095886 3300025941 Bacteria 2617
464 Ga0207711_10430369 3300025941 Bacteria 1228
465 Ga0207689_10004008 3300025942 Bacteria 13397
466 Ga0207689_10097397 3300025942 Bacteria 2416
467 Ga0207689_10143209 3300025942 Bacteria 1969
468 Ga0207689_10211710 3300025942 Bacteria 1601
469 Ga0207661_10002147 3300025944 Bacteria 13578
470 Ga0207661_10006800 3300025944 Bacteria 8101
471 Ga0207661_10177633 3300025944 Bacteria 1857
472 Ga0207661_10195020 3300025944 Bacteria 1778
473 Ga0207661_10234414 3300025944 Bacteria 1627
474 Ga0207661_10273819 3300025944 Bacteria 1507
475 Ga0207679_10005780 3300025945 Bacteria 7765
476 Ga0207679_10088091 3300025945 Bacteria 2392
477 Ga0207679_10410141 3300025945 Bacteria 1193
478 Ga0207667_10077755 3300025949 Bacteria 3440
479 Ga0207651_10093960 3300025960 Bacteria 2204
480 Ga0207651_10181034 3300025960 Bacteria 1672
481 Ga0207712_10057681 3300025961 Bacteria 2740
482 Ga0207668_10108153 3300025972 Bacteria 2081
483 Ga0207640_10049938 3300025981 Bacteria 2711
484 Ga0207640_10090480 3300025981 Bacteria 2118
485 Ga0207658_10225842 3300025986 Bacteria 1578
486 Ga0207677_10005659 3300026023 Bacteria 6797
487 Ga0207677_10080927 3300026023 Bacteria 2329
488 Ga0207703_10000147 3300026035 Bacteria 82822
489 Ga0207703_10338804 3300026035 Bacteria 1381
490 Ga0207703_10375908 3300026035 Bacteria 1313
491 Ga0207639_10549487 3300026041 Bacteria 1060
492 Ga0207678_10254998 3300026067 Bacteria 1503
493 Ga0207708_10002233 3300026075 Bacteria 14285
494 Ga0207708_10057411 3300026075 Bacteria 2969
495 Ga0207708_10194941 3300026075 Bacteria 1614
496 Ga0207708_10211770 3300026075 Bacteria 1550
497 Ga0207702_10022462 3300026078 Bacteria 5230
498 Ga0207702_10053111 3300026078 Bacteria 3430
499 Ga0207641_10013621 3300026088 Bacteria 6670
500 Ga0207641_10562550 3300026088 Bacteria 1113
501 Ga0207648_10105956 3300026089 Bacteria 2466
502 Ga0207648_10185317 3300026089 Bacteria 1843
503 Ga0207676_10125068 3300026095 Bacteria 2176
504 Ga0207674_10014768 3300026116 Bacteria 8614
505 Ga0207674_10065524 3300026116 Bacteria 3661
506 Ga0207674_10080516 3300026116 Bacteria 3260
507 Ga0207675_100016647 3300026118 Bacteria 6865
508 Ga0207675_100096851 3300026118 Bacteria 2778
509 Ga0207675_100302972 3300026118 Bacteria 1557
510 Ga0207675_100682336 3300026118 Bacteria 1035
511 Ga0207675_100687062 3300026118 Bacteria 1032
512 Ga0207683_10055321 3300026121 Bacteria 3479
513 Ga0207683_10072865 3300026121 Bacteria 3038
514 Ga0207683_10166471 3300026121 Bacteria 1995
515 Ga0207698_10253989 3300026142 Bacteria 1611
516 Ga0207428_10011911 3300027907 Bacteria 7656
517 Ga0207428_10084816 3300027907 Bacteria 2468
518 Ga0207428_10249255 3300027907 Bacteria 1325
519 Ga0207428_10431996 3300027907 Bacteria 962
520 Ga0268266_10036260 3300028379 Bacteria 4197
521 Ga0268265_10000009 3300028380 Bacteria 375889
522 Ga0268265_10011087 3300028380 Bacteria 6091
523 Ga0268264_10239901 3300028381 Bacteria 1678
524 Ga0268264_10370255 3300028381 Bacteria 1369
525 Ga0265337_1007533 3300028556 Bacteria 4065
526 Ga0265334_10002841 3300028573 Bacteria 7971
527 Ga0265318_10009714 3300028577 Bacteria 4219
528 Ga0265323_10050599 3300028653 Bacteria 1476
529 Ga0265322_10014063 3300028654 Bacteria 2315
530 Ga0265336_10002351 3300028666 Bacteria 7861
531 Ga0265338_10000059 3300028800 Bacteria 198047
532 Ga0265324_10000821 3300029957 Bacteria 20206
533 Ga0265332_10056074 3300031238 Bacteria 1688
534 Ga0265320_10027075 3300031240 Bacteria 2993
535 Ga0265325_10026166 3300031241 Bacteria 3163
536 Ga0265340_10025478 3300031247 Bacteria 2994
537 Ga0265339_10094920 3300031249 Bacteria 1558
538 Ga0265316_10115796 3300031344 Bacteria 2026
539 Ga0307509_10018890 3300031507 Bacteria 7887
540 Ga0307509_10154829 3300031507 Bacteria 2200
541 Ga0307408_100058048 3300031548 Bacteria 2812
542 Ga0265313_10010238 3300031595 Bacteria 5966
543 Ga0307508_10000773 3300031616 Bacteria 37871
544 Ga0307508_10022967 3300031616 Bacteria 5668
545 Ga0265314_10029104 3300031711 Bacteria 4109
546 Ga0265342_10001214 3300031712 Bacteria 24392
547 Ga0307516_10090310 3300031730 Bacteria 2892
548 Ga0307516_10196739 3300031730 Bacteria 1738
549 Ga0307405_10323592 3300031731 Bacteria 1179
550 Ga0307405_10356484 3300031731 Bacteria 1130
551 Ga0307410_10111961 3300031852 Bacteria 1976
552 Ga0307410_10787588 3300031852 Bacteria 808
553 Ga0307406_10025635 3300031901 Bacteria 3531
554 Ga0307406_10144817 3300031901 Bacteria 1687
555 Ga0307409_100014296 3300031995 Bacteria 5155
556 Ga0307409_100048571 3300031995 Bacteria 3231
557 Ga0307409_100228455 3300031995 Bacteria 1685
558 Ga0307409_100862256 3300031995 Bacteria 917
559 Ga0307416_100027141 3300032002 Bacteria 4234
560 Ga0307416_100140536 3300032002 Bacteria 2194
561 Ga0307416_100220814 3300032002 Bacteria 1817
562 Ga0307416_100391909 3300032002 Bacteria 1423
563 Ga0307416_100559727 3300032002 Bacteria 1218
564 Ga0307416_100577483 3300032002 Bacteria 1201
565 Ga0307416_100819067 3300032002 Bacteria 1028
566 Ga0307414_10377354 3300032004 Bacteria 1225
567 Ga0307411_10085920 3300032005 Bacteria 2181
568 Ga0307415_100000782 3300032126 Bacteria 14413
569 Ga0307415_100035544 3300032126 Bacteria 3255
570 Ga0307415_100303898 3300032126 Bacteria 1323
571 Ga0307507_10041455 3300033179 Bacteria 4606
572 Ga0307510_10138705 3300033180 Bacteria 2082
573 Ga0373959_0004805 3300034820 Bacteria 2195
574 Ga0373934_0004661 3300035086 Bacteria 5067
575 Ga0373940_0004238 3300035088 Bacteria 3017
576 Ga0373944_0001641 3300035089 Bacteria 5656
577 Ga0373951_0074284 3300035091 Bacteria 871
578 Ga0373923_0000678 3300035111 Bacteria 8650
579 Ga0373936_0001646 3300035113 Bacteria 8191
580 Ga0373936_0005075 3300035113 Bacteria 4954
581 Ga0373936_0009359 3300035113 Bacteria 3692
582 Ga0373936_0015325 3300035113 Bacteria 2937
583 Ga0373936_0078316 3300035113 Bacteria 1372
584 Ga0373936_0196018 3300035113 Bacteria 890
585 Ga0373941_0017037 3300035115 Bacteria 1985
586 Ga0373945_0005082 3300035116 Bacteria 4195
587 Ga0373945_0005101 3300035116 Bacteria 4189
588 Ga0373945_0115615 3300035116 Bacteria 1062
589 Ga0373953_0005118 3300035117 Bacteria 4235
590 Ga0373954_0029978 3300035118 Bacteria 2508
591 Ga0373954_0033563 3300035118 Bacteria 2374
592 Ga0373954_0077204 3300035118 Bacteria 1588
593 Ga0373954_0090198 3300035118 Bacteria 1472
594 Ga0373956_0002110 3300035119 Bacteria 8236
595 Ga0373956_0013526 3300035119 Bacteria 3395
596 Ga0373956_0021836 3300035119 Bacteria 2732
597 Ga0373956_0106793 3300035119 Bacteria 1301
598 Ga0373957_0002124 3300035120 Bacteria 5575
599 Ga0373957_0003893 3300035120 Bacteria 4481
600 Ga0373960_0040736 3300035121 Bacteria 1342
601 Ga0373943_0009200 3300035170 Bacteria 4426
602 Ga0373946_0000512 3300035171 Bacteria 12860
603 Ga0373946_0036015 3300035171 Bacteria 2004
604 Ga0373955_0001398 3300035172 Bacteria 10270
605 Ga0373955_0005298 3300035172 Bacteria 5789
606 Ga0373955_0013567 3300035172 Bacteria 3944
607 Ga0373955_0030280 3300035172 Bacteria 2823
608 Ga0373955_0374907 3300035172 Bacteria 863
609 Ga0373942_0053647 3300035207 Bacteria 1137
610 Ga0373924_0002263 3300035410 Bacteria 6459
611 Ga0373924_0004734 3300035410 Bacteria 4776
612 Ga0373924_0005988 3300035410 Bacteria 4336
613 Ga0373931_0048120 3300035691 Bacteria 2259
614 Ga0373935_0078910 3300035692 Bacteria 2136
615 Ga0373935_0089915 3300035692 Bacteria 2008
616 Ga0373935_0114919 3300035692 Bacteria 1791
617 Ga0373935_0339616 3300035692 Bacteria 1069
618 Ga0373927_0003660 3300035695 Bacteria 10952
619 Ga0373927_0034598 3300035695 Bacteria 3286
620 Ga0373927_0038905 3300035695 Bacteria 3087
621 Ga0373927_0238893 3300035695 Bacteria 1194
622 Ga0373933_0007397 3300035724 Bacteria 5988
623 Ga0373933_0033398 3300035724 Bacteria 2993
624 Ga0373933_0066318 3300035724 Bacteria 2187
625 Ga0373933_0075580 3300035724 Bacteria 2056
626 Ga0373933_0082908 3300035724 Bacteria 1968
627 Ga0373933_0122955 3300035724 Bacteria 1626
628 Ga0373933_0124644 3300035724 Bacteria 1615
629 Ga0373933_0164469 3300035724 Bacteria 1410
630 Ga0373947_0003126 3300035725 Bacteria 9852
631 Ga0373947_0018422 3300035725 Bacteria 4018
632 Ga0373947_0040507 3300035725 Bacteria 2774
633 Ga0373937_0002125 3300036401 Bacteria 16562
634 Ga0373937_0007374 3300036401 Bacteria 9517
635 Ga0373937_0008229 3300036401 Bacteria 9056
636 Ga0373937_0010358 3300036401 Bacteria 8140
637 Ga0373937_0016955 3300036401 Bacteria 6477
638 Ga0373937_0020657 3300036401 Bacteria 5904
639 Ga0373937_0033873 3300036401 Bacteria 4643
640 Ga0373937_0051430 3300036401 Bacteria 3776
641 Ga0373937_0083306 3300036401 Bacteria 2958
642 Ga0373937_0165860 3300036401 Bacteria 2071
643 Ga0373937_0198097 3300036401 Bacteria 1888
644 Ga0373937_0469191 3300036401 Bacteria 1195
645 Ga0372808_013280 3300036459 Bacteria 1173
646 Ga0373925_0000231 3300037068 Bacteria 59007
647 Ga0373925_0000554 3300037068 Bacteria 36625
648 Ga0373925_0000779 3300037068 Bacteria 29324
649 Ga0373925_0004017 3300037068 Bacteria 11185
650 Ga0373925_0009300 3300037068 Bacteria 7153
651 Ga0373925_0014345 3300037068 Bacteria 5732
652 Ga0373925_0108618 3300037068 Bacteria 2141
653 Ga0373925_0199146 3300037068 Bacteria 1592
654 Ga0373925_0250578 3300037068 Bacteria 1420
655 Ga0373925_0334557 3300037068 Bacteria 1227
656 Ga0373925_0675273 3300037068 Bacteria 851
657 Ga0395899_0005516 3300037312 Bacteria 9803
658 Ga0395899_0023085 3300037312 Bacteria 4714
659 Ga0395899_0023972 3300037312 Bacteria 4617
660 Ga0395899_0077434 3300037312 Bacteria 2425
661 Ga0395899_0167572 3300037312 Bacteria 1549
662 Ga0395899_0240888 3300037312 Bacteria 1245
663 Ga0395900_0029569 3300037418 Bacteria 5621
664 Ga0395900_0030702 3300037418 Bacteria 5518
665 Ga0395900_0035605 3300037418 Bacteria 5128
666 Ga0395900_0039982 3300037418 Bacteria 4833
667 Ga0395900_0044740 3300037418 Bacteria 4561
668 Ga0395900_0047123 3300037418 Bacteria 4438
669 Ga0395900_0048875 3300037418 Bacteria 4356
670 Ga0395900_0055124 3300037418 Bacteria 4093
671 Ga0395900_0080771 3300037418 Bacteria 3341
672 Ga0395900_0149599 3300037418 Bacteria 2386
673 Ga0395898_0007057 3300037466 Bacteria 11935
674 Ga0395898_0014253 3300037466 Bacteria 8171
675 Ga0395898_0029725 3300037466 Bacteria 5470
676 Ga0395898_0039170 3300037466 Bacteria 4692
677 Ga0395898_0076991 3300037466 Bacteria 3220
678 Ga0395898_0114384 3300037466 Bacteria 2585
679 Ga0395898_0133395 3300037466 Bacteria 2378
680 Ga0395898_0154104 3300037466 Bacteria 2198
681 Ga0395898_0197322 3300037466 Bacteria 1922
682 Ga0395898_0412620 3300037466 Bacteria 1287
683 Ga0395905_0009185 3300037471 Bacteria 9679
684 Ga0395905_0017073 3300037471 Bacteria 6892
685 Ga0395905_0018244 3300037471 Bacteria 6661
686 Ga0395905_0035080 3300037471 Bacteria 4709
687 Ga0395905_0057431 3300037471 Bacteria 3640
688 Ga0395905_0081703 3300037471 Bacteria 3028
689 Ga0395905_0135021 3300037471 Bacteria 2321
690 Ga0395905_0159127 3300037471 Bacteria 2123
691 Ga0395905_0730980 3300037471 Bacteria 892
692 Ga0436364_0010280 3300037853 Bacteria 19989
693 Ga0436364_0082841 3300037853 Bacteria 976
694 Ga0436364_0241292 3300037853 Bacteria 1788
695 Ga0436364_0383955 3300037853 Bacteria 2718
696 Ga0436364_0496703 3300037853 Bacteria 4106
697 Ga0436364_0821490 3300037853 Bacteria 2234
698 Ga0436364_0825929 3300037853 Bacteria 3275
699 Ga0436364_0923522 3300037853 Bacteria 137390
700 Ga0436364_1023683 3300037853 Bacteria 3343
701 Ga0436364_1237330 3300037853 Bacteria 9021
702 Ga0436364_1404373 3300037853 Bacteria 8917
703 Ga0395901_0020563 3300038443 Bacteria 6754
704 Ga0395901_0024346 3300038443 Bacteria 6213
705 Ga0395901_0029599 3300038443 Bacteria 5639
706 Ga0395901_0030170 3300038443 Bacteria 5586
707 Ga0395901_0053689 3300038443 Bacteria 4187
708 Ga0395901_0064867 3300038443 Bacteria 3802
709 Ga0395901_0090089 3300038443 Bacteria 3210
710 Ga0395901_0160058 3300038443 Bacteria 2365
711 Ga0395901_0292959 3300038443 Bacteria 1688
712 Ga0395901_0631449 3300038443 Bacteria 1077
713 Ga0395901_0935609 3300038443 Bacteria 846
714 Ga0436365_0614644 3300039437 Bacteria 1550
715 Ga0436360_0246735 3300039438 Bacteria 1513
716 Ga0436363_0322036 3300039450 Bacteria 1307
717 Ga0436363_0980729 3300039450 Bacteria 2343
718 Ga0436363_1328754 3300039450 Bacteria 2513
719 Ga0451853_0135350 3300041512 Bacteria 1976
720 Ga0439463_025482 3300042016 Bacteria 1484
721 Ga0450908_012200 3300042184 Bacteria 1562
722 Ga0439435_0037468 3300042436 Bacteria 1344
723 Ga0466965_0048583 3300044683 Bacteria 2102
724 Ga0466963_0178155 3300044694 Bacteria 1484
725 Ga0466960_0024774 3300044901 Bacteria 2710
726 Ga0466959_0345553 3300045049 Bacteria 1015
727 Ga0466959_0432720 3300045049 Bacteria 893
728 Ga0466958_0160530 3300045836 Bacteria 1420
729 Ga0466958_0537629 3300045836 Bacteria 759
730 Ga0466967_0280250 3300045976 Bacteria 1599
731 Ga0466967_0390062 3300045976 Bacteria 1353
732 Ga0466967_0547377 3300045976 Bacteria 1139
733 Ga0495592_0025222 3300046454 Bacteria 4513
734 Ga0495592_0065299 3300046454 Bacteria 2664
735 Ga0495592_0082818 3300046454 Bacteria 2318
736 Ga0495603_0001113 3300046455 Bacteria 15625
737 Ga0495603_0004303 3300046455 Bacteria 8488
738 Ga0495629_0011488 3300046459 Bacteria 6432
739 Ga0495629_0013405 3300046459 Bacteria 5914
740 Ga0495629_0051026 3300046459 Bacteria 2896
741 Ga0495641_0005227 3300046461 Bacteria 8844
742 Ga0495641_0010720 3300046461 Bacteria 5282
743 Ga0495641_0016732 3300046461 Bacteria 3852
744 Ga0495651_0021252 3300046462 Bacteria 5043
745 Ga0495651_0022414 3300046462 Bacteria 4908
746 Ga0495651_0023445 3300046462 Bacteria 4797
747 Ga0495651_0029088 3300046462 Bacteria 4309
748 Ga0495651_0044435 3300046462 Bacteria 3443
749 Ga0495653_0011070 3300046463 Bacteria 7375
750 Ga0495653_0042044 3300046463 Bacteria 3563
751 Ga0495653_0086891 3300046463 Bacteria 2297
752 Ga0495653_0094982 3300046463 Bacteria 2171
753 Ga0495653_0096657 3300046463 Bacteria 2147
754 Ga0495580_0007651 3300046472 Bacteria 8666
755 Ga0495580_0058359 3300046472 Bacteria 2714
756 Ga0495582_0001782 3300046473 Bacteria 12155
757 Ga0495582_0008719 3300046473 Bacteria 5591
758 Ga0495582_0066246 3300046473 Bacteria 1995
759 Ga0495582_0087275 3300046473 Bacteria 1737
760 Ga0495639_0000902 3300046475 Bacteria 13408
761 Ga0495639_0014608 3300046475 Bacteria 3401
762 Ga0495662_0017607 3300046476 Bacteria 3458
763 Ga0495662_0049342 3300046476 Bacteria 2031
764 Ga0495662_0110126 3300046476 Bacteria 1349
765 Ga0495664_0002110 3300046477 Bacteria 10635
766 Ga0495664_0046511 3300046477 Bacteria 2574
767 Ga0495664_0105754 3300046477 Bacteria 1696
768 Ga0495664_0179185 3300046477 Bacteria 1285
769 Ga0495594_0004077 3300046499 Bacteria 7510
770 Ga0495594_0022643 3300046499 Bacteria 3360
771 Ga0495594_0337765 3300046499 Bacteria 858
772 Ga0495608_0056516 3300046511 Bacteria 2591
773 Ga0495608_0085740 3300046511 Bacteria 2041
774 Ga0495608_0111328 3300046511 Bacteria 1760
775 Ga0495608_0218797 3300046511 Bacteria 1195
776 Ga0495608_0262740 3300046511 Bacteria 1074
777 Ga0495608_0404313 3300046511 Bacteria 835
778 Ga0495618_0009119 3300046514 Bacteria 5985
779 Ga0495618_0016207 3300046514 Bacteria 4555
780 Ga0495618_0060587 3300046514 Bacteria 2400
781 Ga0495618_0067340 3300046514 Bacteria 2277
782 Ga0495628_0019080 3300046516 Bacteria 5672
783 Ga0495628_0033703 3300046516 Bacteria 4124
784 Ga0495628_0082117 3300046516 Bacteria 2503
785 Ga0495628_0263238 3300046516 Bacteria 1284
786 Ga0495630_0010186 3300046517 Bacteria 6778
787 Ga0495630_0041868 3300046517 Bacteria 3420
788 Ga0495630_0132730 3300046517 Bacteria 1891
789 Ga0495666_0001705 3300046526 Bacteria 10859
790 Ga0495652_0017730 3300046529 Bacteria 6355
791 Ga0495652_0020248 3300046529 Bacteria 5914
792 Ga0495652_0249349 3300046529 Bacteria 1316
793 Ga0495652_0279741 3300046529 Bacteria 1222
794 Ga0495652_0392249 3300046529 Bacteria 985
795 Ga0495665_0005360 3300046531 Bacteria 6912
796 Ga0495665_0040081 3300046531 Bacteria 2494
797 Ga0495640_0007047 3300046533 Bacteria 8848
798 Ga0495640_0051582 3300046533 Bacteria 2827
799 Ga0495640_0177516 3300046533 Bacteria 1359
800 Ga0495586_0006962 3300046535 Bacteria 6023
801 Ga0495586_0013646 3300046535 Bacteria 4310
802 Ga0495586_0172558 3300046535 Bacteria 1222
803 Ga0495587_0009099 3300046536 Bacteria 6372
804 Ga0495587_0057356 3300046536 Bacteria 2289
805 Ga0495587_0062098 3300046536 Bacteria 2188
806 Ga0495645_0069259 3300046543 Bacteria 2546
807 Ga0495645_0075853 3300046543 Bacteria 2420
808 Ga0495645_0117775 3300046543 Bacteria 1873
809 Ga0495667_0005171 3300046559 Bacteria 8815
810 Ga0495667_0020210 3300046559 Bacteria 4492
811 Ga0495667_0029400 3300046559 Bacteria 3699
812 Ga0495667_0041872 3300046559 Bacteria 3036
813 Ga0495667_0109291 3300046559 Bacteria 1786
814 Ga0495656_0144651 3300046615 Bacteria 1143
815 Ga0495656_0340372 3300046615 Bacteria 776
816 Ga0495634_0037462 3300046642 Bacteria 3313
817 Ga0495634_0058617 3300046642 Bacteria 2566
818 Ga0495635_0016830 3300046663 Bacteria 5107
819 Ga0495635_0028518 3300046663 Bacteria 3881
820 Ga0495635_0053924 3300046663 Bacteria 2769
821 Ga0495635_0100822 3300046663 Bacteria 1973
822 Ga0495635_0205917 3300046663 Bacteria 1333
823 Ga0495635_0238789 3300046663 Bacteria 1226
824 Ga0495659_0087105 3300046664 Bacteria 1194
825 Ga0495588_0007147 3300046674 Bacteria 5065
826 Ga0495588_0115686 3300046674 Bacteria 1413
827 Ga0495657_0012189 3300046675 Bacteria 6394
828 Ga0495657_0052313 3300046675 Bacteria 2738
829 Ga0495657_0079423 3300046675 Bacteria 2125
830 Ga0495657_0089568 3300046675 Bacteria 1976
831 Ga0495657_0094235 3300046675 Bacteria 1915
832 Ga0495657_0139320 3300046675 Bacteria 1513
833 Ga0495657_0356201 3300046675 Bacteria 865
834 Ga0495599_0009353 3300046678 Bacteria 5986
835 Ga0495599_0019364 3300046678 Bacteria 4243
836 Ga0495599_0063871 3300046678 Bacteria 2300
837 Ga0495599_0077161 3300046678 Bacteria 2080
838 Ga0495623_0058542 3300046679 Bacteria 2422
839 Ga0495623_0059980 3300046679 Bacteria 2388
840 Ga0495623_0089508 3300046679 Bacteria 1892
841 Ga0495623_0145632 3300046679 Bacteria 1405
842 Ga0495646_0007317 3300046680 Bacteria 7013
843 Ga0495646_0064335 3300046680 Bacteria 2174
844 Ga0495646_0236485 3300046680 Bacteria 983
845 Ga0495647_0010633 3300046681 Bacteria 3137
846 Ga0495647_0022181 3300046681 Bacteria 2292
847 Ga0495658_0004824 3300046683 Bacteria 6614
848 Ga0495658_0011799 3300046683 Bacteria 4405
849 Ga0495613_0003433 3300046689 Bacteria 11846
850 Ga0495613_0007035 3300046689 Bacteria 8374
851 Ga0495613_0025801 3300046689 Bacteria 4378
852 Ga0495624_0006342 3300046690 Bacteria 8399
853 Ga0495670_0267504 3300046691 Bacteria 913
854 Ga0495589_0123796 3300046794 Bacteria 1244
855 Ga0495600_0006668 3300046809 Bacteria 7036
856 Ga0495600_0047171 3300046809 Bacteria 2810
857 Ga0495600_0102369 3300046809 Bacteria 1866
858 Ga0495600_0192535 3300046809 Bacteria 1311
859 Ga0495581_0002431 3300047315 Bacteria 10524
860 Ga0495581_0005320 3300047315 Bacteria 7445
861 Ga0495604_0037480 3300047317 Bacteria 3817
862 Ga0495604_0040138 3300047317 Bacteria 3676
863 Ga0495604_0073276 3300047317 Bacteria 2585
864 Ga0495604_0117480 3300047317 Bacteria 1929
865 Ga0495674_0015950 3300047319 Bacteria 7013
866 Ga0495674_0070849 3300047319 Bacteria 3012
867 Ga0495674_0087945 3300047319 Bacteria 2658
868 Ga0495674_0093469 3300047319 Bacteria 2566
869 Ga0495674_0099087 3300047319 Bacteria 2481
870 Ga0495674_0170529 3300047319 Bacteria 1816
871 Ga0495676_0006083 3300047321 Bacteria 11098
872 Ga0495676_0102382 3300047321 Bacteria 2116
873 Ga0495680_0012830 3300047322 Bacteria 7343
874 Ga0495680_0019030 3300047322 Bacteria 5812
875 Ga0495680_0029697 3300047322 Bacteria 4474
876 Ga0495680_0046315 3300047322 Bacteria 3429
877 Ga0495680_0085583 3300047322 Bacteria 2373
878 Ga0495680_0097434 3300047322 Bacteria 2195
879 Ga0495680_0145810 3300047322 Bacteria 1729
880 Ga0495680_0347063 3300047322 Bacteria 1034
881 Ga0495675_0004262 3300047444 Bacteria 8647
882 Ga0495675_0015104 3300047444 Bacteria 4882
883 Ga0495675_0124402 3300047444 Bacteria 1605
884 Ga0495675_0156381 3300047444 Bacteria 1406
885 Ga0495684_0029336 3300047471 Bacteria 4222
886 Ga0495684_0030940 3300047471 Bacteria 4109
887 Ga0495684_0036478 3300047471 Bacteria 3768
888 Ga0495684_0089383 3300047471 Bacteria 2333
889 Ga0495684_0116567 3300047471 Bacteria 2013
890 Ga0495684_0121323 3300047471 Bacteria 1968
891 Ga0495684_0188584 3300047471 Bacteria 1525
892 Ga0495684_0223052 3300047471 Bacteria 1381
893 Ga0495593_0004098 3300047673 Bacteria 8667
894 Ga0495593_0006460 3300047673 Bacteria 6868
895 Ga0495602_0013041 3300048088 Bacteria 8501
896 Ga0495602_0019899 3300048088 Bacteria 6647
897 Ga0495602_0034577 3300048088 Bacteria 4726
898 Ga0495602_0049359 3300048088 Bacteria 3770
899 Ga0495602_0097502 3300048088 Bacteria 2421
900 Ga0495602_0115157 3300048088 Bacteria 2175
901 Ga0495602_0201218 3300048088 Bacteria 1519
902 Ga0495614_0001897 3300048089 Bacteria 9170
903 Ga0495614_0013260 3300048089 Bacteria 3615
904 Ga0495615_0059491 3300048090 Bacteria 1005
905 Ga0496100_0037878 3300048903 Bacteria 3052
906 Ga0496101_0005465 3300048904 Bacteria 8101
907 Ga0496104_0037090 3300048907 Bacteria 4558
908 Ga0496104_0116546 3300048907 Bacteria 2564
909 Ga0496104_0146782 3300048907 Bacteria 2265
910 Ga0496104_0269116 3300048907 Bacteria 1616
911 Ga0496105_0151016 3300048908 Bacteria 1909
912 Ga0496105_0423648 3300048908 Bacteria 1053
913 Ga0496107_0038018 3300048910 Bacteria 3455
914 Ga0496107_0094315 3300048910 Bacteria 2189
915 Ga0496108_0000128 3300048911 Bacteria 74691
916 Ga0496108_0087238 3300048911 Bacteria 2650
917 Ga0496108_0234662 3300048911 Bacteria 1595
918 Ga0496109_0062422 3300048912 Bacteria 3407
919 Ga0496109_0120199 3300048912 Bacteria 2447
920 Ga0496109_0289898 3300048912 Bacteria 1543
921 Ga0496109_0652667 3300048912 Bacteria 989
922 Ga0496110_0025180 3300048913 Bacteria 5082
923 Ga0496110_0232255 3300048913 Bacteria 1678
924 Ga0496111_0103140 3300048914 Bacteria 2097
925 Ga0496111_0271774 3300048914 Bacteria 1257
926 Ga0496111_0455477 3300048914 Bacteria 944
927 Ga0496112_0004178 3300048915 Bacteria 12161
928 Ga0496112_0011017 3300048915 Bacteria 8240
929 Ga0496112_0517368 3300048915 Bacteria 1128
930 Ga0496113_0034712 3300048916 Bacteria 3682
931 Ga0496113_0068024 3300048916 Bacteria 2703
932 Ga0496114_0041577 3300048917 Bacteria 3810
933 Ga0496115_0098262 3300048918 Bacteria 2397
934 Ga0496115_0140345 3300048918 Bacteria 1994
935 Ga0496115_0406307 3300048918 Bacteria 1104
936 Ga0496119_0013498 3300048922 Bacteria 6501
937 Ga0496121_0003979 3300048924 Bacteria 20381
938 Ga0496126_0109185 3300048929 Bacteria 2411
939 Ga0501031_0000675 3300049568 Bacteria 20344
940 Ga0501031_0216344 3300049568 Bacteria 1248
941 Ga0501032_0001344 3300049569 Bacteria 19545
942 Ga0501034_0002489 3300049571 Bacteria 22128
943 Ga0501034_0037606 3300049571 Bacteria 4902
944 Ga0501034_0384329 3300049571 Bacteria 1328
945 Ga0501036_0008489 3300049572 Bacteria 8418
946 Ga0501036_0026504 3300049572 Bacteria 4893
947 Ga0501036_0134098 3300049572 Bacteria 2090
948 Ga0501037_0000743 3300049573 Bacteria 24719
949 Ga0501038_0002150 3300049574 Bacteria 18302
950 Ga0501038_0364619 3300049574 Bacteria 1123
951 Ga0501039_0037530 3300049575 Bacteria 3740
952 Ga0501039_0101627 3300049575 Bacteria 2244
953 Ga0501040_0012695 3300049576 Bacteria 5526
954 Ga0501040_0065837 3300049576 Bacteria 2497
955 Ga0501041_0001788 3300049577 Bacteria 12041
956 Ga0501042_0012703 3300049578 Bacteria 5714
957 Ga0501042_0015337 3300049578 Bacteria 5246
958 Ga0501042_0045369 3300049578 Bacteria 3132
959 Ga0501042_0162863 3300049578 Bacteria 1609
960 Ga0501043_0002416 3300049579 Bacteria 15805
961 Ga0501047_0001452 3300049581 Bacteria 23191
962 Ga0501047_0008803 3300049581 Bacteria 9521
963 Ga0501047_0348144 3300049581 Bacteria 1319
964 Ga0501048_0147408 3300049582 Bacteria 1664
965 Ga0501048_0454465 3300049582 Bacteria 917
966 Ga0501068_0000449 3300049584 Bacteria 20936
967 Ga0501069_0007288 3300049585 Bacteria 5801
968 Ga0501070_0022072 3300049586 Bacteria 5331
969 Ga0501071_0013042 3300049587 Bacteria 5655
970 Ga0501072_0002736 3300049588 Bacteria 13233
971 Ga0501072_0397494 3300049588 Bacteria 1093
972 Ga0501074_0063990 3300049590 Bacteria 2648
973 Ga0501074_0147553 3300049590 Bacteria 1682
974 Ga0501074_0168228 3300049590 Bacteria 1565
975 Ga0501074_0244651 3300049590 Bacteria 1276
976 Ga0501077_0007206 3300049593 Bacteria 6860
977 Ga0501079_0051330 3300049741 Bacteria 3184
978 Ga0501079_0132860 3300049741 Bacteria 1937
979 Ga0501079_0479393 3300049741 Bacteria 978
980 Ga0501080_0050109 3300049742 Bacteria 3887
981 Ga0501081_0240692 3300049743 Bacteria 1319
982 Ga0501081_0389919 3300049743 Bacteria 1030
983 Ga0501083_0004068 3300049744 Bacteria 10288
984 Ga0501083_0052676 3300049744 Bacteria 2734
985 Ga0501035_0005249 3300049822 Bacteria 12259
986 Ga0501044_0004027 3300049823 Bacteria 16475
987 Ga0501045_0021387 3300049824 Bacteria 4627
988 Ga0501045_0026945 3300049824 Bacteria 4137
989 nmdc:mga03n38_3102_c1 3300050490 Bacteria 5278
990 nmdc:mga00v17_82352_c1 3300050491 Bacteria 2011
991 nmdc:mga06z11_2123_c1 3300050494 Bacteria 7516
992 nmdc:mga06z11_3600_c1 3300050494 Bacteria 6006
993 nmdc:mga07m45_44537_c1 3300050496 Bacteria 2491
994 nmdc:mga05p37_365168_c1 3300050507 Bacteria 1696
995 nmdc:mga05p37_66039_c1 3300050507 Bacteria 4451
996 nmdc:mga05p37_801902_c1 3300050507 Bacteria 1030
997 nmdc:mga05p37_906223_c1 3300050507 Bacteria 950
998 nmdc:mga09592_107029_c1 3300050508 Bacteria 2398
999 nmdc:mga09592_231857_c1 3300050508 Bacteria 1600
1000 nmdc:mga0qj67_16266_c1 3300050509 Bacteria 5638
1001 nmdc:mga0qj67_2370_c1 3300050509 Bacteria 13417
1002 nmdc:mga06r32_15640_c1 3300050510 Bacteria 6894
1003 nmdc:mga06r32_169740_c1 3300050510 Bacteria 2165
1004 nmdc:mga06r32_23994_c1 3300050510 Bacteria 5653
1005 nmdc:mga06r32_600573_c1 3300050510 Bacteria 1071
1006 nmdc:mga08y16_26187_c1 3300050511 Bacteria 6151
1007 nmdc:mga08y16_3451_c1 3300050511 Bacteria 16400
1008 nmdc:mga08y16_65693_c1 3300050511 Bacteria 3787
1009 nmdc:mga0n895_236531_c1 3300050512 Bacteria 1854
1010 nmdc:mga0n895_28873_c1 3300050512 Bacteria 5282
1011 nmdc:mga0n895_415844_c1 3300050512 Bacteria 1359
1012 nmdc:mga0n895_580640_c1 3300050512 Bacteria 1125
1013 nmdc:mga0rr50_16858_c1 3300050513 Bacteria 4864
1014 nmdc:mga0a205_135935_c1 3300050515 Bacteria 2359
1015 nmdc:mga0a205_231803_c1 3300050515 Bacteria 1729
1016 nmdc:mga0a205_51221_c1 3300050515 Bacteria 3985
1017 Ga0495601_0009094 3300053077 Bacteria 5865
1018 Ga0495601_0064605 3300053077 Bacteria 2327
1019 Ga0495612_0004871 3300053078 Bacteria 5558
1020 Ga0495612_0009451 3300053078 Bacteria 3954
1021 Ga0495612_0012451 3300053078 Bacteria 3429
1022 Ga0495612_0013835 3300053078 Bacteria 3251
1023 Ga0495612_0073284 3300053078 Bacteria 1430
1024 Ga0495595_0001206 3300053084 Bacteria 10046
1025 Ga0495595_0031316 3300053084 Bacteria 2390
1026 Ga0495619_0003469 3300053085 Bacteria 10174
1027 Ga0495619_0010754 3300053085 Bacteria 5759
1028 Ga0495619_0027888 3300053085 Bacteria 3641
1029 Ga0500660_122220 3300053100 Bacteria 1081
1030 Ga0500600_0065466 3300053149 Bacteria 2010
1031 Ga0501084_0007957 3300054114 Bacteria 8727
1032 Ga0501084_0009802 3300054114 Bacteria 7919
1033 Ga0501082_0012964 3300060353 Bacteria 7165
1034 Ga0501082_0165170 3300060353 Bacteria 1924
1035 Ga0530510_0058769 3300061734 Bacteria 2781

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049588 Ga0501072_0397494 Ga0501072_0397494_477_1082 189
2 3300035724 Ga0373933_0066318 Ga0373933_0066318_477_1238 202
3 3300047319 Ga0495674_0093469 Ga0495674_0093469_978_1739 202
4 3300046462 Ga0495651_0029088 Ga0495651_0029088_3280_4041 203
5 3300046477 Ga0495664_0179185 Ga0495664_0179185_507_1268 203
6 3300046663 Ga0495635_0053924 Ga0495635_0053924_619_1380 203
7 3300046675 Ga0495657_0079423 Ga0495657_0079423_775_1536 203
8 3300047322 Ga0495680_0097434 Ga0495680_0097434_225_986 203
9 3300047471 Ga0495684_0029336 Ga0495684_0029336_3070_3831 203
10 3300006881 Ga0068865_100111232 Ga0068865_1001112322 224
11 3300037853 Ga0436364_0383955 Ga0436364_0383955_562_1329 224
12 3300005329 Ga0070683_100690999 Ga0070683_1006909992 225
13 3300005441 Ga0070700_100105175 Ga0070700_1001051752 225
14 3300005459 Ga0068867_100088736 Ga0068867_1000887362 225
15 3300005543 Ga0070672_100252363 Ga0070672_1002523631 225
16 3300005719 Ga0068861_100248628 Ga0068861_1002486282 225
17 3300009098 Ga0105245_10104769 Ga0105245_101047692 225
18 3300009176 Ga0105242_10115680 Ga0105242_101156802 225
19 3300025926 Ga0207659_10279483 Ga0207659_102794832 225
20 3300025944 Ga0207661_10195020 Ga0207661_101950202 225
21 3300026075 Ga0207708_10211770 Ga0207708_102117702 225
22 3300026118 Ga0207675_100687062 Ga0207675_1006870622 225
23 3300005983 Ga0081540_1001036 Ga0081540_100103615 226
24 3300042016 Ga0439463_025482 Ga0439463_025482_180_860 226
25 3300048090 Ga0495615_0059491 Ga0495615_0059491_32_754 226
26 3300005518 Ga0070699_100079743 Ga0070699_1000797433 227
27 3300037853 Ga0436364_0082841 Ga0436364_0082841_26_709 227
28 3300046517 Ga0495630_0132730 Ga0495630_0132730_665_1390 227
29 3300046533 Ga0495640_0177516 Ga0495640_0177516_10_735 227
30 3300046642 Ga0495634_0058617 Ga0495634_0058617_873_1598 227
31 3300047319 Ga0495674_0070849 Ga0495674_0070849_1015_1740 227
32 3300048907 Ga0496104_0146782 Ga0496104_0146782_917_1642 228
33 3300049568 Ga0501031_0216344 Ga0501031_0216344_340_1062 228
34 3300049572 Ga0501036_0026504 Ga0501036_0026504_3563_4285 228
35 3300049575 Ga0501039_0101627 Ga0501039_0101627_969_1691 228
36 3300049578 Ga0501042_0012703 Ga0501042_0012703_3838_4560 228
37 3300049587 Ga0501071_0013042 Ga0501071_0013042_3656_4378 228
38 3300049590 Ga0501074_0147553 Ga0501074_0147553_182_904 228
39 3300049741 Ga0501079_0132860 Ga0501079_0132860_833_1555 228
40 3300049743 Ga0501081_0240692 Ga0501081_0240692_556_1278 228
41 3300005329 Ga0070683_100081477 Ga0070683_1000814774 229
42 3300005331 Ga0070670_100057963 Ga0070670_1000579632 229
43 3300005355 Ga0070671_100005711 Ga0070671_1000057118 229
44 3300005842 Ga0068858_100108445 Ga0068858_1001084452 229
45 3300025925 Ga0207650_10145297 Ga0207650_101452972 229
46 3300046511 Ga0495608_0262740 Ga0495608_0262740_18_770 229
47 3300005535 Ga0070684_100127799 Ga0070684_1001277992 230
48 3300009011 Ga0105251_10133634 Ga0105251_101336341 230
49 3300014325 Ga0163163_10004683 Ga0163163_100046832 230
50 3300017792 Ga0163161_10732795 Ga0163161_107327951 230
51 3300025945 Ga0207679_10088091 Ga0207679_100880912 230
52 3300005334 Ga0068869_100093717 Ga0068869_1000937173 231
53 3300005438 Ga0070701_10039250 Ga0070701_100392502 231
54 3300005471 Ga0070698_100071852 Ga0070698_1000718523 231
55 3300005543 Ga0070672_100057779 Ga0070672_1000577794 231
56 3300006028 Ga0070717_10145174 Ga0070717_101451743 231
57 3300006173 Ga0070716_100216927 Ga0070716_1002169272 231
58 3300006881 Ga0068865_100040620 Ga0068865_1000406202 231
59 3300025922 Ga0207646_10051775 Ga0207646_100517752 231
60 3300025929 Ga0207664_10056124 Ga0207664_100561242 231
61 3300025937 Ga0207669_10023945 Ga0207669_100239453 231
62 3300025938 Ga0207704_10038018 Ga0207704_100380182 231
63 3300025939 Ga0207665_10076898 Ga0207665_100768982 231
64 3300025940 Ga0207691_10057293 Ga0207691_100572932 231
65 3300035113 Ga0373936_0078316 Ga0373936_0078316_164_925 231
66 3300047319 Ga0495674_0087945 Ga0495674_0087945_210_971 231
67 3300005563 Ga0068855_100045099 Ga0068855_1000450994 233
68 3300010375 Ga0105239_10056981 Ga0105239_100569814 233
69 3300025949 Ga0207667_10077755 Ga0207667_100777552 233
70 3300026078 Ga0207702_10022462 Ga0207702_100224622 233
71 3300031995 Ga0307409_100048571 Ga0307409_1000485712 233
72 3300032002 Ga0307416_100819067 Ga0307416_1008190671 233
73 3300032004 Ga0307414_10377354 Ga0307414_103773542 233
74 3300009174 Ga0105241_10395020 Ga0105241_103950202 234
75 3300047317 Ga0495604_0117480 Ga0495604_0117480_29_739 234
76 3300005436 Ga0070713_100044011 Ga0070713_1000440112 235
77 3300005439 Ga0070711_100102343 Ga0070711_1001023432 235
78 3300006028 Ga0070717_10017077 Ga0070717_100170772 235
79 3300021388 Ga0213875_10026180 Ga0213875_100261802 235
80 3300025928 Ga0207700_10039159 Ga0207700_100391593 235
81 3300025929 Ga0207664_10014115 Ga0207664_100141152 235
82 3300031730 Ga0307516_10196739 Ga0307516_101967392 235
83 3300032002 Ga0307416_100220814 Ga0307416_1002208142 235
84 3300033179 Ga0307507_10041455 Ga0307507_100414552 235
85 3300037853 Ga0436364_1023683 Ga0436364_1023683_1451_2170 235
86 iso_pu_bacteria 2751185782 2753264979 235
87 3300006028 Ga0070717_10224397 Ga0070717_102243972 236
88 3300048929 Ga0496126_0109185 Ga0496126_0109185_1685_2395 236
89 iso_pu_bacteria 2579778521 2579857338 236
90 iso_pu_bacteria 2619618881 2619857372 236
91 iso_pu_bacteria 2619619003 2620353214 236
92 3300005518 Ga0070699_100001774 Ga0070699_1000017742 237
93 3300006028 Ga0070717_10031359 Ga0070717_100313592 237
94 3300006028 Ga0070717_10045250 Ga0070717_100452504 237
95 3300025910 Ga0207684_10384661 Ga0207684_103846612 237
96 3300025928 Ga0207700_10027814 Ga0207700_100278143 237
97 3300025928 Ga0207700_10192514 Ga0207700_101925142 237
98 3300025939 Ga0207665_10005314 Ga0207665_100053144 237
99 3300031507 Ga0307509_10154829 Ga0307509_101548292 237
100 3300035086 Ga0373934_0004661 Ga0373934_0004661_4268_4984 237
101 3300035089 Ga0373944_0001641 Ga0373944_0001641_1752_2468 237
102 3300035111 Ga0373923_0000678 Ga0373923_0000678_924_1640 237
103 3300035113 Ga0373936_0001646 Ga0373936_0001646_1782_2498 237
104 3300035116 Ga0373945_0005082 Ga0373945_0005082_3172_3888 237
105 3300035118 Ga0373954_0029978 Ga0373954_0029978_769_1485 237
106 3300035119 Ga0373956_0002110 Ga0373956_0002110_2822_3538 237
107 3300035120 Ga0373957_0002124 Ga0373957_0002124_3352_4068 237
108 3300035170 Ga0373943_0009200 Ga0373943_0009200_3561_4277 237
109 3300035171 Ga0373946_0000512 Ga0373946_0000512_11709_12425 237
110 3300035172 Ga0373955_0001398 Ga0373955_0001398_5399_6115 237
111 3300035410 Ga0373924_0002263 Ga0373924_0002263_1119_1835 237
112 3300035692 Ga0373935_0089915 Ga0373935_0089915_616_1332 237
113 3300035695 Ga0373927_0003660 Ga0373927_0003660_6697_7413 237
114 3300035724 Ga0373933_0007397 Ga0373933_0007397_3211_3927 237
115 3300035725 Ga0373947_0003126 Ga0373947_0003126_6611_7327 237
116 3300036401 Ga0373937_0016955 Ga0373937_0016955_4466_5182 237
117 3300037068 Ga0373925_0004017 Ga0373925_0004017_5026_5778 237
118 3300037068 Ga0373925_0009300 Ga0373925_0009300_5311_6027 237
119 3300037068 Ga0373925_0199146 Ga0373925_0199146_198_920 237
120 3300037853 Ga0436364_0825929 Ga0436364_0825929_1177_1893 237
121 3300037853 Ga0436364_0923522 Ga0436364_0923522_92686_93408 237
122 3300039450 Ga0436363_0322036 Ga0436363_0322036_161_880 237
123 3300045836 Ga0466958_0537629 Ga0466958_0537629_14_727 237
124 3300046454 Ga0495592_0025222 Ga0495592_0025222_925_1641 237
125 3300046455 Ga0495603_0004303 Ga0495603_0004303_5150_5866 237
126 3300046459 Ga0495629_0013405 Ga0495629_0013405_1181_1897 237
127 3300046461 Ga0495641_0005227 Ga0495641_0005227_5256_5972 237
128 3300046462 Ga0495651_0023445 Ga0495651_0023445_1053_1769 237
129 3300046463 Ga0495653_0011070 Ga0495653_0011070_5668_6384 237
130 3300046472 Ga0495580_0007651 Ga0495580_0007651_1957_2673 237
131 3300046473 Ga0495582_0001782 Ga0495582_0001782_4778_5494 237
132 3300046475 Ga0495639_0014608 Ga0495639_0014608_2423_3139 237
133 3300046476 Ga0495662_0049342 Ga0495662_0049342_1053_1769 237
134 3300046476 Ga0495662_0110126 Ga0495662_0110126_15_737 237
135 3300046477 Ga0495664_0002110 Ga0495664_0002110_5261_5977 237
136 3300046511 Ga0495608_0056516 Ga0495608_0056516_299_1015 237
137 3300046514 Ga0495618_0009119 Ga0495618_0009119_4593_5309 237
138 3300046516 Ga0495628_0033703 Ga0495628_0033703_1053_1769 237
139 3300046517 Ga0495630_0041868 Ga0495630_0041868_119_835 237
140 3300046526 Ga0495666_0001705 Ga0495666_0001705_8710_9426 237
141 3300046529 Ga0495652_0017730 Ga0495652_0017730_967_1683 237
142 3300046531 Ga0495665_0005360 Ga0495665_0005360_1478_2194 237
143 3300046533 Ga0495640_0007047 Ga0495640_0007047_3540_4256 237
144 3300046535 Ga0495586_0006962 Ga0495586_0006962_4872_5588 237
145 3300046536 Ga0495587_0009099 Ga0495587_0009099_1064_1780 237
146 3300046543 Ga0495645_0069259 Ga0495645_0069259_778_1494 237
147 3300046559 Ga0495667_0005171 Ga0495667_0005171_1053_1769 237
148 3300046663 Ga0495635_0016830 Ga0495635_0016830_2745_3461 237
149 3300046663 Ga0495635_0205917 Ga0495635_0205917_231_953 237
150 3300046674 Ga0495588_0115686 Ga0495588_0115686_299_1015 237
151 3300046675 Ga0495657_0012189 Ga0495657_0012189_992_1708 237
152 3300046678 Ga0495599_0009353 Ga0495599_0009353_4963_5679 237
153 3300046678 Ga0495599_0077161 Ga0495599_0077161_1001_1723 237
154 3300046680 Ga0495646_0007317 Ga0495646_0007317_1577_2293 237
155 3300046681 Ga0495647_0010633 Ga0495647_0010633_1454_2170 237
156 3300046683 Ga0495658_0004824 Ga0495658_0004824_2722_3438 237
157 3300046689 Ga0495613_0025801 Ga0495613_0025801_546_1262 237
158 3300046690 Ga0495624_0006342 Ga0495624_0006342_3831_4547 237
159 3300046809 Ga0495600_0006668 Ga0495600_0006668_4363_5079 237
160 3300047315 Ga0495581_0002431 Ga0495581_0002431_8628_9344 237
161 3300047319 Ga0495674_0015950 Ga0495674_0015950_4721_5437 237
162 3300047319 Ga0495674_0099087 Ga0495674_0099087_1031_1753 237
163 3300047321 Ga0495676_0006083 Ga0495676_0006083_9330_10046 237
164 3300047321 Ga0495676_0102382 Ga0495676_0102382_750_1472 237
165 3300047322 Ga0495680_0012830 Ga0495680_0012830_1647_2363 237
166 3300047444 Ga0495675_0015104 Ga0495675_0015104_1803_2519 237
167 3300047444 Ga0495675_0156381 Ga0495675_0156381_236_958 237
168 3300047471 Ga0495684_0036478 Ga0495684_0036478_2745_3461 237
169 3300047673 Ga0495593_0004098 Ga0495593_0004098_1334_2050 237
170 3300048088 Ga0495602_0034577 Ga0495602_0034577_2873_3589 237
171 3300048089 Ga0495614_0001897 Ga0495614_0001897_4658_5374 237
172 3300049743 Ga0501081_0389919 Ga0501081_0389919_28_741 237
173 3300053077 Ga0495601_0009094 Ga0495601_0009094_4721_5437 237
174 3300053078 Ga0495612_0004871 Ga0495612_0004871_3266_3982 237
175 3300053084 Ga0495595_0031316 Ga0495595_0031316_1546_2262 237
176 3300053085 Ga0495619_0003469 Ga0495619_0003469_3919_4635 237
177 iso_pu_bacteria 2508501039 2508673615 237
178 iso_pu_bacteria 2643221604 2644034927 237
179 iso_pu_bacteria 2675902999 2676203971 237
180 iso_pu_bacteria 2687453737 2689957701 237
181 iso_pu_bacteria 2773857921 2774848547 237
182 3300005327 Ga0070658_10050435 Ga0070658_100504352 238
183 3300005329 Ga0070683_100001043 Ga0070683_10000104313 238
184 3300005329 Ga0070683_100126188 Ga0070683_1001261882 238
185 3300005329 Ga0070683_100463212 Ga0070683_1004632122 238
186 3300005336 Ga0070680_100084670 Ga0070680_1000846702 238
187 3300005339 Ga0070660_100244985 Ga0070660_1002449852 238
188 3300005434 Ga0070709_10161910 Ga0070709_101619102 238
189 3300005434 Ga0070709_10218351 Ga0070709_102183512 238
190 3300005435 Ga0070714_100057222 Ga0070714_1000572222 238
191 3300005435 Ga0070714_100104044 Ga0070714_1001040442 238
192 3300005435 Ga0070714_100114912 Ga0070714_1001149122 238
193 3300005435 Ga0070714_100159369 Ga0070714_1001593692 238
194 3300005435 Ga0070714_100273041 Ga0070714_1002730412 238
195 3300005435 Ga0070714_100383567 Ga0070714_1003835672 238
196 3300005436 Ga0070713_100007612 Ga0070713_1000076123 238
197 3300005436 Ga0070713_100130636 Ga0070713_1001306362 238
198 3300005436 Ga0070713_100192960 Ga0070713_1001929602 238
199 3300005436 Ga0070713_100217711 Ga0070713_1002177111 238
200 3300005437 Ga0070710_10044370 Ga0070710_100443703 238
201 3300005439 Ga0070711_100034450 Ga0070711_1000344502 238
202 3300005455 Ga0070663_100019012 Ga0070663_1000190122 238
203 3300005458 Ga0070681_10142579 Ga0070681_101425792 238
204 3300005467 Ga0070706_100200175 Ga0070706_1002001751 238
205 3300005468 Ga0070707_100004358 Ga0070707_1000043587 238
206 3300005468 Ga0070707_100030808 Ga0070707_1000308082 238
207 3300005471 Ga0070698_100054421 Ga0070698_1000544212 238
208 3300005530 Ga0070679_100052992 Ga0070679_1000529922 238
209 3300005535 Ga0070684_100016381 Ga0070684_1000163814 238
210 3300005535 Ga0070684_100083131 Ga0070684_1000831312 238
211 3300005536 Ga0070697_100099589 Ga0070697_1000995892 238
212 3300005577 Ga0068857_100070859 Ga0068857_1000708592 238
213 3300005616 Ga0068852_100323149 Ga0068852_1003231492 238
214 3300005981 Ga0081538_10013643 Ga0081538_100136432 238
215 3300005983 Ga0081540_1047547 Ga0081540_10475471 238
216 3300006028 Ga0070717_10013112 Ga0070717_100131122 238
217 3300006058 Ga0075432_10039653 Ga0075432_100396532 238
218 3300006163 Ga0070715_10059557 Ga0070715_100595573 238
219 3300006173 Ga0070716_100009847 Ga0070716_1000098472 238
220 3300006175 Ga0070712_100038520 Ga0070712_1000385202 238
221 3300006175 Ga0070712_100148320 Ga0070712_1001483203 238
222 3300006852 Ga0075433_10043000 Ga0075433_100430003 238
223 3300006852 Ga0075433_10048975 Ga0075433_100489752 238
224 3300006871 Ga0075434_100031601 Ga0075434_1000316012 238
225 3300006871 Ga0075434_100090563 Ga0075434_1000905632 238
226 3300007076 Ga0075435_100024919 Ga0075435_1000249192 238
227 3300007076 Ga0075435_100046476 Ga0075435_1000464763 238
228 3300009093 Ga0105240_11098461 Ga0105240_110984611 238
229 3300009094 Ga0111539_10090372 Ga0111539_100903722 238
230 3300013105 Ga0157369_10089018 Ga0157369_100890182 238
231 3300020082 Ga0206353_11280236 Ga0206353_112802362 238
232 3300025898 Ga0207692_10003168 Ga0207692_100031683 238
233 3300025904 Ga0207647_10169420 Ga0207647_101694202 238
234 3300025905 Ga0207685_10079620 Ga0207685_100796202 238
235 3300025906 Ga0207699_10422676 Ga0207699_104226761 238
236 3300025915 Ga0207693_10014890 Ga0207693_100148903 238
237 3300025917 Ga0207660_10131688 Ga0207660_101316882 238
238 3300025919 Ga0207657_10093624 Ga0207657_100936243 238
239 3300025921 Ga0207652_10013580 Ga0207652_100135802 238
240 3300025922 Ga0207646_10103806 Ga0207646_101038062 238
241 3300025928 Ga0207700_10005311 Ga0207700_100053117 238
242 3300025928 Ga0207700_10006552 Ga0207700_100065526 238
243 3300025928 Ga0207700_10013326 Ga0207700_100133262 238
244 3300025928 Ga0207700_10176240 Ga0207700_101762402 238
245 3300025929 Ga0207664_10008588 Ga0207664_100085887 238
246 3300025929 Ga0207664_10020134 Ga0207664_100201346 238
247 3300025929 Ga0207664_10093066 Ga0207664_100930662 238
248 3300025929 Ga0207664_10190259 Ga0207664_101902592 238
249 3300025939 Ga0207665_10007468 Ga0207665_1000746810 238
250 3300025939 Ga0207665_10036332 Ga0207665_100363323 238
251 3300025944 Ga0207661_10002147 Ga0207661_100021475 238
252 3300025944 Ga0207661_10273819 Ga0207661_102738192 238
253 3300026067 Ga0207678_10254998 Ga0207678_102549982 238
254 3300026116 Ga0207674_10014768 Ga0207674_100147688 238
255 3300026142 Ga0207698_10253989 Ga0207698_102539892 238
256 3300027907 Ga0207428_10084816 Ga0207428_100848162 238
257 3300028556 Ga0265337_1007533 Ga0265337_10075332 238
258 3300028573 Ga0265334_10002841 Ga0265334_100028415 238
259 3300028577 Ga0265318_10009714 Ga0265318_100097142 238
260 3300028653 Ga0265323_10050599 Ga0265323_100505992 238
261 3300028654 Ga0265322_10014063 Ga0265322_100140632 238
262 3300028666 Ga0265336_10002351 Ga0265336_100023512 238
263 3300028800 Ga0265338_10000059 Ga0265338_100000599 238
264 3300029957 Ga0265324_10000821 Ga0265324_100008212 238
265 3300031238 Ga0265332_10056074 Ga0265332_100560742 238
266 3300031240 Ga0265320_10027075 Ga0265320_100270751 238
267 3300031241 Ga0265325_10026166 Ga0265325_100261662 238
268 3300031247 Ga0265340_10025478 Ga0265340_100254782 238
269 3300031249 Ga0265339_10094920 Ga0265339_100949202 238
270 3300031344 Ga0265316_10115796 Ga0265316_101157962 238
271 3300031595 Ga0265313_10010238 Ga0265313_100102384 238
272 3300031711 Ga0265314_10029104 Ga0265314_100291042 238
273 3300031712 Ga0265342_10001214 Ga0265342_1000121416 238
274 3300031901 Ga0307406_10144817 Ga0307406_101448172 238
275 3300035113 Ga0373936_0196018 Ga0373936_0196018_139_864 238
276 3300035116 Ga0373945_0115615 Ga0373945_0115615_58_783 238
277 3300035118 Ga0373954_0077204 Ga0373954_0077204_813_1538 238
278 3300035118 Ga0373954_0090198 Ga0373954_0090198_342_1064 238
279 3300035119 Ga0373956_0013526 Ga0373956_0013526_1570_2295 238
280 3300035120 Ga0373957_0003893 Ga0373957_0003893_1508_2233 238
281 3300035171 Ga0373946_0036015 Ga0373946_0036015_676_1401 238
282 3300035172 Ga0373955_0030280 Ga0373955_0030280_2027_2752 238
283 3300035172 Ga0373955_0374907 Ga0373955_0374907_51_773 238
284 3300035410 Ga0373924_0005988 Ga0373924_0005988_2299_3024 238
285 3300035692 Ga0373935_0114919 Ga0373935_0114919_904_1629 238
286 3300035695 Ga0373927_0238893 Ga0373927_0238893_276_1001 238
287 3300035724 Ga0373933_0122955 Ga0373933_0122955_654_1376 238
288 3300035724 Ga0373933_0124644 Ga0373933_0124644_177_902 238
289 3300036401 Ga0373937_0007374 Ga0373937_0007374_6120_6845 238
290 3300036401 Ga0373937_0008229 Ga0373937_0008229_1687_2412 238
291 3300036401 Ga0373937_0010358 Ga0373937_0010358_714_1439 238
292 3300036401 Ga0373937_0051430 Ga0373937_0051430_2885_3607 238
293 3300036401 Ga0373937_0198097 Ga0373937_0198097_578_1294 238
294 3300037068 Ga0373925_0000779 Ga0373925_0000779_23098_23814 238
295 3300037068 Ga0373925_0108618 Ga0373925_0108618_262_987 238
296 3300037466 Ga0395898_0154104 Ga0395898_0154104_286_1002 238
297 3300037853 Ga0436364_0821490 Ga0436364_0821490_619_1341 238
298 3300039450 Ga0436363_0980729 Ga0436363_0980729_738_1463 238
299 3300044694 Ga0466963_0178155 Ga0466963_0178155_407_1132 238
300 3300045049 Ga0466959_0432720 Ga0466959_0432720_54_773 238
301 3300046459 Ga0495629_0011488 Ga0495629_0011488_3113_3838 238
302 3300046461 Ga0495641_0010720 Ga0495641_0010720_2464_3189 238
303 3300046462 Ga0495651_0044435 Ga0495651_0044435_1757_2482 238
304 3300046463 Ga0495653_0096657 Ga0495653_0096657_268_993 238
305 3300046473 Ga0495582_0066246 Ga0495582_0066246_1094_1819 238
306 3300046476 Ga0495662_0017607 Ga0495662_0017607_1635_2360 238
307 3300046511 Ga0495608_0085740 Ga0495608_0085740_879_1604 238
308 3300046514 Ga0495618_0067340 Ga0495618_0067340_92_817 238
309 3300046516 Ga0495628_0019080 Ga0495628_0019080_2444_3169 238
310 3300046516 Ga0495628_0082117 Ga0495628_0082117_1349_2074 238
311 3300046529 Ga0495652_0020248 Ga0495652_0020248_3371_4096 238
312 3300046531 Ga0495665_0040081 Ga0495665_0040081_1148_1873 238
313 3300046533 Ga0495640_0051582 Ga0495640_0051582_988_1713 238
314 3300046535 Ga0495586_0013646 Ga0495586_0013646_2385_3110 238
315 3300046535 Ga0495586_0172558 Ga0495586_0172558_463_1188 238
316 3300046536 Ga0495587_0057356 Ga0495587_0057356_923_1648 238
317 3300046543 Ga0495645_0117775 Ga0495645_0117775_178_903 238
318 3300046559 Ga0495667_0029400 Ga0495667_0029400_369_1094 238
319 3300046663 Ga0495635_0100822 Ga0495635_0100822_72_797 238
320 3300046675 Ga0495657_0052313 Ga0495657_0052313_1216_1941 238
321 3300046675 Ga0495657_0094235 Ga0495657_0094235_1051_1776 238
322 3300046675 Ga0495657_0139320 Ga0495657_0139320_51_776 238
323 3300046678 Ga0495599_0019364 Ga0495599_0019364_2943_3668 238
324 3300046678 Ga0495599_0063871 Ga0495599_0063871_1419_2144 238
325 3300046679 Ga0495623_0058542 Ga0495623_0058542_1561_2286 238
326 3300046679 Ga0495623_0059980 Ga0495623_0059980_828_1553 238
327 3300046680 Ga0495646_0064335 Ga0495646_0064335_808_1533 238
328 3300046689 Ga0495613_0003433 Ga0495613_0003433_5910_6635 238
329 3300046809 Ga0495600_0047171 Ga0495600_0047171_1510_2235 238
330 3300046809 Ga0495600_0102369 Ga0495600_0102369_372_1097 238
331 3300047315 Ga0495581_0005320 Ga0495581_0005320_985_1710 238
332 3300047317 Ga0495604_0040138 Ga0495604_0040138_2098_2823 238
333 3300047317 Ga0495604_0073276 Ga0495604_0073276_679_1404 238
334 3300047322 Ga0495680_0029697 Ga0495680_0029697_1198_1923 238
335 3300047322 Ga0495680_0085583 Ga0495680_0085583_832_1557 238
336 3300047471 Ga0495684_0089383 Ga0495684_0089383_642_1367 238
337 3300048088 Ga0495602_0013041 Ga0495602_0013041_1165_1890 238
338 3300048088 Ga0495602_0097502 Ga0495602_0097502_983_1708 238
339 3300048088 Ga0495602_0115157 Ga0495602_0115157_1182_1907 238
340 3300048912 Ga0496109_0289898 Ga0496109_0289898_150_869 238
341 3300048918 Ga0496115_0406307 Ga0496115_0406307_172_888 238
342 3300049568 Ga0501031_0000675 Ga0501031_0000675_8372_9118 238
343 3300049569 Ga0501032_0001344 Ga0501032_0001344_15060_15806 238
344 3300049571 Ga0501034_0002489 Ga0501034_0002489_2698_3444 238
345 3300049572 Ga0501036_0008489 Ga0501036_0008489_5872_6618 238
346 3300049573 Ga0501037_0000743 Ga0501037_0000743_8453_9199 238
347 3300049574 Ga0501038_0002150 Ga0501038_0002150_1677_2423 238
348 3300049574 Ga0501038_0364619 Ga0501038_0364619_384_1103 238
349 3300049576 Ga0501040_0012695 Ga0501040_0012695_1980_2726 238
350 3300049577 Ga0501041_0001788 Ga0501041_0001788_1414_2160 238
351 3300049578 Ga0501042_0045369 Ga0501042_0045369_652_1398 238
352 3300049579 Ga0501043_0002416 Ga0501043_0002416_12505_13251 238
353 3300049581 Ga0501047_0001452 Ga0501047_0001452_10154_10900 238
354 3300049581 Ga0501047_0008803 Ga0501047_0008803_8495_9241 238
355 3300049582 Ga0501048_0147408 Ga0501048_0147408_237_983 238
356 3300049584 Ga0501068_0000449 Ga0501068_0000449_12928_13674 238
357 3300049585 Ga0501069_0007288 Ga0501069_0007288_1549_2295 238
358 3300049586 Ga0501070_0022072 Ga0501070_0022072_846_1592 238
359 3300049588 Ga0501072_0002736 Ga0501072_0002736_4523_5269 238
360 3300049590 Ga0501074_0063990 Ga0501074_0063990_354_1100 238
361 3300049590 Ga0501074_0244651 Ga0501074_0244651_435_1151 238
362 3300049593 Ga0501077_0007206 Ga0501077_0007206_3775_4521 238
363 3300049741 Ga0501079_0479393 Ga0501079_0479393_29_745 238
364 3300049742 Ga0501080_0050109 Ga0501080_0050109_1407_2153 238
365 3300049744 Ga0501083_0004068 Ga0501083_0004068_8261_9007 238
366 3300049822 Ga0501035_0005249 Ga0501035_0005249_8841_9587 238
367 3300049823 Ga0501044_0004027 Ga0501044_0004027_13032_13778 238
368 3300049824 Ga0501045_0021387 Ga0501045_0021387_118_864 238
369 3300050511 nmdc:mga08y16_65693_c1 nmdc:mga08y16_65693_c1_1479_2195 238
370 3300050512 nmdc:mga0n895_236531_c1 nmdc:mga0n895_236531_c1_748_1473 238
371 3300050512 nmdc:mga0n895_28873_c1 nmdc:mga0n895_28873_c1_1814_2530 238
372 3300050513 nmdc:mga0rr50_16858_c1 nmdc:mga0rr50_16858_c1_1100_1816 238
373 3300050515 nmdc:mga0a205_135935_c1 nmdc:mga0a205_135935_c1_138_854 238
374 3300050515 nmdc:mga0a205_51221_c1 nmdc:mga0a205_51221_c1_1996_2721 238
375 3300053077 Ga0495601_0064605 Ga0495601_0064605_695_1420 238
376 3300053078 Ga0495612_0009451 Ga0495612_0009451_2432_3157 238
377 3300053078 Ga0495612_0013835 Ga0495612_0013835_1489_2214 238
378 3300053084 Ga0495595_0001206 Ga0495595_0001206_4726_5451 238
379 3300053085 Ga0495619_0010754 Ga0495619_0010754_4913_5638 238
380 3300054114 Ga0501084_0007957 Ga0501084_0007957_2942_3688 238
381 3300060353 Ga0501082_0012964 Ga0501082_0012964_809_1555 238
382 3300003320 rootH2_10176451 rootH2_101764512 239
383 3300003373 JGI25407J50210_10020236 JGI25407J50210_100202363 239
384 3300005329 Ga0070683_100035577 Ga0070683_1000355774 239
385 3300005331 Ga0070670_100464998 Ga0070670_1004649982 239
386 3300005334 Ga0068869_100182309 Ga0068869_1001823093 239
387 3300005335 Ga0070666_10057061 Ga0070666_100570612 239
388 3300005336 Ga0070680_100275660 Ga0070680_1002756602 239
389 3300005337 Ga0070682_100037652 Ga0070682_1000376522 239
390 3300005340 Ga0070689_100190115 Ga0070689_1001901152 239
391 3300005344 Ga0070661_100082474 Ga0070661_1000824741 239
392 3300005347 Ga0070668_100402865 Ga0070668_1004028652 239
393 3300005354 Ga0070675_100084216 Ga0070675_1000842162 239
394 3300005356 Ga0070674_100135371 Ga0070674_1001353712 239
395 3300005364 Ga0070673_100191314 Ga0070673_1001913141 239
396 3300005366 Ga0070659_100079788 Ga0070659_1000797882 239
397 3300005367 Ga0070667_100420322 Ga0070667_1004203222 239
398 3300005434 Ga0070709_10000377 Ga0070709_1000037727 239
399 3300005434 Ga0070709_10008315 Ga0070709_100083155 239
400 3300005434 Ga0070709_10019524 Ga0070709_100195242 239
401 3300005434 Ga0070709_10169751 Ga0070709_101697512 239
402 3300005435 Ga0070714_100001403 Ga0070714_1000014033 239
403 3300005435 Ga0070714_100040608 Ga0070714_1000406082 239
404 3300005435 Ga0070714_100058509 Ga0070714_1000585092 239
405 3300005435 Ga0070714_100192371 Ga0070714_1001923712 239
406 3300005436 Ga0070713_100054601 Ga0070713_1000546012 239
407 3300005436 Ga0070713_100209417 Ga0070713_1002094172 239
408 3300005436 Ga0070713_100272080 Ga0070713_1002720802 239
409 3300005436 Ga0070713_100297780 Ga0070713_1002977802 239
410 3300005436 Ga0070713_100323588 Ga0070713_1003235882 239
411 3300005437 Ga0070710_10000960 Ga0070710_100009608 239
412 3300005437 Ga0070710_10009633 Ga0070710_100096331 239
413 3300005437 Ga0070710_10024616 Ga0070710_100246162 239
414 3300005437 Ga0070710_10054984 Ga0070710_100549842 239
415 3300005438 Ga0070701_10018169 Ga0070701_100181692 239
416 3300005439 Ga0070711_100022050 Ga0070711_1000220502 239
417 3300005439 Ga0070711_100025523 Ga0070711_1000255232 239
418 3300005439 Ga0070711_100096145 Ga0070711_1000961452 239
419 3300005439 Ga0070711_100141980 Ga0070711_1001419802 239
420 3300005440 Ga0070705_100028799 Ga0070705_1000287994 239
421 3300005444 Ga0070694_100070536 Ga0070694_1000705363 239
422 3300005445 Ga0070708_100132755 Ga0070708_1001327552 239
423 3300005456 Ga0070678_100368515 Ga0070678_1003685152 239
424 3300005457 Ga0070662_100467645 Ga0070662_1004676452 239
425 3300005459 Ga0068867_100199803 Ga0068867_1001998032 239
426 3300005466 Ga0070685_10011144 Ga0070685_100111444 239
427 3300005467 Ga0070706_100001268 Ga0070706_1000012686 239
428 3300005467 Ga0070706_100046766 Ga0070706_1000467661 239
429 3300005467 Ga0070706_100077044 Ga0070706_1000770442 239
430 3300005467 Ga0070706_100196192 Ga0070706_1001961922 239
431 3300005467 Ga0070706_100490959 Ga0070706_1004909592 239
432 3300005468 Ga0070707_100056451 Ga0070707_1000564514 239
433 3300005468 Ga0070707_100252220 Ga0070707_1002522201 239
434 3300005468 Ga0070707_100716432 Ga0070707_1007164321 239
435 3300005471 Ga0070698_100010296 Ga0070698_1000102964 239
436 3300005471 Ga0070698_100031059 Ga0070698_1000310593 239
437 3300005518 Ga0070699_100000213 Ga0070699_10000021351 239
438 3300005518 Ga0070699_100609628 Ga0070699_1006096282 239
439 3300005530 Ga0070679_100167176 Ga0070679_1001671762 239
440 3300005535 Ga0070684_100678884 Ga0070684_1006788842 239
441 3300005536 Ga0070697_100003375 Ga0070697_10000337513 239
442 3300005539 Ga0068853_100203242 Ga0068853_1002032422 239
443 3300005545 Ga0070695_100045435 Ga0070695_1000454352 239
444 3300005546 Ga0070696_100053585 Ga0070696_1000535852 239
445 3300005548 Ga0070665_100549680 Ga0070665_1005496802 239
446 3300005549 Ga0070704_100164797 Ga0070704_1001647972 239
447 3300005563 Ga0068855_100107528 Ga0068855_1001075285 239
448 3300005564 Ga0070664_100044700 Ga0070664_1000447002 239
449 3300005578 Ga0068854_100027007 Ga0068854_1000270072 239
450 3300005614 Ga0068856_100721979 Ga0068856_1007219792 239
451 3300005718 Ga0068866_10122035 Ga0068866_101220352 239
452 3300005719 Ga0068861_100205677 Ga0068861_1002056772 239
453 3300005719 Ga0068861_100301036 Ga0068861_1003010362 239
454 3300005840 Ga0068870_10046740 Ga0068870_100467402 239
455 3300005842 Ga0068858_100116606 Ga0068858_1001166063 239
456 3300005843 Ga0068860_100106372 Ga0068860_1001063722 239
457 3300005844 Ga0068862_100372978 Ga0068862_1003729782 239
458 3300005981 Ga0081538_10000258 Ga0081538_100002585 239
459 3300005981 Ga0081538_10017309 Ga0081538_100173092 239
460 3300005981 Ga0081538_10030481 Ga0081538_100304812 239
461 3300005983 Ga0081540_1000356 Ga0081540_100035634 239
462 3300005983 Ga0081540_1047614 Ga0081540_10476142 239
463 3300006028 Ga0070717_10010846 Ga0070717_100108465 239
464 3300006028 Ga0070717_10042424 Ga0070717_100424243 239
465 3300006028 Ga0070717_10082041 Ga0070717_100820412 239
466 3300006028 Ga0070717_10177527 Ga0070717_101775272 239
467 3300006028 Ga0070717_10322108 Ga0070717_103221082 239
468 3300006038 Ga0075365_10051109 Ga0075365_100511092 239
469 3300006051 Ga0075364_10229186 Ga0075364_102291862 239
470 3300006163 Ga0070715_10091588 Ga0070715_100915882 239
471 3300006163 Ga0070715_10099582 Ga0070715_100995821 239
472 3300006173 Ga0070716_100000082 Ga0070716_10000008226 239
473 3300006175 Ga0070712_100004947 Ga0070712_1000049478 239
474 3300006175 Ga0070712_100030262 Ga0070712_1000302623 239
475 3300006175 Ga0070712_100049629 Ga0070712_1000496292 239
476 3300006175 Ga0070712_100060383 Ga0070712_1000603832 239
477 3300006175 Ga0070712_100209192 Ga0070712_1002091922 239
478 3300006178 Ga0075367_10087053 Ga0075367_100870533 239
479 3300006178 Ga0075367_10274723 Ga0075367_102747232 239
480 3300006353 Ga0075370_10014533 Ga0075370_100145332 239
481 3300006358 Ga0068871_100108858 Ga0068871_1001088582 239
482 3300006358 Ga0068871_100112352 Ga0068871_1001123522 239
483 3300006871 Ga0075434_100439088 Ga0075434_1004390882 239
484 3300006914 Ga0075436_100125385 Ga0075436_1001253852 239
485 3300007076 Ga0075435_100295112 Ga0075435_1002951122 239
486 3300009011 Ga0105251_10016785 Ga0105251_100167852 239
487 3300009101 Ga0105247_10001021 Ga0105247_1000102114 239
488 3300009147 Ga0114129_11160773 Ga0114129_111607732 239
489 3300009148 Ga0105243_10076310 Ga0105243_100763102 239
490 3300009177 Ga0105248_10610682 Ga0105248_106106822 239
491 3300009545 Ga0105237_10032375 Ga0105237_100323753 239
492 3300009551 Ga0105238_10108612 Ga0105238_101086122 239
493 3300009553 Ga0105249_10316215 Ga0105249_103162152 239
494 3300010159 Ga0099796_10024654 Ga0099796_100246542 239
495 3300010375 Ga0105239_10804189 Ga0105239_108041891 239
496 3300013100 Ga0157373_10068066 Ga0157373_100680662 239
497 3300013297 Ga0157378_10085791 Ga0157378_100857913 239
498 3300014325 Ga0163163_10291902 Ga0163163_102919021 239
499 3300014497 Ga0182008_10148930 Ga0182008_101489302 239
500 3300014968 Ga0157379_10035817 Ga0157379_100358172 239
501 3300020069 Ga0197907_10517940 Ga0197907_105179402 239
502 3300020070 Ga0206356_11280802 Ga0206356_112808023 239
503 3300020075 Ga0206349_1062031 Ga0206349_10620312 239
504 3300020077 Ga0206351_10211465 Ga0206351_102114652 239
505 3300020080 Ga0206350_10944510 Ga0206350_109445102 239
506 3300021388 Ga0213875_10004191 Ga0213875_100041914 239
507 3300021388 Ga0213875_10008337 Ga0213875_100083372 239
508 3300022467 Ga0224712_10001526 Ga0224712_100015263 239
509 3300022467 Ga0224712_10021779 Ga0224712_100217792 239
510 3300024225 Ga0224572_1007130 Ga0224572_10071302 239
511 3300024225 Ga0224572_1012941 Ga0224572_10129412 239
512 3300025898 Ga0207692_10000682 Ga0207692_100006822 239
513 3300025898 Ga0207692_10033109 Ga0207692_100331092 239
514 3300025898 Ga0207692_10041370 Ga0207692_100413703 239
515 3300025898 Ga0207692_10068382 Ga0207692_100683822 239
516 3300025900 Ga0207710_10000813 Ga0207710_1000081314 239
517 3300025901 Ga0207688_10012315 Ga0207688_100123152 239
518 3300025905 Ga0207685_10012497 Ga0207685_100124972 239
519 3300025905 Ga0207685_10023159 Ga0207685_100231593 239
520 3300025905 Ga0207685_10074177 Ga0207685_100741771 239
521 3300025906 Ga0207699_10001559 Ga0207699_100015596 239
522 3300025908 Ga0207643_10044881 Ga0207643_100448812 239
523 3300025910 Ga0207684_10000654 Ga0207684_1000065429 239
524 3300025910 Ga0207684_10036597 Ga0207684_100365975 239
525 3300025910 Ga0207684_10259450 Ga0207684_102594502 239
526 3300025914 Ga0207671_10031440 Ga0207671_100314403 239
527 3300025915 Ga0207693_10026412 Ga0207693_100264124 239
528 3300025915 Ga0207693_10036715 Ga0207693_100367152 239
529 3300025915 Ga0207693_10083098 Ga0207693_100830982 239
530 3300025915 Ga0207693_10083216 Ga0207693_100832162 239
531 3300025916 Ga0207663_10050524 Ga0207663_100505242 239
532 3300025916 Ga0207663_10052237 Ga0207663_100522374 239
533 3300025916 Ga0207663_10108674 Ga0207663_101086742 239
534 3300025916 Ga0207663_10328496 Ga0207663_103284962 239
535 3300025918 Ga0207662_10073979 Ga0207662_100739792 239
536 3300025919 Ga0207657_10028616 Ga0207657_100286163 239
537 3300025920 Ga0207649_10202082 Ga0207649_102020821 239
538 3300025922 Ga0207646_10013433 Ga0207646_100134334 239
539 3300025922 Ga0207646_10076459 Ga0207646_100764592 239
540 3300025926 Ga0207659_10247677 Ga0207659_102476772 239
541 3300025928 Ga0207700_10000879 Ga0207700_100008797 239
542 3300025928 Ga0207700_10009432 Ga0207700_100094323 239
543 3300025928 Ga0207700_10012259 Ga0207700_100122593 239
544 3300025928 Ga0207700_10025128 Ga0207700_100251282 239
545 3300025928 Ga0207700_10028916 Ga0207700_100289162 239
546 3300025928 Ga0207700_10107439 Ga0207700_101074392 239
547 3300025929 Ga0207664_10000515 Ga0207664_1000051524 239
548 3300025929 Ga0207664_10009335 Ga0207664_100093353 239
549 3300025929 Ga0207664_10017462 Ga0207664_100174624 239
550 3300025929 Ga0207664_10026482 Ga0207664_100264823 239
551 3300025929 Ga0207664_10044574 Ga0207664_100445742 239
552 3300025929 Ga0207664_10046601 Ga0207664_100466012 239
553 3300025929 Ga0207664_10071442 Ga0207664_100714422 239
554 3300025929 Ga0207664_10114611 Ga0207664_101146112 239
555 3300025929 Ga0207664_10142995 Ga0207664_101429952 239
556 3300025929 Ga0207664_10160133 Ga0207664_101601332 239
557 3300025929 Ga0207664_10197286 Ga0207664_101972863 239
558 3300025929 Ga0207664_10231130 Ga0207664_102311301 239
559 3300025929 Ga0207664_10315930 Ga0207664_103159302 239
560 3300025933 Ga0207706_10040701 Ga0207706_100407012 239
561 3300025936 Ga0207670_10250084 Ga0207670_102500842 239
562 3300025937 Ga0207669_10435211 Ga0207669_104352111 239
563 3300025939 Ga0207665_10000100 Ga0207665_1000010035 239
564 3300025939 Ga0207665_10016388 Ga0207665_100163882 239
565 3300025939 Ga0207665_10197034 Ga0207665_101970342 239
566 3300025941 Ga0207711_10095886 Ga0207711_100958862 239
567 3300025942 Ga0207689_10211710 Ga0207689_102117102 239
568 3300025944 Ga0207661_10234414 Ga0207661_102344142 239
569 3300025981 Ga0207640_10049938 Ga0207640_100499382 239
570 3300025986 Ga0207658_10225842 Ga0207658_102258422 239
571 3300026023 Ga0207677_10080927 Ga0207677_100809273 239
572 3300026035 Ga0207703_10375908 Ga0207703_103759082 239
573 3300026041 Ga0207639_10549487 Ga0207639_105494871 239
574 3300026075 Ga0207708_10194941 Ga0207708_101949412 239
575 3300026078 Ga0207702_10053111 Ga0207702_100531112 239
576 3300026088 Ga0207641_10562550 Ga0207641_105625501 239
577 3300026116 Ga0207674_10065524 Ga0207674_100655242 239
578 3300026118 Ga0207675_100096851 Ga0207675_1000968512 239
579 3300028381 Ga0268264_10370255 Ga0268264_103702552 239
580 3300031507 Ga0307509_10018890 Ga0307509_100188904 239
581 3300031616 Ga0307508_10000773 Ga0307508_1000077315 239
582 3300033180 Ga0307510_10138705 Ga0307510_101387052 239
583 3300034820 Ga0373959_0004805 Ga0373959_0004805_930_1652 239
584 3300035088 Ga0373940_0004238 Ga0373940_0004238_1710_2432 239
585 3300035091 Ga0373951_0074284 Ga0373951_0074284_13_735 239
586 3300035113 Ga0373936_0005075 Ga0373936_0005075_196_918 239
587 3300035113 Ga0373936_0009359 Ga0373936_0009359_2235_2957 239
588 3300035113 Ga0373936_0015325 Ga0373936_0015325_1939_2691 239
589 3300035115 Ga0373941_0017037 Ga0373941_0017037_543_1265 239
590 3300035116 Ga0373945_0005101 Ga0373945_0005101_943_1665 239
591 3300035117 Ga0373953_0005118 Ga0373953_0005118_561_1283 239
592 3300035118 Ga0373954_0033563 Ga0373954_0033563_1624_2346 239
593 3300035119 Ga0373956_0021836 Ga0373956_0021836_1769_2521 239
594 3300035119 Ga0373956_0106793 Ga0373956_0106793_219_941 239
595 3300035121 Ga0373960_0040736 Ga0373960_0040736_231_953 239
596 3300035172 Ga0373955_0005298 Ga0373955_0005298_4016_4738 239
597 3300035172 Ga0373955_0013567 Ga0373955_0013567_2640_3392 239
598 3300035207 Ga0373942_0053647 Ga0373942_0053647_26_748 239
599 3300035410 Ga0373924_0004734 Ga0373924_0004734_2889_3611 239
600 3300035691 Ga0373931_0048120 Ga0373931_0048120_75_797 239
601 3300035692 Ga0373935_0078910 Ga0373935_0078910_1351_2091 239
602 3300035692 Ga0373935_0339616 Ga0373935_0339616_162_884 239
603 3300035695 Ga0373927_0034598 Ga0373927_0034598_364_1086 239
604 3300035695 Ga0373927_0038905 Ga0373927_0038905_1827_2549 239
605 3300035724 Ga0373933_0033398 Ga0373933_0033398_2171_2893 239
606 3300035724 Ga0373933_0075580 Ga0373933_0075580_562_1314 239
607 3300035724 Ga0373933_0082908 Ga0373933_0082908_195_917 239
608 3300035724 Ga0373933_0164469 Ga0373933_0164469_95_820 239
609 3300035725 Ga0373947_0018422 Ga0373947_0018422_2692_3444 239
610 3300035725 Ga0373947_0040507 Ga0373947_0040507_873_1595 239
611 3300036401 Ga0373937_0002125 Ga0373937_0002125_10716_11441 239
612 3300036401 Ga0373937_0020657 Ga0373937_0020657_2826_3548 239
613 3300036401 Ga0373937_0033873 Ga0373937_0033873_3217_3939 239
614 3300036401 Ga0373937_0083306 Ga0373937_0083306_463_1185 239
615 3300036401 Ga0373937_0165860 Ga0373937_0165860_734_1456 239
616 3300036401 Ga0373937_0469191 Ga0373937_0469191_352_1074 239
617 3300036459 Ga0372808_013280 Ga0372808_013280_281_1000 239
618 3300037068 Ga0373925_0000231 Ga0373925_0000231_4065_4790 239
619 3300037068 Ga0373925_0000554 Ga0373925_0000554_15963_16724 239
620 3300037068 Ga0373925_0014345 Ga0373925_0014345_4704_5456 239
621 3300037068 Ga0373925_0334557 Ga0373925_0334557_205_927 239
622 3300037068 Ga0373925_0675273 Ga0373925_0675273_60_782 239
623 3300037853 Ga0436364_0010280 Ga0436364_0010280_8637_9359 239
624 3300037853 Ga0436364_0241292 Ga0436364_0241292_230_952 239
625 3300037853 Ga0436364_0496703 Ga0436364_0496703_397_1119 239
626 3300037853 Ga0436364_1237330 Ga0436364_1237330_495_1247 239
627 3300037853 Ga0436364_1404373 Ga0436364_1404373_3047_3769 239
628 3300039437 Ga0436365_0614644 Ga0436365_0614644_608_1330 239
629 3300039438 Ga0436360_0246735 Ga0436360_0246735_36_758 239
630 3300039450 Ga0436363_1328754 Ga0436363_1328754_1656_2378 239
631 3300044683 Ga0466965_0048583 Ga0466965_0048583_1233_1955 239
632 3300044901 Ga0466960_0024774 Ga0466960_0024774_1352_2074 239
633 3300045049 Ga0466959_0345553 Ga0466959_0345553_60_800 239
634 3300045836 Ga0466958_0160530 Ga0466958_0160530_103_825 239
635 3300045976 Ga0466967_0280250 Ga0466967_0280250_481_1203 239
636 3300045976 Ga0466967_0390062 Ga0466967_0390062_253_975 239
637 3300045976 Ga0466967_0547377 Ga0466967_0547377_170_892 239
638 3300046454 Ga0495592_0065299 Ga0495592_0065299_922_1644 239
639 3300046454 Ga0495592_0082818 Ga0495592_0082818_1207_1959 239
640 3300046455 Ga0495603_0001113 Ga0495603_0001113_14741_15463 239
641 3300046461 Ga0495641_0016732 Ga0495641_0016732_2998_3720 239
642 3300046462 Ga0495651_0021252 Ga0495651_0021252_642_1394 239
643 3300046462 Ga0495651_0022414 Ga0495651_0022414_2215_2937 239
644 3300046463 Ga0495653_0042044 Ga0495653_0042044_2493_3215 239
645 3300046463 Ga0495653_0086891 Ga0495653_0086891_640_1392 239
646 3300046463 Ga0495653_0094982 Ga0495653_0094982_799_1521 239
647 3300046472 Ga0495580_0058359 Ga0495580_0058359_1906_2628 239
648 3300046473 Ga0495582_0008719 Ga0495582_0008719_2412_3134 239
649 3300046475 Ga0495639_0000902 Ga0495639_0000902_11745_12467 239
650 3300046477 Ga0495664_0046511 Ga0495664_0046511_531_1253 239
651 3300046477 Ga0495664_0105754 Ga0495664_0105754_194_916 239
652 3300046499 Ga0495594_0004077 Ga0495594_0004077_1398_2120 239
653 3300046511 Ga0495608_0111328 Ga0495608_0111328_250_972 239
654 3300046511 Ga0495608_0218797 Ga0495608_0218797_223_975 239
655 3300046511 Ga0495608_0404313 Ga0495608_0404313_47_772 239
656 3300046514 Ga0495618_0016207 Ga0495618_0016207_3470_4192 239
657 3300046514 Ga0495618_0060587 Ga0495618_0060587_859_1611 239
658 3300046516 Ga0495628_0263238 Ga0495628_0263238_201_923 239
659 3300046517 Ga0495630_0010186 Ga0495630_0010186_2826_3548 239
660 3300046529 Ga0495652_0249349 Ga0495652_0249349_475_1197 239
661 3300046529 Ga0495652_0279741 Ga0495652_0279741_381_1133 239
662 3300046529 Ga0495652_0392249 Ga0495652_0392249_180_902 239
663 3300046536 Ga0495587_0062098 Ga0495587_0062098_343_1065 239
664 3300046543 Ga0495645_0075853 Ga0495645_0075853_1604_2326 239
665 3300046559 Ga0495667_0020210 Ga0495667_0020210_864_1586 239
666 3300046559 Ga0495667_0041872 Ga0495667_0041872_1481_2203 239
667 3300046559 Ga0495667_0109291 Ga0495667_0109291_488_1240 239
668 3300046642 Ga0495634_0037462 Ga0495634_0037462_87_809 239
669 3300046663 Ga0495635_0028518 Ga0495635_0028518_1386_2108 239
670 3300046663 Ga0495635_0238789 Ga0495635_0238789_295_1047 239
671 3300046674 Ga0495588_0007147 Ga0495588_0007147_2169_2891 239
672 3300046675 Ga0495657_0089568 Ga0495657_0089568_768_1490 239
673 3300046675 Ga0495657_0356201 Ga0495657_0356201_85_807 239
674 3300046679 Ga0495623_0089508 Ga0495623_0089508_641_1393 239
675 3300046679 Ga0495623_0145632 Ga0495623_0145632_114_839 239
676 3300046680 Ga0495646_0236485 Ga0495646_0236485_23_748 239
677 3300046681 Ga0495647_0022181 Ga0495647_0022181_652_1374 239
678 3300046683 Ga0495658_0011799 Ga0495658_0011799_226_948 239
679 3300046689 Ga0495613_0007035 Ga0495613_0007035_2485_3207 239
680 3300046809 Ga0495600_0192535 Ga0495600_0192535_403_1155 239
681 3300047317 Ga0495604_0037480 Ga0495604_0037480_2660_3382 239
682 3300047319 Ga0495674_0170529 Ga0495674_0170529_844_1566 239
683 3300047322 Ga0495680_0019030 Ga0495680_0019030_890_1642 239
684 3300047322 Ga0495680_0046315 Ga0495680_0046315_741_1463 239
685 3300047322 Ga0495680_0347063 Ga0495680_0347063_288_1013 239
686 3300047444 Ga0495675_0004262 Ga0495675_0004262_5941_6663 239
687 3300047444 Ga0495675_0124402 Ga0495675_0124402_472_1197 239
688 3300047471 Ga0495684_0030940 Ga0495684_0030940_1149_1901 239
689 3300047471 Ga0495684_0116567 Ga0495684_0116567_240_962 239
690 3300047471 Ga0495684_0121323 Ga0495684_0121323_1126_1848 239
691 3300047471 Ga0495684_0188584 Ga0495684_0188584_18_740 239
692 3300047471 Ga0495684_0223052 Ga0495684_0223052_89_811 239
693 3300047673 Ga0495593_0006460 Ga0495593_0006460_2425_3147 239
694 3300048088 Ga0495602_0019899 Ga0495602_0019899_281_1006 239
695 3300048088 Ga0495602_0049359 Ga0495602_0049359_1974_2696 239
696 3300048088 Ga0495602_0201218 Ga0495602_0201218_58_810 239
697 3300048089 Ga0495614_0013260 Ga0495614_0013260_2307_3029 239
698 3300048903 Ga0496100_0037878 Ga0496100_0037878_246_968 239
699 3300048907 Ga0496104_0037090 Ga0496104_0037090_2212_2934 239
700 3300048908 Ga0496105_0423648 Ga0496105_0423648_135_857 239
701 3300048910 Ga0496107_0094315 Ga0496107_0094315_1432_2154 239
702 3300048914 Ga0496111_0103140 Ga0496111_0103140_906_1628 239
703 3300048915 Ga0496112_0517368 Ga0496112_0517368_258_998 239
704 3300048917 Ga0496114_0041577 Ga0496114_0041577_1439_2161 239
705 3300048918 Ga0496115_0098262 Ga0496115_0098262_1189_1911 239
706 3300049571 Ga0501034_0384329 Ga0501034_0384329_97_825 239
707 3300050490 nmdc:mga03n38_3102_c1 nmdc:mga03n38_3102_c1_1106_1840 239
708 3300050494 nmdc:mga06z11_2123_c1 nmdc:mga06z11_2123_c1_2224_2958 239
709 3300050494 nmdc:mga06z11_3600_c1 nmdc:mga06z11_3600_c1_2712_3443 239
710 3300050496 nmdc:mga07m45_44537_c1 nmdc:mga07m45_44537_c1_1402_2133 239
711 3300050507 nmdc:mga05p37_801902_c1 nmdc:mga05p37_801902_c1_150_875 239
712 3300050512 nmdc:mga0n895_415844_c1 nmdc:mga0n895_415844_c1_41_763 239
713 3300050512 nmdc:mga0n895_580640_c1 nmdc:mga0n895_580640_c1_152_874 239
714 3300050515 nmdc:mga0a205_231803_c1 nmdc:mga0a205_231803_c1_797_1519 239
715 3300053078 Ga0495612_0012451 Ga0495612_0012451_224_946 239
716 3300053078 Ga0495612_0073284 Ga0495612_0073284_599_1321 239
717 3300053085 Ga0495619_0027888 Ga0495619_0027888_368_1090 239
718 3300002076 JGI24749J21850_1006588 JGI24749J21850_10065882 240
719 3300003373 JGI25407J50210_10000245 JGI25407J50210_1000024510 240
720 3300005327 Ga0070658_10005200 Ga0070658_100052006 240
721 3300005328 Ga0070676_10142107 Ga0070676_101421072 240
722 3300005329 Ga0070683_100002200 Ga0070683_1000022001 240
723 3300005329 Ga0070683_100051708 Ga0070683_1000517083 240
724 3300005329 Ga0070683_100222354 Ga0070683_1002223542 240
725 3300005331 Ga0070670_100077924 Ga0070670_1000779242 240
726 3300005334 Ga0068869_100002294 Ga0068869_1000022949 240
727 3300005337 Ga0070682_100182060 Ga0070682_1001820602 240
728 3300005338 Ga0068868_100004349 Ga0068868_1000043492 240
729 3300005339 Ga0070660_100077757 Ga0070660_1000777572 240
730 3300005341 Ga0070691_10092880 Ga0070691_100928802 240
731 3300005344 Ga0070661_100007295 Ga0070661_1000072952 240
732 3300005344 Ga0070661_100012215 Ga0070661_1000122152 240
733 3300005344 Ga0070661_100528106 Ga0070661_1005281062 240
734 3300005345 Ga0070692_10058082 Ga0070692_100580822 240
735 3300005347 Ga0070668_100053649 Ga0070668_1000536492 240
736 3300005354 Ga0070675_100009075 Ga0070675_1000090755 240
737 3300005354 Ga0070675_100542894 Ga0070675_1005428941 240
738 3300005356 Ga0070674_100154153 Ga0070674_1001541532 240
739 3300005356 Ga0070674_100236079 Ga0070674_1002360792 240
740 3300005364 Ga0070673_100031282 Ga0070673_1000312822 240
741 3300005364 Ga0070673_100221662 Ga0070673_1002216623 240
742 3300005366 Ga0070659_100070598 Ga0070659_1000705982 240
743 3300005367 Ga0070667_100366100 Ga0070667_1003661002 240
744 3300005435 Ga0070714_100270072 Ga0070714_1002700722 240
745 3300005436 Ga0070713_100200460 Ga0070713_1002004602 240
746 3300005441 Ga0070700_100009766 Ga0070700_1000097666 240
747 3300005441 Ga0070700_100082525 Ga0070700_1000825252 240
748 3300005445 Ga0070708_100053014 Ga0070708_1000530142 240
749 3300005456 Ga0070678_100057307 Ga0070678_1000573073 240
750 3300005456 Ga0070678_100446528 Ga0070678_1004465282 240
751 3300005457 Ga0070662_100079467 Ga0070662_1000794672 240
752 3300005458 Ga0070681_10110721 Ga0070681_101107212 240
753 3300005458 Ga0070681_10116504 Ga0070681_101165042 240
754 3300005466 Ga0070685_10010560 Ga0070685_100105605 240
755 3300005471 Ga0070698_100038664 Ga0070698_1000386644 240
756 3300005530 Ga0070679_100089352 Ga0070679_1000893522 240
757 3300005530 Ga0070679_100093281 Ga0070679_1000932812 240
758 3300005535 Ga0070684_100003000 Ga0070684_1000030005 240
759 3300005535 Ga0070684_100049353 Ga0070684_1000493532 240
760 3300005535 Ga0070684_100078319 Ga0070684_1000783192 240
761 3300005535 Ga0070684_100181385 Ga0070684_1001813853 240
762 3300005563 Ga0068855_100143516 Ga0068855_1001435162 240
763 3300005564 Ga0070664_100000709 Ga0070664_1000007095 240
764 3300005564 Ga0070664_100065752 Ga0070664_1000657526 240
765 3300005564 Ga0070664_100347134 Ga0070664_1003471342 240
766 3300005616 Ga0068852_100009879 Ga0068852_1000098795 240
767 3300005616 Ga0068852_100539514 Ga0068852_1005395142 240
768 3300005617 Ga0068859_100089640 Ga0068859_1000896403 240
769 3300005618 Ga0068864_100091147 Ga0068864_1000911472 240
770 3300005718 Ga0068866_10197441 Ga0068866_101974412 240
771 3300005719 Ga0068861_100058068 Ga0068861_1000580682 240
772 3300005719 Ga0068861_100576841 Ga0068861_1005768412 240
773 3300005841 Ga0068863_100007563 Ga0068863_1000075632 240
774 3300005842 Ga0068858_100000141 Ga0068858_10000014172 240
775 3300005844 Ga0068862_100000004 Ga0068862_100000004235 240
776 3300005844 Ga0068862_100015926 Ga0068862_1000159262 240
777 3300005937 Ga0081455_10001616 Ga0081455_1000161613 240
778 3300005937 Ga0081455_10002768 Ga0081455_100027686 240
779 3300005937 Ga0081455_10016246 Ga0081455_100162465 240
780 3300005937 Ga0081455_10027643 Ga0081455_100276437 240
781 3300005937 Ga0081455_10070163 Ga0081455_100701633 240
782 3300005937 Ga0081455_10096067 Ga0081455_100960673 240
783 3300005937 Ga0081455_10137893 Ga0081455_101378932 240
784 3300005981 Ga0081538_10000506 Ga0081538_1000050616 240
785 3300005981 Ga0081538_10001127 Ga0081538_1000112714 240
786 3300005981 Ga0081538_10004909 Ga0081538_100049097 240
787 3300005981 Ga0081538_10011657 Ga0081538_100116576 240
788 3300005981 Ga0081538_10022452 Ga0081538_100224524 240
789 3300005981 Ga0081538_10182342 Ga0081538_101823422 240
790 3300005983 Ga0081540_1003879 Ga0081540_100387910 240
791 3300005985 Ga0081539_10002139 Ga0081539_1000213921 240
792 3300005985 Ga0081539_10011478 Ga0081539_100114782 240
793 3300005985 Ga0081539_10015588 Ga0081539_100155884 240
794 3300005985 Ga0081539_10022338 Ga0081539_100223381 240
795 3300006051 Ga0075364_10047373 Ga0075364_100473732 240
796 3300006844 Ga0075428_100180406 Ga0075428_1001804062 240
797 3300006844 Ga0075428_100393168 Ga0075428_1003931682 240
798 3300006846 Ga0075430_100001691 Ga0075430_10000169119 240
799 3300006846 Ga0075430_100007329 Ga0075430_1000073296 240
800 3300006847 Ga0075431_100172451 Ga0075431_1001724512 240
801 3300006847 Ga0075431_100236671 Ga0075431_1002366711 240
802 3300006847 Ga0075431_100544165 Ga0075431_1005441652 240
803 3300006871 Ga0075434_100219036 Ga0075434_1002190362 240
804 3300006880 Ga0075429_100139334 Ga0075429_1001393342 240
805 3300006880 Ga0075429_100149226 Ga0075429_1001492262 240
806 3300006881 Ga0068865_100492920 Ga0068865_1004929202 240
807 3300006931 Ga0097620_100089640 Ga0097620_1000896403 240
808 3300009093 Ga0105240_10019152 Ga0105240_100191524 240
809 3300009094 Ga0111539_10001616 Ga0111539_1000161617 240
810 3300009094 Ga0111539_10025348 Ga0111539_100253482 240
811 3300009094 Ga0111539_10790100 Ga0111539_107901001 240
812 3300009098 Ga0105245_10002942 Ga0105245_100029422 240
813 3300009098 Ga0105245_10024872 Ga0105245_100248722 240
814 3300009101 Ga0105247_10001810 Ga0105247_100018102 240
815 3300009101 Ga0105247_10101128 Ga0105247_101011282 240
816 3300009147 Ga0114129_10032040 Ga0114129_100320406 240
817 3300009147 Ga0114129_10073744 Ga0114129_100737446 240
818 3300009147 Ga0114129_10150784 Ga0114129_101507844 240
819 3300009147 Ga0114129_10236923 Ga0114129_102369232 240
820 3300009147 Ga0114129_10281565 Ga0114129_102815653 240
821 3300009148 Ga0105243_10045283 Ga0105243_100452836 240
822 3300009148 Ga0105243_10085493 Ga0105243_100854933 240
823 3300009148 Ga0105243_10297540 Ga0105243_102975402 240
824 3300009176 Ga0105242_10165076 Ga0105242_101650762 240
825 3300009176 Ga0105242_10510574 Ga0105242_105105742 240
826 3300009176 Ga0105242_10786904 Ga0105242_107869042 240
827 3300009177 Ga0105248_10089093 Ga0105248_100890933 240
828 3300009177 Ga0105248_10137082 Ga0105248_101370822 240
829 3300009177 Ga0105248_10312941 Ga0105248_103129412 240
830 3300009551 Ga0105238_10721806 Ga0105238_107218062 240
831 3300009551 Ga0105238_10772992 Ga0105238_107729922 240
832 3300009553 Ga0105249_10376849 Ga0105249_103768492 240
833 3300009553 Ga0105249_10705820 Ga0105249_107058202 240
834 3300010375 Ga0105239_10094558 Ga0105239_100945584 240
835 3300010375 Ga0105239_10684727 Ga0105239_106847271 240
836 3300011119 Ga0105246_10031222 Ga0105246_100312222 240
837 3300011119 Ga0105246_10469086 Ga0105246_104690862 240
838 3300013105 Ga0157369_10015933 Ga0157369_100159338 240
839 3300013297 Ga0157378_10338367 Ga0157378_103383672 240
840 3300013308 Ga0157375_10037718 Ga0157375_100377186 240
841 3300013308 Ga0157375_10463115 Ga0157375_104631152 240
842 3300013308 Ga0157375_10537222 Ga0157375_105372222 240
843 3300014325 Ga0163163_10009790 Ga0163163_100097903 240
844 3300014325 Ga0163163_10026392 Ga0163163_100263922 240
845 3300014325 Ga0163163_10093464 Ga0163163_100934643 240
846 3300014325 Ga0163163_10105533 Ga0163163_101055332 240
847 3300014326 Ga0157380_10282069 Ga0157380_102820692 240
848 3300014497 Ga0182008_10173991 Ga0182008_101739911 240
849 3300014745 Ga0157377_10028182 Ga0157377_100281823 240
850 3300014968 Ga0157379_10005115 Ga0157379_1000511512 240
851 3300017792 Ga0163161_10384634 Ga0163161_103846342 240
852 3300020082 Ga0206353_10705757 Ga0206353_107057572 240
853 3300025899 Ga0207642_10032509 Ga0207642_100325092 240
854 3300025900 Ga0207710_10000092 Ga0207710_10000092106 240
855 3300025901 Ga0207688_10008728 Ga0207688_100087283 240
856 3300025907 Ga0207645_10132391 Ga0207645_101323912 240
857 3300025907 Ga0207645_10145447 Ga0207645_101454472 240
858 3300025908 Ga0207643_10055822 Ga0207643_100558223 240
859 3300025909 Ga0207705_10047595 Ga0207705_100475952 240
860 3300025912 Ga0207707_10060284 Ga0207707_100602843 240
861 3300025912 Ga0207707_10101432 Ga0207707_101014322 240
862 3300025918 Ga0207662_10020450 Ga0207662_100204504 240
863 3300025920 Ga0207649_10071903 Ga0207649_100719032 240
864 3300025920 Ga0207649_10074921 Ga0207649_100749213 240
865 3300025921 Ga0207652_10058565 Ga0207652_100585652 240
866 3300025921 Ga0207652_10244407 Ga0207652_102444072 240
867 3300025923 Ga0207681_10266403 Ga0207681_102664032 240
868 3300025925 Ga0207650_10039344 Ga0207650_100393443 240
869 3300025926 Ga0207659_10004425 Ga0207659_100044252 240
870 3300025926 Ga0207659_10184386 Ga0207659_101843862 240
871 3300025927 Ga0207687_10163193 Ga0207687_101631932 240
872 3300025933 Ga0207706_10004178 Ga0207706_100041783 240
873 3300025934 Ga0207686_10647108 Ga0207686_106471081 240
874 3300025936 Ga0207670_10034163 Ga0207670_100341633 240
875 3300025937 Ga0207669_10317924 Ga0207669_103179242 240
876 3300025940 Ga0207691_10299901 Ga0207691_102999012 240
877 3300025941 Ga0207711_10430369 Ga0207711_104303692 240
878 3300025942 Ga0207689_10004008 Ga0207689_1000400810 240
879 3300025942 Ga0207689_10097397 Ga0207689_100973972 240
880 3300025942 Ga0207689_10143209 Ga0207689_101432092 240
881 3300025944 Ga0207661_10006800 Ga0207661_100068007 240
882 3300025944 Ga0207661_10177633 Ga0207661_101776332 240
883 3300025945 Ga0207679_10005780 Ga0207679_100057803 240
884 3300025945 Ga0207679_10410141 Ga0207679_104101412 240
885 3300025960 Ga0207651_10093960 Ga0207651_100939602 240
886 3300025960 Ga0207651_10181034 Ga0207651_101810343 240
887 3300025961 Ga0207712_10057681 Ga0207712_100576812 240
888 3300025972 Ga0207668_10108153 Ga0207668_101081532 240
889 3300025981 Ga0207640_10090480 Ga0207640_100904802 240
890 3300026023 Ga0207677_10005659 Ga0207677_100056592 240
891 3300026035 Ga0207703_10000147 Ga0207703_1000014767 240
892 3300026035 Ga0207703_10338804 Ga0207703_103388042 240
893 3300026075 Ga0207708_10002233 Ga0207708_1000223314 240
894 3300026075 Ga0207708_10057411 Ga0207708_100574112 240
895 3300026088 Ga0207641_10013621 Ga0207641_100136213 240
896 3300026089 Ga0207648_10105956 Ga0207648_101059563 240
897 3300026089 Ga0207648_10185317 Ga0207648_101853172 240
898 3300026095 Ga0207676_10125068 Ga0207676_101250683 240
899 3300026116 Ga0207674_10080516 Ga0207674_100805162 240
900 3300026118 Ga0207675_100016647 Ga0207675_10001664710 240
901 3300026118 Ga0207675_100302972 Ga0207675_1003029722 240
902 3300026118 Ga0207675_100682336 Ga0207675_1006823362 240
903 3300026121 Ga0207683_10055321 Ga0207683_100553212 240
904 3300026121 Ga0207683_10072865 Ga0207683_100728652 240
905 3300026121 Ga0207683_10166471 Ga0207683_101664712 240
906 3300027907 Ga0207428_10011911 Ga0207428_100119113 240
907 3300027907 Ga0207428_10249255 Ga0207428_102492552 240
908 3300027907 Ga0207428_10431996 Ga0207428_104319962 240
909 3300028379 Ga0268266_10036260 Ga0268266_100362602 240
910 3300028380 Ga0268265_10000009 Ga0268265_10000009120 240
911 3300028380 Ga0268265_10011087 Ga0268265_100110872 240
912 3300028381 Ga0268264_10239901 Ga0268264_102399012 240
913 3300031548 Ga0307408_100058048 Ga0307408_1000580483 240
914 3300031616 Ga0307508_10022967 Ga0307508_100229675 240
915 3300031730 Ga0307516_10090310 Ga0307516_100903103 240
916 3300031731 Ga0307405_10323592 Ga0307405_103235922 240
917 3300031731 Ga0307405_10356484 Ga0307405_103564842 240
918 3300031852 Ga0307410_10111961 Ga0307410_101119612 240
919 3300031852 Ga0307410_10787588 Ga0307410_107875881 240
920 3300031901 Ga0307406_10025635 Ga0307406_100256351 240
921 3300031995 Ga0307409_100014296 Ga0307409_1000142963 240
922 3300031995 Ga0307409_100228455 Ga0307409_1002284552 240
923 3300031995 Ga0307409_100862256 Ga0307409_1008622561 240
924 3300032002 Ga0307416_100027141 Ga0307416_1000271412 240
925 3300032002 Ga0307416_100140536 Ga0307416_1001405362 240
926 3300032002 Ga0307416_100391909 Ga0307416_1003919092 240
927 3300032002 Ga0307416_100559727 Ga0307416_1005597272 240
928 3300032002 Ga0307416_100577483 Ga0307416_1005774831 240
929 3300032005 Ga0307411_10085920 Ga0307411_100859202 240
930 3300032126 Ga0307415_100000782 Ga0307415_10000078212 240
931 3300032126 Ga0307415_100035544 Ga0307415_1000355442 240
932 3300032126 Ga0307415_100303898 Ga0307415_1003038982 240
933 3300037068 Ga0373925_0250578 Ga0373925_0250578_684_1409 240
934 3300037312 Ga0395899_0005516 Ga0395899_0005516_3835_4557 240
935 3300037312 Ga0395899_0023085 Ga0395899_0023085_2247_2969 240
936 3300037312 Ga0395899_0023972 Ga0395899_0023972_1259_1984 240
937 3300037312 Ga0395899_0077434 Ga0395899_0077434_581_1306 240
938 3300037312 Ga0395899_0167572 Ga0395899_0167572_611_1336 240
939 3300037312 Ga0395899_0240888 Ga0395899_0240888_50_775 240
940 3300037418 Ga0395900_0029569 Ga0395900_0029569_2489_3214 240
941 3300037418 Ga0395900_0030702 Ga0395900_0030702_1436_2161 240
942 3300037418 Ga0395900_0035605 Ga0395900_0035605_3693_4415 240
943 3300037418 Ga0395900_0039982 Ga0395900_0039982_2362_3084 240
944 3300037418 Ga0395900_0044740 Ga0395900_0044740_1488_2213 240
945 3300037418 Ga0395900_0047123 Ga0395900_0047123_2950_3675 240
946 3300037418 Ga0395900_0048875 Ga0395900_0048875_3191_3913 240
947 3300037418 Ga0395900_0055124 Ga0395900_0055124_1017_1742 240
948 3300037418 Ga0395900_0080771 Ga0395900_0080771_1928_2653 240
949 3300037418 Ga0395900_0149599 Ga0395900_0149599_968_1690 240
950 3300037466 Ga0395898_0007057 Ga0395898_0007057_5208_5930 240
951 3300037466 Ga0395898_0014253 Ga0395898_0014253_1901_2626 240
952 3300037466 Ga0395898_0029725 Ga0395898_0029725_807_1532 240
953 3300037466 Ga0395898_0039170 Ga0395898_0039170_857_1582 240
954 3300037466 Ga0395898_0076991 Ga0395898_0076991_749_1471 240
955 3300037466 Ga0395898_0114384 Ga0395898_0114384_834_1556 240
956 3300037466 Ga0395898_0133395 Ga0395898_0133395_197_922 240
957 3300037466 Ga0395898_0197322 Ga0395898_0197322_1086_1811 240
958 3300037466 Ga0395898_0412620 Ga0395898_0412620_108_830 240
959 3300037471 Ga0395905_0009185 Ga0395905_0009185_5359_6081 240
960 3300037471 Ga0395905_0017073 Ga0395905_0017073_2465_3190 240
961 3300037471 Ga0395905_0018244 Ga0395905_0018244_1418_2143 240
962 3300037471 Ga0395905_0035080 Ga0395905_0035080_1045_1770 240
963 3300037471 Ga0395905_0057431 Ga0395905_0057431_2082_2804 240
964 3300037471 Ga0395905_0081703 Ga0395905_0081703_460_1182 240
965 3300037471 Ga0395905_0135021 Ga0395905_0135021_47_769 240
966 3300037471 Ga0395905_0159127 Ga0395905_0159127_516_1238 240
967 3300037471 Ga0395905_0730980 Ga0395905_0730980_86_811 240
968 3300038443 Ga0395901_0020563 Ga0395901_0020563_2425_3150 240
969 3300038443 Ga0395901_0024346 Ga0395901_0024346_4501_5226 240
970 3300038443 Ga0395901_0029599 Ga0395901_0029599_4528_5253 240
971 3300038443 Ga0395901_0030170 Ga0395901_0030170_1454_2179 240
972 3300038443 Ga0395901_0053689 Ga0395901_0053689_1143_1865 240
973 3300038443 Ga0395901_0064867 Ga0395901_0064867_514_1239 240
974 3300038443 Ga0395901_0090089 Ga0395901_0090089_1213_1938 240
975 3300038443 Ga0395901_0160058 Ga0395901_0160058_335_1060 240
976 3300038443 Ga0395901_0292959 Ga0395901_0292959_561_1283 240
977 3300038443 Ga0395901_0631449 Ga0395901_0631449_240_962 240
978 3300038443 Ga0395901_0935609 Ga0395901_0935609_62_784 240
979 3300041512 Ga0451853_0135350 Ga0451853_0135350_1110_1835 240
980 3300042184 Ga0450908_012200 Ga0450908_012200_420_1145 240
981 3300042436 Ga0439435_0037468 Ga0439435_0037468_42_767 240
982 3300046459 Ga0495629_0051026 Ga0495629_0051026_295_1020 240
983 3300046473 Ga0495582_0087275 Ga0495582_0087275_592_1317 240
984 3300046499 Ga0495594_0022643 Ga0495594_0022643_2179_2904 240
985 3300046499 Ga0495594_0337765 Ga0495594_0337765_79_804 240
986 3300046615 Ga0495656_0144651 Ga0495656_0144651_192_917 240
987 3300046615 Ga0495656_0340372 Ga0495656_0340372_40_765 240
988 3300046664 Ga0495659_0087105 Ga0495659_0087105_99_821 240
989 3300046691 Ga0495670_0267504 Ga0495670_0267504_100_822 240
990 3300046794 Ga0495589_0123796 Ga0495589_0123796_238_963 240
991 3300047322 Ga0495680_0145810 Ga0495680_0145810_542_1267 240
992 3300048904 Ga0496101_0005465 Ga0496101_0005465_666_1391 240
993 3300048907 Ga0496104_0116546 Ga0496104_0116546_331_1176 240
994 3300048907 Ga0496104_0269116 Ga0496104_0269116_295_1020 240
995 3300048908 Ga0496105_0151016 Ga0496105_0151016_858_1583 240
996 3300048910 Ga0496107_0038018 Ga0496107_0038018_1787_2512 240
997 3300048911 Ga0496108_0000128 Ga0496108_0000128_11734_12459 240
998 3300048911 Ga0496108_0087238 Ga0496108_0087238_1146_1868 240
999 3300048911 Ga0496108_0234662 Ga0496108_0234662_29_754 240
1000 3300048912 Ga0496109_0062422 Ga0496109_0062422_628_1353 240
1001 3300048912 Ga0496109_0120199 Ga0496109_0120199_270_995 240
1002 3300048912 Ga0496109_0652667 Ga0496109_0652667_153_878 240
1003 3300048913 Ga0496110_0025180 Ga0496110_0025180_787_1512 240
1004 3300048913 Ga0496110_0232255 Ga0496110_0232255_30_755 240
1005 3300048914 Ga0496111_0271774 Ga0496111_0271774_320_1045 240
1006 3300048914 Ga0496111_0455477 Ga0496111_0455477_82_810 240
1007 3300048915 Ga0496112_0004178 Ga0496112_0004178_6907_7632 240
1008 3300048915 Ga0496112_0011017 Ga0496112_0011017_6956_7681 240
1009 3300048916 Ga0496113_0034712 Ga0496113_0034712_1222_1947 240
1010 3300048916 Ga0496113_0068024 Ga0496113_0068024_595_1320 240
1011 3300048918 Ga0496115_0140345 Ga0496115_0140345_637_1362 240
1012 3300048922 Ga0496119_0013498 Ga0496119_0013498_3456_4184 240
1013 3300048924 Ga0496121_0003979 Ga0496121_0003979_9257_9985 240
1014 3300049571 Ga0501034_0037606 Ga0501034_0037606_3357_4088 240
1015 3300049572 Ga0501036_0134098 Ga0501036_0134098_782_1507 240
1016 3300049575 Ga0501039_0037530 Ga0501039_0037530_1141_1866 240
1017 3300049576 Ga0501040_0065837 Ga0501040_0065837_1699_2424 240
1018 3300049578 Ga0501042_0015337 Ga0501042_0015337_3851_4576 240
1019 3300049578 Ga0501042_0162863 Ga0501042_0162863_866_1588 240
1020 3300049581 Ga0501047_0348144 Ga0501047_0348144_525_1250 240
1021 3300049582 Ga0501048_0454465 Ga0501048_0454465_152_877 240
1022 3300049590 Ga0501074_0168228 Ga0501074_0168228_517_1242 240
1023 3300049741 Ga0501079_0051330 Ga0501079_0051330_1418_2143 240
1024 3300049744 Ga0501083_0052676 Ga0501083_0052676_1660_2385 240
1025 3300049824 Ga0501045_0026945 Ga0501045_0026945_1718_2443 240
1026 3300050491 nmdc:mga00v17_82352_c1 nmdc:mga00v17_82352_c1_549_1274 240
1027 3300050507 nmdc:mga05p37_365168_c1 nmdc:mga05p37_365168_c1_586_1308 240
1028 3300050507 nmdc:mga05p37_66039_c1 nmdc:mga05p37_66039_c1_3531_4256 240
1029 3300050507 nmdc:mga05p37_906223_c1 nmdc:mga05p37_906223_c1_189_914 240
1030 3300050508 nmdc:mga09592_107029_c1 nmdc:mga09592_107029_c1_1164_1892 240
1031 3300050508 nmdc:mga09592_231857_c1 nmdc:mga09592_231857_c1_323_1048 240
1032 3300050509 nmdc:mga0qj67_16266_c1 nmdc:mga0qj67_16266_c1_3083_3805 240
1033 3300050509 nmdc:mga0qj67_2370_c1 nmdc:mga0qj67_2370_c1_702_1427 240
1034 3300050510 nmdc:mga06r32_15640_c1 nmdc:mga06r32_15640_c1_1401_2126 240
1035 3300050510 nmdc:mga06r32_169740_c1 nmdc:mga06r32_169740_c1_261_983 240
1036 3300050510 nmdc:mga06r32_23994_c1 nmdc:mga06r32_23994_c1_4244_4969 240
1037 3300050510 nmdc:mga06r32_600573_c1 nmdc:mga06r32_600573_c1_232_954 240
1038 3300050511 nmdc:mga08y16_26187_c1 nmdc:mga08y16_26187_c1_352_1077 240
1039 3300050511 nmdc:mga08y16_3451_c1 nmdc:mga08y16_3451_c1_6618_7346 240
1040 3300053100 Ga0500660_122220 Ga0500660_122220_61_786 240
1041 3300053149 Ga0500600_0065466 Ga0500600_0065466_768_1493 240
1042 3300054114 Ga0501084_0009802 Ga0501084_0009802_6714_7439 240
1043 3300060353 Ga0501082_0165170 Ga0501082_0165170_683_1408 240
1044 3300061734 Ga0530510_0058769 Ga0530510_0058769_625_1350 240
1045 iso_pu_bacteria 2517572101 2517764419 240
1046 iso_pu_bacteria 8002784119 8002787800 240

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

24

173

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9719 3 228
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9634 3 228
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9588 3 225
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9578 5 226
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9529 3 225
ID Description Score Start End Superfamily
2pclA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9682 3 226 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.963 1 226 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9588 3 225 3.40.50.300
af_Q2G0D8_1_227_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.958 3 226 3.40.50.300
af_Q2FVR1_1_221_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9559 5 223 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A346PK27-F1-model_v4 ABC-type antimicrobial peptide transport system, ATPase component 0.9755 3 228 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7J3QCK0-F1-model_v4 ABC transporter ATP-binding protein 0.9731 29 228 GO:0005524
GO:0016887
AF-A0A544YA04-F1-model_v4 ABC transporter ATP-binding protein 0.9724 2 225 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7J0BSF2-F1-model_v4 ABC transporter ATP-binding protein 0.9715 2 228 GO:0005524
GO:0016887
AF-A0A2T2QVM2-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9692 3 229 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Feature Viewer

pLDDT pTM Quality
89.56 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map