F488970
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1046 | 391 | 1035 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0116546|Ga0496104_0116546_331_1176 |
| Length | 281 |
| Sequence | MTGVLEMRAVSKTYLDGADEVHALRDVDLTVEPGKMVAVMGPSGSGKSTLLTIAGALETPTAGDVLIAGHSLAAMSRDDRARLRRRAIGYVFQDFNLLPGLTAAENVALPLELDGLSAGKARAAGLRALDELGLADRAARFPDQLSGGERQRVAIARAVVGDRRLVLADEPTGALDTDTGEAVMRLILTACKAGVGAVVVTHDAQLASWADRVVFIRDGRVVDRTAPRPGPDSLLAGEAARCVSRCRIHRWRSAPDTAGCRRGSPSRAGPGGYSGASGGSN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 3 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 4 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 5 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 6 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 7 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 8 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 9 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 10 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 204 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 205 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 210 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 211 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 216 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 217 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 218 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 219 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 220 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 221 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 222 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 223 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 224 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 225 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 226 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 227 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 228 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 229 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 230 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 241 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 242 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 243 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 249 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 250 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 258 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 259 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 260 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 261 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 262 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 263 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 264 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 265 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 266 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 267 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 268 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 269 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 270 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 273 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 274 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 275 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 276 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 330 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 331 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 332 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 334 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 335 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 336 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 337 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 338 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 339 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 340 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 341 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 371 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 372 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 374 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 387 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 388 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 391 | 8002784119 | Frankia sp. AgB1.9 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.99 |
| Metatranscriptomes | 0.96 |
| Isolates | 1.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.24 |
| Nodule | 0.67 |
| Rhizoplane | 2.96 |
| Rhizosphere | 91.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24749J21850_1006588 | 3300002076 | Bacteria | 1617 |
| 2 | rootH2_10176451 | 3300003320 | Bacteria | 3605 |
| 3 | JGI25407J50210_10000245 | 3300003373 | Bacteria | 9544 |
| 4 | JGI25407J50210_10020236 | 3300003373 | Bacteria | 1731 |
| 5 | Ga0070658_10005200 | 3300005327 | Bacteria | 10588 |
| 6 | Ga0070658_10050435 | 3300005327 | Bacteria | 3374 |
| 7 | Ga0070676_10142107 | 3300005328 | Bacteria | 1529 |
| 8 | Ga0070683_100001043 | 3300005329 | Bacteria | 20818 |
| 9 | Ga0070683_100002200 | 3300005329 | Bacteria | 15436 |
| 10 | Ga0070683_100035577 | 3300005329 | Bacteria | 4552 |
| 11 | Ga0070683_100051708 | 3300005329 | Bacteria | 3804 |
| 12 | Ga0070683_100081477 | 3300005329 | Bacteria | 3030 |
| 13 | Ga0070683_100126188 | 3300005329 | Bacteria | 2419 |
| 14 | Ga0070683_100222354 | 3300005329 | Bacteria | 1794 |
| 15 | Ga0070683_100463212 | 3300005329 | Bacteria | 1210 |
| 16 | Ga0070683_100690999 | 3300005329 | Bacteria | 977 |
| 17 | Ga0070670_100057963 | 3300005331 | Bacteria | 3324 |
| 18 | Ga0070670_100077924 | 3300005331 | Bacteria | 2847 |
| 19 | Ga0070670_100464998 | 3300005331 | Bacteria | 1122 |
| 20 | Ga0068869_100002294 | 3300005334 | Bacteria | 11509 |
| 21 | Ga0068869_100093717 | 3300005334 | Bacteria | 2263 |
| 22 | Ga0068869_100182309 | 3300005334 | Bacteria | 1647 |
| 23 | Ga0070666_10057061 | 3300005335 | Bacteria | 2638 |
| 24 | Ga0070680_100084670 | 3300005336 | Bacteria | 2619 |
| 25 | Ga0070680_100275660 | 3300005336 | Bacteria | 1424 |
| 26 | Ga0070682_100037652 | 3300005337 | Bacteria | 2963 |
| 27 | Ga0070682_100182060 | 3300005337 | Bacteria | 1469 |
| 28 | Ga0068868_100004349 | 3300005338 | Bacteria | 9933 |
| 29 | Ga0070660_100077757 | 3300005339 | Bacteria | 2601 |
| 30 | Ga0070660_100244985 | 3300005339 | Bacteria | 1460 |
| 31 | Ga0070689_100190115 | 3300005340 | Bacteria | 1672 |
| 32 | Ga0070691_10092880 | 3300005341 | Bacteria | 1490 |
| 33 | Ga0070661_100007295 | 3300005344 | Bacteria | 7626 |
| 34 | Ga0070661_100012215 | 3300005344 | Bacteria | 6005 |
| 35 | Ga0070661_100082474 | 3300005344 | Bacteria | 2375 |
| 36 | Ga0070661_100528106 | 3300005344 | Bacteria | 947 |
| 37 | Ga0070692_10058082 | 3300005345 | Bacteria | 2031 |
| 38 | Ga0070668_100053649 | 3300005347 | Bacteria | 3109 |
| 39 | Ga0070668_100402865 | 3300005347 | Bacteria | 1168 |
| 40 | Ga0070675_100009075 | 3300005354 | Bacteria | 7724 |
| 41 | Ga0070675_100084216 | 3300005354 | Bacteria | 2655 |
| 42 | Ga0070675_100542894 | 3300005354 | Bacteria | 1051 |
| 43 | Ga0070671_100005711 | 3300005355 | Bacteria | 9913 |
| 44 | Ga0070674_100135371 | 3300005356 | Bacteria | 1842 |
| 45 | Ga0070674_100154153 | 3300005356 | Bacteria | 1737 |
| 46 | Ga0070674_100236079 | 3300005356 | Bacteria | 1429 |
| 47 | Ga0070673_100031282 | 3300005364 | Bacteria | 3992 |
| 48 | Ga0070673_100191314 | 3300005364 | Bacteria | 1758 |
| 49 | Ga0070673_100221662 | 3300005364 | Bacteria | 1637 |
| 50 | Ga0070659_100070598 | 3300005366 | Bacteria | 2775 |
| 51 | Ga0070659_100079788 | 3300005366 | Bacteria | 2612 |
| 52 | Ga0070667_100366100 | 3300005367 | Bacteria | 1307 |
| 53 | Ga0070667_100420322 | 3300005367 | Bacteria | 1218 |
| 54 | Ga0070709_10000377 | 3300005434 | Bacteria | 27511 |
| 55 | Ga0070709_10008315 | 3300005434 | Bacteria | 5697 |
| 56 | Ga0070709_10019524 | 3300005434 | Bacteria | 3920 |
| 57 | Ga0070709_10161910 | 3300005434 | Bacteria | 1557 |
| 58 | Ga0070709_10169751 | 3300005434 | Bacteria | 1523 |
| 59 | Ga0070709_10218351 | 3300005434 | Bacteria | 1358 |
| 60 | Ga0070714_100001403 | 3300005435 | Bacteria | 17466 |
| 61 | Ga0070714_100040608 | 3300005435 | Bacteria | 3921 |
| 62 | Ga0070714_100057222 | 3300005435 | Bacteria | 3336 |
| 63 | Ga0070714_100058509 | 3300005435 | Bacteria | 3302 |
| 64 | Ga0070714_100104044 | 3300005435 | Bacteria | 2505 |
| 65 | Ga0070714_100114912 | 3300005435 | Bacteria | 2388 |
| 66 | Ga0070714_100159369 | 3300005435 | Bacteria | 2040 |
| 67 | Ga0070714_100192371 | 3300005435 | Bacteria | 1862 |
| 68 | Ga0070714_100270072 | 3300005435 | Bacteria | 1577 |
| 69 | Ga0070714_100273041 | 3300005435 | Bacteria | 1568 |
| 70 | Ga0070714_100383567 | 3300005435 | Bacteria | 1325 |
| 71 | Ga0070713_100007612 | 3300005436 | Bacteria | 7620 |
| 72 | Ga0070713_100044011 | 3300005436 | Bacteria | 3652 |
| 73 | Ga0070713_100054601 | 3300005436 | Bacteria | 3315 |
| 74 | Ga0070713_100130636 | 3300005436 | Bacteria | 2214 |
| 75 | Ga0070713_100192960 | 3300005436 | Bacteria | 1836 |
| 76 | Ga0070713_100200460 | 3300005436 | Bacteria | 1802 |
| 77 | Ga0070713_100209417 | 3300005436 | Bacteria | 1764 |
| 78 | Ga0070713_100217711 | 3300005436 | Bacteria | 1731 |
| 79 | Ga0070713_100272080 | 3300005436 | Bacteria | 1551 |
| 80 | Ga0070713_100297780 | 3300005436 | Bacteria | 1484 |
| 81 | Ga0070713_100323588 | 3300005436 | Bacteria | 1424 |
| 82 | Ga0070710_10000960 | 3300005437 | Bacteria | 13669 |
| 83 | Ga0070710_10009633 | 3300005437 | Bacteria | 4730 |
| 84 | Ga0070710_10024616 | 3300005437 | Bacteria | 3178 |
| 85 | Ga0070710_10044370 | 3300005437 | Bacteria | 2466 |
| 86 | Ga0070710_10054984 | 3300005437 | Bacteria | 2247 |
| 87 | Ga0070701_10018169 | 3300005438 | Bacteria | 3301 |
| 88 | Ga0070701_10039250 | 3300005438 | Bacteria | 2401 |
| 89 | Ga0070711_100022050 | 3300005439 | Bacteria | 4124 |
| 90 | Ga0070711_100025523 | 3300005439 | Bacteria | 3867 |
| 91 | Ga0070711_100034450 | 3300005439 | Bacteria | 3377 |
| 92 | Ga0070711_100096145 | 3300005439 | Bacteria | 2145 |
| 93 | Ga0070711_100102343 | 3300005439 | Bacteria | 2086 |
| 94 | Ga0070711_100141980 | 3300005439 | Bacteria | 1802 |
| 95 | Ga0070705_100028799 | 3300005440 | Bacteria | 3046 |
| 96 | Ga0070700_100009766 | 3300005441 | Bacteria | 5276 |
| 97 | Ga0070700_100082525 | 3300005441 | Bacteria | 2079 |
| 98 | Ga0070700_100105175 | 3300005441 | Bacteria | 1866 |
| 99 | Ga0070694_100070536 | 3300005444 | Bacteria | 2406 |
| 100 | Ga0070708_100053014 | 3300005445 | Bacteria | 3598 |
| 101 | Ga0070708_100132755 | 3300005445 | Bacteria | 2305 |
| 102 | Ga0070663_100019012 | 3300005455 | Bacteria | 4518 |
| 103 | Ga0070678_100057307 | 3300005456 | Bacteria | 2854 |
| 104 | Ga0070678_100368515 | 3300005456 | Bacteria | 1240 |
| 105 | Ga0070678_100446528 | 3300005456 | Bacteria | 1132 |
| 106 | Ga0070662_100079467 | 3300005457 | Bacteria | 2439 |
| 107 | Ga0070662_100467645 | 3300005457 | Bacteria | 1049 |
| 108 | Ga0070681_10110721 | 3300005458 | Bacteria | 2685 |
| 109 | Ga0070681_10116504 | 3300005458 | Bacteria | 2608 |
| 110 | Ga0070681_10142579 | 3300005458 | Bacteria | 2325 |
| 111 | Ga0068867_100088736 | 3300005459 | Bacteria | 2344 |
| 112 | Ga0068867_100199803 | 3300005459 | Bacteria | 1600 |
| 113 | Ga0070685_10010560 | 3300005466 | Bacteria | 4802 |
| 114 | Ga0070685_10011144 | 3300005466 | Bacteria | 4699 |
| 115 | Ga0070706_100001268 | 3300005467 | Bacteria | 26964 |
| 116 | Ga0070706_100046766 | 3300005467 | Bacteria | 3994 |
| 117 | Ga0070706_100077044 | 3300005467 | Bacteria | 3086 |
| 118 | Ga0070706_100196192 | 3300005467 | Bacteria | 1886 |
| 119 | Ga0070706_100200175 | 3300005467 | Bacteria | 1866 |
| 120 | Ga0070706_100490959 | 3300005467 | Bacteria | 1142 |
| 121 | Ga0070707_100004358 | 3300005468 | Bacteria | 13265 |
| 122 | Ga0070707_100030808 | 3300005468 | Bacteria | 5109 |
| 123 | Ga0070707_100056451 | 3300005468 | Bacteria | 3766 |
| 124 | Ga0070707_100252220 | 3300005468 | Bacteria | 1717 |
| 125 | Ga0070707_100716432 | 3300005468 | Bacteria | 963 |
| 126 | Ga0070698_100010296 | 3300005471 | Bacteria | 9983 |
| 127 | Ga0070698_100031059 | 3300005471 | Bacteria | 5539 |
| 128 | Ga0070698_100038664 | 3300005471 | Bacteria | 4916 |
| 129 | Ga0070698_100054421 | 3300005471 | Bacteria | 4062 |
| 130 | Ga0070698_100071852 | 3300005471 | Bacteria | 3469 |
| 131 | Ga0070699_100000213 | 3300005518 | Bacteria | 57419 |
| 132 | Ga0070699_100001774 | 3300005518 | Bacteria | 19648 |
| 133 | Ga0070699_100079743 | 3300005518 | Bacteria | 2852 |
| 134 | Ga0070699_100609628 | 3300005518 | Bacteria | 996 |
| 135 | Ga0070679_100052992 | 3300005530 | Bacteria | 4038 |
| 136 | Ga0070679_100089352 | 3300005530 | Bacteria | 3068 |
| 137 | Ga0070679_100093281 | 3300005530 | Bacteria | 2998 |
| 138 | Ga0070679_100167176 | 3300005530 | Bacteria | 2172 |
| 139 | Ga0070684_100003000 | 3300005535 | Bacteria | 12566 |
| 140 | Ga0070684_100016381 | 3300005535 | Bacteria | 6057 |
| 141 | Ga0070684_100049353 | 3300005535 | Bacteria | 3652 |
| 142 | Ga0070684_100078319 | 3300005535 | Bacteria | 2920 |
| 143 | Ga0070684_100083131 | 3300005535 | Bacteria | 2836 |
| 144 | Ga0070684_100127799 | 3300005535 | Bacteria | 2291 |
| 145 | Ga0070684_100181385 | 3300005535 | Bacteria | 1914 |
| 146 | Ga0070684_100678884 | 3300005535 | Bacteria | 960 |
| 147 | Ga0070697_100003375 | 3300005536 | Bacteria | 12283 |
| 148 | Ga0070697_100099589 | 3300005536 | Bacteria | 2413 |
| 149 | Ga0068853_100203242 | 3300005539 | Bacteria | 1803 |
| 150 | Ga0070672_100057779 | 3300005543 | Bacteria | 3047 |
| 151 | Ga0070672_100252363 | 3300005543 | Bacteria | 1486 |
| 152 | Ga0070695_100045435 | 3300005545 | Bacteria | 2799 |
| 153 | Ga0070696_100053585 | 3300005546 | Bacteria | 2808 |
| 154 | Ga0070665_100549680 | 3300005548 | Bacteria | 1167 |
| 155 | Ga0070704_100164797 | 3300005549 | Bacteria | 1756 |
| 156 | Ga0068855_100045099 | 3300005563 | Bacteria | 5215 |
| 157 | Ga0068855_100107528 | 3300005563 | Bacteria | 3204 |
| 158 | Ga0068855_100143516 | 3300005563 | Bacteria | 2719 |
| 159 | Ga0070664_100000709 | 3300005564 | Bacteria | 25499 |
| 160 | Ga0070664_100044700 | 3300005564 | Bacteria | 3739 |
| 161 | Ga0070664_100065752 | 3300005564 | Bacteria | 3095 |
| 162 | Ga0070664_100347134 | 3300005564 | Bacteria | 1349 |
| 163 | Ga0068857_100070859 | 3300005577 | Bacteria | 3105 |
| 164 | Ga0068854_100027007 | 3300005578 | Bacteria | 3951 |
| 165 | Ga0068856_100721979 | 3300005614 | Bacteria | 1017 |
| 166 | Ga0068852_100009879 | 3300005616 | Bacteria | 7101 |
| 167 | Ga0068852_100323149 | 3300005616 | Bacteria | 1499 |
| 168 | Ga0068852_100539514 | 3300005616 | Bacteria | 1166 |
| 169 | Ga0068859_100089640 | 3300005617 | Bacteria | 3126 |
| 170 | Ga0068864_100091147 | 3300005618 | Bacteria | 2688 |
| 171 | Ga0068866_10122035 | 3300005718 | Bacteria | 1469 |
| 172 | Ga0068866_10197441 | 3300005718 | Bacteria | 1200 |
| 173 | Ga0068861_100058068 | 3300005719 | Bacteria | 2958 |
| 174 | Ga0068861_100205677 | 3300005719 | Bacteria | 1655 |
| 175 | Ga0068861_100248628 | 3300005719 | Bacteria | 1516 |
| 176 | Ga0068861_100301036 | 3300005719 | Bacteria | 1389 |
| 177 | Ga0068861_100576841 | 3300005719 | Bacteria | 1029 |
| 178 | Ga0068870_10046740 | 3300005840 | Bacteria | 2272 |
| 179 | Ga0068863_100007563 | 3300005841 | Bacteria | 10626 |
| 180 | Ga0068858_100000141 | 3300005842 | Bacteria | 76388 |
| 181 | Ga0068858_100108445 | 3300005842 | Bacteria | 2592 |
| 182 | Ga0068858_100116606 | 3300005842 | Bacteria | 2495 |
| 183 | Ga0068860_100106372 | 3300005843 | Bacteria | 2679 |
| 184 | Ga0068862_100000004 | 3300005844 | Bacteria | 365124 |
| 185 | Ga0068862_100015926 | 3300005844 | Bacteria | 6250 |
| 186 | Ga0068862_100372978 | 3300005844 | Bacteria | 1329 |
| 187 | Ga0081455_10001616 | 3300005937 | Bacteria | 27541 |
| 188 | Ga0081455_10002768 | 3300005937 | Bacteria | 20669 |
| 189 | Ga0081455_10016246 | 3300005937 | Bacteria | 7193 |
| 190 | Ga0081455_10027643 | 3300005937 | Bacteria | 5197 |
| 191 | Ga0081455_10070163 | 3300005937 | Bacteria | 2911 |
| 192 | Ga0081455_10096067 | 3300005937 | Bacteria | 2390 |
| 193 | Ga0081455_10137893 | 3300005937 | Bacteria | 1898 |
| 194 | Ga0081538_10000258 | 3300005981 | Bacteria | 60142 |
| 195 | Ga0081538_10000506 | 3300005981 | Bacteria | 43569 |
| 196 | Ga0081538_10001127 | 3300005981 | Bacteria | 28300 |
| 197 | Ga0081538_10004909 | 3300005981 | Bacteria | 12185 |
| 198 | Ga0081538_10011657 | 3300005981 | Bacteria | 7107 |
| 199 | Ga0081538_10013643 | 3300005981 | Bacteria | 6426 |
| 200 | Ga0081538_10017309 | 3300005981 | Bacteria | 5476 |
| 201 | Ga0081538_10022452 | 3300005981 | Bacteria | 4571 |
| 202 | Ga0081538_10030481 | 3300005981 | Bacteria | 3661 |
| 203 | Ga0081538_10182342 | 3300005981 | Bacteria | 896 |
| 204 | Ga0081540_1000356 | 3300005983 | Bacteria | 46150 |
| 205 | Ga0081540_1001036 | 3300005983 | Bacteria | 24897 |
| 206 | Ga0081540_1003879 | 3300005983 | Bacteria | 11663 |
| 207 | Ga0081540_1047547 | 3300005983 | Bacteria | 2156 |
| 208 | Ga0081540_1047614 | 3300005983 | Bacteria | 2154 |
| 209 | Ga0081539_10002139 | 3300005985 | Bacteria | 29179 |
| 210 | Ga0081539_10011478 | 3300005985 | Bacteria | 6995 |
| 211 | Ga0081539_10015588 | 3300005985 | Bacteria | 5512 |
| 212 | Ga0081539_10022338 | 3300005985 | Bacteria | 4191 |
| 213 | Ga0070717_10010846 | 3300006028 | Bacteria | 6896 |
| 214 | Ga0070717_10013112 | 3300006028 | Bacteria | 6335 |
| 215 | Ga0070717_10017077 | 3300006028 | Bacteria | 5637 |
| 216 | Ga0070717_10031359 | 3300006028 | Bacteria | 4276 |
| 217 | Ga0070717_10042424 | 3300006028 | Bacteria | 3710 |
| 218 | Ga0070717_10045250 | 3300006028 | Bacteria | 3598 |
| 219 | Ga0070717_10082041 | 3300006028 | Bacteria | 2708 |
| 220 | Ga0070717_10145174 | 3300006028 | Bacteria | 2049 |
| 221 | Ga0070717_10177527 | 3300006028 | Bacteria | 1855 |
| 222 | Ga0070717_10224397 | 3300006028 | Bacteria | 1652 |
| 223 | Ga0070717_10322108 | 3300006028 | Bacteria | 1377 |
| 224 | Ga0075365_10051109 | 3300006038 | Bacteria | 2728 |
| 225 | Ga0075364_10047373 | 3300006051 | Bacteria | 2800 |
| 226 | Ga0075364_10229186 | 3300006051 | Bacteria | 1262 |
| 227 | Ga0075432_10039653 | 3300006058 | Bacteria | 1643 |
| 228 | Ga0070715_10059557 | 3300006163 | Bacteria | 1671 |
| 229 | Ga0070715_10091588 | 3300006163 | Bacteria | 1400 |
| 230 | Ga0070715_10099582 | 3300006163 | Bacteria | 1353 |
| 231 | Ga0070716_100000082 | 3300006173 | Bacteria | 37745 |
| 232 | Ga0070716_100009847 | 3300006173 | Bacteria | 4777 |
| 233 | Ga0070716_100216927 | 3300006173 | Bacteria | 1283 |
| 234 | Ga0070712_100004947 | 3300006175 | Bacteria | 8241 |
| 235 | Ga0070712_100030262 | 3300006175 | Bacteria | 3636 |
| 236 | Ga0070712_100038520 | 3300006175 | Bacteria | 3267 |
| 237 | Ga0070712_100049629 | 3300006175 | Bacteria | 2915 |
| 238 | Ga0070712_100060383 | 3300006175 | Bacteria | 2674 |
| 239 | Ga0070712_100148320 | 3300006175 | Bacteria | 1798 |
| 240 | Ga0070712_100209192 | 3300006175 | Bacteria | 1537 |
| 241 | Ga0075367_10087053 | 3300006178 | Bacteria | 1897 |
| 242 | Ga0075367_10274723 | 3300006178 | Bacteria | 1059 |
| 243 | Ga0075370_10014533 | 3300006353 | Bacteria | 4202 |
| 244 | Ga0068871_100108858 | 3300006358 | Bacteria | 2329 |
| 245 | Ga0068871_100112352 | 3300006358 | Bacteria | 2293 |
| 246 | Ga0075428_100180406 | 3300006844 | Bacteria | 2286 |
| 247 | Ga0075428_100393168 | 3300006844 | Bacteria | 1486 |
| 248 | Ga0075430_100001691 | 3300006846 | Bacteria | 18031 |
| 249 | Ga0075430_100007329 | 3300006846 | Bacteria | 9317 |
| 250 | Ga0075431_100172451 | 3300006847 | Bacteria | 2222 |
| 251 | Ga0075431_100236671 | 3300006847 | Bacteria | 1859 |
| 252 | Ga0075431_100544165 | 3300006847 | Bacteria | 1149 |
| 253 | Ga0075433_10043000 | 3300006852 | Bacteria | 3921 |
| 254 | Ga0075433_10048975 | 3300006852 | Bacteria | 3675 |
| 255 | Ga0075434_100031601 | 3300006871 | Bacteria | 5220 |
| 256 | Ga0075434_100090563 | 3300006871 | Bacteria | 3060 |
| 257 | Ga0075434_100219036 | 3300006871 | Bacteria | 1923 |
| 258 | Ga0075434_100439088 | 3300006871 | Bacteria | 1326 |
| 259 | Ga0075429_100139334 | 3300006880 | Bacteria | 2123 |
| 260 | Ga0075429_100149226 | 3300006880 | Bacteria | 2047 |
| 261 | Ga0068865_100040620 | 3300006881 | Bacteria | 3163 |
| 262 | Ga0068865_100111232 | 3300006881 | Bacteria | 2021 |
| 263 | Ga0068865_100492920 | 3300006881 | Bacteria | 1020 |
| 264 | Ga0075436_100125385 | 3300006914 | Bacteria | 1799 |
| 265 | Ga0097620_100089640 | 3300006931 | Bacteria | 3126 |
| 266 | Ga0075435_100024919 | 3300007076 | Bacteria | 4650 |
| 267 | Ga0075435_100046476 | 3300007076 | Bacteria | 3482 |
| 268 | Ga0075435_100295112 | 3300007076 | Bacteria | 1386 |
| 269 | Ga0105251_10016785 | 3300009011 | Bacteria | 3943 |
| 270 | Ga0105251_10133634 | 3300009011 | Bacteria | 1124 |
| 271 | Ga0105240_10019152 | 3300009093 | Bacteria | 9151 |
| 272 | Ga0105240_11098461 | 3300009093 | Bacteria | 846 |
| 273 | Ga0111539_10001616 | 3300009094 | Bacteria | 30103 |
| 274 | Ga0111539_10025348 | 3300009094 | Bacteria | 7269 |
| 275 | Ga0111539_10090372 | 3300009094 | Bacteria | 3598 |
| 276 | Ga0111539_10790100 | 3300009094 | Bacteria | 1105 |
| 277 | Ga0105245_10002942 | 3300009098 | Bacteria | 15290 |
| 278 | Ga0105245_10024872 | 3300009098 | Bacteria | 5263 |
| 279 | Ga0105245_10104769 | 3300009098 | Bacteria | 2623 |
| 280 | Ga0105247_10001021 | 3300009101 | Bacteria | 21079 |
| 281 | Ga0105247_10001810 | 3300009101 | Bacteria | 14995 |
| 282 | Ga0105247_10101128 | 3300009101 | Bacteria | 1843 |
| 283 | Ga0114129_10032040 | 3300009147 | Bacteria | 7430 |
| 284 | Ga0114129_10073744 | 3300009147 | Bacteria | 4755 |
| 285 | Ga0114129_10150784 | 3300009147 | Bacteria | 3182 |
| 286 | Ga0114129_10236923 | 3300009147 | Bacteria | 2455 |
| 287 | Ga0114129_10281565 | 3300009147 | Bacteria | 2221 |
| 288 | Ga0114129_11160773 | 3300009147 | Bacteria | 964 |
| 289 | Ga0105243_10045283 | 3300009148 | Bacteria | 3456 |
| 290 | Ga0105243_10076310 | 3300009148 | Bacteria | 2723 |
| 291 | Ga0105243_10085493 | 3300009148 | Bacteria | 2586 |
| 292 | Ga0105243_10297540 | 3300009148 | Bacteria | 1461 |
| 293 | Ga0105241_10395020 | 3300009174 | Bacteria | 1212 |
| 294 | Ga0105242_10115680 | 3300009176 | Bacteria | 2293 |
| 295 | Ga0105242_10165076 | 3300009176 | Bacteria | 1942 |
| 296 | Ga0105242_10510574 | 3300009176 | Bacteria | 1145 |
| 297 | Ga0105242_10786904 | 3300009176 | Bacteria | 940 |
| 298 | Ga0105248_10089093 | 3300009177 | Bacteria | 3473 |
| 299 | Ga0105248_10137082 | 3300009177 | Bacteria | 2761 |
| 300 | Ga0105248_10312941 | 3300009177 | Bacteria | 1768 |
| 301 | Ga0105248_10610682 | 3300009177 | Bacteria | 1230 |
| 302 | Ga0105237_10032375 | 3300009545 | Bacteria | 5294 |
| 303 | Ga0105238_10108612 | 3300009551 | Bacteria | 2755 |
| 304 | Ga0105238_10721806 | 3300009551 | Bacteria | 1009 |
| 305 | Ga0105238_10772992 | 3300009551 | Bacteria | 975 |
| 306 | Ga0105249_10316215 | 3300009553 | Bacteria | 1571 |
| 307 | Ga0105249_10376849 | 3300009553 | Bacteria | 1444 |
| 308 | Ga0105249_10705820 | 3300009553 | Bacteria | 1069 |
| 309 | Ga0099796_10024654 | 3300010159 | Bacteria | 1890 |
| 310 | Ga0105239_10056981 | 3300010375 | Bacteria | 4286 |
| 311 | Ga0105239_10094558 | 3300010375 | Bacteria | 3301 |
| 312 | Ga0105239_10684727 | 3300010375 | Bacteria | 1172 |
| 313 | Ga0105239_10804189 | 3300010375 | Bacteria | 1077 |
| 314 | Ga0105246_10031222 | 3300011119 | Bacteria | 3524 |
| 315 | Ga0105246_10469086 | 3300011119 | Bacteria | 1062 |
| 316 | Ga0157373_10068066 | 3300013100 | Bacteria | 2517 |
| 317 | Ga0157369_10015933 | 3300013105 | Bacteria | 8460 |
| 318 | Ga0157369_10089018 | 3300013105 | Bacteria | 3296 |
| 319 | Ga0157378_10085791 | 3300013297 | Bacteria | 2853 |
| 320 | Ga0157378_10338367 | 3300013297 | Bacteria | 1467 |
| 321 | Ga0157375_10037718 | 3300013308 | Bacteria | 4633 |
| 322 | Ga0157375_10463115 | 3300013308 | Bacteria | 1433 |
| 323 | Ga0157375_10537222 | 3300013308 | Bacteria | 1332 |
| 324 | Ga0163163_10004683 | 3300014325 | Bacteria | 11708 |
| 325 | Ga0163163_10009790 | 3300014325 | Bacteria | 8587 |
| 326 | Ga0163163_10026392 | 3300014325 | Bacteria | 5552 |
| 327 | Ga0163163_10093464 | 3300014325 | Bacteria | 3024 |
| 328 | Ga0163163_10105533 | 3300014325 | Bacteria | 2843 |
| 329 | Ga0163163_10291902 | 3300014325 | Bacteria | 1683 |
| 330 | Ga0157380_10282069 | 3300014326 | Bacteria | 1521 |
| 331 | Ga0182008_10148930 | 3300014497 | Bacteria | 1173 |
| 332 | Ga0182008_10173991 | 3300014497 | Bacteria | 1088 |
| 333 | Ga0157377_10028182 | 3300014745 | Bacteria | 3021 |
| 334 | Ga0157379_10005115 | 3300014968 | Bacteria | 11247 |
| 335 | Ga0157379_10035817 | 3300014968 | Bacteria | 4425 |
| 336 | Ga0163161_10384634 | 3300017792 | Bacteria | 1122 |
| 337 | Ga0163161_10732795 | 3300017792 | Bacteria | 825 |
| 338 | Ga0197907_10517940 | 3300020069 | Bacteria | 3242 |
| 339 | Ga0206356_11280802 | 3300020070 | Bacteria | 2869 |
| 340 | Ga0206349_1062031 | 3300020075 | Bacteria | 2663 |
| 341 | Ga0206351_10211465 | 3300020077 | Bacteria | 2199 |
| 342 | Ga0206350_10944510 | 3300020080 | Bacteria | 3518 |
| 343 | Ga0206353_10705757 | 3300020082 | Bacteria | 1617 |
| 344 | Ga0206353_11280236 | 3300020082 | Bacteria | 975 |
| 345 | Ga0213875_10004191 | 3300021388 | Bacteria | 7975 |
| 346 | Ga0213875_10008337 | 3300021388 | Bacteria | 5314 |
| 347 | Ga0213875_10026180 | 3300021388 | Bacteria | 2776 |
| 348 | Ga0224712_10001526 | 3300022467 | Bacteria | 5376 |
| 349 | Ga0224712_10021779 | 3300022467 | Bacteria | 2199 |
| 350 | Ga0224572_1007130 | 3300024225 | Bacteria | 2039 |
| 351 | Ga0224572_1012941 | 3300024225 | Bacteria | 1590 |
| 352 | Ga0207692_10000682 | 3300025898 | Bacteria | 11994 |
| 353 | Ga0207692_10003168 | 3300025898 | Bacteria | 6384 |
| 354 | Ga0207692_10033109 | 3300025898 | Bacteria | 2490 |
| 355 | Ga0207692_10041370 | 3300025898 | Bacteria | 2281 |
| 356 | Ga0207692_10068382 | 3300025898 | Bacteria | 1862 |
| 357 | Ga0207642_10032509 | 3300025899 | Bacteria | 2198 |
| 358 | Ga0207710_10000092 | 3300025900 | Bacteria | 121199 |
| 359 | Ga0207710_10000813 | 3300025900 | Bacteria | 16912 |
| 360 | Ga0207688_10008728 | 3300025901 | Bacteria | 5514 |
| 361 | Ga0207688_10012315 | 3300025901 | Bacteria | 4655 |
| 362 | Ga0207647_10169420 | 3300025904 | Bacteria | 1272 |
| 363 | Ga0207685_10012497 | 3300025905 | Bacteria | 2593 |
| 364 | Ga0207685_10023159 | 3300025905 | Bacteria | 2110 |
| 365 | Ga0207685_10074177 | 3300025905 | Bacteria | 1388 |
| 366 | Ga0207685_10079620 | 3300025905 | Bacteria | 1352 |
| 367 | Ga0207699_10001559 | 3300025906 | Bacteria | 10861 |
| 368 | Ga0207699_10422676 | 3300025906 | Bacteria | 952 |
| 369 | Ga0207645_10132391 | 3300025907 | Bacteria | 1623 |
| 370 | Ga0207645_10145447 | 3300025907 | Bacteria | 1545 |
| 371 | Ga0207643_10044881 | 3300025908 | Bacteria | 2495 |
| 372 | Ga0207643_10055822 | 3300025908 | Bacteria | 2246 |
| 373 | Ga0207705_10047595 | 3300025909 | Bacteria | 3084 |
| 374 | Ga0207684_10000654 | 3300025910 | Bacteria | 40954 |
| 375 | Ga0207684_10036597 | 3300025910 | Bacteria | 4166 |
| 376 | Ga0207684_10259450 | 3300025910 | Bacteria | 1499 |
| 377 | Ga0207684_10384661 | 3300025910 | Bacteria | 1207 |
| 378 | Ga0207707_10060284 | 3300025912 | Bacteria | 3301 |
| 379 | Ga0207707_10101432 | 3300025912 | Bacteria | 2515 |
| 380 | Ga0207671_10031440 | 3300025914 | Bacteria | 3956 |
| 381 | Ga0207693_10014890 | 3300025915 | Bacteria | 6247 |
| 382 | Ga0207693_10026412 | 3300025915 | Bacteria | 4596 |
| 383 | Ga0207693_10036715 | 3300025915 | Bacteria | 3863 |
| 384 | Ga0207693_10083098 | 3300025915 | Bacteria | 2508 |
| 385 | Ga0207693_10083216 | 3300025915 | Bacteria | 2506 |
| 386 | Ga0207663_10050524 | 3300025916 | Bacteria | 2584 |
| 387 | Ga0207663_10052237 | 3300025916 | Bacteria | 2548 |
| 388 | Ga0207663_10108674 | 3300025916 | Bacteria | 1878 |
| 389 | Ga0207663_10328496 | 3300025916 | Bacteria | 1151 |
| 390 | Ga0207660_10131688 | 3300025917 | Bacteria | 1904 |
| 391 | Ga0207662_10020450 | 3300025918 | Bacteria | 3777 |
| 392 | Ga0207662_10073979 | 3300025918 | Bacteria | 2068 |
| 393 | Ga0207657_10028616 | 3300025919 | Bacteria | 5080 |
| 394 | Ga0207657_10093624 | 3300025919 | Bacteria | 2502 |
| 395 | Ga0207649_10071903 | 3300025920 | Bacteria | 2211 |
| 396 | Ga0207649_10074921 | 3300025920 | Bacteria | 2173 |
| 397 | Ga0207649_10202082 | 3300025920 | Bacteria | 1404 |
| 398 | Ga0207652_10013580 | 3300025921 | Bacteria | 6586 |
| 399 | Ga0207652_10058565 | 3300025921 | Bacteria | 3319 |
| 400 | Ga0207652_10244407 | 3300025921 | Bacteria | 1618 |
| 401 | Ga0207646_10013433 | 3300025922 | Bacteria | 7832 |
| 402 | Ga0207646_10051775 | 3300025922 | Bacteria | 3673 |
| 403 | Ga0207646_10076459 | 3300025922 | Bacteria | 2992 |
| 404 | Ga0207646_10103806 | 3300025922 | Bacteria | 2549 |
| 405 | Ga0207681_10266403 | 3300025923 | Bacteria | 1343 |
| 406 | Ga0207650_10039344 | 3300025925 | Bacteria | 3456 |
| 407 | Ga0207650_10145297 | 3300025925 | Bacteria | 1867 |
| 408 | Ga0207659_10004425 | 3300025926 | Bacteria | 8495 |
| 409 | Ga0207659_10184386 | 3300025926 | Bacteria | 1656 |
| 410 | Ga0207659_10247677 | 3300025926 | Bacteria | 1444 |
| 411 | Ga0207659_10279483 | 3300025926 | Bacteria | 1364 |
| 412 | Ga0207687_10163193 | 3300025927 | Bacteria | 1712 |
| 413 | Ga0207700_10000879 | 3300025928 | Bacteria | 17301 |
| 414 | Ga0207700_10005311 | 3300025928 | Bacteria | 7686 |
| 415 | Ga0207700_10006552 | 3300025928 | Bacteria | 7044 |
| 416 | Ga0207700_10009432 | 3300025928 | Bacteria | 6096 |
| 417 | Ga0207700_10012259 | 3300025928 | Bacteria | 5519 |
| 418 | Ga0207700_10013326 | 3300025928 | Bacteria | 5344 |
| 419 | Ga0207700_10025128 | 3300025928 | Bacteria | 4132 |
| 420 | Ga0207700_10027814 | 3300025928 | Bacteria | 3966 |
| 421 | Ga0207700_10028916 | 3300025928 | Bacteria | 3906 |
| 422 | Ga0207700_10039159 | 3300025928 | Bacteria | 3447 |
| 423 | Ga0207700_10107439 | 3300025928 | Bacteria | 2239 |
| 424 | Ga0207700_10176240 | 3300025928 | Bacteria | 1787 |
| 425 | Ga0207700_10192514 | 3300025928 | Bacteria | 1714 |
| 426 | Ga0207664_10000515 | 3300025929 | Bacteria | 27496 |
| 427 | Ga0207664_10008588 | 3300025929 | Bacteria | 7138 |
| 428 | Ga0207664_10009335 | 3300025929 | Bacteria | 6878 |
| 429 | Ga0207664_10014115 | 3300025929 | Bacteria | 5760 |
| 430 | Ga0207664_10017462 | 3300025929 | Bacteria | 5262 |
| 431 | Ga0207664_10020134 | 3300025929 | Bacteria | 4940 |
| 432 | Ga0207664_10026482 | 3300025929 | Bacteria | 4384 |
| 433 | Ga0207664_10044574 | 3300025929 | Bacteria | 3474 |
| 434 | Ga0207664_10046601 | 3300025929 | Bacteria | 3403 |
| 435 | Ga0207664_10056124 | 3300025929 | Bacteria | 3127 |
| 436 | Ga0207664_10071442 | 3300025929 | Bacteria | 2796 |
| 437 | Ga0207664_10093066 | 3300025929 | Bacteria | 2475 |
| 438 | Ga0207664_10114611 | 3300025929 | Bacteria | 2246 |
| 439 | Ga0207664_10142995 | 3300025929 | Bacteria | 2026 |
| 440 | Ga0207664_10160133 | 3300025929 | Bacteria | 1919 |
| 441 | Ga0207664_10190259 | 3300025929 | Bacteria | 1766 |
| 442 | Ga0207664_10197286 | 3300025929 | Bacteria | 1736 |
| 443 | Ga0207664_10231130 | 3300025929 | Bacteria | 1607 |
| 444 | Ga0207664_10315930 | 3300025929 | Bacteria | 1377 |
| 445 | Ga0207706_10004178 | 3300025933 | Bacteria | 13594 |
| 446 | Ga0207706_10040701 | 3300025933 | Bacteria | 4119 |
| 447 | Ga0207686_10647108 | 3300025934 | Bacteria | 836 |
| 448 | Ga0207670_10034163 | 3300025936 | Bacteria | 3283 |
| 449 | Ga0207670_10250084 | 3300025936 | Bacteria | 1369 |
| 450 | Ga0207669_10023945 | 3300025937 | Bacteria | 3272 |
| 451 | Ga0207669_10317924 | 3300025937 | Bacteria | 1190 |
| 452 | Ga0207669_10435211 | 3300025937 | Bacteria | 1036 |
| 453 | Ga0207704_10038018 | 3300025938 | Bacteria | 2786 |
| 454 | Ga0207665_10000100 | 3300025939 | Bacteria | 55652 |
| 455 | Ga0207665_10005314 | 3300025939 | Bacteria | 8606 |
| 456 | Ga0207665_10007468 | 3300025939 | Bacteria | 7225 |
| 457 | Ga0207665_10016388 | 3300025939 | Bacteria | 4865 |
| 458 | Ga0207665_10036332 | 3300025939 | Bacteria | 3276 |
| 459 | Ga0207665_10076898 | 3300025939 | Bacteria | 2290 |
| 460 | Ga0207665_10197034 | 3300025939 | Bacteria | 1466 |
| 461 | Ga0207691_10057293 | 3300025940 | Bacteria | 3546 |
| 462 | Ga0207691_10299901 | 3300025940 | Bacteria | 1381 |
| 463 | Ga0207711_10095886 | 3300025941 | Bacteria | 2617 |
| 464 | Ga0207711_10430369 | 3300025941 | Bacteria | 1228 |
| 465 | Ga0207689_10004008 | 3300025942 | Bacteria | 13397 |
| 466 | Ga0207689_10097397 | 3300025942 | Bacteria | 2416 |
| 467 | Ga0207689_10143209 | 3300025942 | Bacteria | 1969 |
| 468 | Ga0207689_10211710 | 3300025942 | Bacteria | 1601 |
| 469 | Ga0207661_10002147 | 3300025944 | Bacteria | 13578 |
| 470 | Ga0207661_10006800 | 3300025944 | Bacteria | 8101 |
| 471 | Ga0207661_10177633 | 3300025944 | Bacteria | 1857 |
| 472 | Ga0207661_10195020 | 3300025944 | Bacteria | 1778 |
| 473 | Ga0207661_10234414 | 3300025944 | Bacteria | 1627 |
| 474 | Ga0207661_10273819 | 3300025944 | Bacteria | 1507 |
| 475 | Ga0207679_10005780 | 3300025945 | Bacteria | 7765 |
| 476 | Ga0207679_10088091 | 3300025945 | Bacteria | 2392 |
| 477 | Ga0207679_10410141 | 3300025945 | Bacteria | 1193 |
| 478 | Ga0207667_10077755 | 3300025949 | Bacteria | 3440 |
| 479 | Ga0207651_10093960 | 3300025960 | Bacteria | 2204 |
| 480 | Ga0207651_10181034 | 3300025960 | Bacteria | 1672 |
| 481 | Ga0207712_10057681 | 3300025961 | Bacteria | 2740 |
| 482 | Ga0207668_10108153 | 3300025972 | Bacteria | 2081 |
| 483 | Ga0207640_10049938 | 3300025981 | Bacteria | 2711 |
| 484 | Ga0207640_10090480 | 3300025981 | Bacteria | 2118 |
| 485 | Ga0207658_10225842 | 3300025986 | Bacteria | 1578 |
| 486 | Ga0207677_10005659 | 3300026023 | Bacteria | 6797 |
| 487 | Ga0207677_10080927 | 3300026023 | Bacteria | 2329 |
| 488 | Ga0207703_10000147 | 3300026035 | Bacteria | 82822 |
| 489 | Ga0207703_10338804 | 3300026035 | Bacteria | 1381 |
| 490 | Ga0207703_10375908 | 3300026035 | Bacteria | 1313 |
| 491 | Ga0207639_10549487 | 3300026041 | Bacteria | 1060 |
| 492 | Ga0207678_10254998 | 3300026067 | Bacteria | 1503 |
| 493 | Ga0207708_10002233 | 3300026075 | Bacteria | 14285 |
| 494 | Ga0207708_10057411 | 3300026075 | Bacteria | 2969 |
| 495 | Ga0207708_10194941 | 3300026075 | Bacteria | 1614 |
| 496 | Ga0207708_10211770 | 3300026075 | Bacteria | 1550 |
| 497 | Ga0207702_10022462 | 3300026078 | Bacteria | 5230 |
| 498 | Ga0207702_10053111 | 3300026078 | Bacteria | 3430 |
| 499 | Ga0207641_10013621 | 3300026088 | Bacteria | 6670 |
| 500 | Ga0207641_10562550 | 3300026088 | Bacteria | 1113 |
| 501 | Ga0207648_10105956 | 3300026089 | Bacteria | 2466 |
| 502 | Ga0207648_10185317 | 3300026089 | Bacteria | 1843 |
| 503 | Ga0207676_10125068 | 3300026095 | Bacteria | 2176 |
| 504 | Ga0207674_10014768 | 3300026116 | Bacteria | 8614 |
| 505 | Ga0207674_10065524 | 3300026116 | Bacteria | 3661 |
| 506 | Ga0207674_10080516 | 3300026116 | Bacteria | 3260 |
| 507 | Ga0207675_100016647 | 3300026118 | Bacteria | 6865 |
| 508 | Ga0207675_100096851 | 3300026118 | Bacteria | 2778 |
| 509 | Ga0207675_100302972 | 3300026118 | Bacteria | 1557 |
| 510 | Ga0207675_100682336 | 3300026118 | Bacteria | 1035 |
| 511 | Ga0207675_100687062 | 3300026118 | Bacteria | 1032 |
| 512 | Ga0207683_10055321 | 3300026121 | Bacteria | 3479 |
| 513 | Ga0207683_10072865 | 3300026121 | Bacteria | 3038 |
| 514 | Ga0207683_10166471 | 3300026121 | Bacteria | 1995 |
| 515 | Ga0207698_10253989 | 3300026142 | Bacteria | 1611 |
| 516 | Ga0207428_10011911 | 3300027907 | Bacteria | 7656 |
| 517 | Ga0207428_10084816 | 3300027907 | Bacteria | 2468 |
| 518 | Ga0207428_10249255 | 3300027907 | Bacteria | 1325 |
| 519 | Ga0207428_10431996 | 3300027907 | Bacteria | 962 |
| 520 | Ga0268266_10036260 | 3300028379 | Bacteria | 4197 |
| 521 | Ga0268265_10000009 | 3300028380 | Bacteria | 375889 |
| 522 | Ga0268265_10011087 | 3300028380 | Bacteria | 6091 |
| 523 | Ga0268264_10239901 | 3300028381 | Bacteria | 1678 |
| 524 | Ga0268264_10370255 | 3300028381 | Bacteria | 1369 |
| 525 | Ga0265337_1007533 | 3300028556 | Bacteria | 4065 |
| 526 | Ga0265334_10002841 | 3300028573 | Bacteria | 7971 |
| 527 | Ga0265318_10009714 | 3300028577 | Bacteria | 4219 |
| 528 | Ga0265323_10050599 | 3300028653 | Bacteria | 1476 |
| 529 | Ga0265322_10014063 | 3300028654 | Bacteria | 2315 |
| 530 | Ga0265336_10002351 | 3300028666 | Bacteria | 7861 |
| 531 | Ga0265338_10000059 | 3300028800 | Bacteria | 198047 |
| 532 | Ga0265324_10000821 | 3300029957 | Bacteria | 20206 |
| 533 | Ga0265332_10056074 | 3300031238 | Bacteria | 1688 |
| 534 | Ga0265320_10027075 | 3300031240 | Bacteria | 2993 |
| 535 | Ga0265325_10026166 | 3300031241 | Bacteria | 3163 |
| 536 | Ga0265340_10025478 | 3300031247 | Bacteria | 2994 |
| 537 | Ga0265339_10094920 | 3300031249 | Bacteria | 1558 |
| 538 | Ga0265316_10115796 | 3300031344 | Bacteria | 2026 |
| 539 | Ga0307509_10018890 | 3300031507 | Bacteria | 7887 |
| 540 | Ga0307509_10154829 | 3300031507 | Bacteria | 2200 |
| 541 | Ga0307408_100058048 | 3300031548 | Bacteria | 2812 |
| 542 | Ga0265313_10010238 | 3300031595 | Bacteria | 5966 |
| 543 | Ga0307508_10000773 | 3300031616 | Bacteria | 37871 |
| 544 | Ga0307508_10022967 | 3300031616 | Bacteria | 5668 |
| 545 | Ga0265314_10029104 | 3300031711 | Bacteria | 4109 |
| 546 | Ga0265342_10001214 | 3300031712 | Bacteria | 24392 |
| 547 | Ga0307516_10090310 | 3300031730 | Bacteria | 2892 |
| 548 | Ga0307516_10196739 | 3300031730 | Bacteria | 1738 |
| 549 | Ga0307405_10323592 | 3300031731 | Bacteria | 1179 |
| 550 | Ga0307405_10356484 | 3300031731 | Bacteria | 1130 |
| 551 | Ga0307410_10111961 | 3300031852 | Bacteria | 1976 |
| 552 | Ga0307410_10787588 | 3300031852 | Bacteria | 808 |
| 553 | Ga0307406_10025635 | 3300031901 | Bacteria | 3531 |
| 554 | Ga0307406_10144817 | 3300031901 | Bacteria | 1687 |
| 555 | Ga0307409_100014296 | 3300031995 | Bacteria | 5155 |
| 556 | Ga0307409_100048571 | 3300031995 | Bacteria | 3231 |
| 557 | Ga0307409_100228455 | 3300031995 | Bacteria | 1685 |
| 558 | Ga0307409_100862256 | 3300031995 | Bacteria | 917 |
| 559 | Ga0307416_100027141 | 3300032002 | Bacteria | 4234 |
| 560 | Ga0307416_100140536 | 3300032002 | Bacteria | 2194 |
| 561 | Ga0307416_100220814 | 3300032002 | Bacteria | 1817 |
| 562 | Ga0307416_100391909 | 3300032002 | Bacteria | 1423 |
| 563 | Ga0307416_100559727 | 3300032002 | Bacteria | 1218 |
| 564 | Ga0307416_100577483 | 3300032002 | Bacteria | 1201 |
| 565 | Ga0307416_100819067 | 3300032002 | Bacteria | 1028 |
| 566 | Ga0307414_10377354 | 3300032004 | Bacteria | 1225 |
| 567 | Ga0307411_10085920 | 3300032005 | Bacteria | 2181 |
| 568 | Ga0307415_100000782 | 3300032126 | Bacteria | 14413 |
| 569 | Ga0307415_100035544 | 3300032126 | Bacteria | 3255 |
| 570 | Ga0307415_100303898 | 3300032126 | Bacteria | 1323 |
| 571 | Ga0307507_10041455 | 3300033179 | Bacteria | 4606 |
| 572 | Ga0307510_10138705 | 3300033180 | Bacteria | 2082 |
| 573 | Ga0373959_0004805 | 3300034820 | Bacteria | 2195 |
| 574 | Ga0373934_0004661 | 3300035086 | Bacteria | 5067 |
| 575 | Ga0373940_0004238 | 3300035088 | Bacteria | 3017 |
| 576 | Ga0373944_0001641 | 3300035089 | Bacteria | 5656 |
| 577 | Ga0373951_0074284 | 3300035091 | Bacteria | 871 |
| 578 | Ga0373923_0000678 | 3300035111 | Bacteria | 8650 |
| 579 | Ga0373936_0001646 | 3300035113 | Bacteria | 8191 |
| 580 | Ga0373936_0005075 | 3300035113 | Bacteria | 4954 |
| 581 | Ga0373936_0009359 | 3300035113 | Bacteria | 3692 |
| 582 | Ga0373936_0015325 | 3300035113 | Bacteria | 2937 |
| 583 | Ga0373936_0078316 | 3300035113 | Bacteria | 1372 |
| 584 | Ga0373936_0196018 | 3300035113 | Bacteria | 890 |
| 585 | Ga0373941_0017037 | 3300035115 | Bacteria | 1985 |
| 586 | Ga0373945_0005082 | 3300035116 | Bacteria | 4195 |
| 587 | Ga0373945_0005101 | 3300035116 | Bacteria | 4189 |
| 588 | Ga0373945_0115615 | 3300035116 | Bacteria | 1062 |
| 589 | Ga0373953_0005118 | 3300035117 | Bacteria | 4235 |
| 590 | Ga0373954_0029978 | 3300035118 | Bacteria | 2508 |
| 591 | Ga0373954_0033563 | 3300035118 | Bacteria | 2374 |
| 592 | Ga0373954_0077204 | 3300035118 | Bacteria | 1588 |
| 593 | Ga0373954_0090198 | 3300035118 | Bacteria | 1472 |
| 594 | Ga0373956_0002110 | 3300035119 | Bacteria | 8236 |
| 595 | Ga0373956_0013526 | 3300035119 | Bacteria | 3395 |
| 596 | Ga0373956_0021836 | 3300035119 | Bacteria | 2732 |
| 597 | Ga0373956_0106793 | 3300035119 | Bacteria | 1301 |
| 598 | Ga0373957_0002124 | 3300035120 | Bacteria | 5575 |
| 599 | Ga0373957_0003893 | 3300035120 | Bacteria | 4481 |
| 600 | Ga0373960_0040736 | 3300035121 | Bacteria | 1342 |
| 601 | Ga0373943_0009200 | 3300035170 | Bacteria | 4426 |
| 602 | Ga0373946_0000512 | 3300035171 | Bacteria | 12860 |
| 603 | Ga0373946_0036015 | 3300035171 | Bacteria | 2004 |
| 604 | Ga0373955_0001398 | 3300035172 | Bacteria | 10270 |
| 605 | Ga0373955_0005298 | 3300035172 | Bacteria | 5789 |
| 606 | Ga0373955_0013567 | 3300035172 | Bacteria | 3944 |
| 607 | Ga0373955_0030280 | 3300035172 | Bacteria | 2823 |
| 608 | Ga0373955_0374907 | 3300035172 | Bacteria | 863 |
| 609 | Ga0373942_0053647 | 3300035207 | Bacteria | 1137 |
| 610 | Ga0373924_0002263 | 3300035410 | Bacteria | 6459 |
| 611 | Ga0373924_0004734 | 3300035410 | Bacteria | 4776 |
| 612 | Ga0373924_0005988 | 3300035410 | Bacteria | 4336 |
| 613 | Ga0373931_0048120 | 3300035691 | Bacteria | 2259 |
| 614 | Ga0373935_0078910 | 3300035692 | Bacteria | 2136 |
| 615 | Ga0373935_0089915 | 3300035692 | Bacteria | 2008 |
| 616 | Ga0373935_0114919 | 3300035692 | Bacteria | 1791 |
| 617 | Ga0373935_0339616 | 3300035692 | Bacteria | 1069 |
| 618 | Ga0373927_0003660 | 3300035695 | Bacteria | 10952 |
| 619 | Ga0373927_0034598 | 3300035695 | Bacteria | 3286 |
| 620 | Ga0373927_0038905 | 3300035695 | Bacteria | 3087 |
| 621 | Ga0373927_0238893 | 3300035695 | Bacteria | 1194 |
| 622 | Ga0373933_0007397 | 3300035724 | Bacteria | 5988 |
| 623 | Ga0373933_0033398 | 3300035724 | Bacteria | 2993 |
| 624 | Ga0373933_0066318 | 3300035724 | Bacteria | 2187 |
| 625 | Ga0373933_0075580 | 3300035724 | Bacteria | 2056 |
| 626 | Ga0373933_0082908 | 3300035724 | Bacteria | 1968 |
| 627 | Ga0373933_0122955 | 3300035724 | Bacteria | 1626 |
| 628 | Ga0373933_0124644 | 3300035724 | Bacteria | 1615 |
| 629 | Ga0373933_0164469 | 3300035724 | Bacteria | 1410 |
| 630 | Ga0373947_0003126 | 3300035725 | Bacteria | 9852 |
| 631 | Ga0373947_0018422 | 3300035725 | Bacteria | 4018 |
| 632 | Ga0373947_0040507 | 3300035725 | Bacteria | 2774 |
| 633 | Ga0373937_0002125 | 3300036401 | Bacteria | 16562 |
| 634 | Ga0373937_0007374 | 3300036401 | Bacteria | 9517 |
| 635 | Ga0373937_0008229 | 3300036401 | Bacteria | 9056 |
| 636 | Ga0373937_0010358 | 3300036401 | Bacteria | 8140 |
| 637 | Ga0373937_0016955 | 3300036401 | Bacteria | 6477 |
| 638 | Ga0373937_0020657 | 3300036401 | Bacteria | 5904 |
| 639 | Ga0373937_0033873 | 3300036401 | Bacteria | 4643 |
| 640 | Ga0373937_0051430 | 3300036401 | Bacteria | 3776 |
| 641 | Ga0373937_0083306 | 3300036401 | Bacteria | 2958 |
| 642 | Ga0373937_0165860 | 3300036401 | Bacteria | 2071 |
| 643 | Ga0373937_0198097 | 3300036401 | Bacteria | 1888 |
| 644 | Ga0373937_0469191 | 3300036401 | Bacteria | 1195 |
| 645 | Ga0372808_013280 | 3300036459 | Bacteria | 1173 |
| 646 | Ga0373925_0000231 | 3300037068 | Bacteria | 59007 |
| 647 | Ga0373925_0000554 | 3300037068 | Bacteria | 36625 |
| 648 | Ga0373925_0000779 | 3300037068 | Bacteria | 29324 |
| 649 | Ga0373925_0004017 | 3300037068 | Bacteria | 11185 |
| 650 | Ga0373925_0009300 | 3300037068 | Bacteria | 7153 |
| 651 | Ga0373925_0014345 | 3300037068 | Bacteria | 5732 |
| 652 | Ga0373925_0108618 | 3300037068 | Bacteria | 2141 |
| 653 | Ga0373925_0199146 | 3300037068 | Bacteria | 1592 |
| 654 | Ga0373925_0250578 | 3300037068 | Bacteria | 1420 |
| 655 | Ga0373925_0334557 | 3300037068 | Bacteria | 1227 |
| 656 | Ga0373925_0675273 | 3300037068 | Bacteria | 851 |
| 657 | Ga0395899_0005516 | 3300037312 | Bacteria | 9803 |
| 658 | Ga0395899_0023085 | 3300037312 | Bacteria | 4714 |
| 659 | Ga0395899_0023972 | 3300037312 | Bacteria | 4617 |
| 660 | Ga0395899_0077434 | 3300037312 | Bacteria | 2425 |
| 661 | Ga0395899_0167572 | 3300037312 | Bacteria | 1549 |
| 662 | Ga0395899_0240888 | 3300037312 | Bacteria | 1245 |
| 663 | Ga0395900_0029569 | 3300037418 | Bacteria | 5621 |
| 664 | Ga0395900_0030702 | 3300037418 | Bacteria | 5518 |
| 665 | Ga0395900_0035605 | 3300037418 | Bacteria | 5128 |
| 666 | Ga0395900_0039982 | 3300037418 | Bacteria | 4833 |
| 667 | Ga0395900_0044740 | 3300037418 | Bacteria | 4561 |
| 668 | Ga0395900_0047123 | 3300037418 | Bacteria | 4438 |
| 669 | Ga0395900_0048875 | 3300037418 | Bacteria | 4356 |
| 670 | Ga0395900_0055124 | 3300037418 | Bacteria | 4093 |
| 671 | Ga0395900_0080771 | 3300037418 | Bacteria | 3341 |
| 672 | Ga0395900_0149599 | 3300037418 | Bacteria | 2386 |
| 673 | Ga0395898_0007057 | 3300037466 | Bacteria | 11935 |
| 674 | Ga0395898_0014253 | 3300037466 | Bacteria | 8171 |
| 675 | Ga0395898_0029725 | 3300037466 | Bacteria | 5470 |
| 676 | Ga0395898_0039170 | 3300037466 | Bacteria | 4692 |
| 677 | Ga0395898_0076991 | 3300037466 | Bacteria | 3220 |
| 678 | Ga0395898_0114384 | 3300037466 | Bacteria | 2585 |
| 679 | Ga0395898_0133395 | 3300037466 | Bacteria | 2378 |
| 680 | Ga0395898_0154104 | 3300037466 | Bacteria | 2198 |
| 681 | Ga0395898_0197322 | 3300037466 | Bacteria | 1922 |
| 682 | Ga0395898_0412620 | 3300037466 | Bacteria | 1287 |
| 683 | Ga0395905_0009185 | 3300037471 | Bacteria | 9679 |
| 684 | Ga0395905_0017073 | 3300037471 | Bacteria | 6892 |
| 685 | Ga0395905_0018244 | 3300037471 | Bacteria | 6661 |
| 686 | Ga0395905_0035080 | 3300037471 | Bacteria | 4709 |
| 687 | Ga0395905_0057431 | 3300037471 | Bacteria | 3640 |
| 688 | Ga0395905_0081703 | 3300037471 | Bacteria | 3028 |
| 689 | Ga0395905_0135021 | 3300037471 | Bacteria | 2321 |
| 690 | Ga0395905_0159127 | 3300037471 | Bacteria | 2123 |
| 691 | Ga0395905_0730980 | 3300037471 | Bacteria | 892 |
| 692 | Ga0436364_0010280 | 3300037853 | Bacteria | 19989 |
| 693 | Ga0436364_0082841 | 3300037853 | Bacteria | 976 |
| 694 | Ga0436364_0241292 | 3300037853 | Bacteria | 1788 |
| 695 | Ga0436364_0383955 | 3300037853 | Bacteria | 2718 |
| 696 | Ga0436364_0496703 | 3300037853 | Bacteria | 4106 |
| 697 | Ga0436364_0821490 | 3300037853 | Bacteria | 2234 |
| 698 | Ga0436364_0825929 | 3300037853 | Bacteria | 3275 |
| 699 | Ga0436364_0923522 | 3300037853 | Bacteria | 137390 |
| 700 | Ga0436364_1023683 | 3300037853 | Bacteria | 3343 |
| 701 | Ga0436364_1237330 | 3300037853 | Bacteria | 9021 |
| 702 | Ga0436364_1404373 | 3300037853 | Bacteria | 8917 |
| 703 | Ga0395901_0020563 | 3300038443 | Bacteria | 6754 |
| 704 | Ga0395901_0024346 | 3300038443 | Bacteria | 6213 |
| 705 | Ga0395901_0029599 | 3300038443 | Bacteria | 5639 |
| 706 | Ga0395901_0030170 | 3300038443 | Bacteria | 5586 |
| 707 | Ga0395901_0053689 | 3300038443 | Bacteria | 4187 |
| 708 | Ga0395901_0064867 | 3300038443 | Bacteria | 3802 |
| 709 | Ga0395901_0090089 | 3300038443 | Bacteria | 3210 |
| 710 | Ga0395901_0160058 | 3300038443 | Bacteria | 2365 |
| 711 | Ga0395901_0292959 | 3300038443 | Bacteria | 1688 |
| 712 | Ga0395901_0631449 | 3300038443 | Bacteria | 1077 |
| 713 | Ga0395901_0935609 | 3300038443 | Bacteria | 846 |
| 714 | Ga0436365_0614644 | 3300039437 | Bacteria | 1550 |
| 715 | Ga0436360_0246735 | 3300039438 | Bacteria | 1513 |
| 716 | Ga0436363_0322036 | 3300039450 | Bacteria | 1307 |
| 717 | Ga0436363_0980729 | 3300039450 | Bacteria | 2343 |
| 718 | Ga0436363_1328754 | 3300039450 | Bacteria | 2513 |
| 719 | Ga0451853_0135350 | 3300041512 | Bacteria | 1976 |
| 720 | Ga0439463_025482 | 3300042016 | Bacteria | 1484 |
| 721 | Ga0450908_012200 | 3300042184 | Bacteria | 1562 |
| 722 | Ga0439435_0037468 | 3300042436 | Bacteria | 1344 |
| 723 | Ga0466965_0048583 | 3300044683 | Bacteria | 2102 |
| 724 | Ga0466963_0178155 | 3300044694 | Bacteria | 1484 |
| 725 | Ga0466960_0024774 | 3300044901 | Bacteria | 2710 |
| 726 | Ga0466959_0345553 | 3300045049 | Bacteria | 1015 |
| 727 | Ga0466959_0432720 | 3300045049 | Bacteria | 893 |
| 728 | Ga0466958_0160530 | 3300045836 | Bacteria | 1420 |
| 729 | Ga0466958_0537629 | 3300045836 | Bacteria | 759 |
| 730 | Ga0466967_0280250 | 3300045976 | Bacteria | 1599 |
| 731 | Ga0466967_0390062 | 3300045976 | Bacteria | 1353 |
| 732 | Ga0466967_0547377 | 3300045976 | Bacteria | 1139 |
| 733 | Ga0495592_0025222 | 3300046454 | Bacteria | 4513 |
| 734 | Ga0495592_0065299 | 3300046454 | Bacteria | 2664 |
| 735 | Ga0495592_0082818 | 3300046454 | Bacteria | 2318 |
| 736 | Ga0495603_0001113 | 3300046455 | Bacteria | 15625 |
| 737 | Ga0495603_0004303 | 3300046455 | Bacteria | 8488 |
| 738 | Ga0495629_0011488 | 3300046459 | Bacteria | 6432 |
| 739 | Ga0495629_0013405 | 3300046459 | Bacteria | 5914 |
| 740 | Ga0495629_0051026 | 3300046459 | Bacteria | 2896 |
| 741 | Ga0495641_0005227 | 3300046461 | Bacteria | 8844 |
| 742 | Ga0495641_0010720 | 3300046461 | Bacteria | 5282 |
| 743 | Ga0495641_0016732 | 3300046461 | Bacteria | 3852 |
| 744 | Ga0495651_0021252 | 3300046462 | Bacteria | 5043 |
| 745 | Ga0495651_0022414 | 3300046462 | Bacteria | 4908 |
| 746 | Ga0495651_0023445 | 3300046462 | Bacteria | 4797 |
| 747 | Ga0495651_0029088 | 3300046462 | Bacteria | 4309 |
| 748 | Ga0495651_0044435 | 3300046462 | Bacteria | 3443 |
| 749 | Ga0495653_0011070 | 3300046463 | Bacteria | 7375 |
| 750 | Ga0495653_0042044 | 3300046463 | Bacteria | 3563 |
| 751 | Ga0495653_0086891 | 3300046463 | Bacteria | 2297 |
| 752 | Ga0495653_0094982 | 3300046463 | Bacteria | 2171 |
| 753 | Ga0495653_0096657 | 3300046463 | Bacteria | 2147 |
| 754 | Ga0495580_0007651 | 3300046472 | Bacteria | 8666 |
| 755 | Ga0495580_0058359 | 3300046472 | Bacteria | 2714 |
| 756 | Ga0495582_0001782 | 3300046473 | Bacteria | 12155 |
| 757 | Ga0495582_0008719 | 3300046473 | Bacteria | 5591 |
| 758 | Ga0495582_0066246 | 3300046473 | Bacteria | 1995 |
| 759 | Ga0495582_0087275 | 3300046473 | Bacteria | 1737 |
| 760 | Ga0495639_0000902 | 3300046475 | Bacteria | 13408 |
| 761 | Ga0495639_0014608 | 3300046475 | Bacteria | 3401 |
| 762 | Ga0495662_0017607 | 3300046476 | Bacteria | 3458 |
| 763 | Ga0495662_0049342 | 3300046476 | Bacteria | 2031 |
| 764 | Ga0495662_0110126 | 3300046476 | Bacteria | 1349 |
| 765 | Ga0495664_0002110 | 3300046477 | Bacteria | 10635 |
| 766 | Ga0495664_0046511 | 3300046477 | Bacteria | 2574 |
| 767 | Ga0495664_0105754 | 3300046477 | Bacteria | 1696 |
| 768 | Ga0495664_0179185 | 3300046477 | Bacteria | 1285 |
| 769 | Ga0495594_0004077 | 3300046499 | Bacteria | 7510 |
| 770 | Ga0495594_0022643 | 3300046499 | Bacteria | 3360 |
| 771 | Ga0495594_0337765 | 3300046499 | Bacteria | 858 |
| 772 | Ga0495608_0056516 | 3300046511 | Bacteria | 2591 |
| 773 | Ga0495608_0085740 | 3300046511 | Bacteria | 2041 |
| 774 | Ga0495608_0111328 | 3300046511 | Bacteria | 1760 |
| 775 | Ga0495608_0218797 | 3300046511 | Bacteria | 1195 |
| 776 | Ga0495608_0262740 | 3300046511 | Bacteria | 1074 |
| 777 | Ga0495608_0404313 | 3300046511 | Bacteria | 835 |
| 778 | Ga0495618_0009119 | 3300046514 | Bacteria | 5985 |
| 779 | Ga0495618_0016207 | 3300046514 | Bacteria | 4555 |
| 780 | Ga0495618_0060587 | 3300046514 | Bacteria | 2400 |
| 781 | Ga0495618_0067340 | 3300046514 | Bacteria | 2277 |
| 782 | Ga0495628_0019080 | 3300046516 | Bacteria | 5672 |
| 783 | Ga0495628_0033703 | 3300046516 | Bacteria | 4124 |
| 784 | Ga0495628_0082117 | 3300046516 | Bacteria | 2503 |
| 785 | Ga0495628_0263238 | 3300046516 | Bacteria | 1284 |
| 786 | Ga0495630_0010186 | 3300046517 | Bacteria | 6778 |
| 787 | Ga0495630_0041868 | 3300046517 | Bacteria | 3420 |
| 788 | Ga0495630_0132730 | 3300046517 | Bacteria | 1891 |
| 789 | Ga0495666_0001705 | 3300046526 | Bacteria | 10859 |
| 790 | Ga0495652_0017730 | 3300046529 | Bacteria | 6355 |
| 791 | Ga0495652_0020248 | 3300046529 | Bacteria | 5914 |
| 792 | Ga0495652_0249349 | 3300046529 | Bacteria | 1316 |
| 793 | Ga0495652_0279741 | 3300046529 | Bacteria | 1222 |
| 794 | Ga0495652_0392249 | 3300046529 | Bacteria | 985 |
| 795 | Ga0495665_0005360 | 3300046531 | Bacteria | 6912 |
| 796 | Ga0495665_0040081 | 3300046531 | Bacteria | 2494 |
| 797 | Ga0495640_0007047 | 3300046533 | Bacteria | 8848 |
| 798 | Ga0495640_0051582 | 3300046533 | Bacteria | 2827 |
| 799 | Ga0495640_0177516 | 3300046533 | Bacteria | 1359 |
| 800 | Ga0495586_0006962 | 3300046535 | Bacteria | 6023 |
| 801 | Ga0495586_0013646 | 3300046535 | Bacteria | 4310 |
| 802 | Ga0495586_0172558 | 3300046535 | Bacteria | 1222 |
| 803 | Ga0495587_0009099 | 3300046536 | Bacteria | 6372 |
| 804 | Ga0495587_0057356 | 3300046536 | Bacteria | 2289 |
| 805 | Ga0495587_0062098 | 3300046536 | Bacteria | 2188 |
| 806 | Ga0495645_0069259 | 3300046543 | Bacteria | 2546 |
| 807 | Ga0495645_0075853 | 3300046543 | Bacteria | 2420 |
| 808 | Ga0495645_0117775 | 3300046543 | Bacteria | 1873 |
| 809 | Ga0495667_0005171 | 3300046559 | Bacteria | 8815 |
| 810 | Ga0495667_0020210 | 3300046559 | Bacteria | 4492 |
| 811 | Ga0495667_0029400 | 3300046559 | Bacteria | 3699 |
| 812 | Ga0495667_0041872 | 3300046559 | Bacteria | 3036 |
| 813 | Ga0495667_0109291 | 3300046559 | Bacteria | 1786 |
| 814 | Ga0495656_0144651 | 3300046615 | Bacteria | 1143 |
| 815 | Ga0495656_0340372 | 3300046615 | Bacteria | 776 |
| 816 | Ga0495634_0037462 | 3300046642 | Bacteria | 3313 |
| 817 | Ga0495634_0058617 | 3300046642 | Bacteria | 2566 |
| 818 | Ga0495635_0016830 | 3300046663 | Bacteria | 5107 |
| 819 | Ga0495635_0028518 | 3300046663 | Bacteria | 3881 |
| 820 | Ga0495635_0053924 | 3300046663 | Bacteria | 2769 |
| 821 | Ga0495635_0100822 | 3300046663 | Bacteria | 1973 |
| 822 | Ga0495635_0205917 | 3300046663 | Bacteria | 1333 |
| 823 | Ga0495635_0238789 | 3300046663 | Bacteria | 1226 |
| 824 | Ga0495659_0087105 | 3300046664 | Bacteria | 1194 |
| 825 | Ga0495588_0007147 | 3300046674 | Bacteria | 5065 |
| 826 | Ga0495588_0115686 | 3300046674 | Bacteria | 1413 |
| 827 | Ga0495657_0012189 | 3300046675 | Bacteria | 6394 |
| 828 | Ga0495657_0052313 | 3300046675 | Bacteria | 2738 |
| 829 | Ga0495657_0079423 | 3300046675 | Bacteria | 2125 |
| 830 | Ga0495657_0089568 | 3300046675 | Bacteria | 1976 |
| 831 | Ga0495657_0094235 | 3300046675 | Bacteria | 1915 |
| 832 | Ga0495657_0139320 | 3300046675 | Bacteria | 1513 |
| 833 | Ga0495657_0356201 | 3300046675 | Bacteria | 865 |
| 834 | Ga0495599_0009353 | 3300046678 | Bacteria | 5986 |
| 835 | Ga0495599_0019364 | 3300046678 | Bacteria | 4243 |
| 836 | Ga0495599_0063871 | 3300046678 | Bacteria | 2300 |
| 837 | Ga0495599_0077161 | 3300046678 | Bacteria | 2080 |
| 838 | Ga0495623_0058542 | 3300046679 | Bacteria | 2422 |
| 839 | Ga0495623_0059980 | 3300046679 | Bacteria | 2388 |
| 840 | Ga0495623_0089508 | 3300046679 | Bacteria | 1892 |
| 841 | Ga0495623_0145632 | 3300046679 | Bacteria | 1405 |
| 842 | Ga0495646_0007317 | 3300046680 | Bacteria | 7013 |
| 843 | Ga0495646_0064335 | 3300046680 | Bacteria | 2174 |
| 844 | Ga0495646_0236485 | 3300046680 | Bacteria | 983 |
| 845 | Ga0495647_0010633 | 3300046681 | Bacteria | 3137 |
| 846 | Ga0495647_0022181 | 3300046681 | Bacteria | 2292 |
| 847 | Ga0495658_0004824 | 3300046683 | Bacteria | 6614 |
| 848 | Ga0495658_0011799 | 3300046683 | Bacteria | 4405 |
| 849 | Ga0495613_0003433 | 3300046689 | Bacteria | 11846 |
| 850 | Ga0495613_0007035 | 3300046689 | Bacteria | 8374 |
| 851 | Ga0495613_0025801 | 3300046689 | Bacteria | 4378 |
| 852 | Ga0495624_0006342 | 3300046690 | Bacteria | 8399 |
| 853 | Ga0495670_0267504 | 3300046691 | Bacteria | 913 |
| 854 | Ga0495589_0123796 | 3300046794 | Bacteria | 1244 |
| 855 | Ga0495600_0006668 | 3300046809 | Bacteria | 7036 |
| 856 | Ga0495600_0047171 | 3300046809 | Bacteria | 2810 |
| 857 | Ga0495600_0102369 | 3300046809 | Bacteria | 1866 |
| 858 | Ga0495600_0192535 | 3300046809 | Bacteria | 1311 |
| 859 | Ga0495581_0002431 | 3300047315 | Bacteria | 10524 |
| 860 | Ga0495581_0005320 | 3300047315 | Bacteria | 7445 |
| 861 | Ga0495604_0037480 | 3300047317 | Bacteria | 3817 |
| 862 | Ga0495604_0040138 | 3300047317 | Bacteria | 3676 |
| 863 | Ga0495604_0073276 | 3300047317 | Bacteria | 2585 |
| 864 | Ga0495604_0117480 | 3300047317 | Bacteria | 1929 |
| 865 | Ga0495674_0015950 | 3300047319 | Bacteria | 7013 |
| 866 | Ga0495674_0070849 | 3300047319 | Bacteria | 3012 |
| 867 | Ga0495674_0087945 | 3300047319 | Bacteria | 2658 |
| 868 | Ga0495674_0093469 | 3300047319 | Bacteria | 2566 |
| 869 | Ga0495674_0099087 | 3300047319 | Bacteria | 2481 |
| 870 | Ga0495674_0170529 | 3300047319 | Bacteria | 1816 |
| 871 | Ga0495676_0006083 | 3300047321 | Bacteria | 11098 |
| 872 | Ga0495676_0102382 | 3300047321 | Bacteria | 2116 |
| 873 | Ga0495680_0012830 | 3300047322 | Bacteria | 7343 |
| 874 | Ga0495680_0019030 | 3300047322 | Bacteria | 5812 |
| 875 | Ga0495680_0029697 | 3300047322 | Bacteria | 4474 |
| 876 | Ga0495680_0046315 | 3300047322 | Bacteria | 3429 |
| 877 | Ga0495680_0085583 | 3300047322 | Bacteria | 2373 |
| 878 | Ga0495680_0097434 | 3300047322 | Bacteria | 2195 |
| 879 | Ga0495680_0145810 | 3300047322 | Bacteria | 1729 |
| 880 | Ga0495680_0347063 | 3300047322 | Bacteria | 1034 |
| 881 | Ga0495675_0004262 | 3300047444 | Bacteria | 8647 |
| 882 | Ga0495675_0015104 | 3300047444 | Bacteria | 4882 |
| 883 | Ga0495675_0124402 | 3300047444 | Bacteria | 1605 |
| 884 | Ga0495675_0156381 | 3300047444 | Bacteria | 1406 |
| 885 | Ga0495684_0029336 | 3300047471 | Bacteria | 4222 |
| 886 | Ga0495684_0030940 | 3300047471 | Bacteria | 4109 |
| 887 | Ga0495684_0036478 | 3300047471 | Bacteria | 3768 |
| 888 | Ga0495684_0089383 | 3300047471 | Bacteria | 2333 |
| 889 | Ga0495684_0116567 | 3300047471 | Bacteria | 2013 |
| 890 | Ga0495684_0121323 | 3300047471 | Bacteria | 1968 |
| 891 | Ga0495684_0188584 | 3300047471 | Bacteria | 1525 |
| 892 | Ga0495684_0223052 | 3300047471 | Bacteria | 1381 |
| 893 | Ga0495593_0004098 | 3300047673 | Bacteria | 8667 |
| 894 | Ga0495593_0006460 | 3300047673 | Bacteria | 6868 |
| 895 | Ga0495602_0013041 | 3300048088 | Bacteria | 8501 |
| 896 | Ga0495602_0019899 | 3300048088 | Bacteria | 6647 |
| 897 | Ga0495602_0034577 | 3300048088 | Bacteria | 4726 |
| 898 | Ga0495602_0049359 | 3300048088 | Bacteria | 3770 |
| 899 | Ga0495602_0097502 | 3300048088 | Bacteria | 2421 |
| 900 | Ga0495602_0115157 | 3300048088 | Bacteria | 2175 |
| 901 | Ga0495602_0201218 | 3300048088 | Bacteria | 1519 |
| 902 | Ga0495614_0001897 | 3300048089 | Bacteria | 9170 |
| 903 | Ga0495614_0013260 | 3300048089 | Bacteria | 3615 |
| 904 | Ga0495615_0059491 | 3300048090 | Bacteria | 1005 |
| 905 | Ga0496100_0037878 | 3300048903 | Bacteria | 3052 |
| 906 | Ga0496101_0005465 | 3300048904 | Bacteria | 8101 |
| 907 | Ga0496104_0037090 | 3300048907 | Bacteria | 4558 |
| 908 | Ga0496104_0116546 | 3300048907 | Bacteria | 2564 |
| 909 | Ga0496104_0146782 | 3300048907 | Bacteria | 2265 |
| 910 | Ga0496104_0269116 | 3300048907 | Bacteria | 1616 |
| 911 | Ga0496105_0151016 | 3300048908 | Bacteria | 1909 |
| 912 | Ga0496105_0423648 | 3300048908 | Bacteria | 1053 |
| 913 | Ga0496107_0038018 | 3300048910 | Bacteria | 3455 |
| 914 | Ga0496107_0094315 | 3300048910 | Bacteria | 2189 |
| 915 | Ga0496108_0000128 | 3300048911 | Bacteria | 74691 |
| 916 | Ga0496108_0087238 | 3300048911 | Bacteria | 2650 |
| 917 | Ga0496108_0234662 | 3300048911 | Bacteria | 1595 |
| 918 | Ga0496109_0062422 | 3300048912 | Bacteria | 3407 |
| 919 | Ga0496109_0120199 | 3300048912 | Bacteria | 2447 |
| 920 | Ga0496109_0289898 | 3300048912 | Bacteria | 1543 |
| 921 | Ga0496109_0652667 | 3300048912 | Bacteria | 989 |
| 922 | Ga0496110_0025180 | 3300048913 | Bacteria | 5082 |
| 923 | Ga0496110_0232255 | 3300048913 | Bacteria | 1678 |
| 924 | Ga0496111_0103140 | 3300048914 | Bacteria | 2097 |
| 925 | Ga0496111_0271774 | 3300048914 | Bacteria | 1257 |
| 926 | Ga0496111_0455477 | 3300048914 | Bacteria | 944 |
| 927 | Ga0496112_0004178 | 3300048915 | Bacteria | 12161 |
| 928 | Ga0496112_0011017 | 3300048915 | Bacteria | 8240 |
| 929 | Ga0496112_0517368 | 3300048915 | Bacteria | 1128 |
| 930 | Ga0496113_0034712 | 3300048916 | Bacteria | 3682 |
| 931 | Ga0496113_0068024 | 3300048916 | Bacteria | 2703 |
| 932 | Ga0496114_0041577 | 3300048917 | Bacteria | 3810 |
| 933 | Ga0496115_0098262 | 3300048918 | Bacteria | 2397 |
| 934 | Ga0496115_0140345 | 3300048918 | Bacteria | 1994 |
| 935 | Ga0496115_0406307 | 3300048918 | Bacteria | 1104 |
| 936 | Ga0496119_0013498 | 3300048922 | Bacteria | 6501 |
| 937 | Ga0496121_0003979 | 3300048924 | Bacteria | 20381 |
| 938 | Ga0496126_0109185 | 3300048929 | Bacteria | 2411 |
| 939 | Ga0501031_0000675 | 3300049568 | Bacteria | 20344 |
| 940 | Ga0501031_0216344 | 3300049568 | Bacteria | 1248 |
| 941 | Ga0501032_0001344 | 3300049569 | Bacteria | 19545 |
| 942 | Ga0501034_0002489 | 3300049571 | Bacteria | 22128 |
| 943 | Ga0501034_0037606 | 3300049571 | Bacteria | 4902 |
| 944 | Ga0501034_0384329 | 3300049571 | Bacteria | 1328 |
| 945 | Ga0501036_0008489 | 3300049572 | Bacteria | 8418 |
| 946 | Ga0501036_0026504 | 3300049572 | Bacteria | 4893 |
| 947 | Ga0501036_0134098 | 3300049572 | Bacteria | 2090 |
| 948 | Ga0501037_0000743 | 3300049573 | Bacteria | 24719 |
| 949 | Ga0501038_0002150 | 3300049574 | Bacteria | 18302 |
| 950 | Ga0501038_0364619 | 3300049574 | Bacteria | 1123 |
| 951 | Ga0501039_0037530 | 3300049575 | Bacteria | 3740 |
| 952 | Ga0501039_0101627 | 3300049575 | Bacteria | 2244 |
| 953 | Ga0501040_0012695 | 3300049576 | Bacteria | 5526 |
| 954 | Ga0501040_0065837 | 3300049576 | Bacteria | 2497 |
| 955 | Ga0501041_0001788 | 3300049577 | Bacteria | 12041 |
| 956 | Ga0501042_0012703 | 3300049578 | Bacteria | 5714 |
| 957 | Ga0501042_0015337 | 3300049578 | Bacteria | 5246 |
| 958 | Ga0501042_0045369 | 3300049578 | Bacteria | 3132 |
| 959 | Ga0501042_0162863 | 3300049578 | Bacteria | 1609 |
| 960 | Ga0501043_0002416 | 3300049579 | Bacteria | 15805 |
| 961 | Ga0501047_0001452 | 3300049581 | Bacteria | 23191 |
| 962 | Ga0501047_0008803 | 3300049581 | Bacteria | 9521 |
| 963 | Ga0501047_0348144 | 3300049581 | Bacteria | 1319 |
| 964 | Ga0501048_0147408 | 3300049582 | Bacteria | 1664 |
| 965 | Ga0501048_0454465 | 3300049582 | Bacteria | 917 |
| 966 | Ga0501068_0000449 | 3300049584 | Bacteria | 20936 |
| 967 | Ga0501069_0007288 | 3300049585 | Bacteria | 5801 |
| 968 | Ga0501070_0022072 | 3300049586 | Bacteria | 5331 |
| 969 | Ga0501071_0013042 | 3300049587 | Bacteria | 5655 |
| 970 | Ga0501072_0002736 | 3300049588 | Bacteria | 13233 |
| 971 | Ga0501072_0397494 | 3300049588 | Bacteria | 1093 |
| 972 | Ga0501074_0063990 | 3300049590 | Bacteria | 2648 |
| 973 | Ga0501074_0147553 | 3300049590 | Bacteria | 1682 |
| 974 | Ga0501074_0168228 | 3300049590 | Bacteria | 1565 |
| 975 | Ga0501074_0244651 | 3300049590 | Bacteria | 1276 |
| 976 | Ga0501077_0007206 | 3300049593 | Bacteria | 6860 |
| 977 | Ga0501079_0051330 | 3300049741 | Bacteria | 3184 |
| 978 | Ga0501079_0132860 | 3300049741 | Bacteria | 1937 |
| 979 | Ga0501079_0479393 | 3300049741 | Bacteria | 978 |
| 980 | Ga0501080_0050109 | 3300049742 | Bacteria | 3887 |
| 981 | Ga0501081_0240692 | 3300049743 | Bacteria | 1319 |
| 982 | Ga0501081_0389919 | 3300049743 | Bacteria | 1030 |
| 983 | Ga0501083_0004068 | 3300049744 | Bacteria | 10288 |
| 984 | Ga0501083_0052676 | 3300049744 | Bacteria | 2734 |
| 985 | Ga0501035_0005249 | 3300049822 | Bacteria | 12259 |
| 986 | Ga0501044_0004027 | 3300049823 | Bacteria | 16475 |
| 987 | Ga0501045_0021387 | 3300049824 | Bacteria | 4627 |
| 988 | Ga0501045_0026945 | 3300049824 | Bacteria | 4137 |
| 989 | nmdc:mga03n38_3102_c1 | 3300050490 | Bacteria | 5278 |
| 990 | nmdc:mga00v17_82352_c1 | 3300050491 | Bacteria | 2011 |
| 991 | nmdc:mga06z11_2123_c1 | 3300050494 | Bacteria | 7516 |
| 992 | nmdc:mga06z11_3600_c1 | 3300050494 | Bacteria | 6006 |
| 993 | nmdc:mga07m45_44537_c1 | 3300050496 | Bacteria | 2491 |
| 994 | nmdc:mga05p37_365168_c1 | 3300050507 | Bacteria | 1696 |
| 995 | nmdc:mga05p37_66039_c1 | 3300050507 | Bacteria | 4451 |
| 996 | nmdc:mga05p37_801902_c1 | 3300050507 | Bacteria | 1030 |
| 997 | nmdc:mga05p37_906223_c1 | 3300050507 | Bacteria | 950 |
| 998 | nmdc:mga09592_107029_c1 | 3300050508 | Bacteria | 2398 |
| 999 | nmdc:mga09592_231857_c1 | 3300050508 | Bacteria | 1600 |
| 1000 | nmdc:mga0qj67_16266_c1 | 3300050509 | Bacteria | 5638 |
| 1001 | nmdc:mga0qj67_2370_c1 | 3300050509 | Bacteria | 13417 |
| 1002 | nmdc:mga06r32_15640_c1 | 3300050510 | Bacteria | 6894 |
| 1003 | nmdc:mga06r32_169740_c1 | 3300050510 | Bacteria | 2165 |
| 1004 | nmdc:mga06r32_23994_c1 | 3300050510 | Bacteria | 5653 |
| 1005 | nmdc:mga06r32_600573_c1 | 3300050510 | Bacteria | 1071 |
| 1006 | nmdc:mga08y16_26187_c1 | 3300050511 | Bacteria | 6151 |
| 1007 | nmdc:mga08y16_3451_c1 | 3300050511 | Bacteria | 16400 |
| 1008 | nmdc:mga08y16_65693_c1 | 3300050511 | Bacteria | 3787 |
| 1009 | nmdc:mga0n895_236531_c1 | 3300050512 | Bacteria | 1854 |
| 1010 | nmdc:mga0n895_28873_c1 | 3300050512 | Bacteria | 5282 |
| 1011 | nmdc:mga0n895_415844_c1 | 3300050512 | Bacteria | 1359 |
| 1012 | nmdc:mga0n895_580640_c1 | 3300050512 | Bacteria | 1125 |
| 1013 | nmdc:mga0rr50_16858_c1 | 3300050513 | Bacteria | 4864 |
| 1014 | nmdc:mga0a205_135935_c1 | 3300050515 | Bacteria | 2359 |
| 1015 | nmdc:mga0a205_231803_c1 | 3300050515 | Bacteria | 1729 |
| 1016 | nmdc:mga0a205_51221_c1 | 3300050515 | Bacteria | 3985 |
| 1017 | Ga0495601_0009094 | 3300053077 | Bacteria | 5865 |
| 1018 | Ga0495601_0064605 | 3300053077 | Bacteria | 2327 |
| 1019 | Ga0495612_0004871 | 3300053078 | Bacteria | 5558 |
| 1020 | Ga0495612_0009451 | 3300053078 | Bacteria | 3954 |
| 1021 | Ga0495612_0012451 | 3300053078 | Bacteria | 3429 |
| 1022 | Ga0495612_0013835 | 3300053078 | Bacteria | 3251 |
| 1023 | Ga0495612_0073284 | 3300053078 | Bacteria | 1430 |
| 1024 | Ga0495595_0001206 | 3300053084 | Bacteria | 10046 |
| 1025 | Ga0495595_0031316 | 3300053084 | Bacteria | 2390 |
| 1026 | Ga0495619_0003469 | 3300053085 | Bacteria | 10174 |
| 1027 | Ga0495619_0010754 | 3300053085 | Bacteria | 5759 |
| 1028 | Ga0495619_0027888 | 3300053085 | Bacteria | 3641 |
| 1029 | Ga0500660_122220 | 3300053100 | Bacteria | 1081 |
| 1030 | Ga0500600_0065466 | 3300053149 | Bacteria | 2010 |
| 1031 | Ga0501084_0007957 | 3300054114 | Bacteria | 8727 |
| 1032 | Ga0501084_0009802 | 3300054114 | Bacteria | 7919 |
| 1033 | Ga0501082_0012964 | 3300060353 | Bacteria | 7165 |
| 1034 | Ga0501082_0165170 | 3300060353 | Bacteria | 1924 |
| 1035 | Ga0530510_0058769 | 3300061734 | Bacteria | 2781 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049588 | Ga0501072_0397494 | Ga0501072_0397494_477_1082 | 189 |
| 2 | 3300035724 | Ga0373933_0066318 | Ga0373933_0066318_477_1238 | 202 |
| 3 | 3300047319 | Ga0495674_0093469 | Ga0495674_0093469_978_1739 | 202 |
| 4 | 3300046462 | Ga0495651_0029088 | Ga0495651_0029088_3280_4041 | 203 |
| 5 | 3300046477 | Ga0495664_0179185 | Ga0495664_0179185_507_1268 | 203 |
| 6 | 3300046663 | Ga0495635_0053924 | Ga0495635_0053924_619_1380 | 203 |
| 7 | 3300046675 | Ga0495657_0079423 | Ga0495657_0079423_775_1536 | 203 |
| 8 | 3300047322 | Ga0495680_0097434 | Ga0495680_0097434_225_986 | 203 |
| 9 | 3300047471 | Ga0495684_0029336 | Ga0495684_0029336_3070_3831 | 203 |
| 10 | 3300006881 | Ga0068865_100111232 | Ga0068865_1001112322 | 224 |
| 11 | 3300037853 | Ga0436364_0383955 | Ga0436364_0383955_562_1329 | 224 |
| 12 | 3300005329 | Ga0070683_100690999 | Ga0070683_1006909992 | 225 |
| 13 | 3300005441 | Ga0070700_100105175 | Ga0070700_1001051752 | 225 |
| 14 | 3300005459 | Ga0068867_100088736 | Ga0068867_1000887362 | 225 |
| 15 | 3300005543 | Ga0070672_100252363 | Ga0070672_1002523631 | 225 |
| 16 | 3300005719 | Ga0068861_100248628 | Ga0068861_1002486282 | 225 |
| 17 | 3300009098 | Ga0105245_10104769 | Ga0105245_101047692 | 225 |
| 18 | 3300009176 | Ga0105242_10115680 | Ga0105242_101156802 | 225 |
| 19 | 3300025926 | Ga0207659_10279483 | Ga0207659_102794832 | 225 |
| 20 | 3300025944 | Ga0207661_10195020 | Ga0207661_101950202 | 225 |
| 21 | 3300026075 | Ga0207708_10211770 | Ga0207708_102117702 | 225 |
| 22 | 3300026118 | Ga0207675_100687062 | Ga0207675_1006870622 | 225 |
| 23 | 3300005983 | Ga0081540_1001036 | Ga0081540_100103615 | 226 |
| 24 | 3300042016 | Ga0439463_025482 | Ga0439463_025482_180_860 | 226 |
| 25 | 3300048090 | Ga0495615_0059491 | Ga0495615_0059491_32_754 | 226 |
| 26 | 3300005518 | Ga0070699_100079743 | Ga0070699_1000797433 | 227 |
| 27 | 3300037853 | Ga0436364_0082841 | Ga0436364_0082841_26_709 | 227 |
| 28 | 3300046517 | Ga0495630_0132730 | Ga0495630_0132730_665_1390 | 227 |
| 29 | 3300046533 | Ga0495640_0177516 | Ga0495640_0177516_10_735 | 227 |
| 30 | 3300046642 | Ga0495634_0058617 | Ga0495634_0058617_873_1598 | 227 |
| 31 | 3300047319 | Ga0495674_0070849 | Ga0495674_0070849_1015_1740 | 227 |
| 32 | 3300048907 | Ga0496104_0146782 | Ga0496104_0146782_917_1642 | 228 |
| 33 | 3300049568 | Ga0501031_0216344 | Ga0501031_0216344_340_1062 | 228 |
| 34 | 3300049572 | Ga0501036_0026504 | Ga0501036_0026504_3563_4285 | 228 |
| 35 | 3300049575 | Ga0501039_0101627 | Ga0501039_0101627_969_1691 | 228 |
| 36 | 3300049578 | Ga0501042_0012703 | Ga0501042_0012703_3838_4560 | 228 |
| 37 | 3300049587 | Ga0501071_0013042 | Ga0501071_0013042_3656_4378 | 228 |
| 38 | 3300049590 | Ga0501074_0147553 | Ga0501074_0147553_182_904 | 228 |
| 39 | 3300049741 | Ga0501079_0132860 | Ga0501079_0132860_833_1555 | 228 |
| 40 | 3300049743 | Ga0501081_0240692 | Ga0501081_0240692_556_1278 | 228 |
| 41 | 3300005329 | Ga0070683_100081477 | Ga0070683_1000814774 | 229 |
| 42 | 3300005331 | Ga0070670_100057963 | Ga0070670_1000579632 | 229 |
| 43 | 3300005355 | Ga0070671_100005711 | Ga0070671_1000057118 | 229 |
| 44 | 3300005842 | Ga0068858_100108445 | Ga0068858_1001084452 | 229 |
| 45 | 3300025925 | Ga0207650_10145297 | Ga0207650_101452972 | 229 |
| 46 | 3300046511 | Ga0495608_0262740 | Ga0495608_0262740_18_770 | 229 |
| 47 | 3300005535 | Ga0070684_100127799 | Ga0070684_1001277992 | 230 |
| 48 | 3300009011 | Ga0105251_10133634 | Ga0105251_101336341 | 230 |
| 49 | 3300014325 | Ga0163163_10004683 | Ga0163163_100046832 | 230 |
| 50 | 3300017792 | Ga0163161_10732795 | Ga0163161_107327951 | 230 |
| 51 | 3300025945 | Ga0207679_10088091 | Ga0207679_100880912 | 230 |
| 52 | 3300005334 | Ga0068869_100093717 | Ga0068869_1000937173 | 231 |
| 53 | 3300005438 | Ga0070701_10039250 | Ga0070701_100392502 | 231 |
| 54 | 3300005471 | Ga0070698_100071852 | Ga0070698_1000718523 | 231 |
| 55 | 3300005543 | Ga0070672_100057779 | Ga0070672_1000577794 | 231 |
| 56 | 3300006028 | Ga0070717_10145174 | Ga0070717_101451743 | 231 |
| 57 | 3300006173 | Ga0070716_100216927 | Ga0070716_1002169272 | 231 |
| 58 | 3300006881 | Ga0068865_100040620 | Ga0068865_1000406202 | 231 |
| 59 | 3300025922 | Ga0207646_10051775 | Ga0207646_100517752 | 231 |
| 60 | 3300025929 | Ga0207664_10056124 | Ga0207664_100561242 | 231 |
| 61 | 3300025937 | Ga0207669_10023945 | Ga0207669_100239453 | 231 |
| 62 | 3300025938 | Ga0207704_10038018 | Ga0207704_100380182 | 231 |
| 63 | 3300025939 | Ga0207665_10076898 | Ga0207665_100768982 | 231 |
| 64 | 3300025940 | Ga0207691_10057293 | Ga0207691_100572932 | 231 |
| 65 | 3300035113 | Ga0373936_0078316 | Ga0373936_0078316_164_925 | 231 |
| 66 | 3300047319 | Ga0495674_0087945 | Ga0495674_0087945_210_971 | 231 |
| 67 | 3300005563 | Ga0068855_100045099 | Ga0068855_1000450994 | 233 |
| 68 | 3300010375 | Ga0105239_10056981 | Ga0105239_100569814 | 233 |
| 69 | 3300025949 | Ga0207667_10077755 | Ga0207667_100777552 | 233 |
| 70 | 3300026078 | Ga0207702_10022462 | Ga0207702_100224622 | 233 |
| 71 | 3300031995 | Ga0307409_100048571 | Ga0307409_1000485712 | 233 |
| 72 | 3300032002 | Ga0307416_100819067 | Ga0307416_1008190671 | 233 |
| 73 | 3300032004 | Ga0307414_10377354 | Ga0307414_103773542 | 233 |
| 74 | 3300009174 | Ga0105241_10395020 | Ga0105241_103950202 | 234 |
| 75 | 3300047317 | Ga0495604_0117480 | Ga0495604_0117480_29_739 | 234 |
| 76 | 3300005436 | Ga0070713_100044011 | Ga0070713_1000440112 | 235 |
| 77 | 3300005439 | Ga0070711_100102343 | Ga0070711_1001023432 | 235 |
| 78 | 3300006028 | Ga0070717_10017077 | Ga0070717_100170772 | 235 |
| 79 | 3300021388 | Ga0213875_10026180 | Ga0213875_100261802 | 235 |
| 80 | 3300025928 | Ga0207700_10039159 | Ga0207700_100391593 | 235 |
| 81 | 3300025929 | Ga0207664_10014115 | Ga0207664_100141152 | 235 |
| 82 | 3300031730 | Ga0307516_10196739 | Ga0307516_101967392 | 235 |
| 83 | 3300032002 | Ga0307416_100220814 | Ga0307416_1002208142 | 235 |
| 84 | 3300033179 | Ga0307507_10041455 | Ga0307507_100414552 | 235 |
| 85 | 3300037853 | Ga0436364_1023683 | Ga0436364_1023683_1451_2170 | 235 |
| 86 | iso_pu_bacteria | 2751185782 | 2753264979 | 235 |
| 87 | 3300006028 | Ga0070717_10224397 | Ga0070717_102243972 | 236 |
| 88 | 3300048929 | Ga0496126_0109185 | Ga0496126_0109185_1685_2395 | 236 |
| 89 | iso_pu_bacteria | 2579778521 | 2579857338 | 236 |
| 90 | iso_pu_bacteria | 2619618881 | 2619857372 | 236 |
| 91 | iso_pu_bacteria | 2619619003 | 2620353214 | 236 |
| 92 | 3300005518 | Ga0070699_100001774 | Ga0070699_1000017742 | 237 |
| 93 | 3300006028 | Ga0070717_10031359 | Ga0070717_100313592 | 237 |
| 94 | 3300006028 | Ga0070717_10045250 | Ga0070717_100452504 | 237 |
| 95 | 3300025910 | Ga0207684_10384661 | Ga0207684_103846612 | 237 |
| 96 | 3300025928 | Ga0207700_10027814 | Ga0207700_100278143 | 237 |
| 97 | 3300025928 | Ga0207700_10192514 | Ga0207700_101925142 | 237 |
| 98 | 3300025939 | Ga0207665_10005314 | Ga0207665_100053144 | 237 |
| 99 | 3300031507 | Ga0307509_10154829 | Ga0307509_101548292 | 237 |
| 100 | 3300035086 | Ga0373934_0004661 | Ga0373934_0004661_4268_4984 | 237 |
| 101 | 3300035089 | Ga0373944_0001641 | Ga0373944_0001641_1752_2468 | 237 |
| 102 | 3300035111 | Ga0373923_0000678 | Ga0373923_0000678_924_1640 | 237 |
| 103 | 3300035113 | Ga0373936_0001646 | Ga0373936_0001646_1782_2498 | 237 |
| 104 | 3300035116 | Ga0373945_0005082 | Ga0373945_0005082_3172_3888 | 237 |
| 105 | 3300035118 | Ga0373954_0029978 | Ga0373954_0029978_769_1485 | 237 |
| 106 | 3300035119 | Ga0373956_0002110 | Ga0373956_0002110_2822_3538 | 237 |
| 107 | 3300035120 | Ga0373957_0002124 | Ga0373957_0002124_3352_4068 | 237 |
| 108 | 3300035170 | Ga0373943_0009200 | Ga0373943_0009200_3561_4277 | 237 |
| 109 | 3300035171 | Ga0373946_0000512 | Ga0373946_0000512_11709_12425 | 237 |
| 110 | 3300035172 | Ga0373955_0001398 | Ga0373955_0001398_5399_6115 | 237 |
| 111 | 3300035410 | Ga0373924_0002263 | Ga0373924_0002263_1119_1835 | 237 |
| 112 | 3300035692 | Ga0373935_0089915 | Ga0373935_0089915_616_1332 | 237 |
| 113 | 3300035695 | Ga0373927_0003660 | Ga0373927_0003660_6697_7413 | 237 |
| 114 | 3300035724 | Ga0373933_0007397 | Ga0373933_0007397_3211_3927 | 237 |
| 115 | 3300035725 | Ga0373947_0003126 | Ga0373947_0003126_6611_7327 | 237 |
| 116 | 3300036401 | Ga0373937_0016955 | Ga0373937_0016955_4466_5182 | 237 |
| 117 | 3300037068 | Ga0373925_0004017 | Ga0373925_0004017_5026_5778 | 237 |
| 118 | 3300037068 | Ga0373925_0009300 | Ga0373925_0009300_5311_6027 | 237 |
| 119 | 3300037068 | Ga0373925_0199146 | Ga0373925_0199146_198_920 | 237 |
| 120 | 3300037853 | Ga0436364_0825929 | Ga0436364_0825929_1177_1893 | 237 |
| 121 | 3300037853 | Ga0436364_0923522 | Ga0436364_0923522_92686_93408 | 237 |
| 122 | 3300039450 | Ga0436363_0322036 | Ga0436363_0322036_161_880 | 237 |
| 123 | 3300045836 | Ga0466958_0537629 | Ga0466958_0537629_14_727 | 237 |
| 124 | 3300046454 | Ga0495592_0025222 | Ga0495592_0025222_925_1641 | 237 |
| 125 | 3300046455 | Ga0495603_0004303 | Ga0495603_0004303_5150_5866 | 237 |
| 126 | 3300046459 | Ga0495629_0013405 | Ga0495629_0013405_1181_1897 | 237 |
| 127 | 3300046461 | Ga0495641_0005227 | Ga0495641_0005227_5256_5972 | 237 |
| 128 | 3300046462 | Ga0495651_0023445 | Ga0495651_0023445_1053_1769 | 237 |
| 129 | 3300046463 | Ga0495653_0011070 | Ga0495653_0011070_5668_6384 | 237 |
| 130 | 3300046472 | Ga0495580_0007651 | Ga0495580_0007651_1957_2673 | 237 |
| 131 | 3300046473 | Ga0495582_0001782 | Ga0495582_0001782_4778_5494 | 237 |
| 132 | 3300046475 | Ga0495639_0014608 | Ga0495639_0014608_2423_3139 | 237 |
| 133 | 3300046476 | Ga0495662_0049342 | Ga0495662_0049342_1053_1769 | 237 |
| 134 | 3300046476 | Ga0495662_0110126 | Ga0495662_0110126_15_737 | 237 |
| 135 | 3300046477 | Ga0495664_0002110 | Ga0495664_0002110_5261_5977 | 237 |
| 136 | 3300046511 | Ga0495608_0056516 | Ga0495608_0056516_299_1015 | 237 |
| 137 | 3300046514 | Ga0495618_0009119 | Ga0495618_0009119_4593_5309 | 237 |
| 138 | 3300046516 | Ga0495628_0033703 | Ga0495628_0033703_1053_1769 | 237 |
| 139 | 3300046517 | Ga0495630_0041868 | Ga0495630_0041868_119_835 | 237 |
| 140 | 3300046526 | Ga0495666_0001705 | Ga0495666_0001705_8710_9426 | 237 |
| 141 | 3300046529 | Ga0495652_0017730 | Ga0495652_0017730_967_1683 | 237 |
| 142 | 3300046531 | Ga0495665_0005360 | Ga0495665_0005360_1478_2194 | 237 |
| 143 | 3300046533 | Ga0495640_0007047 | Ga0495640_0007047_3540_4256 | 237 |
| 144 | 3300046535 | Ga0495586_0006962 | Ga0495586_0006962_4872_5588 | 237 |
| 145 | 3300046536 | Ga0495587_0009099 | Ga0495587_0009099_1064_1780 | 237 |
| 146 | 3300046543 | Ga0495645_0069259 | Ga0495645_0069259_778_1494 | 237 |
| 147 | 3300046559 | Ga0495667_0005171 | Ga0495667_0005171_1053_1769 | 237 |
| 148 | 3300046663 | Ga0495635_0016830 | Ga0495635_0016830_2745_3461 | 237 |
| 149 | 3300046663 | Ga0495635_0205917 | Ga0495635_0205917_231_953 | 237 |
| 150 | 3300046674 | Ga0495588_0115686 | Ga0495588_0115686_299_1015 | 237 |
| 151 | 3300046675 | Ga0495657_0012189 | Ga0495657_0012189_992_1708 | 237 |
| 152 | 3300046678 | Ga0495599_0009353 | Ga0495599_0009353_4963_5679 | 237 |
| 153 | 3300046678 | Ga0495599_0077161 | Ga0495599_0077161_1001_1723 | 237 |
| 154 | 3300046680 | Ga0495646_0007317 | Ga0495646_0007317_1577_2293 | 237 |
| 155 | 3300046681 | Ga0495647_0010633 | Ga0495647_0010633_1454_2170 | 237 |
| 156 | 3300046683 | Ga0495658_0004824 | Ga0495658_0004824_2722_3438 | 237 |
| 157 | 3300046689 | Ga0495613_0025801 | Ga0495613_0025801_546_1262 | 237 |
| 158 | 3300046690 | Ga0495624_0006342 | Ga0495624_0006342_3831_4547 | 237 |
| 159 | 3300046809 | Ga0495600_0006668 | Ga0495600_0006668_4363_5079 | 237 |
| 160 | 3300047315 | Ga0495581_0002431 | Ga0495581_0002431_8628_9344 | 237 |
| 161 | 3300047319 | Ga0495674_0015950 | Ga0495674_0015950_4721_5437 | 237 |
| 162 | 3300047319 | Ga0495674_0099087 | Ga0495674_0099087_1031_1753 | 237 |
| 163 | 3300047321 | Ga0495676_0006083 | Ga0495676_0006083_9330_10046 | 237 |
| 164 | 3300047321 | Ga0495676_0102382 | Ga0495676_0102382_750_1472 | 237 |
| 165 | 3300047322 | Ga0495680_0012830 | Ga0495680_0012830_1647_2363 | 237 |
| 166 | 3300047444 | Ga0495675_0015104 | Ga0495675_0015104_1803_2519 | 237 |
| 167 | 3300047444 | Ga0495675_0156381 | Ga0495675_0156381_236_958 | 237 |
| 168 | 3300047471 | Ga0495684_0036478 | Ga0495684_0036478_2745_3461 | 237 |
| 169 | 3300047673 | Ga0495593_0004098 | Ga0495593_0004098_1334_2050 | 237 |
| 170 | 3300048088 | Ga0495602_0034577 | Ga0495602_0034577_2873_3589 | 237 |
| 171 | 3300048089 | Ga0495614_0001897 | Ga0495614_0001897_4658_5374 | 237 |
| 172 | 3300049743 | Ga0501081_0389919 | Ga0501081_0389919_28_741 | 237 |
| 173 | 3300053077 | Ga0495601_0009094 | Ga0495601_0009094_4721_5437 | 237 |
| 174 | 3300053078 | Ga0495612_0004871 | Ga0495612_0004871_3266_3982 | 237 |
| 175 | 3300053084 | Ga0495595_0031316 | Ga0495595_0031316_1546_2262 | 237 |
| 176 | 3300053085 | Ga0495619_0003469 | Ga0495619_0003469_3919_4635 | 237 |
| 177 | iso_pu_bacteria | 2508501039 | 2508673615 | 237 |
| 178 | iso_pu_bacteria | 2643221604 | 2644034927 | 237 |
| 179 | iso_pu_bacteria | 2675902999 | 2676203971 | 237 |
| 180 | iso_pu_bacteria | 2687453737 | 2689957701 | 237 |
| 181 | iso_pu_bacteria | 2773857921 | 2774848547 | 237 |
| 182 | 3300005327 | Ga0070658_10050435 | Ga0070658_100504352 | 238 |
| 183 | 3300005329 | Ga0070683_100001043 | Ga0070683_10000104313 | 238 |
| 184 | 3300005329 | Ga0070683_100126188 | Ga0070683_1001261882 | 238 |
| 185 | 3300005329 | Ga0070683_100463212 | Ga0070683_1004632122 | 238 |
| 186 | 3300005336 | Ga0070680_100084670 | Ga0070680_1000846702 | 238 |
| 187 | 3300005339 | Ga0070660_100244985 | Ga0070660_1002449852 | 238 |
| 188 | 3300005434 | Ga0070709_10161910 | Ga0070709_101619102 | 238 |
| 189 | 3300005434 | Ga0070709_10218351 | Ga0070709_102183512 | 238 |
| 190 | 3300005435 | Ga0070714_100057222 | Ga0070714_1000572222 | 238 |
| 191 | 3300005435 | Ga0070714_100104044 | Ga0070714_1001040442 | 238 |
| 192 | 3300005435 | Ga0070714_100114912 | Ga0070714_1001149122 | 238 |
| 193 | 3300005435 | Ga0070714_100159369 | Ga0070714_1001593692 | 238 |
| 194 | 3300005435 | Ga0070714_100273041 | Ga0070714_1002730412 | 238 |
| 195 | 3300005435 | Ga0070714_100383567 | Ga0070714_1003835672 | 238 |
| 196 | 3300005436 | Ga0070713_100007612 | Ga0070713_1000076123 | 238 |
| 197 | 3300005436 | Ga0070713_100130636 | Ga0070713_1001306362 | 238 |
| 198 | 3300005436 | Ga0070713_100192960 | Ga0070713_1001929602 | 238 |
| 199 | 3300005436 | Ga0070713_100217711 | Ga0070713_1002177111 | 238 |
| 200 | 3300005437 | Ga0070710_10044370 | Ga0070710_100443703 | 238 |
| 201 | 3300005439 | Ga0070711_100034450 | Ga0070711_1000344502 | 238 |
| 202 | 3300005455 | Ga0070663_100019012 | Ga0070663_1000190122 | 238 |
| 203 | 3300005458 | Ga0070681_10142579 | Ga0070681_101425792 | 238 |
| 204 | 3300005467 | Ga0070706_100200175 | Ga0070706_1002001751 | 238 |
| 205 | 3300005468 | Ga0070707_100004358 | Ga0070707_1000043587 | 238 |
| 206 | 3300005468 | Ga0070707_100030808 | Ga0070707_1000308082 | 238 |
| 207 | 3300005471 | Ga0070698_100054421 | Ga0070698_1000544212 | 238 |
| 208 | 3300005530 | Ga0070679_100052992 | Ga0070679_1000529922 | 238 |
| 209 | 3300005535 | Ga0070684_100016381 | Ga0070684_1000163814 | 238 |
| 210 | 3300005535 | Ga0070684_100083131 | Ga0070684_1000831312 | 238 |
| 211 | 3300005536 | Ga0070697_100099589 | Ga0070697_1000995892 | 238 |
| 212 | 3300005577 | Ga0068857_100070859 | Ga0068857_1000708592 | 238 |
| 213 | 3300005616 | Ga0068852_100323149 | Ga0068852_1003231492 | 238 |
| 214 | 3300005981 | Ga0081538_10013643 | Ga0081538_100136432 | 238 |
| 215 | 3300005983 | Ga0081540_1047547 | Ga0081540_10475471 | 238 |
| 216 | 3300006028 | Ga0070717_10013112 | Ga0070717_100131122 | 238 |
| 217 | 3300006058 | Ga0075432_10039653 | Ga0075432_100396532 | 238 |
| 218 | 3300006163 | Ga0070715_10059557 | Ga0070715_100595573 | 238 |
| 219 | 3300006173 | Ga0070716_100009847 | Ga0070716_1000098472 | 238 |
| 220 | 3300006175 | Ga0070712_100038520 | Ga0070712_1000385202 | 238 |
| 221 | 3300006175 | Ga0070712_100148320 | Ga0070712_1001483203 | 238 |
| 222 | 3300006852 | Ga0075433_10043000 | Ga0075433_100430003 | 238 |
| 223 | 3300006852 | Ga0075433_10048975 | Ga0075433_100489752 | 238 |
| 224 | 3300006871 | Ga0075434_100031601 | Ga0075434_1000316012 | 238 |
| 225 | 3300006871 | Ga0075434_100090563 | Ga0075434_1000905632 | 238 |
| 226 | 3300007076 | Ga0075435_100024919 | Ga0075435_1000249192 | 238 |
| 227 | 3300007076 | Ga0075435_100046476 | Ga0075435_1000464763 | 238 |
| 228 | 3300009093 | Ga0105240_11098461 | Ga0105240_110984611 | 238 |
| 229 | 3300009094 | Ga0111539_10090372 | Ga0111539_100903722 | 238 |
| 230 | 3300013105 | Ga0157369_10089018 | Ga0157369_100890182 | 238 |
| 231 | 3300020082 | Ga0206353_11280236 | Ga0206353_112802362 | 238 |
| 232 | 3300025898 | Ga0207692_10003168 | Ga0207692_100031683 | 238 |
| 233 | 3300025904 | Ga0207647_10169420 | Ga0207647_101694202 | 238 |
| 234 | 3300025905 | Ga0207685_10079620 | Ga0207685_100796202 | 238 |
| 235 | 3300025906 | Ga0207699_10422676 | Ga0207699_104226761 | 238 |
| 236 | 3300025915 | Ga0207693_10014890 | Ga0207693_100148903 | 238 |
| 237 | 3300025917 | Ga0207660_10131688 | Ga0207660_101316882 | 238 |
| 238 | 3300025919 | Ga0207657_10093624 | Ga0207657_100936243 | 238 |
| 239 | 3300025921 | Ga0207652_10013580 | Ga0207652_100135802 | 238 |
| 240 | 3300025922 | Ga0207646_10103806 | Ga0207646_101038062 | 238 |
| 241 | 3300025928 | Ga0207700_10005311 | Ga0207700_100053117 | 238 |
| 242 | 3300025928 | Ga0207700_10006552 | Ga0207700_100065526 | 238 |
| 243 | 3300025928 | Ga0207700_10013326 | Ga0207700_100133262 | 238 |
| 244 | 3300025928 | Ga0207700_10176240 | Ga0207700_101762402 | 238 |
| 245 | 3300025929 | Ga0207664_10008588 | Ga0207664_100085887 | 238 |
| 246 | 3300025929 | Ga0207664_10020134 | Ga0207664_100201346 | 238 |
| 247 | 3300025929 | Ga0207664_10093066 | Ga0207664_100930662 | 238 |
| 248 | 3300025929 | Ga0207664_10190259 | Ga0207664_101902592 | 238 |
| 249 | 3300025939 | Ga0207665_10007468 | Ga0207665_1000746810 | 238 |
| 250 | 3300025939 | Ga0207665_10036332 | Ga0207665_100363323 | 238 |
| 251 | 3300025944 | Ga0207661_10002147 | Ga0207661_100021475 | 238 |
| 252 | 3300025944 | Ga0207661_10273819 | Ga0207661_102738192 | 238 |
| 253 | 3300026067 | Ga0207678_10254998 | Ga0207678_102549982 | 238 |
| 254 | 3300026116 | Ga0207674_10014768 | Ga0207674_100147688 | 238 |
| 255 | 3300026142 | Ga0207698_10253989 | Ga0207698_102539892 | 238 |
| 256 | 3300027907 | Ga0207428_10084816 | Ga0207428_100848162 | 238 |
| 257 | 3300028556 | Ga0265337_1007533 | Ga0265337_10075332 | 238 |
| 258 | 3300028573 | Ga0265334_10002841 | Ga0265334_100028415 | 238 |
| 259 | 3300028577 | Ga0265318_10009714 | Ga0265318_100097142 | 238 |
| 260 | 3300028653 | Ga0265323_10050599 | Ga0265323_100505992 | 238 |
| 261 | 3300028654 | Ga0265322_10014063 | Ga0265322_100140632 | 238 |
| 262 | 3300028666 | Ga0265336_10002351 | Ga0265336_100023512 | 238 |
| 263 | 3300028800 | Ga0265338_10000059 | Ga0265338_100000599 | 238 |
| 264 | 3300029957 | Ga0265324_10000821 | Ga0265324_100008212 | 238 |
| 265 | 3300031238 | Ga0265332_10056074 | Ga0265332_100560742 | 238 |
| 266 | 3300031240 | Ga0265320_10027075 | Ga0265320_100270751 | 238 |
| 267 | 3300031241 | Ga0265325_10026166 | Ga0265325_100261662 | 238 |
| 268 | 3300031247 | Ga0265340_10025478 | Ga0265340_100254782 | 238 |
| 269 | 3300031249 | Ga0265339_10094920 | Ga0265339_100949202 | 238 |
| 270 | 3300031344 | Ga0265316_10115796 | Ga0265316_101157962 | 238 |
| 271 | 3300031595 | Ga0265313_10010238 | Ga0265313_100102384 | 238 |
| 272 | 3300031711 | Ga0265314_10029104 | Ga0265314_100291042 | 238 |
| 273 | 3300031712 | Ga0265342_10001214 | Ga0265342_1000121416 | 238 |
| 274 | 3300031901 | Ga0307406_10144817 | Ga0307406_101448172 | 238 |
| 275 | 3300035113 | Ga0373936_0196018 | Ga0373936_0196018_139_864 | 238 |
| 276 | 3300035116 | Ga0373945_0115615 | Ga0373945_0115615_58_783 | 238 |
| 277 | 3300035118 | Ga0373954_0077204 | Ga0373954_0077204_813_1538 | 238 |
| 278 | 3300035118 | Ga0373954_0090198 | Ga0373954_0090198_342_1064 | 238 |
| 279 | 3300035119 | Ga0373956_0013526 | Ga0373956_0013526_1570_2295 | 238 |
| 280 | 3300035120 | Ga0373957_0003893 | Ga0373957_0003893_1508_2233 | 238 |
| 281 | 3300035171 | Ga0373946_0036015 | Ga0373946_0036015_676_1401 | 238 |
| 282 | 3300035172 | Ga0373955_0030280 | Ga0373955_0030280_2027_2752 | 238 |
| 283 | 3300035172 | Ga0373955_0374907 | Ga0373955_0374907_51_773 | 238 |
| 284 | 3300035410 | Ga0373924_0005988 | Ga0373924_0005988_2299_3024 | 238 |
| 285 | 3300035692 | Ga0373935_0114919 | Ga0373935_0114919_904_1629 | 238 |
| 286 | 3300035695 | Ga0373927_0238893 | Ga0373927_0238893_276_1001 | 238 |
| 287 | 3300035724 | Ga0373933_0122955 | Ga0373933_0122955_654_1376 | 238 |
| 288 | 3300035724 | Ga0373933_0124644 | Ga0373933_0124644_177_902 | 238 |
| 289 | 3300036401 | Ga0373937_0007374 | Ga0373937_0007374_6120_6845 | 238 |
| 290 | 3300036401 | Ga0373937_0008229 | Ga0373937_0008229_1687_2412 | 238 |
| 291 | 3300036401 | Ga0373937_0010358 | Ga0373937_0010358_714_1439 | 238 |
| 292 | 3300036401 | Ga0373937_0051430 | Ga0373937_0051430_2885_3607 | 238 |
| 293 | 3300036401 | Ga0373937_0198097 | Ga0373937_0198097_578_1294 | 238 |
| 294 | 3300037068 | Ga0373925_0000779 | Ga0373925_0000779_23098_23814 | 238 |
| 295 | 3300037068 | Ga0373925_0108618 | Ga0373925_0108618_262_987 | 238 |
| 296 | 3300037466 | Ga0395898_0154104 | Ga0395898_0154104_286_1002 | 238 |
| 297 | 3300037853 | Ga0436364_0821490 | Ga0436364_0821490_619_1341 | 238 |
| 298 | 3300039450 | Ga0436363_0980729 | Ga0436363_0980729_738_1463 | 238 |
| 299 | 3300044694 | Ga0466963_0178155 | Ga0466963_0178155_407_1132 | 238 |
| 300 | 3300045049 | Ga0466959_0432720 | Ga0466959_0432720_54_773 | 238 |
| 301 | 3300046459 | Ga0495629_0011488 | Ga0495629_0011488_3113_3838 | 238 |
| 302 | 3300046461 | Ga0495641_0010720 | Ga0495641_0010720_2464_3189 | 238 |
| 303 | 3300046462 | Ga0495651_0044435 | Ga0495651_0044435_1757_2482 | 238 |
| 304 | 3300046463 | Ga0495653_0096657 | Ga0495653_0096657_268_993 | 238 |
| 305 | 3300046473 | Ga0495582_0066246 | Ga0495582_0066246_1094_1819 | 238 |
| 306 | 3300046476 | Ga0495662_0017607 | Ga0495662_0017607_1635_2360 | 238 |
| 307 | 3300046511 | Ga0495608_0085740 | Ga0495608_0085740_879_1604 | 238 |
| 308 | 3300046514 | Ga0495618_0067340 | Ga0495618_0067340_92_817 | 238 |
| 309 | 3300046516 | Ga0495628_0019080 | Ga0495628_0019080_2444_3169 | 238 |
| 310 | 3300046516 | Ga0495628_0082117 | Ga0495628_0082117_1349_2074 | 238 |
| 311 | 3300046529 | Ga0495652_0020248 | Ga0495652_0020248_3371_4096 | 238 |
| 312 | 3300046531 | Ga0495665_0040081 | Ga0495665_0040081_1148_1873 | 238 |
| 313 | 3300046533 | Ga0495640_0051582 | Ga0495640_0051582_988_1713 | 238 |
| 314 | 3300046535 | Ga0495586_0013646 | Ga0495586_0013646_2385_3110 | 238 |
| 315 | 3300046535 | Ga0495586_0172558 | Ga0495586_0172558_463_1188 | 238 |
| 316 | 3300046536 | Ga0495587_0057356 | Ga0495587_0057356_923_1648 | 238 |
| 317 | 3300046543 | Ga0495645_0117775 | Ga0495645_0117775_178_903 | 238 |
| 318 | 3300046559 | Ga0495667_0029400 | Ga0495667_0029400_369_1094 | 238 |
| 319 | 3300046663 | Ga0495635_0100822 | Ga0495635_0100822_72_797 | 238 |
| 320 | 3300046675 | Ga0495657_0052313 | Ga0495657_0052313_1216_1941 | 238 |
| 321 | 3300046675 | Ga0495657_0094235 | Ga0495657_0094235_1051_1776 | 238 |
| 322 | 3300046675 | Ga0495657_0139320 | Ga0495657_0139320_51_776 | 238 |
| 323 | 3300046678 | Ga0495599_0019364 | Ga0495599_0019364_2943_3668 | 238 |
| 324 | 3300046678 | Ga0495599_0063871 | Ga0495599_0063871_1419_2144 | 238 |
| 325 | 3300046679 | Ga0495623_0058542 | Ga0495623_0058542_1561_2286 | 238 |
| 326 | 3300046679 | Ga0495623_0059980 | Ga0495623_0059980_828_1553 | 238 |
| 327 | 3300046680 | Ga0495646_0064335 | Ga0495646_0064335_808_1533 | 238 |
| 328 | 3300046689 | Ga0495613_0003433 | Ga0495613_0003433_5910_6635 | 238 |
| 329 | 3300046809 | Ga0495600_0047171 | Ga0495600_0047171_1510_2235 | 238 |
| 330 | 3300046809 | Ga0495600_0102369 | Ga0495600_0102369_372_1097 | 238 |
| 331 | 3300047315 | Ga0495581_0005320 | Ga0495581_0005320_985_1710 | 238 |
| 332 | 3300047317 | Ga0495604_0040138 | Ga0495604_0040138_2098_2823 | 238 |
| 333 | 3300047317 | Ga0495604_0073276 | Ga0495604_0073276_679_1404 | 238 |
| 334 | 3300047322 | Ga0495680_0029697 | Ga0495680_0029697_1198_1923 | 238 |
| 335 | 3300047322 | Ga0495680_0085583 | Ga0495680_0085583_832_1557 | 238 |
| 336 | 3300047471 | Ga0495684_0089383 | Ga0495684_0089383_642_1367 | 238 |
| 337 | 3300048088 | Ga0495602_0013041 | Ga0495602_0013041_1165_1890 | 238 |
| 338 | 3300048088 | Ga0495602_0097502 | Ga0495602_0097502_983_1708 | 238 |
| 339 | 3300048088 | Ga0495602_0115157 | Ga0495602_0115157_1182_1907 | 238 |
| 340 | 3300048912 | Ga0496109_0289898 | Ga0496109_0289898_150_869 | 238 |
| 341 | 3300048918 | Ga0496115_0406307 | Ga0496115_0406307_172_888 | 238 |
| 342 | 3300049568 | Ga0501031_0000675 | Ga0501031_0000675_8372_9118 | 238 |
| 343 | 3300049569 | Ga0501032_0001344 | Ga0501032_0001344_15060_15806 | 238 |
| 344 | 3300049571 | Ga0501034_0002489 | Ga0501034_0002489_2698_3444 | 238 |
| 345 | 3300049572 | Ga0501036_0008489 | Ga0501036_0008489_5872_6618 | 238 |
| 346 | 3300049573 | Ga0501037_0000743 | Ga0501037_0000743_8453_9199 | 238 |
| 347 | 3300049574 | Ga0501038_0002150 | Ga0501038_0002150_1677_2423 | 238 |
| 348 | 3300049574 | Ga0501038_0364619 | Ga0501038_0364619_384_1103 | 238 |
| 349 | 3300049576 | Ga0501040_0012695 | Ga0501040_0012695_1980_2726 | 238 |
| 350 | 3300049577 | Ga0501041_0001788 | Ga0501041_0001788_1414_2160 | 238 |
| 351 | 3300049578 | Ga0501042_0045369 | Ga0501042_0045369_652_1398 | 238 |
| 352 | 3300049579 | Ga0501043_0002416 | Ga0501043_0002416_12505_13251 | 238 |
| 353 | 3300049581 | Ga0501047_0001452 | Ga0501047_0001452_10154_10900 | 238 |
| 354 | 3300049581 | Ga0501047_0008803 | Ga0501047_0008803_8495_9241 | 238 |
| 355 | 3300049582 | Ga0501048_0147408 | Ga0501048_0147408_237_983 | 238 |
| 356 | 3300049584 | Ga0501068_0000449 | Ga0501068_0000449_12928_13674 | 238 |
| 357 | 3300049585 | Ga0501069_0007288 | Ga0501069_0007288_1549_2295 | 238 |
| 358 | 3300049586 | Ga0501070_0022072 | Ga0501070_0022072_846_1592 | 238 |
| 359 | 3300049588 | Ga0501072_0002736 | Ga0501072_0002736_4523_5269 | 238 |
| 360 | 3300049590 | Ga0501074_0063990 | Ga0501074_0063990_354_1100 | 238 |
| 361 | 3300049590 | Ga0501074_0244651 | Ga0501074_0244651_435_1151 | 238 |
| 362 | 3300049593 | Ga0501077_0007206 | Ga0501077_0007206_3775_4521 | 238 |
| 363 | 3300049741 | Ga0501079_0479393 | Ga0501079_0479393_29_745 | 238 |
| 364 | 3300049742 | Ga0501080_0050109 | Ga0501080_0050109_1407_2153 | 238 |
| 365 | 3300049744 | Ga0501083_0004068 | Ga0501083_0004068_8261_9007 | 238 |
| 366 | 3300049822 | Ga0501035_0005249 | Ga0501035_0005249_8841_9587 | 238 |
| 367 | 3300049823 | Ga0501044_0004027 | Ga0501044_0004027_13032_13778 | 238 |
| 368 | 3300049824 | Ga0501045_0021387 | Ga0501045_0021387_118_864 | 238 |
| 369 | 3300050511 | nmdc:mga08y16_65693_c1 | nmdc:mga08y16_65693_c1_1479_2195 | 238 |
| 370 | 3300050512 | nmdc:mga0n895_236531_c1 | nmdc:mga0n895_236531_c1_748_1473 | 238 |
| 371 | 3300050512 | nmdc:mga0n895_28873_c1 | nmdc:mga0n895_28873_c1_1814_2530 | 238 |
| 372 | 3300050513 | nmdc:mga0rr50_16858_c1 | nmdc:mga0rr50_16858_c1_1100_1816 | 238 |
| 373 | 3300050515 | nmdc:mga0a205_135935_c1 | nmdc:mga0a205_135935_c1_138_854 | 238 |
| 374 | 3300050515 | nmdc:mga0a205_51221_c1 | nmdc:mga0a205_51221_c1_1996_2721 | 238 |
| 375 | 3300053077 | Ga0495601_0064605 | Ga0495601_0064605_695_1420 | 238 |
| 376 | 3300053078 | Ga0495612_0009451 | Ga0495612_0009451_2432_3157 | 238 |
| 377 | 3300053078 | Ga0495612_0013835 | Ga0495612_0013835_1489_2214 | 238 |
| 378 | 3300053084 | Ga0495595_0001206 | Ga0495595_0001206_4726_5451 | 238 |
| 379 | 3300053085 | Ga0495619_0010754 | Ga0495619_0010754_4913_5638 | 238 |
| 380 | 3300054114 | Ga0501084_0007957 | Ga0501084_0007957_2942_3688 | 238 |
| 381 | 3300060353 | Ga0501082_0012964 | Ga0501082_0012964_809_1555 | 238 |
| 382 | 3300003320 | rootH2_10176451 | rootH2_101764512 | 239 |
| 383 | 3300003373 | JGI25407J50210_10020236 | JGI25407J50210_100202363 | 239 |
| 384 | 3300005329 | Ga0070683_100035577 | Ga0070683_1000355774 | 239 |
| 385 | 3300005331 | Ga0070670_100464998 | Ga0070670_1004649982 | 239 |
| 386 | 3300005334 | Ga0068869_100182309 | Ga0068869_1001823093 | 239 |
| 387 | 3300005335 | Ga0070666_10057061 | Ga0070666_100570612 | 239 |
| 388 | 3300005336 | Ga0070680_100275660 | Ga0070680_1002756602 | 239 |
| 389 | 3300005337 | Ga0070682_100037652 | Ga0070682_1000376522 | 239 |
| 390 | 3300005340 | Ga0070689_100190115 | Ga0070689_1001901152 | 239 |
| 391 | 3300005344 | Ga0070661_100082474 | Ga0070661_1000824741 | 239 |
| 392 | 3300005347 | Ga0070668_100402865 | Ga0070668_1004028652 | 239 |
| 393 | 3300005354 | Ga0070675_100084216 | Ga0070675_1000842162 | 239 |
| 394 | 3300005356 | Ga0070674_100135371 | Ga0070674_1001353712 | 239 |
| 395 | 3300005364 | Ga0070673_100191314 | Ga0070673_1001913141 | 239 |
| 396 | 3300005366 | Ga0070659_100079788 | Ga0070659_1000797882 | 239 |
| 397 | 3300005367 | Ga0070667_100420322 | Ga0070667_1004203222 | 239 |
| 398 | 3300005434 | Ga0070709_10000377 | Ga0070709_1000037727 | 239 |
| 399 | 3300005434 | Ga0070709_10008315 | Ga0070709_100083155 | 239 |
| 400 | 3300005434 | Ga0070709_10019524 | Ga0070709_100195242 | 239 |
| 401 | 3300005434 | Ga0070709_10169751 | Ga0070709_101697512 | 239 |
| 402 | 3300005435 | Ga0070714_100001403 | Ga0070714_1000014033 | 239 |
| 403 | 3300005435 | Ga0070714_100040608 | Ga0070714_1000406082 | 239 |
| 404 | 3300005435 | Ga0070714_100058509 | Ga0070714_1000585092 | 239 |
| 405 | 3300005435 | Ga0070714_100192371 | Ga0070714_1001923712 | 239 |
| 406 | 3300005436 | Ga0070713_100054601 | Ga0070713_1000546012 | 239 |
| 407 | 3300005436 | Ga0070713_100209417 | Ga0070713_1002094172 | 239 |
| 408 | 3300005436 | Ga0070713_100272080 | Ga0070713_1002720802 | 239 |
| 409 | 3300005436 | Ga0070713_100297780 | Ga0070713_1002977802 | 239 |
| 410 | 3300005436 | Ga0070713_100323588 | Ga0070713_1003235882 | 239 |
| 411 | 3300005437 | Ga0070710_10000960 | Ga0070710_100009608 | 239 |
| 412 | 3300005437 | Ga0070710_10009633 | Ga0070710_100096331 | 239 |
| 413 | 3300005437 | Ga0070710_10024616 | Ga0070710_100246162 | 239 |
| 414 | 3300005437 | Ga0070710_10054984 | Ga0070710_100549842 | 239 |
| 415 | 3300005438 | Ga0070701_10018169 | Ga0070701_100181692 | 239 |
| 416 | 3300005439 | Ga0070711_100022050 | Ga0070711_1000220502 | 239 |
| 417 | 3300005439 | Ga0070711_100025523 | Ga0070711_1000255232 | 239 |
| 418 | 3300005439 | Ga0070711_100096145 | Ga0070711_1000961452 | 239 |
| 419 | 3300005439 | Ga0070711_100141980 | Ga0070711_1001419802 | 239 |
| 420 | 3300005440 | Ga0070705_100028799 | Ga0070705_1000287994 | 239 |
| 421 | 3300005444 | Ga0070694_100070536 | Ga0070694_1000705363 | 239 |
| 422 | 3300005445 | Ga0070708_100132755 | Ga0070708_1001327552 | 239 |
| 423 | 3300005456 | Ga0070678_100368515 | Ga0070678_1003685152 | 239 |
| 424 | 3300005457 | Ga0070662_100467645 | Ga0070662_1004676452 | 239 |
| 425 | 3300005459 | Ga0068867_100199803 | Ga0068867_1001998032 | 239 |
| 426 | 3300005466 | Ga0070685_10011144 | Ga0070685_100111444 | 239 |
| 427 | 3300005467 | Ga0070706_100001268 | Ga0070706_1000012686 | 239 |
| 428 | 3300005467 | Ga0070706_100046766 | Ga0070706_1000467661 | 239 |
| 429 | 3300005467 | Ga0070706_100077044 | Ga0070706_1000770442 | 239 |
| 430 | 3300005467 | Ga0070706_100196192 | Ga0070706_1001961922 | 239 |
| 431 | 3300005467 | Ga0070706_100490959 | Ga0070706_1004909592 | 239 |
| 432 | 3300005468 | Ga0070707_100056451 | Ga0070707_1000564514 | 239 |
| 433 | 3300005468 | Ga0070707_100252220 | Ga0070707_1002522201 | 239 |
| 434 | 3300005468 | Ga0070707_100716432 | Ga0070707_1007164321 | 239 |
| 435 | 3300005471 | Ga0070698_100010296 | Ga0070698_1000102964 | 239 |
| 436 | 3300005471 | Ga0070698_100031059 | Ga0070698_1000310593 | 239 |
| 437 | 3300005518 | Ga0070699_100000213 | Ga0070699_10000021351 | 239 |
| 438 | 3300005518 | Ga0070699_100609628 | Ga0070699_1006096282 | 239 |
| 439 | 3300005530 | Ga0070679_100167176 | Ga0070679_1001671762 | 239 |
| 440 | 3300005535 | Ga0070684_100678884 | Ga0070684_1006788842 | 239 |
| 441 | 3300005536 | Ga0070697_100003375 | Ga0070697_10000337513 | 239 |
| 442 | 3300005539 | Ga0068853_100203242 | Ga0068853_1002032422 | 239 |
| 443 | 3300005545 | Ga0070695_100045435 | Ga0070695_1000454352 | 239 |
| 444 | 3300005546 | Ga0070696_100053585 | Ga0070696_1000535852 | 239 |
| 445 | 3300005548 | Ga0070665_100549680 | Ga0070665_1005496802 | 239 |
| 446 | 3300005549 | Ga0070704_100164797 | Ga0070704_1001647972 | 239 |
| 447 | 3300005563 | Ga0068855_100107528 | Ga0068855_1001075285 | 239 |
| 448 | 3300005564 | Ga0070664_100044700 | Ga0070664_1000447002 | 239 |
| 449 | 3300005578 | Ga0068854_100027007 | Ga0068854_1000270072 | 239 |
| 450 | 3300005614 | Ga0068856_100721979 | Ga0068856_1007219792 | 239 |
| 451 | 3300005718 | Ga0068866_10122035 | Ga0068866_101220352 | 239 |
| 452 | 3300005719 | Ga0068861_100205677 | Ga0068861_1002056772 | 239 |
| 453 | 3300005719 | Ga0068861_100301036 | Ga0068861_1003010362 | 239 |
| 454 | 3300005840 | Ga0068870_10046740 | Ga0068870_100467402 | 239 |
| 455 | 3300005842 | Ga0068858_100116606 | Ga0068858_1001166063 | 239 |
| 456 | 3300005843 | Ga0068860_100106372 | Ga0068860_1001063722 | 239 |
| 457 | 3300005844 | Ga0068862_100372978 | Ga0068862_1003729782 | 239 |
| 458 | 3300005981 | Ga0081538_10000258 | Ga0081538_100002585 | 239 |
| 459 | 3300005981 | Ga0081538_10017309 | Ga0081538_100173092 | 239 |
| 460 | 3300005981 | Ga0081538_10030481 | Ga0081538_100304812 | 239 |
| 461 | 3300005983 | Ga0081540_1000356 | Ga0081540_100035634 | 239 |
| 462 | 3300005983 | Ga0081540_1047614 | Ga0081540_10476142 | 239 |
| 463 | 3300006028 | Ga0070717_10010846 | Ga0070717_100108465 | 239 |
| 464 | 3300006028 | Ga0070717_10042424 | Ga0070717_100424243 | 239 |
| 465 | 3300006028 | Ga0070717_10082041 | Ga0070717_100820412 | 239 |
| 466 | 3300006028 | Ga0070717_10177527 | Ga0070717_101775272 | 239 |
| 467 | 3300006028 | Ga0070717_10322108 | Ga0070717_103221082 | 239 |
| 468 | 3300006038 | Ga0075365_10051109 | Ga0075365_100511092 | 239 |
| 469 | 3300006051 | Ga0075364_10229186 | Ga0075364_102291862 | 239 |
| 470 | 3300006163 | Ga0070715_10091588 | Ga0070715_100915882 | 239 |
| 471 | 3300006163 | Ga0070715_10099582 | Ga0070715_100995821 | 239 |
| 472 | 3300006173 | Ga0070716_100000082 | Ga0070716_10000008226 | 239 |
| 473 | 3300006175 | Ga0070712_100004947 | Ga0070712_1000049478 | 239 |
| 474 | 3300006175 | Ga0070712_100030262 | Ga0070712_1000302623 | 239 |
| 475 | 3300006175 | Ga0070712_100049629 | Ga0070712_1000496292 | 239 |
| 476 | 3300006175 | Ga0070712_100060383 | Ga0070712_1000603832 | 239 |
| 477 | 3300006175 | Ga0070712_100209192 | Ga0070712_1002091922 | 239 |
| 478 | 3300006178 | Ga0075367_10087053 | Ga0075367_100870533 | 239 |
| 479 | 3300006178 | Ga0075367_10274723 | Ga0075367_102747232 | 239 |
| 480 | 3300006353 | Ga0075370_10014533 | Ga0075370_100145332 | 239 |
| 481 | 3300006358 | Ga0068871_100108858 | Ga0068871_1001088582 | 239 |
| 482 | 3300006358 | Ga0068871_100112352 | Ga0068871_1001123522 | 239 |
| 483 | 3300006871 | Ga0075434_100439088 | Ga0075434_1004390882 | 239 |
| 484 | 3300006914 | Ga0075436_100125385 | Ga0075436_1001253852 | 239 |
| 485 | 3300007076 | Ga0075435_100295112 | Ga0075435_1002951122 | 239 |
| 486 | 3300009011 | Ga0105251_10016785 | Ga0105251_100167852 | 239 |
| 487 | 3300009101 | Ga0105247_10001021 | Ga0105247_1000102114 | 239 |
| 488 | 3300009147 | Ga0114129_11160773 | Ga0114129_111607732 | 239 |
| 489 | 3300009148 | Ga0105243_10076310 | Ga0105243_100763102 | 239 |
| 490 | 3300009177 | Ga0105248_10610682 | Ga0105248_106106822 | 239 |
| 491 | 3300009545 | Ga0105237_10032375 | Ga0105237_100323753 | 239 |
| 492 | 3300009551 | Ga0105238_10108612 | Ga0105238_101086122 | 239 |
| 493 | 3300009553 | Ga0105249_10316215 | Ga0105249_103162152 | 239 |
| 494 | 3300010159 | Ga0099796_10024654 | Ga0099796_100246542 | 239 |
| 495 | 3300010375 | Ga0105239_10804189 | Ga0105239_108041891 | 239 |
| 496 | 3300013100 | Ga0157373_10068066 | Ga0157373_100680662 | 239 |
| 497 | 3300013297 | Ga0157378_10085791 | Ga0157378_100857913 | 239 |
| 498 | 3300014325 | Ga0163163_10291902 | Ga0163163_102919021 | 239 |
| 499 | 3300014497 | Ga0182008_10148930 | Ga0182008_101489302 | 239 |
| 500 | 3300014968 | Ga0157379_10035817 | Ga0157379_100358172 | 239 |
| 501 | 3300020069 | Ga0197907_10517940 | Ga0197907_105179402 | 239 |
| 502 | 3300020070 | Ga0206356_11280802 | Ga0206356_112808023 | 239 |
| 503 | 3300020075 | Ga0206349_1062031 | Ga0206349_10620312 | 239 |
| 504 | 3300020077 | Ga0206351_10211465 | Ga0206351_102114652 | 239 |
| 505 | 3300020080 | Ga0206350_10944510 | Ga0206350_109445102 | 239 |
| 506 | 3300021388 | Ga0213875_10004191 | Ga0213875_100041914 | 239 |
| 507 | 3300021388 | Ga0213875_10008337 | Ga0213875_100083372 | 239 |
| 508 | 3300022467 | Ga0224712_10001526 | Ga0224712_100015263 | 239 |
| 509 | 3300022467 | Ga0224712_10021779 | Ga0224712_100217792 | 239 |
| 510 | 3300024225 | Ga0224572_1007130 | Ga0224572_10071302 | 239 |
| 511 | 3300024225 | Ga0224572_1012941 | Ga0224572_10129412 | 239 |
| 512 | 3300025898 | Ga0207692_10000682 | Ga0207692_100006822 | 239 |
| 513 | 3300025898 | Ga0207692_10033109 | Ga0207692_100331092 | 239 |
| 514 | 3300025898 | Ga0207692_10041370 | Ga0207692_100413703 | 239 |
| 515 | 3300025898 | Ga0207692_10068382 | Ga0207692_100683822 | 239 |
| 516 | 3300025900 | Ga0207710_10000813 | Ga0207710_1000081314 | 239 |
| 517 | 3300025901 | Ga0207688_10012315 | Ga0207688_100123152 | 239 |
| 518 | 3300025905 | Ga0207685_10012497 | Ga0207685_100124972 | 239 |
| 519 | 3300025905 | Ga0207685_10023159 | Ga0207685_100231593 | 239 |
| 520 | 3300025905 | Ga0207685_10074177 | Ga0207685_100741771 | 239 |
| 521 | 3300025906 | Ga0207699_10001559 | Ga0207699_100015596 | 239 |
| 522 | 3300025908 | Ga0207643_10044881 | Ga0207643_100448812 | 239 |
| 523 | 3300025910 | Ga0207684_10000654 | Ga0207684_1000065429 | 239 |
| 524 | 3300025910 | Ga0207684_10036597 | Ga0207684_100365975 | 239 |
| 525 | 3300025910 | Ga0207684_10259450 | Ga0207684_102594502 | 239 |
| 526 | 3300025914 | Ga0207671_10031440 | Ga0207671_100314403 | 239 |
| 527 | 3300025915 | Ga0207693_10026412 | Ga0207693_100264124 | 239 |
| 528 | 3300025915 | Ga0207693_10036715 | Ga0207693_100367152 | 239 |
| 529 | 3300025915 | Ga0207693_10083098 | Ga0207693_100830982 | 239 |
| 530 | 3300025915 | Ga0207693_10083216 | Ga0207693_100832162 | 239 |
| 531 | 3300025916 | Ga0207663_10050524 | Ga0207663_100505242 | 239 |
| 532 | 3300025916 | Ga0207663_10052237 | Ga0207663_100522374 | 239 |
| 533 | 3300025916 | Ga0207663_10108674 | Ga0207663_101086742 | 239 |
| 534 | 3300025916 | Ga0207663_10328496 | Ga0207663_103284962 | 239 |
| 535 | 3300025918 | Ga0207662_10073979 | Ga0207662_100739792 | 239 |
| 536 | 3300025919 | Ga0207657_10028616 | Ga0207657_100286163 | 239 |
| 537 | 3300025920 | Ga0207649_10202082 | Ga0207649_102020821 | 239 |
| 538 | 3300025922 | Ga0207646_10013433 | Ga0207646_100134334 | 239 |
| 539 | 3300025922 | Ga0207646_10076459 | Ga0207646_100764592 | 239 |
| 540 | 3300025926 | Ga0207659_10247677 | Ga0207659_102476772 | 239 |
| 541 | 3300025928 | Ga0207700_10000879 | Ga0207700_100008797 | 239 |
| 542 | 3300025928 | Ga0207700_10009432 | Ga0207700_100094323 | 239 |
| 543 | 3300025928 | Ga0207700_10012259 | Ga0207700_100122593 | 239 |
| 544 | 3300025928 | Ga0207700_10025128 | Ga0207700_100251282 | 239 |
| 545 | 3300025928 | Ga0207700_10028916 | Ga0207700_100289162 | 239 |
| 546 | 3300025928 | Ga0207700_10107439 | Ga0207700_101074392 | 239 |
| 547 | 3300025929 | Ga0207664_10000515 | Ga0207664_1000051524 | 239 |
| 548 | 3300025929 | Ga0207664_10009335 | Ga0207664_100093353 | 239 |
| 549 | 3300025929 | Ga0207664_10017462 | Ga0207664_100174624 | 239 |
| 550 | 3300025929 | Ga0207664_10026482 | Ga0207664_100264823 | 239 |
| 551 | 3300025929 | Ga0207664_10044574 | Ga0207664_100445742 | 239 |
| 552 | 3300025929 | Ga0207664_10046601 | Ga0207664_100466012 | 239 |
| 553 | 3300025929 | Ga0207664_10071442 | Ga0207664_100714422 | 239 |
| 554 | 3300025929 | Ga0207664_10114611 | Ga0207664_101146112 | 239 |
| 555 | 3300025929 | Ga0207664_10142995 | Ga0207664_101429952 | 239 |
| 556 | 3300025929 | Ga0207664_10160133 | Ga0207664_101601332 | 239 |
| 557 | 3300025929 | Ga0207664_10197286 | Ga0207664_101972863 | 239 |
| 558 | 3300025929 | Ga0207664_10231130 | Ga0207664_102311301 | 239 |
| 559 | 3300025929 | Ga0207664_10315930 | Ga0207664_103159302 | 239 |
| 560 | 3300025933 | Ga0207706_10040701 | Ga0207706_100407012 | 239 |
| 561 | 3300025936 | Ga0207670_10250084 | Ga0207670_102500842 | 239 |
| 562 | 3300025937 | Ga0207669_10435211 | Ga0207669_104352111 | 239 |
| 563 | 3300025939 | Ga0207665_10000100 | Ga0207665_1000010035 | 239 |
| 564 | 3300025939 | Ga0207665_10016388 | Ga0207665_100163882 | 239 |
| 565 | 3300025939 | Ga0207665_10197034 | Ga0207665_101970342 | 239 |
| 566 | 3300025941 | Ga0207711_10095886 | Ga0207711_100958862 | 239 |
| 567 | 3300025942 | Ga0207689_10211710 | Ga0207689_102117102 | 239 |
| 568 | 3300025944 | Ga0207661_10234414 | Ga0207661_102344142 | 239 |
| 569 | 3300025981 | Ga0207640_10049938 | Ga0207640_100499382 | 239 |
| 570 | 3300025986 | Ga0207658_10225842 | Ga0207658_102258422 | 239 |
| 571 | 3300026023 | Ga0207677_10080927 | Ga0207677_100809273 | 239 |
| 572 | 3300026035 | Ga0207703_10375908 | Ga0207703_103759082 | 239 |
| 573 | 3300026041 | Ga0207639_10549487 | Ga0207639_105494871 | 239 |
| 574 | 3300026075 | Ga0207708_10194941 | Ga0207708_101949412 | 239 |
| 575 | 3300026078 | Ga0207702_10053111 | Ga0207702_100531112 | 239 |
| 576 | 3300026088 | Ga0207641_10562550 | Ga0207641_105625501 | 239 |
| 577 | 3300026116 | Ga0207674_10065524 | Ga0207674_100655242 | 239 |
| 578 | 3300026118 | Ga0207675_100096851 | Ga0207675_1000968512 | 239 |
| 579 | 3300028381 | Ga0268264_10370255 | Ga0268264_103702552 | 239 |
| 580 | 3300031507 | Ga0307509_10018890 | Ga0307509_100188904 | 239 |
| 581 | 3300031616 | Ga0307508_10000773 | Ga0307508_1000077315 | 239 |
| 582 | 3300033180 | Ga0307510_10138705 | Ga0307510_101387052 | 239 |
| 583 | 3300034820 | Ga0373959_0004805 | Ga0373959_0004805_930_1652 | 239 |
| 584 | 3300035088 | Ga0373940_0004238 | Ga0373940_0004238_1710_2432 | 239 |
| 585 | 3300035091 | Ga0373951_0074284 | Ga0373951_0074284_13_735 | 239 |
| 586 | 3300035113 | Ga0373936_0005075 | Ga0373936_0005075_196_918 | 239 |
| 587 | 3300035113 | Ga0373936_0009359 | Ga0373936_0009359_2235_2957 | 239 |
| 588 | 3300035113 | Ga0373936_0015325 | Ga0373936_0015325_1939_2691 | 239 |
| 589 | 3300035115 | Ga0373941_0017037 | Ga0373941_0017037_543_1265 | 239 |
| 590 | 3300035116 | Ga0373945_0005101 | Ga0373945_0005101_943_1665 | 239 |
| 591 | 3300035117 | Ga0373953_0005118 | Ga0373953_0005118_561_1283 | 239 |
| 592 | 3300035118 | Ga0373954_0033563 | Ga0373954_0033563_1624_2346 | 239 |
| 593 | 3300035119 | Ga0373956_0021836 | Ga0373956_0021836_1769_2521 | 239 |
| 594 | 3300035119 | Ga0373956_0106793 | Ga0373956_0106793_219_941 | 239 |
| 595 | 3300035121 | Ga0373960_0040736 | Ga0373960_0040736_231_953 | 239 |
| 596 | 3300035172 | Ga0373955_0005298 | Ga0373955_0005298_4016_4738 | 239 |
| 597 | 3300035172 | Ga0373955_0013567 | Ga0373955_0013567_2640_3392 | 239 |
| 598 | 3300035207 | Ga0373942_0053647 | Ga0373942_0053647_26_748 | 239 |
| 599 | 3300035410 | Ga0373924_0004734 | Ga0373924_0004734_2889_3611 | 239 |
| 600 | 3300035691 | Ga0373931_0048120 | Ga0373931_0048120_75_797 | 239 |
| 601 | 3300035692 | Ga0373935_0078910 | Ga0373935_0078910_1351_2091 | 239 |
| 602 | 3300035692 | Ga0373935_0339616 | Ga0373935_0339616_162_884 | 239 |
| 603 | 3300035695 | Ga0373927_0034598 | Ga0373927_0034598_364_1086 | 239 |
| 604 | 3300035695 | Ga0373927_0038905 | Ga0373927_0038905_1827_2549 | 239 |
| 605 | 3300035724 | Ga0373933_0033398 | Ga0373933_0033398_2171_2893 | 239 |
| 606 | 3300035724 | Ga0373933_0075580 | Ga0373933_0075580_562_1314 | 239 |
| 607 | 3300035724 | Ga0373933_0082908 | Ga0373933_0082908_195_917 | 239 |
| 608 | 3300035724 | Ga0373933_0164469 | Ga0373933_0164469_95_820 | 239 |
| 609 | 3300035725 | Ga0373947_0018422 | Ga0373947_0018422_2692_3444 | 239 |
| 610 | 3300035725 | Ga0373947_0040507 | Ga0373947_0040507_873_1595 | 239 |
| 611 | 3300036401 | Ga0373937_0002125 | Ga0373937_0002125_10716_11441 | 239 |
| 612 | 3300036401 | Ga0373937_0020657 | Ga0373937_0020657_2826_3548 | 239 |
| 613 | 3300036401 | Ga0373937_0033873 | Ga0373937_0033873_3217_3939 | 239 |
| 614 | 3300036401 | Ga0373937_0083306 | Ga0373937_0083306_463_1185 | 239 |
| 615 | 3300036401 | Ga0373937_0165860 | Ga0373937_0165860_734_1456 | 239 |
| 616 | 3300036401 | Ga0373937_0469191 | Ga0373937_0469191_352_1074 | 239 |
| 617 | 3300036459 | Ga0372808_013280 | Ga0372808_013280_281_1000 | 239 |
| 618 | 3300037068 | Ga0373925_0000231 | Ga0373925_0000231_4065_4790 | 239 |
| 619 | 3300037068 | Ga0373925_0000554 | Ga0373925_0000554_15963_16724 | 239 |
| 620 | 3300037068 | Ga0373925_0014345 | Ga0373925_0014345_4704_5456 | 239 |
| 621 | 3300037068 | Ga0373925_0334557 | Ga0373925_0334557_205_927 | 239 |
| 622 | 3300037068 | Ga0373925_0675273 | Ga0373925_0675273_60_782 | 239 |
| 623 | 3300037853 | Ga0436364_0010280 | Ga0436364_0010280_8637_9359 | 239 |
| 624 | 3300037853 | Ga0436364_0241292 | Ga0436364_0241292_230_952 | 239 |
| 625 | 3300037853 | Ga0436364_0496703 | Ga0436364_0496703_397_1119 | 239 |
| 626 | 3300037853 | Ga0436364_1237330 | Ga0436364_1237330_495_1247 | 239 |
| 627 | 3300037853 | Ga0436364_1404373 | Ga0436364_1404373_3047_3769 | 239 |
| 628 | 3300039437 | Ga0436365_0614644 | Ga0436365_0614644_608_1330 | 239 |
| 629 | 3300039438 | Ga0436360_0246735 | Ga0436360_0246735_36_758 | 239 |
| 630 | 3300039450 | Ga0436363_1328754 | Ga0436363_1328754_1656_2378 | 239 |
| 631 | 3300044683 | Ga0466965_0048583 | Ga0466965_0048583_1233_1955 | 239 |
| 632 | 3300044901 | Ga0466960_0024774 | Ga0466960_0024774_1352_2074 | 239 |
| 633 | 3300045049 | Ga0466959_0345553 | Ga0466959_0345553_60_800 | 239 |
| 634 | 3300045836 | Ga0466958_0160530 | Ga0466958_0160530_103_825 | 239 |
| 635 | 3300045976 | Ga0466967_0280250 | Ga0466967_0280250_481_1203 | 239 |
| 636 | 3300045976 | Ga0466967_0390062 | Ga0466967_0390062_253_975 | 239 |
| 637 | 3300045976 | Ga0466967_0547377 | Ga0466967_0547377_170_892 | 239 |
| 638 | 3300046454 | Ga0495592_0065299 | Ga0495592_0065299_922_1644 | 239 |
| 639 | 3300046454 | Ga0495592_0082818 | Ga0495592_0082818_1207_1959 | 239 |
| 640 | 3300046455 | Ga0495603_0001113 | Ga0495603_0001113_14741_15463 | 239 |
| 641 | 3300046461 | Ga0495641_0016732 | Ga0495641_0016732_2998_3720 | 239 |
| 642 | 3300046462 | Ga0495651_0021252 | Ga0495651_0021252_642_1394 | 239 |
| 643 | 3300046462 | Ga0495651_0022414 | Ga0495651_0022414_2215_2937 | 239 |
| 644 | 3300046463 | Ga0495653_0042044 | Ga0495653_0042044_2493_3215 | 239 |
| 645 | 3300046463 | Ga0495653_0086891 | Ga0495653_0086891_640_1392 | 239 |
| 646 | 3300046463 | Ga0495653_0094982 | Ga0495653_0094982_799_1521 | 239 |
| 647 | 3300046472 | Ga0495580_0058359 | Ga0495580_0058359_1906_2628 | 239 |
| 648 | 3300046473 | Ga0495582_0008719 | Ga0495582_0008719_2412_3134 | 239 |
| 649 | 3300046475 | Ga0495639_0000902 | Ga0495639_0000902_11745_12467 | 239 |
| 650 | 3300046477 | Ga0495664_0046511 | Ga0495664_0046511_531_1253 | 239 |
| 651 | 3300046477 | Ga0495664_0105754 | Ga0495664_0105754_194_916 | 239 |
| 652 | 3300046499 | Ga0495594_0004077 | Ga0495594_0004077_1398_2120 | 239 |
| 653 | 3300046511 | Ga0495608_0111328 | Ga0495608_0111328_250_972 | 239 |
| 654 | 3300046511 | Ga0495608_0218797 | Ga0495608_0218797_223_975 | 239 |
| 655 | 3300046511 | Ga0495608_0404313 | Ga0495608_0404313_47_772 | 239 |
| 656 | 3300046514 | Ga0495618_0016207 | Ga0495618_0016207_3470_4192 | 239 |
| 657 | 3300046514 | Ga0495618_0060587 | Ga0495618_0060587_859_1611 | 239 |
| 658 | 3300046516 | Ga0495628_0263238 | Ga0495628_0263238_201_923 | 239 |
| 659 | 3300046517 | Ga0495630_0010186 | Ga0495630_0010186_2826_3548 | 239 |
| 660 | 3300046529 | Ga0495652_0249349 | Ga0495652_0249349_475_1197 | 239 |
| 661 | 3300046529 | Ga0495652_0279741 | Ga0495652_0279741_381_1133 | 239 |
| 662 | 3300046529 | Ga0495652_0392249 | Ga0495652_0392249_180_902 | 239 |
| 663 | 3300046536 | Ga0495587_0062098 | Ga0495587_0062098_343_1065 | 239 |
| 664 | 3300046543 | Ga0495645_0075853 | Ga0495645_0075853_1604_2326 | 239 |
| 665 | 3300046559 | Ga0495667_0020210 | Ga0495667_0020210_864_1586 | 239 |
| 666 | 3300046559 | Ga0495667_0041872 | Ga0495667_0041872_1481_2203 | 239 |
| 667 | 3300046559 | Ga0495667_0109291 | Ga0495667_0109291_488_1240 | 239 |
| 668 | 3300046642 | Ga0495634_0037462 | Ga0495634_0037462_87_809 | 239 |
| 669 | 3300046663 | Ga0495635_0028518 | Ga0495635_0028518_1386_2108 | 239 |
| 670 | 3300046663 | Ga0495635_0238789 | Ga0495635_0238789_295_1047 | 239 |
| 671 | 3300046674 | Ga0495588_0007147 | Ga0495588_0007147_2169_2891 | 239 |
| 672 | 3300046675 | Ga0495657_0089568 | Ga0495657_0089568_768_1490 | 239 |
| 673 | 3300046675 | Ga0495657_0356201 | Ga0495657_0356201_85_807 | 239 |
| 674 | 3300046679 | Ga0495623_0089508 | Ga0495623_0089508_641_1393 | 239 |
| 675 | 3300046679 | Ga0495623_0145632 | Ga0495623_0145632_114_839 | 239 |
| 676 | 3300046680 | Ga0495646_0236485 | Ga0495646_0236485_23_748 | 239 |
| 677 | 3300046681 | Ga0495647_0022181 | Ga0495647_0022181_652_1374 | 239 |
| 678 | 3300046683 | Ga0495658_0011799 | Ga0495658_0011799_226_948 | 239 |
| 679 | 3300046689 | Ga0495613_0007035 | Ga0495613_0007035_2485_3207 | 239 |
| 680 | 3300046809 | Ga0495600_0192535 | Ga0495600_0192535_403_1155 | 239 |
| 681 | 3300047317 | Ga0495604_0037480 | Ga0495604_0037480_2660_3382 | 239 |
| 682 | 3300047319 | Ga0495674_0170529 | Ga0495674_0170529_844_1566 | 239 |
| 683 | 3300047322 | Ga0495680_0019030 | Ga0495680_0019030_890_1642 | 239 |
| 684 | 3300047322 | Ga0495680_0046315 | Ga0495680_0046315_741_1463 | 239 |
| 685 | 3300047322 | Ga0495680_0347063 | Ga0495680_0347063_288_1013 | 239 |
| 686 | 3300047444 | Ga0495675_0004262 | Ga0495675_0004262_5941_6663 | 239 |
| 687 | 3300047444 | Ga0495675_0124402 | Ga0495675_0124402_472_1197 | 239 |
| 688 | 3300047471 | Ga0495684_0030940 | Ga0495684_0030940_1149_1901 | 239 |
| 689 | 3300047471 | Ga0495684_0116567 | Ga0495684_0116567_240_962 | 239 |
| 690 | 3300047471 | Ga0495684_0121323 | Ga0495684_0121323_1126_1848 | 239 |
| 691 | 3300047471 | Ga0495684_0188584 | Ga0495684_0188584_18_740 | 239 |
| 692 | 3300047471 | Ga0495684_0223052 | Ga0495684_0223052_89_811 | 239 |
| 693 | 3300047673 | Ga0495593_0006460 | Ga0495593_0006460_2425_3147 | 239 |
| 694 | 3300048088 | Ga0495602_0019899 | Ga0495602_0019899_281_1006 | 239 |
| 695 | 3300048088 | Ga0495602_0049359 | Ga0495602_0049359_1974_2696 | 239 |
| 696 | 3300048088 | Ga0495602_0201218 | Ga0495602_0201218_58_810 | 239 |
| 697 | 3300048089 | Ga0495614_0013260 | Ga0495614_0013260_2307_3029 | 239 |
| 698 | 3300048903 | Ga0496100_0037878 | Ga0496100_0037878_246_968 | 239 |
| 699 | 3300048907 | Ga0496104_0037090 | Ga0496104_0037090_2212_2934 | 239 |
| 700 | 3300048908 | Ga0496105_0423648 | Ga0496105_0423648_135_857 | 239 |
| 701 | 3300048910 | Ga0496107_0094315 | Ga0496107_0094315_1432_2154 | 239 |
| 702 | 3300048914 | Ga0496111_0103140 | Ga0496111_0103140_906_1628 | 239 |
| 703 | 3300048915 | Ga0496112_0517368 | Ga0496112_0517368_258_998 | 239 |
| 704 | 3300048917 | Ga0496114_0041577 | Ga0496114_0041577_1439_2161 | 239 |
| 705 | 3300048918 | Ga0496115_0098262 | Ga0496115_0098262_1189_1911 | 239 |
| 706 | 3300049571 | Ga0501034_0384329 | Ga0501034_0384329_97_825 | 239 |
| 707 | 3300050490 | nmdc:mga03n38_3102_c1 | nmdc:mga03n38_3102_c1_1106_1840 | 239 |
| 708 | 3300050494 | nmdc:mga06z11_2123_c1 | nmdc:mga06z11_2123_c1_2224_2958 | 239 |
| 709 | 3300050494 | nmdc:mga06z11_3600_c1 | nmdc:mga06z11_3600_c1_2712_3443 | 239 |
| 710 | 3300050496 | nmdc:mga07m45_44537_c1 | nmdc:mga07m45_44537_c1_1402_2133 | 239 |
| 711 | 3300050507 | nmdc:mga05p37_801902_c1 | nmdc:mga05p37_801902_c1_150_875 | 239 |
| 712 | 3300050512 | nmdc:mga0n895_415844_c1 | nmdc:mga0n895_415844_c1_41_763 | 239 |
| 713 | 3300050512 | nmdc:mga0n895_580640_c1 | nmdc:mga0n895_580640_c1_152_874 | 239 |
| 714 | 3300050515 | nmdc:mga0a205_231803_c1 | nmdc:mga0a205_231803_c1_797_1519 | 239 |
| 715 | 3300053078 | Ga0495612_0012451 | Ga0495612_0012451_224_946 | 239 |
| 716 | 3300053078 | Ga0495612_0073284 | Ga0495612_0073284_599_1321 | 239 |
| 717 | 3300053085 | Ga0495619_0027888 | Ga0495619_0027888_368_1090 | 239 |
| 718 | 3300002076 | JGI24749J21850_1006588 | JGI24749J21850_10065882 | 240 |
| 719 | 3300003373 | JGI25407J50210_10000245 | JGI25407J50210_1000024510 | 240 |
| 720 | 3300005327 | Ga0070658_10005200 | Ga0070658_100052006 | 240 |
| 721 | 3300005328 | Ga0070676_10142107 | Ga0070676_101421072 | 240 |
| 722 | 3300005329 | Ga0070683_100002200 | Ga0070683_1000022001 | 240 |
| 723 | 3300005329 | Ga0070683_100051708 | Ga0070683_1000517083 | 240 |
| 724 | 3300005329 | Ga0070683_100222354 | Ga0070683_1002223542 | 240 |
| 725 | 3300005331 | Ga0070670_100077924 | Ga0070670_1000779242 | 240 |
| 726 | 3300005334 | Ga0068869_100002294 | Ga0068869_1000022949 | 240 |
| 727 | 3300005337 | Ga0070682_100182060 | Ga0070682_1001820602 | 240 |
| 728 | 3300005338 | Ga0068868_100004349 | Ga0068868_1000043492 | 240 |
| 729 | 3300005339 | Ga0070660_100077757 | Ga0070660_1000777572 | 240 |
| 730 | 3300005341 | Ga0070691_10092880 | Ga0070691_100928802 | 240 |
| 731 | 3300005344 | Ga0070661_100007295 | Ga0070661_1000072952 | 240 |
| 732 | 3300005344 | Ga0070661_100012215 | Ga0070661_1000122152 | 240 |
| 733 | 3300005344 | Ga0070661_100528106 | Ga0070661_1005281062 | 240 |
| 734 | 3300005345 | Ga0070692_10058082 | Ga0070692_100580822 | 240 |
| 735 | 3300005347 | Ga0070668_100053649 | Ga0070668_1000536492 | 240 |
| 736 | 3300005354 | Ga0070675_100009075 | Ga0070675_1000090755 | 240 |
| 737 | 3300005354 | Ga0070675_100542894 | Ga0070675_1005428941 | 240 |
| 738 | 3300005356 | Ga0070674_100154153 | Ga0070674_1001541532 | 240 |
| 739 | 3300005356 | Ga0070674_100236079 | Ga0070674_1002360792 | 240 |
| 740 | 3300005364 | Ga0070673_100031282 | Ga0070673_1000312822 | 240 |
| 741 | 3300005364 | Ga0070673_100221662 | Ga0070673_1002216623 | 240 |
| 742 | 3300005366 | Ga0070659_100070598 | Ga0070659_1000705982 | 240 |
| 743 | 3300005367 | Ga0070667_100366100 | Ga0070667_1003661002 | 240 |
| 744 | 3300005435 | Ga0070714_100270072 | Ga0070714_1002700722 | 240 |
| 745 | 3300005436 | Ga0070713_100200460 | Ga0070713_1002004602 | 240 |
| 746 | 3300005441 | Ga0070700_100009766 | Ga0070700_1000097666 | 240 |
| 747 | 3300005441 | Ga0070700_100082525 | Ga0070700_1000825252 | 240 |
| 748 | 3300005445 | Ga0070708_100053014 | Ga0070708_1000530142 | 240 |
| 749 | 3300005456 | Ga0070678_100057307 | Ga0070678_1000573073 | 240 |
| 750 | 3300005456 | Ga0070678_100446528 | Ga0070678_1004465282 | 240 |
| 751 | 3300005457 | Ga0070662_100079467 | Ga0070662_1000794672 | 240 |
| 752 | 3300005458 | Ga0070681_10110721 | Ga0070681_101107212 | 240 |
| 753 | 3300005458 | Ga0070681_10116504 | Ga0070681_101165042 | 240 |
| 754 | 3300005466 | Ga0070685_10010560 | Ga0070685_100105605 | 240 |
| 755 | 3300005471 | Ga0070698_100038664 | Ga0070698_1000386644 | 240 |
| 756 | 3300005530 | Ga0070679_100089352 | Ga0070679_1000893522 | 240 |
| 757 | 3300005530 | Ga0070679_100093281 | Ga0070679_1000932812 | 240 |
| 758 | 3300005535 | Ga0070684_100003000 | Ga0070684_1000030005 | 240 |
| 759 | 3300005535 | Ga0070684_100049353 | Ga0070684_1000493532 | 240 |
| 760 | 3300005535 | Ga0070684_100078319 | Ga0070684_1000783192 | 240 |
| 761 | 3300005535 | Ga0070684_100181385 | Ga0070684_1001813853 | 240 |
| 762 | 3300005563 | Ga0068855_100143516 | Ga0068855_1001435162 | 240 |
| 763 | 3300005564 | Ga0070664_100000709 | Ga0070664_1000007095 | 240 |
| 764 | 3300005564 | Ga0070664_100065752 | Ga0070664_1000657526 | 240 |
| 765 | 3300005564 | Ga0070664_100347134 | Ga0070664_1003471342 | 240 |
| 766 | 3300005616 | Ga0068852_100009879 | Ga0068852_1000098795 | 240 |
| 767 | 3300005616 | Ga0068852_100539514 | Ga0068852_1005395142 | 240 |
| 768 | 3300005617 | Ga0068859_100089640 | Ga0068859_1000896403 | 240 |
| 769 | 3300005618 | Ga0068864_100091147 | Ga0068864_1000911472 | 240 |
| 770 | 3300005718 | Ga0068866_10197441 | Ga0068866_101974412 | 240 |
| 771 | 3300005719 | Ga0068861_100058068 | Ga0068861_1000580682 | 240 |
| 772 | 3300005719 | Ga0068861_100576841 | Ga0068861_1005768412 | 240 |
| 773 | 3300005841 | Ga0068863_100007563 | Ga0068863_1000075632 | 240 |
| 774 | 3300005842 | Ga0068858_100000141 | Ga0068858_10000014172 | 240 |
| 775 | 3300005844 | Ga0068862_100000004 | Ga0068862_100000004235 | 240 |
| 776 | 3300005844 | Ga0068862_100015926 | Ga0068862_1000159262 | 240 |
| 777 | 3300005937 | Ga0081455_10001616 | Ga0081455_1000161613 | 240 |
| 778 | 3300005937 | Ga0081455_10002768 | Ga0081455_100027686 | 240 |
| 779 | 3300005937 | Ga0081455_10016246 | Ga0081455_100162465 | 240 |
| 780 | 3300005937 | Ga0081455_10027643 | Ga0081455_100276437 | 240 |
| 781 | 3300005937 | Ga0081455_10070163 | Ga0081455_100701633 | 240 |
| 782 | 3300005937 | Ga0081455_10096067 | Ga0081455_100960673 | 240 |
| 783 | 3300005937 | Ga0081455_10137893 | Ga0081455_101378932 | 240 |
| 784 | 3300005981 | Ga0081538_10000506 | Ga0081538_1000050616 | 240 |
| 785 | 3300005981 | Ga0081538_10001127 | Ga0081538_1000112714 | 240 |
| 786 | 3300005981 | Ga0081538_10004909 | Ga0081538_100049097 | 240 |
| 787 | 3300005981 | Ga0081538_10011657 | Ga0081538_100116576 | 240 |
| 788 | 3300005981 | Ga0081538_10022452 | Ga0081538_100224524 | 240 |
| 789 | 3300005981 | Ga0081538_10182342 | Ga0081538_101823422 | 240 |
| 790 | 3300005983 | Ga0081540_1003879 | Ga0081540_100387910 | 240 |
| 791 | 3300005985 | Ga0081539_10002139 | Ga0081539_1000213921 | 240 |
| 792 | 3300005985 | Ga0081539_10011478 | Ga0081539_100114782 | 240 |
| 793 | 3300005985 | Ga0081539_10015588 | Ga0081539_100155884 | 240 |
| 794 | 3300005985 | Ga0081539_10022338 | Ga0081539_100223381 | 240 |
| 795 | 3300006051 | Ga0075364_10047373 | Ga0075364_100473732 | 240 |
| 796 | 3300006844 | Ga0075428_100180406 | Ga0075428_1001804062 | 240 |
| 797 | 3300006844 | Ga0075428_100393168 | Ga0075428_1003931682 | 240 |
| 798 | 3300006846 | Ga0075430_100001691 | Ga0075430_10000169119 | 240 |
| 799 | 3300006846 | Ga0075430_100007329 | Ga0075430_1000073296 | 240 |
| 800 | 3300006847 | Ga0075431_100172451 | Ga0075431_1001724512 | 240 |
| 801 | 3300006847 | Ga0075431_100236671 | Ga0075431_1002366711 | 240 |
| 802 | 3300006847 | Ga0075431_100544165 | Ga0075431_1005441652 | 240 |
| 803 | 3300006871 | Ga0075434_100219036 | Ga0075434_1002190362 | 240 |
| 804 | 3300006880 | Ga0075429_100139334 | Ga0075429_1001393342 | 240 |
| 805 | 3300006880 | Ga0075429_100149226 | Ga0075429_1001492262 | 240 |
| 806 | 3300006881 | Ga0068865_100492920 | Ga0068865_1004929202 | 240 |
| 807 | 3300006931 | Ga0097620_100089640 | Ga0097620_1000896403 | 240 |
| 808 | 3300009093 | Ga0105240_10019152 | Ga0105240_100191524 | 240 |
| 809 | 3300009094 | Ga0111539_10001616 | Ga0111539_1000161617 | 240 |
| 810 | 3300009094 | Ga0111539_10025348 | Ga0111539_100253482 | 240 |
| 811 | 3300009094 | Ga0111539_10790100 | Ga0111539_107901001 | 240 |
| 812 | 3300009098 | Ga0105245_10002942 | Ga0105245_100029422 | 240 |
| 813 | 3300009098 | Ga0105245_10024872 | Ga0105245_100248722 | 240 |
| 814 | 3300009101 | Ga0105247_10001810 | Ga0105247_100018102 | 240 |
| 815 | 3300009101 | Ga0105247_10101128 | Ga0105247_101011282 | 240 |
| 816 | 3300009147 | Ga0114129_10032040 | Ga0114129_100320406 | 240 |
| 817 | 3300009147 | Ga0114129_10073744 | Ga0114129_100737446 | 240 |
| 818 | 3300009147 | Ga0114129_10150784 | Ga0114129_101507844 | 240 |
| 819 | 3300009147 | Ga0114129_10236923 | Ga0114129_102369232 | 240 |
| 820 | 3300009147 | Ga0114129_10281565 | Ga0114129_102815653 | 240 |
| 821 | 3300009148 | Ga0105243_10045283 | Ga0105243_100452836 | 240 |
| 822 | 3300009148 | Ga0105243_10085493 | Ga0105243_100854933 | 240 |
| 823 | 3300009148 | Ga0105243_10297540 | Ga0105243_102975402 | 240 |
| 824 | 3300009176 | Ga0105242_10165076 | Ga0105242_101650762 | 240 |
| 825 | 3300009176 | Ga0105242_10510574 | Ga0105242_105105742 | 240 |
| 826 | 3300009176 | Ga0105242_10786904 | Ga0105242_107869042 | 240 |
| 827 | 3300009177 | Ga0105248_10089093 | Ga0105248_100890933 | 240 |
| 828 | 3300009177 | Ga0105248_10137082 | Ga0105248_101370822 | 240 |
| 829 | 3300009177 | Ga0105248_10312941 | Ga0105248_103129412 | 240 |
| 830 | 3300009551 | Ga0105238_10721806 | Ga0105238_107218062 | 240 |
| 831 | 3300009551 | Ga0105238_10772992 | Ga0105238_107729922 | 240 |
| 832 | 3300009553 | Ga0105249_10376849 | Ga0105249_103768492 | 240 |
| 833 | 3300009553 | Ga0105249_10705820 | Ga0105249_107058202 | 240 |
| 834 | 3300010375 | Ga0105239_10094558 | Ga0105239_100945584 | 240 |
| 835 | 3300010375 | Ga0105239_10684727 | Ga0105239_106847271 | 240 |
| 836 | 3300011119 | Ga0105246_10031222 | Ga0105246_100312222 | 240 |
| 837 | 3300011119 | Ga0105246_10469086 | Ga0105246_104690862 | 240 |
| 838 | 3300013105 | Ga0157369_10015933 | Ga0157369_100159338 | 240 |
| 839 | 3300013297 | Ga0157378_10338367 | Ga0157378_103383672 | 240 |
| 840 | 3300013308 | Ga0157375_10037718 | Ga0157375_100377186 | 240 |
| 841 | 3300013308 | Ga0157375_10463115 | Ga0157375_104631152 | 240 |
| 842 | 3300013308 | Ga0157375_10537222 | Ga0157375_105372222 | 240 |
| 843 | 3300014325 | Ga0163163_10009790 | Ga0163163_100097903 | 240 |
| 844 | 3300014325 | Ga0163163_10026392 | Ga0163163_100263922 | 240 |
| 845 | 3300014325 | Ga0163163_10093464 | Ga0163163_100934643 | 240 |
| 846 | 3300014325 | Ga0163163_10105533 | Ga0163163_101055332 | 240 |
| 847 | 3300014326 | Ga0157380_10282069 | Ga0157380_102820692 | 240 |
| 848 | 3300014497 | Ga0182008_10173991 | Ga0182008_101739911 | 240 |
| 849 | 3300014745 | Ga0157377_10028182 | Ga0157377_100281823 | 240 |
| 850 | 3300014968 | Ga0157379_10005115 | Ga0157379_1000511512 | 240 |
| 851 | 3300017792 | Ga0163161_10384634 | Ga0163161_103846342 | 240 |
| 852 | 3300020082 | Ga0206353_10705757 | Ga0206353_107057572 | 240 |
| 853 | 3300025899 | Ga0207642_10032509 | Ga0207642_100325092 | 240 |
| 854 | 3300025900 | Ga0207710_10000092 | Ga0207710_10000092106 | 240 |
| 855 | 3300025901 | Ga0207688_10008728 | Ga0207688_100087283 | 240 |
| 856 | 3300025907 | Ga0207645_10132391 | Ga0207645_101323912 | 240 |
| 857 | 3300025907 | Ga0207645_10145447 | Ga0207645_101454472 | 240 |
| 858 | 3300025908 | Ga0207643_10055822 | Ga0207643_100558223 | 240 |
| 859 | 3300025909 | Ga0207705_10047595 | Ga0207705_100475952 | 240 |
| 860 | 3300025912 | Ga0207707_10060284 | Ga0207707_100602843 | 240 |
| 861 | 3300025912 | Ga0207707_10101432 | Ga0207707_101014322 | 240 |
| 862 | 3300025918 | Ga0207662_10020450 | Ga0207662_100204504 | 240 |
| 863 | 3300025920 | Ga0207649_10071903 | Ga0207649_100719032 | 240 |
| 864 | 3300025920 | Ga0207649_10074921 | Ga0207649_100749213 | 240 |
| 865 | 3300025921 | Ga0207652_10058565 | Ga0207652_100585652 | 240 |
| 866 | 3300025921 | Ga0207652_10244407 | Ga0207652_102444072 | 240 |
| 867 | 3300025923 | Ga0207681_10266403 | Ga0207681_102664032 | 240 |
| 868 | 3300025925 | Ga0207650_10039344 | Ga0207650_100393443 | 240 |
| 869 | 3300025926 | Ga0207659_10004425 | Ga0207659_100044252 | 240 |
| 870 | 3300025926 | Ga0207659_10184386 | Ga0207659_101843862 | 240 |
| 871 | 3300025927 | Ga0207687_10163193 | Ga0207687_101631932 | 240 |
| 872 | 3300025933 | Ga0207706_10004178 | Ga0207706_100041783 | 240 |
| 873 | 3300025934 | Ga0207686_10647108 | Ga0207686_106471081 | 240 |
| 874 | 3300025936 | Ga0207670_10034163 | Ga0207670_100341633 | 240 |
| 875 | 3300025937 | Ga0207669_10317924 | Ga0207669_103179242 | 240 |
| 876 | 3300025940 | Ga0207691_10299901 | Ga0207691_102999012 | 240 |
| 877 | 3300025941 | Ga0207711_10430369 | Ga0207711_104303692 | 240 |
| 878 | 3300025942 | Ga0207689_10004008 | Ga0207689_1000400810 | 240 |
| 879 | 3300025942 | Ga0207689_10097397 | Ga0207689_100973972 | 240 |
| 880 | 3300025942 | Ga0207689_10143209 | Ga0207689_101432092 | 240 |
| 881 | 3300025944 | Ga0207661_10006800 | Ga0207661_100068007 | 240 |
| 882 | 3300025944 | Ga0207661_10177633 | Ga0207661_101776332 | 240 |
| 883 | 3300025945 | Ga0207679_10005780 | Ga0207679_100057803 | 240 |
| 884 | 3300025945 | Ga0207679_10410141 | Ga0207679_104101412 | 240 |
| 885 | 3300025960 | Ga0207651_10093960 | Ga0207651_100939602 | 240 |
| 886 | 3300025960 | Ga0207651_10181034 | Ga0207651_101810343 | 240 |
| 887 | 3300025961 | Ga0207712_10057681 | Ga0207712_100576812 | 240 |
| 888 | 3300025972 | Ga0207668_10108153 | Ga0207668_101081532 | 240 |
| 889 | 3300025981 | Ga0207640_10090480 | Ga0207640_100904802 | 240 |
| 890 | 3300026023 | Ga0207677_10005659 | Ga0207677_100056592 | 240 |
| 891 | 3300026035 | Ga0207703_10000147 | Ga0207703_1000014767 | 240 |
| 892 | 3300026035 | Ga0207703_10338804 | Ga0207703_103388042 | 240 |
| 893 | 3300026075 | Ga0207708_10002233 | Ga0207708_1000223314 | 240 |
| 894 | 3300026075 | Ga0207708_10057411 | Ga0207708_100574112 | 240 |
| 895 | 3300026088 | Ga0207641_10013621 | Ga0207641_100136213 | 240 |
| 896 | 3300026089 | Ga0207648_10105956 | Ga0207648_101059563 | 240 |
| 897 | 3300026089 | Ga0207648_10185317 | Ga0207648_101853172 | 240 |
| 898 | 3300026095 | Ga0207676_10125068 | Ga0207676_101250683 | 240 |
| 899 | 3300026116 | Ga0207674_10080516 | Ga0207674_100805162 | 240 |
| 900 | 3300026118 | Ga0207675_100016647 | Ga0207675_10001664710 | 240 |
| 901 | 3300026118 | Ga0207675_100302972 | Ga0207675_1003029722 | 240 |
| 902 | 3300026118 | Ga0207675_100682336 | Ga0207675_1006823362 | 240 |
| 903 | 3300026121 | Ga0207683_10055321 | Ga0207683_100553212 | 240 |
| 904 | 3300026121 | Ga0207683_10072865 | Ga0207683_100728652 | 240 |
| 905 | 3300026121 | Ga0207683_10166471 | Ga0207683_101664712 | 240 |
| 906 | 3300027907 | Ga0207428_10011911 | Ga0207428_100119113 | 240 |
| 907 | 3300027907 | Ga0207428_10249255 | Ga0207428_102492552 | 240 |
| 908 | 3300027907 | Ga0207428_10431996 | Ga0207428_104319962 | 240 |
| 909 | 3300028379 | Ga0268266_10036260 | Ga0268266_100362602 | 240 |
| 910 | 3300028380 | Ga0268265_10000009 | Ga0268265_10000009120 | 240 |
| 911 | 3300028380 | Ga0268265_10011087 | Ga0268265_100110872 | 240 |
| 912 | 3300028381 | Ga0268264_10239901 | Ga0268264_102399012 | 240 |
| 913 | 3300031548 | Ga0307408_100058048 | Ga0307408_1000580483 | 240 |
| 914 | 3300031616 | Ga0307508_10022967 | Ga0307508_100229675 | 240 |
| 915 | 3300031730 | Ga0307516_10090310 | Ga0307516_100903103 | 240 |
| 916 | 3300031731 | Ga0307405_10323592 | Ga0307405_103235922 | 240 |
| 917 | 3300031731 | Ga0307405_10356484 | Ga0307405_103564842 | 240 |
| 918 | 3300031852 | Ga0307410_10111961 | Ga0307410_101119612 | 240 |
| 919 | 3300031852 | Ga0307410_10787588 | Ga0307410_107875881 | 240 |
| 920 | 3300031901 | Ga0307406_10025635 | Ga0307406_100256351 | 240 |
| 921 | 3300031995 | Ga0307409_100014296 | Ga0307409_1000142963 | 240 |
| 922 | 3300031995 | Ga0307409_100228455 | Ga0307409_1002284552 | 240 |
| 923 | 3300031995 | Ga0307409_100862256 | Ga0307409_1008622561 | 240 |
| 924 | 3300032002 | Ga0307416_100027141 | Ga0307416_1000271412 | 240 |
| 925 | 3300032002 | Ga0307416_100140536 | Ga0307416_1001405362 | 240 |
| 926 | 3300032002 | Ga0307416_100391909 | Ga0307416_1003919092 | 240 |
| 927 | 3300032002 | Ga0307416_100559727 | Ga0307416_1005597272 | 240 |
| 928 | 3300032002 | Ga0307416_100577483 | Ga0307416_1005774831 | 240 |
| 929 | 3300032005 | Ga0307411_10085920 | Ga0307411_100859202 | 240 |
| 930 | 3300032126 | Ga0307415_100000782 | Ga0307415_10000078212 | 240 |
| 931 | 3300032126 | Ga0307415_100035544 | Ga0307415_1000355442 | 240 |
| 932 | 3300032126 | Ga0307415_100303898 | Ga0307415_1003038982 | 240 |
| 933 | 3300037068 | Ga0373925_0250578 | Ga0373925_0250578_684_1409 | 240 |
| 934 | 3300037312 | Ga0395899_0005516 | Ga0395899_0005516_3835_4557 | 240 |
| 935 | 3300037312 | Ga0395899_0023085 | Ga0395899_0023085_2247_2969 | 240 |
| 936 | 3300037312 | Ga0395899_0023972 | Ga0395899_0023972_1259_1984 | 240 |
| 937 | 3300037312 | Ga0395899_0077434 | Ga0395899_0077434_581_1306 | 240 |
| 938 | 3300037312 | Ga0395899_0167572 | Ga0395899_0167572_611_1336 | 240 |
| 939 | 3300037312 | Ga0395899_0240888 | Ga0395899_0240888_50_775 | 240 |
| 940 | 3300037418 | Ga0395900_0029569 | Ga0395900_0029569_2489_3214 | 240 |
| 941 | 3300037418 | Ga0395900_0030702 | Ga0395900_0030702_1436_2161 | 240 |
| 942 | 3300037418 | Ga0395900_0035605 | Ga0395900_0035605_3693_4415 | 240 |
| 943 | 3300037418 | Ga0395900_0039982 | Ga0395900_0039982_2362_3084 | 240 |
| 944 | 3300037418 | Ga0395900_0044740 | Ga0395900_0044740_1488_2213 | 240 |
| 945 | 3300037418 | Ga0395900_0047123 | Ga0395900_0047123_2950_3675 | 240 |
| 946 | 3300037418 | Ga0395900_0048875 | Ga0395900_0048875_3191_3913 | 240 |
| 947 | 3300037418 | Ga0395900_0055124 | Ga0395900_0055124_1017_1742 | 240 |
| 948 | 3300037418 | Ga0395900_0080771 | Ga0395900_0080771_1928_2653 | 240 |
| 949 | 3300037418 | Ga0395900_0149599 | Ga0395900_0149599_968_1690 | 240 |
| 950 | 3300037466 | Ga0395898_0007057 | Ga0395898_0007057_5208_5930 | 240 |
| 951 | 3300037466 | Ga0395898_0014253 | Ga0395898_0014253_1901_2626 | 240 |
| 952 | 3300037466 | Ga0395898_0029725 | Ga0395898_0029725_807_1532 | 240 |
| 953 | 3300037466 | Ga0395898_0039170 | Ga0395898_0039170_857_1582 | 240 |
| 954 | 3300037466 | Ga0395898_0076991 | Ga0395898_0076991_749_1471 | 240 |
| 955 | 3300037466 | Ga0395898_0114384 | Ga0395898_0114384_834_1556 | 240 |
| 956 | 3300037466 | Ga0395898_0133395 | Ga0395898_0133395_197_922 | 240 |
| 957 | 3300037466 | Ga0395898_0197322 | Ga0395898_0197322_1086_1811 | 240 |
| 958 | 3300037466 | Ga0395898_0412620 | Ga0395898_0412620_108_830 | 240 |
| 959 | 3300037471 | Ga0395905_0009185 | Ga0395905_0009185_5359_6081 | 240 |
| 960 | 3300037471 | Ga0395905_0017073 | Ga0395905_0017073_2465_3190 | 240 |
| 961 | 3300037471 | Ga0395905_0018244 | Ga0395905_0018244_1418_2143 | 240 |
| 962 | 3300037471 | Ga0395905_0035080 | Ga0395905_0035080_1045_1770 | 240 |
| 963 | 3300037471 | Ga0395905_0057431 | Ga0395905_0057431_2082_2804 | 240 |
| 964 | 3300037471 | Ga0395905_0081703 | Ga0395905_0081703_460_1182 | 240 |
| 965 | 3300037471 | Ga0395905_0135021 | Ga0395905_0135021_47_769 | 240 |
| 966 | 3300037471 | Ga0395905_0159127 | Ga0395905_0159127_516_1238 | 240 |
| 967 | 3300037471 | Ga0395905_0730980 | Ga0395905_0730980_86_811 | 240 |
| 968 | 3300038443 | Ga0395901_0020563 | Ga0395901_0020563_2425_3150 | 240 |
| 969 | 3300038443 | Ga0395901_0024346 | Ga0395901_0024346_4501_5226 | 240 |
| 970 | 3300038443 | Ga0395901_0029599 | Ga0395901_0029599_4528_5253 | 240 |
| 971 | 3300038443 | Ga0395901_0030170 | Ga0395901_0030170_1454_2179 | 240 |
| 972 | 3300038443 | Ga0395901_0053689 | Ga0395901_0053689_1143_1865 | 240 |
| 973 | 3300038443 | Ga0395901_0064867 | Ga0395901_0064867_514_1239 | 240 |
| 974 | 3300038443 | Ga0395901_0090089 | Ga0395901_0090089_1213_1938 | 240 |
| 975 | 3300038443 | Ga0395901_0160058 | Ga0395901_0160058_335_1060 | 240 |
| 976 | 3300038443 | Ga0395901_0292959 | Ga0395901_0292959_561_1283 | 240 |
| 977 | 3300038443 | Ga0395901_0631449 | Ga0395901_0631449_240_962 | 240 |
| 978 | 3300038443 | Ga0395901_0935609 | Ga0395901_0935609_62_784 | 240 |
| 979 | 3300041512 | Ga0451853_0135350 | Ga0451853_0135350_1110_1835 | 240 |
| 980 | 3300042184 | Ga0450908_012200 | Ga0450908_012200_420_1145 | 240 |
| 981 | 3300042436 | Ga0439435_0037468 | Ga0439435_0037468_42_767 | 240 |
| 982 | 3300046459 | Ga0495629_0051026 | Ga0495629_0051026_295_1020 | 240 |
| 983 | 3300046473 | Ga0495582_0087275 | Ga0495582_0087275_592_1317 | 240 |
| 984 | 3300046499 | Ga0495594_0022643 | Ga0495594_0022643_2179_2904 | 240 |
| 985 | 3300046499 | Ga0495594_0337765 | Ga0495594_0337765_79_804 | 240 |
| 986 | 3300046615 | Ga0495656_0144651 | Ga0495656_0144651_192_917 | 240 |
| 987 | 3300046615 | Ga0495656_0340372 | Ga0495656_0340372_40_765 | 240 |
| 988 | 3300046664 | Ga0495659_0087105 | Ga0495659_0087105_99_821 | 240 |
| 989 | 3300046691 | Ga0495670_0267504 | Ga0495670_0267504_100_822 | 240 |
| 990 | 3300046794 | Ga0495589_0123796 | Ga0495589_0123796_238_963 | 240 |
| 991 | 3300047322 | Ga0495680_0145810 | Ga0495680_0145810_542_1267 | 240 |
| 992 | 3300048904 | Ga0496101_0005465 | Ga0496101_0005465_666_1391 | 240 |
| 993 | 3300048907 | Ga0496104_0116546 | Ga0496104_0116546_331_1176 | 240 |
| 994 | 3300048907 | Ga0496104_0269116 | Ga0496104_0269116_295_1020 | 240 |
| 995 | 3300048908 | Ga0496105_0151016 | Ga0496105_0151016_858_1583 | 240 |
| 996 | 3300048910 | Ga0496107_0038018 | Ga0496107_0038018_1787_2512 | 240 |
| 997 | 3300048911 | Ga0496108_0000128 | Ga0496108_0000128_11734_12459 | 240 |
| 998 | 3300048911 | Ga0496108_0087238 | Ga0496108_0087238_1146_1868 | 240 |
| 999 | 3300048911 | Ga0496108_0234662 | Ga0496108_0234662_29_754 | 240 |
| 1000 | 3300048912 | Ga0496109_0062422 | Ga0496109_0062422_628_1353 | 240 |
| 1001 | 3300048912 | Ga0496109_0120199 | Ga0496109_0120199_270_995 | 240 |
| 1002 | 3300048912 | Ga0496109_0652667 | Ga0496109_0652667_153_878 | 240 |
| 1003 | 3300048913 | Ga0496110_0025180 | Ga0496110_0025180_787_1512 | 240 |
| 1004 | 3300048913 | Ga0496110_0232255 | Ga0496110_0232255_30_755 | 240 |
| 1005 | 3300048914 | Ga0496111_0271774 | Ga0496111_0271774_320_1045 | 240 |
| 1006 | 3300048914 | Ga0496111_0455477 | Ga0496111_0455477_82_810 | 240 |
| 1007 | 3300048915 | Ga0496112_0004178 | Ga0496112_0004178_6907_7632 | 240 |
| 1008 | 3300048915 | Ga0496112_0011017 | Ga0496112_0011017_6956_7681 | 240 |
| 1009 | 3300048916 | Ga0496113_0034712 | Ga0496113_0034712_1222_1947 | 240 |
| 1010 | 3300048916 | Ga0496113_0068024 | Ga0496113_0068024_595_1320 | 240 |
| 1011 | 3300048918 | Ga0496115_0140345 | Ga0496115_0140345_637_1362 | 240 |
| 1012 | 3300048922 | Ga0496119_0013498 | Ga0496119_0013498_3456_4184 | 240 |
| 1013 | 3300048924 | Ga0496121_0003979 | Ga0496121_0003979_9257_9985 | 240 |
| 1014 | 3300049571 | Ga0501034_0037606 | Ga0501034_0037606_3357_4088 | 240 |
| 1015 | 3300049572 | Ga0501036_0134098 | Ga0501036_0134098_782_1507 | 240 |
| 1016 | 3300049575 | Ga0501039_0037530 | Ga0501039_0037530_1141_1866 | 240 |
| 1017 | 3300049576 | Ga0501040_0065837 | Ga0501040_0065837_1699_2424 | 240 |
| 1018 | 3300049578 | Ga0501042_0015337 | Ga0501042_0015337_3851_4576 | 240 |
| 1019 | 3300049578 | Ga0501042_0162863 | Ga0501042_0162863_866_1588 | 240 |
| 1020 | 3300049581 | Ga0501047_0348144 | Ga0501047_0348144_525_1250 | 240 |
| 1021 | 3300049582 | Ga0501048_0454465 | Ga0501048_0454465_152_877 | 240 |
| 1022 | 3300049590 | Ga0501074_0168228 | Ga0501074_0168228_517_1242 | 240 |
| 1023 | 3300049741 | Ga0501079_0051330 | Ga0501079_0051330_1418_2143 | 240 |
| 1024 | 3300049744 | Ga0501083_0052676 | Ga0501083_0052676_1660_2385 | 240 |
| 1025 | 3300049824 | Ga0501045_0026945 | Ga0501045_0026945_1718_2443 | 240 |
| 1026 | 3300050491 | nmdc:mga00v17_82352_c1 | nmdc:mga00v17_82352_c1_549_1274 | 240 |
| 1027 | 3300050507 | nmdc:mga05p37_365168_c1 | nmdc:mga05p37_365168_c1_586_1308 | 240 |
| 1028 | 3300050507 | nmdc:mga05p37_66039_c1 | nmdc:mga05p37_66039_c1_3531_4256 | 240 |
| 1029 | 3300050507 | nmdc:mga05p37_906223_c1 | nmdc:mga05p37_906223_c1_189_914 | 240 |
| 1030 | 3300050508 | nmdc:mga09592_107029_c1 | nmdc:mga09592_107029_c1_1164_1892 | 240 |
| 1031 | 3300050508 | nmdc:mga09592_231857_c1 | nmdc:mga09592_231857_c1_323_1048 | 240 |
| 1032 | 3300050509 | nmdc:mga0qj67_16266_c1 | nmdc:mga0qj67_16266_c1_3083_3805 | 240 |
| 1033 | 3300050509 | nmdc:mga0qj67_2370_c1 | nmdc:mga0qj67_2370_c1_702_1427 | 240 |
| 1034 | 3300050510 | nmdc:mga06r32_15640_c1 | nmdc:mga06r32_15640_c1_1401_2126 | 240 |
| 1035 | 3300050510 | nmdc:mga06r32_169740_c1 | nmdc:mga06r32_169740_c1_261_983 | 240 |
| 1036 | 3300050510 | nmdc:mga06r32_23994_c1 | nmdc:mga06r32_23994_c1_4244_4969 | 240 |
| 1037 | 3300050510 | nmdc:mga06r32_600573_c1 | nmdc:mga06r32_600573_c1_232_954 | 240 |
| 1038 | 3300050511 | nmdc:mga08y16_26187_c1 | nmdc:mga08y16_26187_c1_352_1077 | 240 |
| 1039 | 3300050511 | nmdc:mga08y16_3451_c1 | nmdc:mga08y16_3451_c1_6618_7346 | 240 |
| 1040 | 3300053100 | Ga0500660_122220 | Ga0500660_122220_61_786 | 240 |
| 1041 | 3300053149 | Ga0500600_0065466 | Ga0500600_0065466_768_1493 | 240 |
| 1042 | 3300054114 | Ga0501084_0009802 | Ga0501084_0009802_6714_7439 | 240 |
| 1043 | 3300060353 | Ga0501082_0165170 | Ga0501082_0165170_683_1408 | 240 |
| 1044 | 3300061734 | Ga0530510_0058769 | Ga0530510_0058769_625_1350 | 240 |
| 1045 | iso_pu_bacteria | 2517572101 | 2517764419 | 240 |
| 1046 | iso_pu_bacteria | 8002784119 | 8002787800 | 240 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9719 | 3 | 228 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9634 | 3 | 228 |
| 5xu1-assembly1.cif.gz_A | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9588 | 3 | 225 |
| 1f3o-assembly1.cif.gz_A-2 | crystal structure of mj0796 atp-binding cassette | 0.9578 | 5 | 226 |
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9529 | 3 | 225 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pclA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9682 | 3 | 226 | 3.40.50.300 |
| af_P0A9T8_2_228_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.963 | 1 | 226 | 3.40.50.300 |
| 5xu1A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9588 | 3 | 225 | 3.40.50.300 |
| af_Q2G0D8_1_227_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.958 | 3 | 226 | 3.40.50.300 |
| af_Q2FVR1_1_221_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9559 | 5 | 223 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A346PK27-F1-model_v4 | ABC-type antimicrobial peptide transport system, ATPase component | 0.9755 | 3 | 228 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A7J3QCK0-F1-model_v4 | ABC transporter ATP-binding protein | 0.9731 | 29 | 228 |
GO:0005524
GO:0016887 |
| AF-A0A544YA04-F1-model_v4 | ABC transporter ATP-binding protein | 0.9724 | 2 | 225 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A7J0BSF2-F1-model_v4 | ABC transporter ATP-binding protein | 0.9715 | 2 | 228 |
GO:0005524
GO:0016887 |
| AF-A0A2T2QVM2-F1-model_v4 | Macrolide ABC transporter ATP-binding protein | 0.9692 | 3 | 229 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar