F488892
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1043 | 512 | 2084 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0008782|Ga0466969_0008782_3829_4521 |
| Length | 230 |
| Sequence | VTAAFDDQPSCQQRAGGYVTIPQISMPGLVTPRAAGDIGAGGLGDQVYNRLLNERIIFLGQQVDDDIANKITAQLLLLAADPEKDIFLYINSPGGSVTAGMAIYDTMQYIKNDVVTIAMGMAASMGQFLLTAGAKGKRFALPNAEILMHQPSAGLGGSATDIRIQAQQLVRMKHRMAELIAEHSGQTVDQITKDSDRDRWFTPIEAKEYGLIDNIMHSASDVPGGGGTGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 13 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 15 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 55 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 56 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 140 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 141 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 143 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 144 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 145 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 146 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 148 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 149 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 150 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 151 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 152 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 158 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 163 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 164 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 165 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 166 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 167 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 169 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 172 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 173 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 174 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 175 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 178 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 179 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 184 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 185 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 186 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 187 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 188 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 189 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 190 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 191 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 192 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 193 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 194 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 195 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 196 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 197 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 198 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 199 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 200 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 201 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 202 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 203 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 204 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 205 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 206 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 209 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 215 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 216 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 219 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 222 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 223 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 224 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 225 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 318 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 319 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 327 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 368 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 369 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 370 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 371 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 377 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 379 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 380 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 382 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 383 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 384 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 385 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 389 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 392 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 393 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 395 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 396 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 397 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 398 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 399 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 400 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 401 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 402 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 403 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 404 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 405 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 406 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 407 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 408 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 409 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 410 | 3300053152 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere | Metagenome | Endosphere |
| 411 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 412 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 413 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 414 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 415 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 416 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 418 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 425 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 426 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 427 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 428 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 429 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 430 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 431 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 432 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 433 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 434 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 435 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 436 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 437 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 438 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 439 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 440 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 441 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 442 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 443 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 444 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 445 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 446 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 447 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 448 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 449 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 450 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 451 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 452 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 453 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 454 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 455 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 456 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 457 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 458 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 459 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 460 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 461 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 462 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 463 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 464 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 465 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 466 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 467 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 468 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 469 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 470 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 471 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 472 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 473 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 474 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 475 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 476 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 477 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 478 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 479 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 480 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 481 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 482 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 483 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 484 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 485 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 486 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 487 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 488 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 489 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 490 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 491 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 492 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 493 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 494 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 495 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 496 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 497 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 498 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 499 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 500 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 501 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 502 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 503 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 504 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 505 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 506 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 507 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 508 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 509 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 510 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 511 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 512 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.48 |
| Metatranscriptomes | 5.08 |
| Isolates | 8.44 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.19 |
| Bulb | 0 |
| Endosphere | 10.35 |
| Nodule | 0.29 |
| Rhizoplane | 3.45 |
| Rhizosphere | 76.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466969_0008782 | 3300044656 | Bacteria | 5356 |
| 2 | LJQas_1005528 | 3300000549 | Bacteria | 1600 |
| 3 | JGI24739J22299_10072289 | 3300001989 | Bacteria | 1072 |
| 4 | JGI24737J22298_10009059 | 3300001990 | Bacteria | 3318 |
| 5 | JGI24737J22298_10013219 | 3300001990 | Bacteria | 2688 |
| 6 | JGI24735J21928_10012392 | 3300002067 | Bacteria | 2695 |
| 7 | JGI24750J21931_1005874 | 3300002070 | Bacteria | 1516 |
| 8 | JGI24738J21930_10004960 | 3300002075 | Bacteria | 3220 |
| 9 | JGI24738J21930_10006440 | 3300002075 | Bacteria | 2753 |
| 10 | JGI24744J21845_10000532 | 3300002077 | Bacteria | 6817 |
| 11 | rootH1_10012683 | 3300003316 | Bacteria | 1356 |
| 12 | rootH1_10012684 | 3300003316 | Bacteria | 3921 |
| 13 | rootH2_10073426 | 3300003320 | Bacteria | 5794 |
| 14 | rootH1_10019905 | 3300003323 | Bacteria | 2546 |
| 15 | rootH1_10051264 | 3300003323 | Bacteria | 1568 |
| 16 | Ga0006562J51391_1005843 | 3300003578 | Bacteria | 3210 |
| 17 | Ga0007429J51699_1017997 | 3300003579 | Bacteria | 1215 |
| 18 | Ga0058692_1045109 | 3300003856 | Bacteria | 753 |
| 19 | Ga0058862_10006434 | 3300004803 | Bacteria | 1079 |
| 20 | Ga0070676_10304244 | 3300005328 | Bacteria | 1082 |
| 21 | Ga0070683_100013995 | 3300005329 | Bacteria | 7006 |
| 22 | Ga0070683_100030501 | 3300005329 | Bacteria | 4896 |
| 23 | Ga0070682_100011595 | 3300005337 | Bacteria | 5040 |
| 24 | Ga0070682_100018717 | 3300005337 | Bacteria | 4053 |
| 25 | Ga0070682_100132210 | 3300005337 | Bacteria | 1690 |
| 26 | Ga0068868_100098699 | 3300005338 | Bacteria | 2361 |
| 27 | Ga0068868_100325806 | 3300005338 | Bacteria | 1310 |
| 28 | Ga0070660_100003302 | 3300005339 | Bacteria | 11087 |
| 29 | Ga0070687_100718738 | 3300005343 | Bacteria | 699 |
| 30 | Ga0070692_10020197 | 3300005345 | Bacteria | 3227 |
| 31 | Ga0070692_10020439 | 3300005345 | Bacteria | 3211 |
| 32 | Ga0070692_10201992 | 3300005345 | Bacteria | 1165 |
| 33 | Ga0070692_10225107 | 3300005345 | Bacteria | 1111 |
| 34 | Ga0070668_100116637 | 3300005347 | Bacteria | 2129 |
| 35 | Ga0070668_100262850 | 3300005347 | Bacteria | 1436 |
| 36 | Ga0070675_100182764 | 3300005354 | Bacteria | 1813 |
| 37 | Ga0070675_100374960 | 3300005354 | Bacteria | 1265 |
| 38 | Ga0070671_100548508 | 3300005355 | Bacteria | 997 |
| 39 | Ga0070674_100005174 | 3300005356 | Bacteria | 7496 |
| 40 | Ga0070674_100312722 | 3300005356 | Bacteria | 1256 |
| 41 | Ga0070659_100019106 | 3300005366 | Bacteria | 5184 |
| 42 | Ga0070659_100025275 | 3300005366 | Bacteria | 4558 |
| 43 | Ga0070659_100277939 | 3300005366 | Bacteria | 1393 |
| 44 | Ga0070659_100294972 | 3300005366 | Bacteria | 1351 |
| 45 | Ga0070667_100072949 | 3300005367 | Bacteria | 2926 |
| 46 | Ga0070667_100089384 | 3300005367 | Bacteria | 2646 |
| 47 | Ga0070667_101097476 | 3300005367 | Bacteria | 744 |
| 48 | Ga0070701_10094608 | 3300005438 | Bacteria | 1644 |
| 49 | Ga0070700_100002303 | 3300005441 | Bacteria | 9716 |
| 50 | Ga0070700_100020078 | 3300005441 | Bacteria | 3864 |
| 51 | Ga0070663_100114837 | 3300005455 | Bacteria | 2027 |
| 52 | Ga0070663_100685448 | 3300005455 | Bacteria | 870 |
| 53 | Ga0070678_100030699 | 3300005456 | Bacteria | 3697 |
| 54 | Ga0070678_100104615 | 3300005456 | Bacteria | 2202 |
| 55 | Ga0070678_100265797 | 3300005456 | Bacteria | 1445 |
| 56 | Ga0068867_100007389 | 3300005459 | Bacteria | 7773 |
| 57 | Ga0068867_100278653 | 3300005459 | Bacteria | 1370 |
| 58 | Ga0070685_10176701 | 3300005466 | Bacteria | 1371 |
| 59 | Ga0070707_100400259 | 3300005468 | Bacteria | 1333 |
| 60 | Ga0070698_100011005 | 3300005471 | Bacteria | 9624 |
| 61 | Ga0070679_100809901 | 3300005530 | Bacteria | 880 |
| 62 | Ga0070684_100004672 | 3300005535 | Bacteria | 10459 |
| 63 | Ga0070684_100063833 | 3300005535 | Bacteria | 3230 |
| 64 | Ga0070684_100468834 | 3300005535 | Bacteria | 1165 |
| 65 | Ga0068853_100096039 | 3300005539 | Bacteria | 2614 |
| 66 | Ga0068853_100137090 | 3300005539 | Bacteria | 2195 |
| 67 | Ga0070672_100570698 | 3300005543 | Bacteria | 984 |
| 68 | Ga0070665_100000868 | 3300005548 | Bacteria | 39125 |
| 69 | Ga0068855_100248717 | 3300005563 | Bacteria | 1984 |
| 70 | Ga0070664_100237931 | 3300005564 | Bacteria | 1634 |
| 71 | Ga0068857_100014013 | 3300005577 | Bacteria | 6976 |
| 72 | Ga0068856_100223417 | 3300005614 | Bacteria | 1899 |
| 73 | Ga0068856_100240491 | 3300005614 | Bacteria | 1826 |
| 74 | Ga0070702_100003489 | 3300005615 | Bacteria | 7037 |
| 75 | Ga0070702_100026047 | 3300005615 | Bacteria | 3139 |
| 76 | Ga0068852_100437444 | 3300005616 | Bacteria | 1292 |
| 77 | Ga0068852_100456722 | 3300005616 | Bacteria | 1265 |
| 78 | Ga0068861_100551188 | 3300005719 | Bacteria | 1051 |
| 79 | Ga0068870_10061537 | 3300005840 | Bacteria | 2018 |
| 80 | Ga0068863_100270128 | 3300005841 | Bacteria | 1646 |
| 81 | Ga0068860_100000388 | 3300005843 | Bacteria | 57678 |
| 82 | Ga0068860_100100623 | 3300005843 | Bacteria | 2758 |
| 83 | Ga0081539_10045162 | 3300005985 | Bacteria | 2537 |
| 84 | Ga0075365_10019907 | 3300006038 | Bacteria | 4152 |
| 85 | Ga0075365_10050313 | 3300006038 | Bacteria | 2748 |
| 86 | Ga0075365_10092348 | 3300006038 | Bacteria | 2064 |
| 87 | Ga0075365_10163191 | 3300006038 | Bacteria | 1553 |
| 88 | Ga0075365_10289099 | 3300006038 | Bacteria | 1153 |
| 89 | Ga0075368_10000847 | 3300006042 | Bacteria | 9471 |
| 90 | Ga0075368_10040813 | 3300006042 | Bacteria | 1822 |
| 91 | Ga0075363_100046286 | 3300006048 | Bacteria | 2307 |
| 92 | Ga0075363_100140083 | 3300006048 | Bacteria | 1361 |
| 93 | Ga0075363_100193838 | 3300006048 | Bacteria | 1159 |
| 94 | Ga0075364_10027506 | 3300006051 | Bacteria | 3633 |
| 95 | Ga0075364_10045314 | 3300006051 | Bacteria | 2862 |
| 96 | Ga0075364_10121077 | 3300006051 | Bacteria | 1751 |
| 97 | Ga0075364_10255386 | 3300006051 | Bacteria | 1191 |
| 98 | Ga0075364_10544477 | 3300006051 | Bacteria | 793 |
| 99 | Ga0075362_10004276 | 3300006177 | Bacteria | 5104 |
| 100 | Ga0075367_10000916 | 3300006178 | Bacteria | 11912 |
| 101 | Ga0075367_10037203 | 3300006178 | Bacteria | 2827 |
| 102 | Ga0075367_10051571 | 3300006178 | Bacteria | 2432 |
| 103 | Ga0075367_10180919 | 3300006178 | Bacteria | 1314 |
| 104 | Ga0075367_10298733 | 3300006178 | Bacteria | 1013 |
| 105 | Ga0075370_10024322 | 3300006353 | Bacteria | 3345 |
| 106 | Ga0075370_10033825 | 3300006353 | Bacteria | 2863 |
| 107 | Ga0075370_10078090 | 3300006353 | Bacteria | 1900 |
| 108 | Ga0075370_10094577 | 3300006353 | Bacteria | 1726 |
| 109 | Ga0075370_10110304 | 3300006353 | Bacteria | 1597 |
| 110 | Ga0075370_10150970 | 3300006353 | Bacteria | 1361 |
| 111 | Ga0075370_10299968 | 3300006353 | Bacteria | 955 |
| 112 | Ga0075428_100027812 | 3300006844 | Bacteria | 6256 |
| 113 | Ga0075434_101136693 | 3300006871 | Bacteria | 794 |
| 114 | Ga0068865_100004270 | 3300006881 | Bacteria | 8620 |
| 115 | Ga0068865_100285919 | 3300006881 | Bacteria | 1314 |
| 116 | Ga0105251_10026442 | 3300009011 | Bacteria | 2955 |
| 117 | Ga0105244_10186991 | 3300009036 | Bacteria | 980 |
| 118 | Ga0105250_10123393 | 3300009092 | Bacteria | 1066 |
| 119 | Ga0105245_10002262 | 3300009098 | Bacteria | 17436 |
| 120 | Ga0105245_10010146 | 3300009098 | Bacteria | 8202 |
| 121 | Ga0105245_10589429 | 3300009098 | Bacteria | 1137 |
| 122 | Ga0105245_10735571 | 3300009098 | Bacteria | 1022 |
| 123 | Ga0105247_10292301 | 3300009101 | Bacteria | 1127 |
| 124 | Ga0105243_10047697 | 3300009148 | Bacteria | 3374 |
| 125 | Ga0105243_10083958 | 3300009148 | Bacteria | 2607 |
| 126 | Ga0105243_10224256 | 3300009148 | Bacteria | 1663 |
| 127 | Ga0105242_11308610 | 3300009176 | Bacteria | 749 |
| 128 | Ga0105248_10190351 | 3300009177 | Bacteria | 2312 |
| 129 | Ga0105237_10071232 | 3300009545 | Bacteria | 3471 |
| 130 | Ga0105237_10655307 | 3300009545 | Bacteria | 1056 |
| 131 | Ga0105238_10807971 | 3300009551 | Bacteria | 954 |
| 132 | Ga0105249_10058933 | 3300009553 | Bacteria | 3521 |
| 133 | Ga0105239_10001318 | 3300010375 | Bacteria | 33415 |
| 134 | Ga0105239_10002798 | 3300010375 | Bacteria | 21821 |
| 135 | Ga0105246_10014826 | 3300011119 | Bacteria | 4909 |
| 136 | Ga0105246_10043532 | 3300011119 | Bacteria | 3047 |
| 137 | Ga0157369_10095838 | 3300013105 | Bacteria | 3165 |
| 138 | Ga0157369_10707971 | 3300013105 | Bacteria | 1037 |
| 139 | Ga0157374_10702417 | 3300013296 | Bacteria | 1024 |
| 140 | Ga0163162_10035603 | 3300013306 | Bacteria | 4960 |
| 141 | Ga0157372_10027521 | 3300013307 | Bacteria | 6194 |
| 142 | Ga0157372_10131496 | 3300013307 | Bacteria | 2880 |
| 143 | Ga0157375_11307411 | 3300013308 | Bacteria | 853 |
| 144 | Ga0163163_10129334 | 3300014325 | Bacteria | 2565 |
| 145 | Ga0163163_10160525 | 3300014325 | Bacteria | 2293 |
| 146 | Ga0163163_10365416 | 3300014325 | Bacteria | 1500 |
| 147 | Ga0157380_10005485 | 3300014326 | Bacteria | 8863 |
| 148 | Ga0182008_10016002 | 3300014497 | Bacteria | 3905 |
| 149 | Ga0157377_10026897 | 3300014745 | Bacteria | 3083 |
| 150 | Ga0157379_10040240 | 3300014968 | Bacteria | 4171 |
| 151 | Ga0157376_10216925 | 3300014969 | Bacteria | 1770 |
| 152 | Ga0157376_10356554 | 3300014969 | Bacteria | 1401 |
| 153 | Ga0182007_10001964 | 3300015262 | Bacteria | 10620 |
| 154 | Ga0183367_1006 | 3300015688 | Bacteria | 648044 |
| 155 | Ga0163161_10048837 | 3300017792 | Bacteria | 3056 |
| 156 | Ga0197907_10046109 | 3300020069 | Bacteria | 1203 |
| 157 | Ga0206351_10711097 | 3300020077 | Bacteria | 2906 |
| 158 | Ga0206350_10490934 | 3300020080 | Bacteria | 961 |
| 159 | Ga0206350_11446792 | 3300020080 | Bacteria | 855 |
| 160 | Ga0206350_11624171 | 3300020080 | Bacteria | 825 |
| 161 | Ga0154015_1288929 | 3300020610 | Bacteria | 2267 |
| 162 | Ga0213875_10025417 | 3300021388 | Bacteria | 2821 |
| 163 | Ga0224712_10104738 | 3300022467 | Bacteria | 1205 |
| 164 | Ga0209758_1003504 | 3300025297 | Bacteria | 14174 |
| 165 | Ga0207426_1003149 | 3300025302 | Bacteria | 9372 |
| 166 | Ga0207426_1016168 | 3300025302 | Bacteria | 2687 |
| 167 | Ga0209051_1091365 | 3300025303 | Bacteria | 846 |
| 168 | Ga0207713_1013108 | 3300025735 | Bacteria | 4390 |
| 169 | Ga0207688_10071323 | 3300025901 | Bacteria | 1972 |
| 170 | Ga0207688_10347469 | 3300025901 | Bacteria | 913 |
| 171 | Ga0207647_10010116 | 3300025904 | Bacteria | 6669 |
| 172 | Ga0207647_10011522 | 3300025904 | Bacteria | 6198 |
| 173 | Ga0207647_10059649 | 3300025904 | Bacteria | 2334 |
| 174 | Ga0207671_10087463 | 3300025914 | Bacteria | 2343 |
| 175 | Ga0207671_10127920 | 3300025914 | Bacteria | 1948 |
| 176 | Ga0207662_10079336 | 3300025918 | Bacteria | 2000 |
| 177 | Ga0207662_10379942 | 3300025918 | Bacteria | 954 |
| 178 | Ga0207657_10042184 | 3300025919 | Bacteria | 4027 |
| 179 | Ga0207646_10129704 | 3300025922 | Bacteria | 2269 |
| 180 | Ga0207694_10095551 | 3300025924 | Bacteria | 2350 |
| 181 | Ga0207650_10650748 | 3300025925 | Bacteria | 888 |
| 182 | Ga0207659_10187588 | 3300025926 | Bacteria | 1643 |
| 183 | Ga0207659_10315041 | 3300025926 | Bacteria | 1289 |
| 184 | Ga0207687_10010027 | 3300025927 | Bacteria | 6198 |
| 185 | Ga0207687_10146799 | 3300025927 | Bacteria | 1795 |
| 186 | Ga0207690_10014894 | 3300025932 | Bacteria | 4706 |
| 187 | Ga0207690_10036521 | 3300025932 | Bacteria | 3182 |
| 188 | Ga0207706_10165774 | 3300025933 | Bacteria | 1942 |
| 189 | Ga0207706_10294118 | 3300025933 | Bacteria | 1415 |
| 190 | Ga0207706_10490933 | 3300025933 | Bacteria | 1060 |
| 191 | Ga0207686_10220313 | 3300025934 | Bacteria | 1370 |
| 192 | Ga0207709_10005306 | 3300025935 | Bacteria | 7331 |
| 193 | Ga0207709_10068435 | 3300025935 | Bacteria | 2244 |
| 194 | Ga0207709_10506130 | 3300025935 | Bacteria | 943 |
| 195 | Ga0207669_10012594 | 3300025937 | Bacteria | 4164 |
| 196 | Ga0207669_10190593 | 3300025937 | Bacteria | 1479 |
| 197 | Ga0207691_10003002 | 3300025940 | Bacteria | 16471 |
| 198 | Ga0207691_10081757 | 3300025940 | Bacteria | 2903 |
| 199 | Ga0207711_10322118 | 3300025941 | Bacteria | 1428 |
| 200 | Ga0207689_10427852 | 3300025942 | Bacteria | 1105 |
| 201 | Ga0207689_10757743 | 3300025942 | Bacteria | 819 |
| 202 | Ga0207661_10005512 | 3300025944 | Bacteria | 8927 |
| 203 | Ga0207661_10203304 | 3300025944 | Bacteria | 1742 |
| 204 | Ga0207661_10764360 | 3300025944 | Bacteria | 889 |
| 205 | Ga0207651_10218246 | 3300025960 | Bacteria | 1540 |
| 206 | Ga0207651_11014393 | 3300025960 | Bacteria | 742 |
| 207 | Ga0207712_10097291 | 3300025961 | Bacteria | 2180 |
| 208 | Ga0207668_10340952 | 3300025972 | Bacteria | 1250 |
| 209 | Ga0207668_11185697 | 3300025972 | Bacteria | 686 |
| 210 | Ga0207658_10013451 | 3300025986 | Bacteria | 5590 |
| 211 | Ga0207658_10158162 | 3300025986 | Bacteria | 1854 |
| 212 | Ga0207677_10004641 | 3300026023 | Bacteria | 7397 |
| 213 | Ga0207677_10094319 | 3300026023 | Bacteria | 2184 |
| 214 | Ga0207703_10794898 | 3300026035 | Bacteria | 903 |
| 215 | Ga0207678_10127572 | 3300026067 | Bacteria | 2170 |
| 216 | Ga0207708_10001371 | 3300026075 | Bacteria | 18327 |
| 217 | Ga0207708_10095894 | 3300026075 | Bacteria | 2291 |
| 218 | Ga0207702_10126503 | 3300026078 | Bacteria | 2295 |
| 219 | Ga0207641_10805802 | 3300026088 | Bacteria | 929 |
| 220 | Ga0207648_10056730 | 3300026089 | Bacteria | 3417 |
| 221 | Ga0207648_10453504 | 3300026089 | Bacteria | 1168 |
| 222 | Ga0207674_10007577 | 3300026116 | Bacteria | 12649 |
| 223 | Ga0207674_10803636 | 3300026116 | Bacteria | 908 |
| 224 | Ga0207675_100007138 | 3300026118 | Bacteria | 10557 |
| 225 | Ga0207675_100089750 | 3300026118 | Bacteria | 2889 |
| 226 | Ga0207675_100118612 | 3300026118 | Bacteria | 2502 |
| 227 | Ga0207683_10052995 | 3300026121 | Bacteria | 3556 |
| 228 | Ga0207683_10093108 | 3300026121 | Bacteria | 2685 |
| 229 | Ga0207683_10121129 | 3300026121 | Bacteria | 2349 |
| 230 | Ga0207698_10019604 | 3300026142 | Bacteria | 4634 |
| 231 | Ga0207698_10044631 | 3300026142 | Bacteria | 3332 |
| 232 | Ga0209371_1009821 | 3300027312 | Bacteria | 3008 |
| 233 | Ga0209371_1023114 | 3300027312 | Bacteria | 1470 |
| 234 | Ga0209813_10000658 | 3300027866 | Bacteria | 7921 |
| 235 | Ga0209813_10005764 | 3300027866 | Bacteria | 3025 |
| 236 | Ga0209813_10050640 | 3300027866 | Bacteria | 1297 |
| 237 | Ga0207428_10241590 | 3300027907 | Bacteria | 1349 |
| 238 | Ga0268266_10001392 | 3300028379 | Bacteria | 28952 |
| 239 | Ga0268266_10081155 | 3300028379 | Bacteria | 2827 |
| 240 | Ga0268266_10121698 | 3300028379 | Bacteria | 2323 |
| 241 | Ga0268264_10000387 | 3300028381 | Bacteria | 63349 |
| 242 | Ga0307517_10003800 | 3300028786 | Bacteria | 23438 |
| 243 | Ga0307517_10007226 | 3300028786 | Bacteria | 16257 |
| 244 | Ga0307515_10002026 | 3300028794 | Bacteria | 44830 |
| 245 | Ga0268256_1010880 | 3300030500 | Bacteria | 2921 |
| 246 | Ga0307511_10001267 | 3300030521 | Bacteria | 26758 |
| 247 | Ga0307511_10082268 | 3300030521 | Bacteria | 2253 |
| 248 | Ga0307512_10013231 | 3300030522 | Bacteria | 7744 |
| 249 | Ga0316183_1192358 | 3300030742 | Bacteria | 1265 |
| 250 | Ga0316181_1029856 | 3300030744 | Bacteria | 1884 |
| 251 | Ga0265340_10036704 | 3300031247 | Bacteria | 2428 |
| 252 | Ga0307513_10210165 | 3300031456 | Bacteria | 1778 |
| 253 | Ga0307513_10312574 | 3300031456 | Bacteria | 1332 |
| 254 | Ga0307509_10121232 | 3300031507 | Bacteria | 2592 |
| 255 | Ga0307509_10131531 | 3300031507 | Bacteria | 2457 |
| 256 | Ga0307408_100320242 | 3300031548 | Bacteria | 1306 |
| 257 | Ga0307508_10021403 | 3300031616 | Bacteria | 5879 |
| 258 | Ga0307514_10078495 | 3300031649 | Bacteria | 2451 |
| 259 | Ga0307514_10114213 | 3300031649 | Bacteria | 1904 |
| 260 | Ga0307516_10059421 | 3300031730 | Bacteria | 3718 |
| 261 | Ga0307516_10096309 | 3300031730 | Bacteria | 2780 |
| 262 | Ga0307405_10231258 | 3300031731 | Bacteria | 1363 |
| 263 | Ga0307405_10816385 | 3300031731 | Bacteria | 782 |
| 264 | Ga0307413_10132629 | 3300031824 | Bacteria | 1708 |
| 265 | Ga0307413_10596728 | 3300031824 | Bacteria | 903 |
| 266 | Ga0307518_10126214 | 3300031838 | Bacteria | 1804 |
| 267 | Ga0307518_10176835 | 3300031838 | Bacteria | 1448 |
| 268 | Ga0307410_10094609 | 3300031852 | Bacteria | 2129 |
| 269 | Ga0307406_10080163 | 3300031901 | Bacteria | 2167 |
| 270 | Ga0307406_10300299 | 3300031901 | Bacteria | 1233 |
| 271 | Ga0307407_10020689 | 3300031903 | Bacteria | 3376 |
| 272 | Ga0307407_10102976 | 3300031903 | Bacteria | 1776 |
| 273 | Ga0307407_10142825 | 3300031903 | Bacteria | 1546 |
| 274 | Ga0307412_10050300 | 3300031911 | Bacteria | 2750 |
| 275 | Ga0307412_10067839 | 3300031911 | Bacteria | 2423 |
| 276 | Ga0307412_10166467 | 3300031911 | Bacteria | 1644 |
| 277 | Ga0307412_10284600 | 3300031911 | Bacteria | 1299 |
| 278 | Ga0307412_10768719 | 3300031911 | Bacteria | 833 |
| 279 | Ga0307409_100021958 | 3300031995 | Bacteria | 4389 |
| 280 | Ga0307409_100069450 | 3300031995 | Bacteria | 2791 |
| 281 | Ga0307409_100204584 | 3300031995 | Bacteria | 1769 |
| 282 | Ga0307409_100393645 | 3300031995 | Bacteria | 1321 |
| 283 | Ga0307409_100411779 | 3300031995 | Bacteria | 1294 |
| 284 | Ga0307409_100717134 | 3300031995 | Bacteria | 1001 |
| 285 | Ga0307409_100816992 | 3300031995 | Bacteria | 941 |
| 286 | Ga0307416_100068237 | 3300032002 | Bacteria | 2937 |
| 287 | Ga0307416_100105910 | 3300032002 | Bacteria | 2463 |
| 288 | Ga0307416_100284691 | 3300032002 | Bacteria | 1632 |
| 289 | Ga0307416_100539334 | 3300032002 | Bacteria | 1238 |
| 290 | Ga0307414_10361762 | 3300032004 | Bacteria | 1249 |
| 291 | Ga0307411_10466321 | 3300032005 | Bacteria | 1060 |
| 292 | Ga0307415_100293226 | 3300032126 | Bacteria | 1344 |
| 293 | Ga0307415_100314316 | 3300032126 | Bacteria | 1303 |
| 294 | Ga0307415_100353041 | 3300032126 | Bacteria | 1238 |
| 295 | Ga0307507_10067643 | 3300033179 | Bacteria | 3265 |
| 296 | Ga0307510_10200261 | 3300033180 | Bacteria | 1532 |
| 297 | Ga0307510_10215164 | 3300033180 | Bacteria | 1439 |
| 298 | Ga0373928_0045395 | 3300035084 | Bacteria | 1023 |
| 299 | Ga0373952_0030824 | 3300035092 | Bacteria | 1190 |
| 300 | Ga0395899_0203417 | 3300037312 | Bacteria | 1379 |
| 301 | Ga0395899_0258850 | 3300037312 | Bacteria | 1191 |
| 302 | Ga0395898_0029023 | 3300037466 | Bacteria | 5543 |
| 303 | Ga0395898_0059562 | 3300037466 | Bacteria | 3713 |
| 304 | Ga0395905_0012411 | 3300037471 | Bacteria | 8201 |
| 305 | Ga0395905_0057280 | 3300037471 | Bacteria | 3646 |
| 306 | Ga0395905_0216579 | 3300037471 | Bacteria | 1793 |
| 307 | Ga0395905_0451928 | 3300037471 | Bacteria | 1183 |
| 308 | Ga0395905_0761137 | 3300037471 | Bacteria | 871 |
| 309 | Ga0436364_0961922 | 3300037853 | Bacteria | 760 |
| 310 | Ga0436364_1191885 | 3300037853 | Bacteria | 734 |
| 311 | Ga0436364_1267828 | 3300037853 | Bacteria | 8283 |
| 312 | Ga0436364_1376765 | 3300037853 | Bacteria | 741 |
| 313 | Ga0395901_0034440 | 3300038443 | Bacteria | 5230 |
| 314 | Ga0395901_0081403 | 3300038443 | Bacteria | 3382 |
| 315 | Ga0395901_0083782 | 3300038443 | Bacteria | 3333 |
| 316 | Ga0395901_0140674 | 3300038443 | Bacteria | 2536 |
| 317 | Ga0395901_0930851 | 3300038443 | Bacteria | 849 |
| 318 | Ga0242420_004572 | 3300038996 | Bacteria | 2099 |
| 319 | Ga0400483_018528 | 3300039062 | Bacteria | 3832 |
| 320 | Ga0400483_023161 | 3300039062 | Bacteria | 3323 |
| 321 | Ga0400483_076896 | 3300039062 | Bacteria | 54063 |
| 322 | Ga0400483_103660 | 3300039062 | Bacteria | 17083 |
| 323 | Ga0400483_198923 | 3300039062 | Bacteria | 2222 |
| 324 | Ga0400483_204522 | 3300039062 | Bacteria | 44473 |
| 325 | Ga0400483_248013 | 3300039062 | Bacteria | 2072 |
| 326 | Ga0400483_254236 | 3300039062 | Bacteria | 8575 |
| 327 | Ga0436365_0096389 | 3300039437 | Bacteria | 1009 |
| 328 | Ga0436365_1477850 | 3300039437 | Bacteria | 859 |
| 329 | Ga0439436_0005153 | 3300041404 | Bacteria | 4007 |
| 330 | Ga0439465_0080308 | 3300041413 | Bacteria | 1105 |
| 331 | Ga0451789_0623635 | 3300041443 | Bacteria | 681 |
| 332 | Ga0451797_1306219 | 3300041453 | Bacteria | 840 |
| 333 | Ga0451795_0427087 | 3300041456 | Bacteria | 926 |
| 334 | Ga0451798_1153288 | 3300041458 | Bacteria | 744 |
| 335 | Ga0451841_0903274 | 3300041498 | Bacteria | 996 |
| 336 | Ga0451847_0525880 | 3300041503 | Bacteria | 1213 |
| 337 | Ga0451843_1108888 | 3300041509 | Bacteria | 1223 |
| 338 | Ga0451853_0989324 | 3300041512 | Bacteria | 1906 |
| 339 | Ga0451853_1505240 | 3300041512 | Bacteria | 1760 |
| 340 | Ga0451853_1770887 | 3300041512 | Bacteria | 7057 |
| 341 | Ga0439431_0003253 | 3300041997 | Bacteria | 3574 |
| 342 | Ga0439433_0003818 | 3300041999 | Bacteria | 3239 |
| 343 | Ga0439442_010904 | 3300042002 | Bacteria | 1846 |
| 344 | Ga0439442_037697 | 3300042002 | Bacteria | 1013 |
| 345 | Ga0439448_0003369 | 3300042005 | Bacteria | 4427 |
| 346 | Ga0439448_0029859 | 3300042005 | Bacteria | 1727 |
| 347 | Ga0439432_067955 | 3300042006 | Bacteria | 1090 |
| 348 | Ga0439449_0009834 | 3300042007 | Bacteria | 3619 |
| 349 | Ga0439455_0005439 | 3300042012 | Bacteria | 2588 |
| 350 | Ga0439457_005336 | 3300042014 | Bacteria | 3247 |
| 351 | Ga0439462_0057931 | 3300042015 | Bacteria | 1047 |
| 352 | Ga0450890_018387 | 3300042127 | Bacteria | 935 |
| 353 | Ga0450897_016869 | 3300042128 | Bacteria | 756 |
| 354 | Ga0450895_009203 | 3300042132 | Bacteria | 834 |
| 355 | Ga0450896_019611 | 3300042133 | Bacteria | 985 |
| 356 | Ga0450898_015127 | 3300042134 | Bacteria | 1304 |
| 357 | Ga0450899_001701 | 3300042135 | Bacteria | 2433 |
| 358 | Ga0450900_021765 | 3300042136 | Bacteria | 897 |
| 359 | Ga0450903_000064 | 3300042138 | Bacteria | 21230 |
| 360 | Ga0450904_014518 | 3300042139 | Bacteria | 786 |
| 361 | Ga0450906_001453 | 3300042145 | Bacteria | 5158 |
| 362 | Ga0450907_017642 | 3300042146 | Bacteria | 1191 |
| 363 | Ga0439458_0002342 | 3300042157 | Bacteria | 4647 |
| 364 | Ga0439434_0014704 | 3300042435 | Bacteria | 2329 |
| 365 | Ga0451577_0052176 | 3300042876 | Bacteria | 3651 |
| 366 | Ga0466969_0004974 | 3300044656 | Bacteria | 7078 |
| 367 | Ga0466969_0035054 | 3300044656 | Bacteria | 2540 |
| 368 | Ga0466969_0056306 | 3300044656 | Bacteria | 1920 |
| 369 | Ga0466969_0061669 | 3300044656 | Bacteria | 1821 |
| 370 | Ga0466972_0006814 | 3300044658 | Bacteria | 5734 |
| 371 | Ga0466972_0007313 | 3300044658 | Bacteria | 5542 |
| 372 | Ga0466972_0020389 | 3300044658 | Bacteria | 3313 |
| 373 | Ga0466972_0068328 | 3300044658 | Bacteria | 1697 |
| 374 | Ga0466972_0070849 | 3300044658 | Bacteria | 1663 |
| 375 | Ga0466972_0072263 | 3300044658 | Bacteria | 1645 |
| 376 | Ga0466972_0133857 | 3300044658 | Bacteria | 1167 |
| 377 | Ga0466972_0150263 | 3300044658 | Bacteria | 1095 |
| 378 | Ga0466965_0000715 | 3300044683 | Bacteria | 12381 |
| 379 | Ga0466965_0004463 | 3300044683 | Bacteria | 6225 |
| 380 | Ga0466965_0014544 | 3300044683 | Bacteria | 3726 |
| 381 | Ga0466965_0036099 | 3300044683 | Bacteria | 2424 |
| 382 | Ga0466965_0047301 | 3300044683 | Bacteria | 2130 |
| 383 | Ga0466965_0083675 | 3300044683 | Bacteria | 1615 |
| 384 | Ga0466965_0118354 | 3300044683 | Bacteria | 1366 |
| 385 | Ga0466965_0223760 | 3300044683 | Bacteria | 1003 |
| 386 | Ga0466965_0254302 | 3300044683 | Bacteria | 943 |
| 387 | Ga0466965_0256161 | 3300044683 | Bacteria | 940 |
| 388 | Ga0466966_0023182 | 3300044684 | Bacteria | 4065 |
| 389 | Ga0466966_0043589 | 3300044684 | Bacteria | 2875 |
| 390 | Ga0466966_0059232 | 3300044684 | Bacteria | 2418 |
| 391 | Ga0466966_0096465 | 3300044684 | Bacteria | 1831 |
| 392 | Ga0466966_0120796 | 3300044684 | Bacteria | 1609 |
| 393 | Ga0466966_0164873 | 3300044684 | Bacteria | 1348 |
| 394 | Ga0466966_0329001 | 3300044684 | Bacteria | 918 |
| 395 | Ga0466961_0005346 | 3300044693 | Bacteria | 8083 |
| 396 | Ga0466961_0021513 | 3300044693 | Bacteria | 4151 |
| 397 | Ga0466961_0023802 | 3300044693 | Bacteria | 3941 |
| 398 | Ga0466961_0045577 | 3300044693 | Bacteria | 2806 |
| 399 | Ga0466961_0045889 | 3300044693 | Bacteria | 2795 |
| 400 | Ga0466961_0059876 | 3300044693 | Bacteria | 2421 |
| 401 | Ga0466961_0072868 | 3300044693 | Bacteria | 2178 |
| 402 | Ga0466961_0121598 | 3300044693 | Bacteria | 1639 |
| 403 | Ga0466961_0175550 | 3300044693 | Bacteria | 1331 |
| 404 | Ga0466961_0290667 | 3300044693 | Bacteria | 999 |
| 405 | Ga0466961_0369938 | 3300044693 | Bacteria | 871 |
| 406 | Ga0466963_0004247 | 3300044694 | Bacteria | 8311 |
| 407 | Ga0466963_0031776 | 3300044694 | Bacteria | 3414 |
| 408 | Ga0466963_0167953 | 3300044694 | Bacteria | 1528 |
| 409 | Ga0466963_0474135 | 3300044694 | Bacteria | 883 |
| 410 | Ga0466964_0007480 | 3300044706 | Bacteria | 4088 |
| 411 | Ga0466964_0012185 | 3300044706 | Bacteria | 3252 |
| 412 | Ga0466964_0040086 | 3300044706 | Bacteria | 1890 |
| 413 | Ga0466964_0314419 | 3300044706 | Bacteria | 794 |
| 414 | Ga0453684_0074082 | 3300044712 | Bacteria | 4289 |
| 415 | Ga0466971_0001330 | 3300044719 | Bacteria | 10335 |
| 416 | Ga0466971_0006890 | 3300044719 | Bacteria | 4939 |
| 417 | Ga0466971_0018948 | 3300044719 | Bacteria | 3052 |
| 418 | Ga0466971_0023338 | 3300044719 | Bacteria | 2757 |
| 419 | Ga0466971_0196136 | 3300044719 | Bacteria | 952 |
| 420 | Ga0466968_0063490 | 3300044735 | Bacteria | 1596 |
| 421 | Ga0466970_0011013 | 3300044765 | Bacteria | 4602 |
| 422 | Ga0466970_0022923 | 3300044765 | Bacteria | 3257 |
| 423 | Ga0466970_0031983 | 3300044765 | Bacteria | 2780 |
| 424 | Ga0466970_0039169 | 3300044765 | Bacteria | 2515 |
| 425 | Ga0466970_0055806 | 3300044765 | Bacteria | 2110 |
| 426 | Ga0466970_0062138 | 3300044765 | Bacteria | 2002 |
| 427 | Ga0466970_0067473 | 3300044765 | Bacteria | 1921 |
| 428 | Ga0466970_0073299 | 3300044765 | Bacteria | 1842 |
| 429 | Ga0466970_0184461 | 3300044765 | Bacteria | 1158 |
| 430 | Ga0466970_0246910 | 3300044765 | Bacteria | 999 |
| 431 | Ga0466970_0370736 | 3300044765 | Bacteria | 814 |
| 432 | Ga0466957_0002267 | 3300044842 | Bacteria | 10304 |
| 433 | Ga0466957_0004703 | 3300044842 | Bacteria | 7638 |
| 434 | Ga0466957_0012592 | 3300044842 | Bacteria | 4897 |
| 435 | Ga0466957_0099303 | 3300044842 | Bacteria | 1833 |
| 436 | Ga0466960_0006811 | 3300044901 | Bacteria | 4604 |
| 437 | Ga0466960_0010425 | 3300044901 | Bacteria | 3861 |
| 438 | Ga0466960_0015766 | 3300044901 | Bacteria | 3264 |
| 439 | Ga0466960_0023436 | 3300044901 | Bacteria | 2771 |
| 440 | Ga0466960_0030358 | 3300044901 | Bacteria | 2486 |
| 441 | Ga0466960_0050125 | 3300044901 | Bacteria | 2012 |
| 442 | Ga0466960_0186744 | 3300044901 | Bacteria | 1126 |
| 443 | Ga0466960_0492422 | 3300044901 | Bacteria | 717 |
| 444 | Ga0466960_0500207 | 3300044901 | Bacteria | 712 |
| 445 | Ga0466959_0005786 | 3300045049 | Bacteria | 8516 |
| 446 | Ga0466959_0026569 | 3300045049 | Bacteria | 4290 |
| 447 | Ga0466959_0034787 | 3300045049 | Bacteria | 3726 |
| 448 | Ga0466959_0038841 | 3300045049 | Bacteria | 3517 |
| 449 | Ga0466959_0274011 | 3300045049 | Bacteria | 1159 |
| 450 | Ga0466958_0016938 | 3300045836 | Bacteria | 4204 |
| 451 | Ga0466958_0058011 | 3300045836 | Bacteria | 2353 |
| 452 | Ga0466958_0201850 | 3300045836 | Bacteria | 1265 |
| 453 | Ga0466958_0597288 | 3300045836 | Bacteria | 718 |
| 454 | Ga0466967_0028650 | 3300045976 | Bacteria | 4652 |
| 455 | Ga0466967_0036868 | 3300045976 | Bacteria | 4178 |
| 456 | Ga0466967_0063164 | 3300045976 | Bacteria | 3289 |
| 457 | Ga0466967_0066702 | 3300045976 | Bacteria | 3207 |
| 458 | Ga0466967_0118561 | 3300045976 | Bacteria | 2441 |
| 459 | Ga0466967_0123701 | 3300045976 | Bacteria | 2393 |
| 460 | Ga0466967_0194204 | 3300045976 | Bacteria | 1920 |
| 461 | Ga0466967_0265494 | 3300045976 | Bacteria | 1643 |
| 462 | Ga0466967_0307852 | 3300045976 | Bacteria | 1525 |
| 463 | Ga0466967_0568035 | 3300045976 | Bacteria | 1117 |
| 464 | Ga0466967_0650376 | 3300045976 | Bacteria | 1042 |
| 465 | Ga0466967_0653931 | 3300045976 | Bacteria | 1039 |
| 466 | Ga0466967_0655677 | 3300045976 | Bacteria | 1038 |
| 467 | Ga0466967_1191049 | 3300045976 | Bacteria | 759 |
| 468 | Ga0466967_1254526 | 3300045976 | Bacteria | 738 |
| 469 | Ga0495617_006503 | 3300046452 | Bacteria | 4092 |
| 470 | Ga0495592_0003095 | 3300046454 | Bacteria | 11879 |
| 471 | Ga0495592_0019854 | 3300046454 | Bacteria | 5109 |
| 472 | Ga0495592_0025032 | 3300046454 | Bacteria | 4533 |
| 473 | Ga0495603_0078604 | 3300046455 | Bacteria | 1934 |
| 474 | Ga0495590_0127995 | 3300046457 | Bacteria | 912 |
| 475 | Ga0495629_0005989 | 3300046459 | Bacteria | 9044 |
| 476 | Ga0495629_0078762 | 3300046459 | Bacteria | 2300 |
| 477 | Ga0495629_0331774 | 3300046459 | Bacteria | 1039 |
| 478 | Ga0495629_0336737 | 3300046459 | Bacteria | 1030 |
| 479 | Ga0495638_0021796 | 3300046460 | Bacteria | 4213 |
| 480 | Ga0495638_0056550 | 3300046460 | Bacteria | 2434 |
| 481 | Ga0495641_0086934 | 3300046461 | Bacteria | 1399 |
| 482 | Ga0495651_0005161 | 3300046462 | Bacteria | 9958 |
| 483 | Ga0495651_0034606 | 3300046462 | Bacteria | 3937 |
| 484 | Ga0495651_0092796 | 3300046462 | Bacteria | 2261 |
| 485 | Ga0495653_0003422 | 3300046463 | Bacteria | 12760 |
| 486 | Ga0495580_0008997 | 3300046472 | Bacteria | 7885 |
| 487 | Ga0495605_0001675 | 3300046474 | Bacteria | 14245 |
| 488 | Ga0495639_0058635 | 3300046475 | Bacteria | 1761 |
| 489 | Ga0495662_0004562 | 3300046476 | Bacteria | 6947 |
| 490 | Ga0495664_0005608 | 3300046477 | Bacteria | 6904 |
| 491 | Ga0495664_0067176 | 3300046477 | Bacteria | 2139 |
| 492 | Ga0495664_0302484 | 3300046477 | Bacteria | 965 |
| 493 | Ga0495585_0008236 | 3300046492 | Bacteria | 6329 |
| 494 | Ga0495585_0208841 | 3300046492 | Bacteria | 990 |
| 495 | Ga0495594_0053781 | 3300046499 | Bacteria | 2218 |
| 496 | Ga0495594_0209768 | 3300046499 | Bacteria | 1110 |
| 497 | Ga0495596_0099536 | 3300046500 | Bacteria | 1129 |
| 498 | Ga0495596_0112765 | 3300046500 | Bacteria | 1056 |
| 499 | Ga0495607_0325929 | 3300046501 | Bacteria | 715 |
| 500 | Ga0495583_0094465 | 3300046506 | Bacteria | 1283 |
| 501 | Ga0495606_0001850 | 3300046507 | Bacteria | 26642 |
| 502 | Ga0495608_0004003 | 3300046511 | Bacteria | 10578 |
| 503 | Ga0495610_0015548 | 3300046512 | Bacteria | 4417 |
| 504 | Ga0495616_0005137 | 3300046513 | Bacteria | 8123 |
| 505 | Ga0495618_0038161 | 3300046514 | Bacteria | 3018 |
| 506 | Ga0495618_0110900 | 3300046514 | Bacteria | 1756 |
| 507 | Ga0495620_0071042 | 3300046515 | Bacteria | 1424 |
| 508 | Ga0495628_0010442 | 3300046516 | Bacteria | 7886 |
| 509 | Ga0495628_0052747 | 3300046516 | Bacteria | 3212 |
| 510 | Ga0495630_0003722 | 3300046517 | Bacteria | 10632 |
| 511 | Ga0495630_0259623 | 3300046517 | Bacteria | 1327 |
| 512 | Ga0495631_0022038 | 3300046518 | Bacteria | 2962 |
| 513 | Ga0495632_0166013 | 3300046519 | Bacteria | 1015 |
| 514 | Ga0495643_0014861 | 3300046522 | Bacteria | 4620 |
| 515 | Ga0495643_0016786 | 3300046522 | Bacteria | 4296 |
| 516 | Ga0495648_0063869 | 3300046524 | Bacteria | 2171 |
| 517 | Ga0495666_0002064 | 3300046526 | Bacteria | 9944 |
| 518 | Ga0495666_0045916 | 3300046526 | Bacteria | 2106 |
| 519 | Ga0495642_0297082 | 3300046528 | Bacteria | 707 |
| 520 | Ga0495652_0034123 | 3300046529 | Bacteria | 4436 |
| 521 | Ga0495654_0006973 | 3300046530 | Bacteria | 6365 |
| 522 | Ga0495665_0000429 | 3300046531 | Bacteria | 21413 |
| 523 | Ga0495640_0002937 | 3300046533 | Bacteria | 13724 |
| 524 | Ga0495640_0003552 | 3300046533 | Bacteria | 12522 |
| 525 | Ga0495640_0010149 | 3300046533 | Bacteria | 7299 |
| 526 | Ga0495609_0133817 | 3300046538 | Bacteria | 1060 |
| 527 | Ga0495597_0070764 | 3300046542 | Bacteria | 1503 |
| 528 | Ga0495645_0013370 | 3300046543 | Bacteria | 5800 |
| 529 | Ga0495645_0168249 | 3300046543 | Bacteria | 1510 |
| 530 | Ga0495633_0012373 | 3300046558 | Bacteria | 4542 |
| 531 | Ga0495633_0047313 | 3300046558 | Bacteria | 2033 |
| 532 | Ga0495667_0239208 | 3300046559 | Bacteria | 1157 |
| 533 | Ga0495656_0149364 | 3300046615 | Bacteria | 1127 |
| 534 | Ga0495668_0010309 | 3300046616 | Bacteria | 5663 |
| 535 | Ga0495634_0006662 | 3300046642 | Bacteria | 8759 |
| 536 | Ga0495634_0019788 | 3300046642 | Bacteria | 4778 |
| 537 | Ga0495611_0159762 | 3300046648 | Bacteria | 1053 |
| 538 | Ga0495625_0004464 | 3300046660 | Bacteria | 13220 |
| 539 | Ga0495625_0020688 | 3300046660 | Bacteria | 5072 |
| 540 | Ga0495661_0021798 | 3300046665 | Bacteria | 4171 |
| 541 | Ga0495588_0001032 | 3300046674 | Bacteria | 12113 |
| 542 | Ga0495657_0016668 | 3300046675 | Bacteria | 5347 |
| 543 | Ga0495657_0042216 | 3300046675 | Bacteria | 3115 |
| 544 | Ga0495657_0172428 | 3300046675 | Bacteria | 1331 |
| 545 | Ga0495599_0014736 | 3300046678 | Bacteria | 4840 |
| 546 | Ga0495599_0262545 | 3300046678 | Bacteria | 1049 |
| 547 | Ga0495623_0016899 | 3300046679 | Bacteria | 4712 |
| 548 | Ga0495623_0072393 | 3300046679 | Bacteria | 2143 |
| 549 | Ga0495646_0008076 | 3300046680 | Bacteria | 6688 |
| 550 | Ga0495658_0026150 | 3300046683 | Bacteria | 3125 |
| 551 | Ga0495613_0019423 | 3300046689 | Bacteria | 5063 |
| 552 | Ga0495613_0036762 | 3300046689 | Bacteria | 3631 |
| 553 | Ga0495613_0308573 | 3300046689 | Bacteria | 1094 |
| 554 | Ga0495624_0050354 | 3300046690 | Bacteria | 2639 |
| 555 | Ga0495624_0112449 | 3300046690 | Bacteria | 1674 |
| 556 | Ga0495670_0003415 | 3300046691 | Bacteria | 7804 |
| 557 | Ga0495670_0079092 | 3300046691 | Bacteria | 1673 |
| 558 | Ga0495671_0003551 | 3300046692 | Bacteria | 9530 |
| 559 | Ga0495649_0188997 | 3300046694 | Bacteria | 1072 |
| 560 | Ga0495649_0228648 | 3300046694 | Bacteria | 960 |
| 561 | Ga0495649_0260465 | 3300046694 | Bacteria | 889 |
| 562 | Ga0495589_0074225 | 3300046794 | Bacteria | 1659 |
| 563 | Ga0495589_0136992 | 3300046794 | Bacteria | 1173 |
| 564 | Ga0495600_0015742 | 3300046809 | Bacteria | 4788 |
| 565 | Ga0495600_0036788 | 3300046809 | Bacteria | 3181 |
| 566 | Ga0495600_0134806 | 3300046809 | Bacteria | 1604 |
| 567 | Ga0495660_0029459 | 3300046810 | Bacteria | 3096 |
| 568 | Ga0495581_0073414 | 3300047315 | Bacteria | 1979 |
| 569 | Ga0495581_0218547 | 3300047315 | Bacteria | 1114 |
| 570 | Ga0495604_0001544 | 3300047317 | Bacteria | 18967 |
| 571 | Ga0495604_0017669 | 3300047317 | Bacteria | 5708 |
| 572 | Ga0495604_0020517 | 3300047317 | Bacteria | 5278 |
| 573 | Ga0495604_0038660 | 3300047317 | Bacteria | 3753 |
| 574 | Ga0495674_0097685 | 3300047319 | Bacteria | 2501 |
| 575 | Ga0495674_0100020 | 3300047319 | Bacteria | 2468 |
| 576 | Ga0495672_0100087 | 3300047320 | Bacteria | 1574 |
| 577 | Ga0495676_0004653 | 3300047321 | Bacteria | 12570 |
| 578 | Ga0495676_0091066 | 3300047321 | Bacteria | 2280 |
| 579 | Ga0495676_0480568 | 3300047321 | Bacteria | 817 |
| 580 | Ga0495680_0005653 | 3300047322 | Bacteria | 11711 |
| 581 | Ga0495683_0015695 | 3300047323 | Bacteria | 3934 |
| 582 | Ga0495687_013209 | 3300047443 | Bacteria | 4322 |
| 583 | Ga0495687_019086 | 3300047443 | Bacteria | 3373 |
| 584 | Ga0495687_034585 | 3300047443 | Bacteria | 2281 |
| 585 | Ga0495675_0030475 | 3300047444 | Bacteria | 3441 |
| 586 | Ga0495675_0108650 | 3300047444 | Bacteria | 1732 |
| 587 | Ga0495675_0128999 | 3300047444 | Bacteria | 1572 |
| 588 | Ga0495675_0136995 | 3300047444 | Bacteria | 1519 |
| 589 | Ga0495677_0094431 | 3300047445 | Bacteria | 1129 |
| 590 | Ga0495685_000208 | 3300047447 | Bacteria | 19755 |
| 591 | Ga0495685_068751 | 3300047447 | Bacteria | 1188 |
| 592 | Ga0495681_0001401 | 3300047470 | Bacteria | 18150 |
| 593 | Ga0495681_0005767 | 3300047470 | Bacteria | 8234 |
| 594 | Ga0495681_0082040 | 3300047470 | Bacteria | 1437 |
| 595 | Ga0495684_0011563 | 3300047471 | Bacteria | 6816 |
| 596 | Ga0495684_0316267 | 3300047471 | Bacteria | 1117 |
| 597 | Ga0495686_0019900 | 3300047472 | Bacteria | 4479 |
| 598 | Ga0495686_0067948 | 3300047472 | Bacteria | 2199 |
| 599 | Ga0495686_0068230 | 3300047472 | Bacteria | 2194 |
| 600 | Ga0495593_0025215 | 3300047673 | Bacteria | 3291 |
| 601 | Ga0495602_0004329 | 3300048088 | Bacteria | 14797 |
| 602 | Ga0495602_0186885 | 3300048088 | Bacteria | 1592 |
| 603 | Ga0495614_0021191 | 3300048089 | Bacteria | 2808 |
| 604 | Ga0495614_0061593 | 3300048089 | Bacteria | 1612 |
| 605 | Ga0495626_0009338 | 3300048091 | Bacteria | 5305 |
| 606 | Ga0496100_0557620 | 3300048903 | Bacteria | 887 |
| 607 | Ga0496101_0007043 | 3300048904 | Bacteria | 7267 |
| 608 | Ga0496102_0059503 | 3300048905 | Bacteria | 3493 |
| 609 | Ga0496102_0073936 | 3300048905 | Bacteria | 3132 |
| 610 | Ga0496103_0017558 | 3300048906 | Bacteria | 4283 |
| 611 | Ga0496103_0030095 | 3300048906 | Bacteria | 3302 |
| 612 | Ga0496104_0214482 | 3300048907 | Bacteria | 1837 |
| 613 | Ga0496106_0076410 | 3300048909 | Bacteria | 2567 |
| 614 | Ga0496106_0202027 | 3300048909 | Bacteria | 1582 |
| 615 | Ga0496106_0367620 | 3300048909 | Bacteria | 1156 |
| 616 | Ga0496107_0089094 | 3300048910 | Bacteria | 2253 |
| 617 | Ga0496107_0257936 | 3300048910 | Bacteria | 1297 |
| 618 | Ga0496108_0020531 | 3300048911 | Bacteria | 5429 |
| 619 | Ga0496108_0027320 | 3300048911 | Bacteria | 4711 |
| 620 | Ga0496108_0116181 | 3300048911 | Bacteria | 2292 |
| 621 | Ga0496108_0151100 | 3300048911 | Bacteria | 2004 |
| 622 | Ga0496108_0545715 | 3300048911 | Bacteria | 1011 |
| 623 | Ga0496109_0018653 | 3300048912 | Bacteria | 6097 |
| 624 | Ga0496109_0214887 | 3300048912 | Bacteria | 1808 |
| 625 | Ga0496109_0427587 | 3300048912 | Bacteria | 1251 |
| 626 | Ga0496109_0594830 | 3300048912 | Bacteria | 1042 |
| 627 | Ga0496110_0023038 | 3300048913 | Bacteria | 5295 |
| 628 | Ga0496110_0070304 | 3300048913 | Bacteria | 3101 |
| 629 | Ga0496110_0150551 | 3300048913 | Bacteria | 2107 |
| 630 | Ga0496110_0195849 | 3300048913 | Bacteria | 1835 |
| 631 | Ga0496111_0004558 | 3300048914 | Bacteria | 8771 |
| 632 | Ga0496111_0092364 | 3300048914 | Bacteria | 2218 |
| 633 | Ga0496111_0176670 | 3300048914 | Bacteria | 1587 |
| 634 | Ga0496111_0415429 | 3300048914 | Bacteria | 994 |
| 635 | Ga0496111_0547580 | 3300048914 | Bacteria | 850 |
| 636 | Ga0496112_0700030 | 3300048915 | Bacteria | 941 |
| 637 | Ga0496114_0238270 | 3300048917 | Bacteria | 1599 |
| 638 | Ga0496124_0185713 | 3300048927 | Bacteria | 1596 |
| 639 | Ga0496124_0223077 | 3300048927 | Bacteria | 1416 |
| 640 | Ga0501306_007606 | 3300049127 | Bacteria | 1301 |
| 641 | Ga0501306_024658 | 3300049127 | Bacteria | 861 |
| 642 | Ga0501308_002154 | 3300049128 | Bacteria | 1693 |
| 643 | Ga0501308_027399 | 3300049128 | Bacteria | 748 |
| 644 | Ga0501309_006033 | 3300049129 | Bacteria | 1464 |
| 645 | Ga0501309_007585 | 3300049129 | Bacteria | 1348 |
| 646 | Ga0501309_016816 | 3300049129 | Bacteria | 1000 |
| 647 | Ga0501304_005879 | 3300049160 | Bacteria | 974 |
| 648 | Ga0501305_006624 | 3300049161 | Bacteria | 1444 |
| 649 | Ga0495678_019451 | 3300049459 | Bacteria | 3028 |
| 650 | Ga0495682_0012223 | 3300049460 | Bacteria | 3294 |
| 651 | Ga0501298_045347 | 3300049521 | Bacteria | 900 |
| 652 | Ga0501311_001743 | 3300049527 | Bacteria | 1967 |
| 653 | Ga0501311_007004 | 3300049527 | Bacteria | 1287 |
| 654 | Ga0501312_015254 | 3300049528 | Bacteria | 1088 |
| 655 | Ga0501313_030107 | 3300049529 | Bacteria | 701 |
| 656 | Ga0501313_034065 | 3300049529 | Bacteria | 668 |
| 657 | Ga0501315_005062 | 3300049531 | Bacteria | 1410 |
| 658 | Ga0501315_036102 | 3300049531 | Bacteria | 732 |
| 659 | Ga0501316_004718 | 3300049532 | Bacteria | 1381 |
| 660 | Ga0501316_007434 | 3300049532 | Bacteria | 1190 |
| 661 | Ga0501316_028781 | 3300049532 | Bacteria | 735 |
| 662 | Ga0501317_041610 | 3300049533 | Bacteria | 703 |
| 663 | Ga0501318_001870 | 3300049534 | Bacteria | 1740 |
| 664 | Ga0501318_005094 | 3300049534 | Bacteria | 1288 |
| 665 | Ga0501319_003204 | 3300049535 | Bacteria | 1083 |
| 666 | Ga0501319_010473 | 3300049535 | Bacteria | 738 |
| 667 | Ga0501320_001852 | 3300049536 | Bacteria | 1613 |
| 668 | Ga0501320_014040 | 3300049536 | Bacteria | 861 |
| 669 | Ga0501321_001880 | 3300049537 | Bacteria | 1748 |
| 670 | Ga0501321_013235 | 3300049537 | Bacteria | 945 |
| 671 | Ga0501322_009988 | 3300049538 | Bacteria | 725 |
| 672 | Ga0501323_000098 | 3300049539 | Bacteria | 4633 |
| 673 | Ga0501323_009765 | 3300049539 | Bacteria | 1135 |
| 674 | Ga0501323_020172 | 3300049539 | Bacteria | 874 |
| 675 | Ga0501323_022298 | 3300049539 | Bacteria | 843 |
| 676 | Ga0501324_000124 | 3300049540 | Bacteria | 3139 |
| 677 | Ga0501324_001483 | 3300049540 | Bacteria | 1570 |
| 678 | Ga0501325_003318 | 3300049541 | Bacteria | 1165 |
| 679 | Ga0501325_030237 | 3300049541 | Bacteria | 617 |
| 680 | Ga0501031_0018454 | 3300049568 | Bacteria | 4539 |
| 681 | Ga0501031_0041389 | 3300049568 | Bacteria | 3008 |
| 682 | Ga0501031_0064199 | 3300049568 | Bacteria | 2391 |
| 683 | Ga0501031_0110007 | 3300049568 | Bacteria | 1799 |
| 684 | Ga0501031_0189540 | 3300049568 | Bacteria | 1343 |
| 685 | Ga0501032_0073341 | 3300049569 | Bacteria | 2280 |
| 686 | Ga0501032_0074874 | 3300049569 | Bacteria | 2255 |
| 687 | Ga0501032_0140205 | 3300049569 | Bacteria | 1592 |
| 688 | Ga0501032_0225998 | 3300049569 | Bacteria | 1217 |
| 689 | Ga0501032_0229336 | 3300049569 | Bacteria | 1207 |
| 690 | Ga0501032_0242330 | 3300049569 | Bacteria | 1171 |
| 691 | Ga0501032_0500602 | 3300049569 | Bacteria | 776 |
| 692 | Ga0501033_0010580 | 3300049570 | Bacteria | 7072 |
| 693 | Ga0501033_0018738 | 3300049570 | Bacteria | 5231 |
| 694 | Ga0501033_0021776 | 3300049570 | Bacteria | 4837 |
| 695 | Ga0501033_0043604 | 3300049570 | Bacteria | 3341 |
| 696 | Ga0501033_0049426 | 3300049570 | Bacteria | 3121 |
| 697 | Ga0501033_0096199 | 3300049570 | Bacteria | 2164 |
| 698 | Ga0501034_0037146 | 3300049571 | Bacteria | 4932 |
| 699 | Ga0501034_0068055 | 3300049571 | Bacteria | 3572 |
| 700 | Ga0501034_0069400 | 3300049571 | Bacteria | 3535 |
| 701 | Ga0501034_0098549 | 3300049571 | Bacteria | 2918 |
| 702 | Ga0501034_0118128 | 3300049571 | Bacteria | 2639 |
| 703 | Ga0501034_0179088 | 3300049571 | Bacteria | 2085 |
| 704 | Ga0501034_0223953 | 3300049571 | Bacteria | 1832 |
| 705 | Ga0501034_0250323 | 3300049571 | Bacteria | 1716 |
| 706 | Ga0501034_0454361 | 3300049571 | Bacteria | 1198 |
| 707 | Ga0501036_0000809 | 3300049572 | Bacteria | 23223 |
| 708 | Ga0501036_0008414 | 3300049572 | Bacteria | 8453 |
| 709 | Ga0501036_0022196 | 3300049572 | Bacteria | 5338 |
| 710 | Ga0501036_0043265 | 3300049572 | Bacteria | 3813 |
| 711 | Ga0501036_0051672 | 3300049572 | Bacteria | 3480 |
| 712 | Ga0501036_0250173 | 3300049572 | Bacteria | 1485 |
| 713 | Ga0501036_0277937 | 3300049572 | Bacteria | 1401 |
| 714 | Ga0501036_0302994 | 3300049572 | Bacteria | 1336 |
| 715 | Ga0501036_0587100 | 3300049572 | Bacteria | 925 |
| 716 | Ga0501037_0177644 | 3300049573 | Bacteria | 1511 |
| 717 | Ga0501037_0180349 | 3300049573 | Bacteria | 1498 |
| 718 | Ga0501037_0311826 | 3300049573 | Bacteria | 1090 |
| 719 | Ga0501037_0314303 | 3300049573 | Bacteria | 1085 |
| 720 | Ga0501037_0335339 | 3300049573 | Bacteria | 1045 |
| 721 | Ga0501037_0344551 | 3300049573 | Bacteria | 1029 |
| 722 | Ga0501038_0000986 | 3300049574 | Bacteria | 25579 |
| 723 | Ga0501038_0004611 | 3300049574 | Bacteria | 12820 |
| 724 | Ga0501038_0025754 | 3300049574 | Bacteria | 5240 |
| 725 | Ga0501038_0054524 | 3300049574 | Bacteria | 3438 |
| 726 | Ga0501038_0058470 | 3300049574 | Bacteria | 3306 |
| 727 | Ga0501038_0361755 | 3300049574 | Bacteria | 1128 |
| 728 | Ga0501039_0005182 | 3300049575 | Bacteria | 9869 |
| 729 | Ga0501039_0111716 | 3300049575 | Bacteria | 2136 |
| 730 | Ga0501039_0126406 | 3300049575 | Bacteria | 2005 |
| 731 | Ga0501039_0174514 | 3300049575 | Bacteria | 1690 |
| 732 | Ga0501039_0187343 | 3300049575 | Bacteria | 1627 |
| 733 | Ga0501039_0245697 | 3300049575 | Bacteria | 1407 |
| 734 | Ga0501039_0296390 | 3300049575 | Bacteria | 1271 |
| 735 | Ga0501039_0321903 | 3300049575 | Bacteria | 1215 |
| 736 | Ga0501039_0413472 | 3300049575 | Bacteria | 1059 |
| 737 | Ga0501039_0487305 | 3300049575 | Bacteria | 968 |
| 738 | Ga0501040_0021720 | 3300049576 | Bacteria | 4291 |
| 739 | Ga0501040_0119259 | 3300049576 | Bacteria | 1850 |
| 740 | Ga0501040_0320098 | 3300049576 | Bacteria | 1109 |
| 741 | Ga0501041_0104887 | 3300049577 | Bacteria | 1751 |
| 742 | Ga0501042_0016910 | 3300049578 | Bacteria | 5018 |
| 743 | Ga0501042_0107411 | 3300049578 | Bacteria | 2009 |
| 744 | Ga0501042_0163598 | 3300049578 | Bacteria | 1605 |
| 745 | Ga0501042_0292969 | 3300049578 | Bacteria | 1175 |
| 746 | Ga0501043_0003346 | 3300049579 | Bacteria | 13205 |
| 747 | Ga0501043_0011549 | 3300049579 | Bacteria | 6913 |
| 748 | Ga0501043_0111139 | 3300049579 | Bacteria | 2151 |
| 749 | Ga0501043_0132741 | 3300049579 | Bacteria | 1951 |
| 750 | Ga0501043_0136150 | 3300049579 | Bacteria | 1924 |
| 751 | Ga0501043_0157583 | 3300049579 | Bacteria | 1775 |
| 752 | Ga0501043_0265341 | 3300049579 | Bacteria | 1319 |
| 753 | Ga0501046_0017081 | 3300049580 | Bacteria | 6064 |
| 754 | Ga0501046_0044895 | 3300049580 | Bacteria | 3513 |
| 755 | Ga0501046_0048664 | 3300049580 | Bacteria | 3356 |
| 756 | Ga0501046_0072458 | 3300049580 | Bacteria | 2674 |
| 757 | Ga0501047_0000025 | 3300049581 | Bacteria | 225560 |
| 758 | Ga0501047_0013895 | 3300049581 | Bacteria | 7645 |
| 759 | Ga0501047_0086590 | 3300049581 | Bacteria | 3010 |
| 760 | Ga0501047_0165882 | 3300049581 | Bacteria | 2079 |
| 761 | Ga0501047_0269914 | 3300049581 | Bacteria | 1547 |
| 762 | Ga0501047_0381684 | 3300049581 | Bacteria | 1243 |
| 763 | Ga0501048_0007025 | 3300049582 | Bacteria | 8552 |
| 764 | Ga0501048_0011025 | 3300049582 | Bacteria | 6743 |
| 765 | Ga0501048_0023084 | 3300049582 | Bacteria | 4547 |
| 766 | Ga0501048_0167883 | 3300049582 | Bacteria | 1554 |
| 767 | Ga0501048_0604384 | 3300049582 | Bacteria | 787 |
| 768 | Ga0501067_0009172 | 3300049583 | Bacteria | 5478 |
| 769 | Ga0501067_0031418 | 3300049583 | Bacteria | 2946 |
| 770 | Ga0501067_0045352 | 3300049583 | Bacteria | 2441 |
| 771 | Ga0501067_0062048 | 3300049583 | Bacteria | 2069 |
| 772 | Ga0501067_0082480 | 3300049583 | Bacteria | 1783 |
| 773 | Ga0501067_0098951 | 3300049583 | Bacteria | 1620 |
| 774 | Ga0501067_0199471 | 3300049583 | Bacteria | 1114 |
| 775 | Ga0501067_0344030 | 3300049583 | Bacteria | 831 |
| 776 | Ga0501067_0458346 | 3300049583 | Bacteria | 712 |
| 777 | Ga0501068_0060059 | 3300049584 | Bacteria | 2308 |
| 778 | Ga0501068_0078144 | 3300049584 | Bacteria | 2027 |
| 779 | Ga0501068_0568813 | 3300049584 | Bacteria | 737 |
| 780 | Ga0501069_0025074 | 3300049585 | Bacteria | 3257 |
| 781 | Ga0501069_0086255 | 3300049585 | Bacteria | 1772 |
| 782 | Ga0501069_0113884 | 3300049585 | Bacteria | 1542 |
| 783 | Ga0501070_0001766 | 3300049586 | Bacteria | 19131 |
| 784 | Ga0501070_0015466 | 3300049586 | Bacteria | 6420 |
| 785 | Ga0501070_0024032 | 3300049586 | Bacteria | 5110 |
| 786 | Ga0501070_0038518 | 3300049586 | Bacteria | 3988 |
| 787 | Ga0501070_0101595 | 3300049586 | Bacteria | 2378 |
| 788 | Ga0501070_0147922 | 3300049586 | Bacteria | 1938 |
| 789 | Ga0501070_0154616 | 3300049586 | Bacteria | 1892 |
| 790 | Ga0501070_0184600 | 3300049586 | Bacteria | 1715 |
| 791 | Ga0501070_0560128 | 3300049586 | Bacteria | 914 |
| 792 | Ga0501070_0590632 | 3300049586 | Bacteria | 886 |
| 793 | Ga0501070_0863473 | 3300049586 | Bacteria | 707 |
| 794 | Ga0501071_0004926 | 3300049587 | Bacteria | 8522 |
| 795 | Ga0501071_0022463 | 3300049587 | Bacteria | 4397 |
| 796 | Ga0501071_0067578 | 3300049587 | Bacteria | 2600 |
| 797 | Ga0501072_0014217 | 3300049588 | Bacteria | 6098 |
| 798 | Ga0501072_0033664 | 3300049588 | Bacteria | 4015 |
| 799 | Ga0501072_0049711 | 3300049588 | Bacteria | 3301 |
| 800 | Ga0501072_0124844 | 3300049588 | Bacteria | 2050 |
| 801 | Ga0501072_0332097 | 3300049588 | Bacteria | 1208 |
| 802 | Ga0501073_0005833 | 3300049589 | Bacteria | 9189 |
| 803 | Ga0501073_0032335 | 3300049589 | Bacteria | 3728 |
| 804 | Ga0501073_0043777 | 3300049589 | Bacteria | 3156 |
| 805 | Ga0501073_0073924 | 3300049589 | Bacteria | 2373 |
| 806 | Ga0501073_0155986 | 3300049589 | Bacteria | 1582 |
| 807 | Ga0501074_0000332 | 3300049590 | Bacteria | 27474 |
| 808 | Ga0501074_0018619 | 3300049590 | Bacteria | 5045 |
| 809 | Ga0501074_0163471 | 3300049590 | Bacteria | 1589 |
| 810 | Ga0501075_0050601 | 3300049591 | Bacteria | 3123 |
| 811 | Ga0501075_0483986 | 3300049591 | Bacteria | 944 |
| 812 | Ga0501076_0042229 | 3300049592 | Bacteria | 3590 |
| 813 | Ga0501076_0109499 | 3300049592 | Bacteria | 2232 |
| 814 | Ga0501076_0311498 | 3300049592 | Bacteria | 1291 |
| 815 | Ga0501077_0001085 | 3300049593 | Bacteria | 16408 |
| 816 | Ga0501077_0052451 | 3300049593 | Bacteria | 2590 |
| 817 | Ga0501077_0324375 | 3300049593 | Bacteria | 982 |
| 818 | Ga0501206_004491 | 3300049653 | Bacteria | 1774 |
| 819 | Ga0501208_075059 | 3300049655 | Bacteria | 686 |
| 820 | Ga0501233_040755 | 3300049668 | Bacteria | 1090 |
| 821 | Ga0501257_129115 | 3300049686 | Bacteria | 683 |
| 822 | Ga0501079_0007427 | 3300049741 | Bacteria | 8294 |
| 823 | Ga0501079_0106826 | 3300049741 | Bacteria | 2172 |
| 824 | Ga0501079_0170974 | 3300049741 | Bacteria | 1694 |
| 825 | Ga0501080_0058672 | 3300049742 | Bacteria | 3582 |
| 826 | Ga0501080_0307712 | 3300049742 | Bacteria | 1436 |
| 827 | Ga0501080_0370605 | 3300049742 | Bacteria | 1291 |
| 828 | Ga0501081_0231559 | 3300049743 | Bacteria | 1346 |
| 829 | Ga0501083_0004399 | 3300049744 | Bacteria | 9933 |
| 830 | Ga0501035_0008456 | 3300049822 | Bacteria | 9587 |
| 831 | Ga0501035_0015345 | 3300049822 | Bacteria | 7071 |
| 832 | Ga0501035_0035265 | 3300049822 | Bacteria | 4540 |
| 833 | Ga0501035_0046902 | 3300049822 | Bacteria | 3883 |
| 834 | Ga0501035_0055144 | 3300049822 | Bacteria | 3549 |
| 835 | Ga0501035_0177702 | 3300049822 | Bacteria | 1835 |
| 836 | Ga0501035_0216133 | 3300049822 | Bacteria | 1638 |
| 837 | Ga0501035_0253543 | 3300049822 | Bacteria | 1493 |
| 838 | Ga0501035_0292545 | 3300049822 | Bacteria | 1374 |
| 839 | Ga0501035_0308292 | 3300049822 | Bacteria | 1332 |
| 840 | Ga0501035_0398510 | 3300049822 | Bacteria | 1145 |
| 841 | Ga0501035_0507164 | 3300049822 | Bacteria | 992 |
| 842 | Ga0501035_0649653 | 3300049822 | Bacteria | 855 |
| 843 | Ga0501044_0005123 | 3300049823 | Bacteria | 14617 |
| 844 | Ga0501044_0007826 | 3300049823 | Bacteria | 11745 |
| 845 | Ga0501044_0029805 | 3300049823 | Bacteria | 5752 |
| 846 | Ga0501044_0054400 | 3300049823 | Bacteria | 4114 |
| 847 | Ga0501044_0397809 | 3300049823 | Bacteria | 1291 |
| 848 | Ga0501044_0427169 | 3300049823 | Bacteria | 1234 |
| 849 | Ga0501044_0460223 | 3300049823 | Bacteria | 1178 |
| 850 | Ga0501044_0626536 | 3300049823 | Bacteria | 966 |
| 851 | Ga0501044_0627680 | 3300049823 | Bacteria | 965 |
| 852 | Ga0501045_0124139 | 3300049824 | Bacteria | 1917 |
| 853 | Ga0501045_0217094 | 3300049824 | Bacteria | 1424 |
| 854 | nmdc:mga03683_18082_c1 | 3300050489 | Bacteria | 2676 |
| 855 | nmdc:mga03n38_108625_c1 | 3300050490 | Bacteria | 1348 |
| 856 | nmdc:mga03n38_112337_c1 | 3300050490 | Bacteria | 1329 |
| 857 | nmdc:mga03n38_14627_c1 | 3300050490 | Bacteria | 3012 |
| 858 | nmdc:mga03n38_168573_c1 | 3300050490 | Bacteria | 1114 |
| 859 | nmdc:mga03n38_198990_c1 | 3300050490 | Bacteria | 1036 |
| 860 | nmdc:mga03n38_242525_c1 | 3300050490 | Bacteria | 949 |
| 861 | nmdc:mga03n38_263010_c1 | 3300050490 | Bacteria | 915 |
| 862 | nmdc:mga03n38_44072_c1 | 3300050490 | Bacteria | 1958 |
| 863 | nmdc:mga03n38_57360_c1 | 3300050490 | Bacteria | 1761 |
| 864 | nmdc:mga00v17_101889_c1 | 3300050491 | Bacteria | 1813 |
| 865 | nmdc:mga00v17_103675_c1 | 3300050491 | Bacteria | 1798 |
| 866 | nmdc:mga00v17_106534_c1 | 3300050491 | Bacteria | 1775 |
| 867 | nmdc:mga00v17_146230_c1 | 3300050491 | Bacteria | 1517 |
| 868 | nmdc:mga00v17_16796_c1 | 3300050491 | Bacteria | 4130 |
| 869 | nmdc:mga00v17_26746_c1 | 3300050491 | Bacteria | 3364 |
| 870 | nmdc:mga00v17_34082_c1 | 3300050491 | Bacteria | 3022 |
| 871 | nmdc:mga00v17_83346_c1 | 3300050491 | Bacteria | 2000 |
| 872 | nmdc:mga00v17_87190_c1 | 3300050491 | Bacteria | 1957 |
| 873 | nmdc:mga0yw44_39695_c1 | 3300050492 | Bacteria | 2793 |
| 874 | nmdc:mga0yw44_4297_c1 | 3300050492 | Bacteria | 6503 |
| 875 | nmdc:mga0yw44_432338_c1 | 3300050492 | Bacteria | 892 |
| 876 | nmdc:mga0yw44_48106_c1 | 3300050492 | Bacteria | 2571 |
| 877 | nmdc:mga0yw44_570_c2 | 3300050492 | Bacteria | 9097 |
| 878 | nmdc:mga0yw44_593240_c1 | 3300050492 | Bacteria | 753 |
| 879 | nmdc:mga06z11_153311_c1 | 3300050494 | Bacteria | 1312 |
| 880 | nmdc:mga06z11_153733_c1 | 3300050494 | Bacteria | 1310 |
| 881 | nmdc:mga06z11_17729_c1 | 3300050494 | Bacteria | 3239 |
| 882 | nmdc:mga06z11_21636_c1 | 3300050494 | Bacteria | 2992 |
| 883 | nmdc:mga06z11_2888_c1 | 3300050494 | Bacteria | 6609 |
| 884 | nmdc:mga06z11_29702_c1 | 3300050494 | Bacteria | 2636 |
| 885 | nmdc:mga04h51_31060_c1 | 3300050495 | Bacteria | 1686 |
| 886 | nmdc:mga04h51_346956_c1 | 3300050495 | Bacteria | 613 |
| 887 | nmdc:mga04h51_7896_c1 | 3300050495 | Bacteria | 2829 |
| 888 | nmdc:mga04h51_8493_c1 | 3300050495 | Bacteria | 2749 |
| 889 | nmdc:mga07m45_105263_c1 | 3300050496 | Bacteria | 1623 |
| 890 | nmdc:mga07m45_111576_c1 | 3300050496 | Bacteria | 1575 |
| 891 | nmdc:mga07m45_206501_c1 | 3300050496 | Bacteria | 1143 |
| 892 | nmdc:mga07m45_299815_c1 | 3300050496 | Bacteria | 935 |
| 893 | nmdc:mga07m45_38031_c1 | 3300050496 | Bacteria | 2685 |
| 894 | nmdc:mga07m45_45772_c1 | 3300050496 | Bacteria | 2457 |
| 895 | nmdc:mga07m45_52993_c1 | 3300050496 | Bacteria | 1511 |
| 896 | nmdc:mga07m45_81851_c1 | 3300050496 | Bacteria | 1844 |
| 897 | nmdc:mga08y16_1503206_c1 | 3300050511 | Bacteria | 634 |
| 898 | nmdc:mga0n895_1175822_c1 | 3300050512 | Bacteria | 742 |
| 899 | Ga0495601_0007875 | 3300053077 | Bacteria | 6275 |
| 900 | Ga0495601_0461798 | 3300053077 | Bacteria | 821 |
| 901 | Ga0500610_0093778 | 3300053079 | Bacteria | 1558 |
| 902 | Ga0495655_0028678 | 3300053083 | Bacteria | 1332 |
| 903 | Ga0495655_0037836 | 3300053083 | Bacteria | 1214 |
| 904 | Ga0495655_0046328 | 3300053083 | Bacteria | 1133 |
| 905 | Ga0495619_0010826 | 3300053085 | Bacteria | 5740 |
| 906 | Ga0495619_0019030 | 3300053085 | Bacteria | 4362 |
| 907 | Ga0500578_0011067 | 3300053086 | Bacteria | 5830 |
| 908 | Ga0500644_0000315 | 3300053088 | Bacteria | 25229 |
| 909 | Ga0500654_041639 | 3300053099 | Bacteria | 2600 |
| 910 | Ga0500660_072870 | 3300053100 | Bacteria | 1603 |
| 911 | Ga0500554_029427 | 3300053102 | Bacteria | 1605 |
| 912 | Ga0500556_0003839 | 3300053104 | Bacteria | 4357 |
| 913 | Ga0500560_002243 | 3300053107 | Bacteria | 3642 |
| 914 | Ga0500560_068585 | 3300053107 | Bacteria | 1166 |
| 915 | Ga0500569_001311 | 3300053109 | Bacteria | 4653 |
| 916 | Ga0500593_000520 | 3300053117 | Bacteria | 15117 |
| 917 | Ga0500594_0092057 | 3300053118 | Bacteria | 922 |
| 918 | Ga0500628_002039 | 3300053129 | Bacteria | 3394 |
| 919 | Ga0500628_146037 | 3300053129 | Bacteria | 659 |
| 920 | Ga0500652_001328 | 3300053131 | Bacteria | 7777 |
| 921 | Ga0500658_0009326 | 3300053134 | Bacteria | 3619 |
| 922 | Ga0500561_0000210 | 3300053137 | Bacteria | 10640 |
| 923 | Ga0500573_0003247 | 3300053140 | Bacteria | 8373 |
| 924 | Ga0500573_0048333 | 3300053140 | Bacteria | 2449 |
| 925 | Ga0500577_0259975 | 3300053142 | Bacteria | 755 |
| 926 | Ga0500579_056393 | 3300053143 | Bacteria | 2365 |
| 927 | Ga0500600_0012307 | 3300053149 | Bacteria | 5192 |
| 928 | Ga0500603_035556 | 3300053150 | Bacteria | 1307 |
| 929 | Ga0500606_089661 | 3300053152 | Bacteria | 1040 |
| 930 | Ga0500616_0002786 | 3300053153 | Bacteria | 14082 |
| 931 | Ga0500633_0000718 | 3300053160 | Bacteria | 5617 |
| 932 | Ga0500633_0228862 | 3300053160 | Bacteria | 693 |
| 933 | Ga0500634_0008013 | 3300053161 | Bacteria | 5253 |
| 934 | Ga0500656_001093 | 3300053732 | Bacteria | 2242 |
| 935 | Ga0500587_000429 | 3300053739 | Bacteria | 4927 |
| 936 | Ga0501084_0232071 | 3300054114 | Bacteria | 1557 |
| 937 | Ga0590075_059817 | 3300059424 | Bacteria | 982 |
| 938 | Ga0587098_004278 | 3300059604 | Bacteria | 1338 |
| 939 | Ga0587106_051245 | 3300059605 | Bacteria | 732 |
| 940 | Ga0587099_008043 | 3300059622 | Bacteria | 1010 |
| 941 | Ga0587062_016770 | 3300059639 | Bacteria | 994 |
| 942 | Ga0587119_022745 | 3300059658 | Bacteria | 811 |
| 943 | Ga0587071_066715 | 3300060344 | Bacteria | 775 |
| 944 | Ga0501082_0091447 | 3300060353 | Bacteria | 2627 |
| 945 | Ga0501082_0177876 | 3300060353 | Bacteria | 1850 |
| 946 | Ga0501082_0342366 | 3300060353 | Bacteria | 1303 |
| 947 | Ga0466962_0005850 | 3300061719 | Bacteria | 5910 |
| 948 | Ga0466962_0007798 | 3300061719 | Bacteria | 5131 |
| 949 | Ga0466962_0007857 | 3300061719 | Bacteria | 5117 |
| 950 | Ga0466962_0017971 | 3300061719 | Bacteria | 3403 |
| 951 | Ga0466962_0063102 | 3300061719 | Bacteria | 1769 |
| 952 | Ga0466962_0114975 | 3300061719 | Bacteria | 1296 |
| 953 | Ga0530510_0218603 | 3300061734 | Bacteria | 1416 |
| 954 | Ga0530510_0433236 | 3300061734 | Bacteria | 993 |
| 955 | 2547406852 | 2547132111 | Bacteria | 8013147 |
| 956 | 2585304821 | 2582581313 | Bacteria | 10042643 |
| 957 | 2585319465 | 2582581314 | Bacteria | 11452267 |
| 958 | 2616700748 | 2616644814 | Bacteria | 11555299 |
| 959 | 2643828098 | 2643221561 | Bacteria | 4984412 |
| 960 | 2643892430 | 2643221576 | Bacteria | 5214352 |
| 961 | 2643961482 | 2643221590 | Bacteria | 5214697 |
| 962 | 2644018675 | 2643221601 | Bacteria | 7493239 |
| 963 | 2644032417 | 2643221604 | Bacteria | 5014917 |
| 964 | 2644090745 | 2643221615 | Bacteria | 5487866 |
| 965 | 2644102694 | 2643221617 | Bacteria | 5139111 |
| 966 | 2644118356 | 2643221620 | Bacteria | 5134593 |
| 967 | 2644179810 | 2643221631 | Bacteria | 8168043 |
| 968 | 2644231289 | 2643221641 | Bacteria | 4490190 |
| 969 | 2644320549 | 2643221657 | Bacteria | 5490246 |
| 970 | 2644436398 | 2643221678 | Bacteria | 9540101 |
| 971 | 2644531187 | 2643221696 | Bacteria | 5431823 |
| 972 | 2644625750 | 2643221714 | Bacteria | 9015452 |
| 973 | 2738870595 | 2738541305 | Bacteria | 4910150 |
| 974 | 2740166616 | 2739367898 | Bacteria | 4367674 |
| 975 | 2768646032 | 2767802112 | Bacteria | 6465194 |
| 976 | 2774393803 | 2773857762 | Bacteria | 5971770 |
| 977 | 2784587879 | 2784132148 | Bacteria | 8627943 |
| 978 | 2785344267 | 2784746763 | Bacteria | 9783172 |
| 979 | 2785368602 | 2784746768 | Bacteria | 10036182 |
| 980 | 2786669706 | 2786546132 | Bacteria | 10419719 |
| 981 | 2804844894 | 2802429296 | Bacteria | 7227771 |
| 982 | 2808841286 | 2808606359 | Bacteria | 9866990 |
| 983 | 2808919794 | 2808606375 | Bacteria | 9466072 |
| 984 | 2809195322 | 2808606439 | Bacteria | 5952208 |
| 985 | 2809231466 | 2808606448 | Bacteria | 8656184 |
| 986 | 2812334123 | 2811994874 | Bacteria | 5367947 |
| 987 | 2812350196 | 2811994878 | Bacteria | 5992952 |
| 988 | 2812358972 | 2811994879 | Bacteria | 9313447 |
| 989 | 2812481218 | 2811994917 | Bacteria | 7761064 |
| 990 | 2819742836 | 2818991472 | Bacteria | 10089953 |
| 991 | 2819747076 | 2818991472 | Bacteria | 10089953 |
| 992 | 2852642212 | 2852635781 | Bacteria | 8251373 |
| 993 | 2855387439 | 2855386786 | Bacteria | 4752232 |
| 994 | 2857482791 | 2857481737 | Bacteria | 4761446 |
| 995 | 2862288129 | 2862281513 | Bacteria | 9621493 |
| 996 | 2862295660 | 2862290372 | Bacteria | 7471434 |
| 997 | 2862392446 | 2862382967 | Bacteria | 10317375 |
| 998 | 2862509502 | 2862507626 | Bacteria | 9425308 |
| 999 | 2862711030 | 2862705112 | Bacteria | 6563286 |
| 1000 | 2863068556 | 2863067949 | Bacteria | 8541735 |
| 1001 | 2863405520 | 2863404153 | Bacteria | 9672205 |
| 1002 | 2867348148 | 2867346516 | Bacteria | 7608576 |
| 1003 | 2867371109 | 2867369537 | Bacteria | 6501581 |
| 1004 | 2867431826 | 2867428634 | Bacteria | 9590268 |
| 1005 | 2867479683 | 2867475112 | Bacteria | 6909112 |
| 1006 | 2867480750 | 2867475112 | Bacteria | 6909112 |
| 1007 | 2877681925 | 2877676314 | Bacteria | 9512378 |
| 1008 | 2891972179 | 2891968417 | Bacteria | 5821697 |
| 1009 | 2912720894 | 2912715099 | Bacteria | 9460473 |
| 1010 | 2918507061 | 2918501144 | Bacteria | 8668083 |
| 1011 | 2919468687 | 2919468124 | Bacteria | 9133025 |
| 1012 | 2946066905 | 2946064051 | Bacteria | 8957905 |
| 1013 | 2954003640 | 2954002825 | Bacteria | 9173742 |
| 1014 | 2954387049 | 2954380949 | Bacteria | 10050426 |
| 1015 | 2954676114 | 2954673503 | Bacteria | 9685905 |
| 1016 | 2954688053 | 2954682443 | Bacteria | 9862841 |
| 1017 | 2954697885 | 2954691527 | Bacteria | 10720516 |
| 1018 | 2954704331 | 2954701450 | Bacteria | 10834262 |
| 1019 | 2954716996 | 2954711539 | Bacteria | 10867210 |
| 1020 | 2954726947 | 2954721474 | Bacteria | 10456478 |
| 1021 | 2954734850 | 2954731030 | Bacteria | 10243860 |
| 1022 | 2954745868 | 2954740390 | Bacteria | 10229294 |
| 1023 | 2954753722 | 2954749733 | Bacteria | 10366972 |
| 1024 | 2954764841 | 2954759201 | Bacteria | 9358192 |
| 1025 | 2984577143 | 2984576629 | Bacteria | 4248407 |
| 1026 | 2990046520 | 2990044586 | Bacteria | 6603797 |
| 1027 | 2990061882 | 2990059506 | Bacteria | 9321252 |
| 1028 | 2990093401 | 2990088156 | Bacteria | 6657676 |
| 1029 | 2990260464 | 2990256926 | Bacteria | 4252839 |
| 1030 | 2995471131 | 2995463766 | Bacteria | 8577691 |
| 1031 | 2997456562 | 2997451912 | Bacteria | 8492419 |
| 1032 | 3006427300 | 3006425503 | Bacteria | 6491253 |
| 1033 | 3006501785 | 3006493962 | Bacteria | 8825450 |
| 1034 | 8008488822 | 8008485437 | Bacteria | 7198341 |
| 1035 | 8008559553 | 8008558824 | Bacteria | 10610750 |
| 1036 | 8023629284 | 8023623736 | Bacteria | 8593882 |
| 1037 | 8025419332 | 8025413630 | Bacteria | 7014048 |
| 1038 | 8025528305 | 8025524527 | Bacteria | 7197316 |
| 1039 | 8033686010 | 8033684223 | Bacteria | 6906479 |
| 1040 | 8048407143 | 8048406513 | Bacteria | 8936924 |
| 1041 | 8054165018 | 8054160619 | Bacteria | 7783213 |
| 1042 | 8054612347 | 8054609563 | Bacteria | 5170090 |
| 1043 | Ga0466969_0008782 | |||
| 1044 | LJQas_1005528 | |||
| 1045 | JGI24739J22299_10072289 | |||
| 1046 | JGI24737J22298_10009059 | |||
| 1047 | JGI24737J22298_10013219 | |||
| 1048 | JGI24735J21928_10012392 | |||
| 1049 | JGI24750J21931_1005874 | |||
| 1050 | JGI24738J21930_10004960 | |||
| 1051 | JGI24738J21930_10006440 | |||
| 1052 | JGI24744J21845_10000532 | |||
| 1053 | rootH1_10012683 | |||
| 1054 | rootH1_10012684 | |||
| 1055 | rootH2_10073426 | |||
| 1056 | rootH1_10019905 | |||
| 1057 | rootH1_10051264 | |||
| 1058 | Ga0006562J51391_1005843 | |||
| 1059 | Ga0007429J51699_1017997 | |||
| 1060 | Ga0058692_1045109 | |||
| 1061 | Ga0058862_10006434 | |||
| 1062 | Ga0070676_10304244 | |||
| 1063 | Ga0070683_100013995 | |||
| 1064 | Ga0070683_100030501 | |||
| 1065 | Ga0070682_100011595 | |||
| 1066 | Ga0070682_100018717 | |||
| 1067 | Ga0070682_100132210 | |||
| 1068 | Ga0068868_100098699 | |||
| 1069 | Ga0068868_100325806 | |||
| 1070 | Ga0070660_100003302 | |||
| 1071 | Ga0070687_100718738 | |||
| 1072 | Ga0070692_10020197 | |||
| 1073 | Ga0070692_10020439 | |||
| 1074 | Ga0070692_10201992 | |||
| 1075 | Ga0070692_10225107 | |||
| 1076 | Ga0070668_100116637 | |||
| 1077 | Ga0070668_100262850 | |||
| 1078 | Ga0070675_100182764 | |||
| 1079 | Ga0070675_100374960 | |||
| 1080 | Ga0070671_100548508 | |||
| 1081 | Ga0070674_100005174 | |||
| 1082 | Ga0070674_100312722 | |||
| 1083 | Ga0070659_100019106 | |||
| 1084 | Ga0070659_100025275 | |||
| 1085 | Ga0070659_100277939 | |||
| 1086 | Ga0070659_100294972 | |||
| 1087 | Ga0070667_100072949 | |||
| 1088 | Ga0070667_100089384 | |||
| 1089 | Ga0070667_101097476 | |||
| 1090 | Ga0070701_10094608 | |||
| 1091 | Ga0070700_100002303 | |||
| 1092 | Ga0070700_100020078 | |||
| 1093 | Ga0070663_100114837 | |||
| 1094 | Ga0070663_100685448 | |||
| 1095 | Ga0070678_100030699 | |||
| 1096 | Ga0070678_100104615 | |||
| 1097 | Ga0070678_100265797 | |||
| 1098 | Ga0068867_100007389 | |||
| 1099 | Ga0068867_100278653 | |||
| 1100 | Ga0070685_10176701 | |||
| 1101 | Ga0070707_100400259 | |||
| 1102 | Ga0070698_100011005 | |||
| 1103 | Ga0070679_100809901 | |||
| 1104 | Ga0070684_100004672 | |||
| 1105 | Ga0070684_100063833 | |||
| 1106 | Ga0070684_100468834 | |||
| 1107 | Ga0068853_100096039 | |||
| 1108 | Ga0068853_100137090 | |||
| 1109 | Ga0070672_100570698 | |||
| 1110 | Ga0070665_100000868 | |||
| 1111 | Ga0068855_100248717 | |||
| 1112 | Ga0070664_100237931 | |||
| 1113 | Ga0068857_100014013 | |||
| 1114 | Ga0068856_100223417 | |||
| 1115 | Ga0068856_100240491 | |||
| 1116 | Ga0070702_100003489 | |||
| 1117 | Ga0070702_100026047 | |||
| 1118 | Ga0068852_100437444 | |||
| 1119 | Ga0068852_100456722 | |||
| 1120 | Ga0068861_100551188 | |||
| 1121 | Ga0068870_10061537 | |||
| 1122 | Ga0068863_100270128 | |||
| 1123 | Ga0068860_100000388 | |||
| 1124 | Ga0068860_100100623 | |||
| 1125 | Ga0081539_10045162 | |||
| 1126 | Ga0075365_10019907 | |||
| 1127 | Ga0075365_10050313 | |||
| 1128 | Ga0075365_10092348 | |||
| 1129 | Ga0075365_10163191 | |||
| 1130 | Ga0075365_10289099 | |||
| 1131 | Ga0075368_10000847 | |||
| 1132 | Ga0075368_10040813 | |||
| 1133 | Ga0075363_100046286 | |||
| 1134 | Ga0075363_100140083 | |||
| 1135 | Ga0075363_100193838 | |||
| 1136 | Ga0075364_10027506 | |||
| 1137 | Ga0075364_10045314 | |||
| 1138 | Ga0075364_10121077 | |||
| 1139 | Ga0075364_10255386 | |||
| 1140 | Ga0075364_10544477 | |||
| 1141 | Ga0075362_10004276 | |||
| 1142 | Ga0075367_10000916 | |||
| 1143 | Ga0075367_10037203 | |||
| 1144 | Ga0075367_10051571 | |||
| 1145 | Ga0075367_10180919 | |||
| 1146 | Ga0075367_10298733 | |||
| 1147 | Ga0075370_10024322 | |||
| 1148 | Ga0075370_10033825 | |||
| 1149 | Ga0075370_10078090 | |||
| 1150 | Ga0075370_10094577 | |||
| 1151 | Ga0075370_10110304 | |||
| 1152 | Ga0075370_10150970 | |||
| 1153 | Ga0075370_10299968 | |||
| 1154 | Ga0075428_100027812 | |||
| 1155 | Ga0075434_101136693 | |||
| 1156 | Ga0068865_100004270 | |||
| 1157 | Ga0068865_100285919 | |||
| 1158 | Ga0105251_10026442 | |||
| 1159 | Ga0105244_10186991 | |||
| 1160 | Ga0105250_10123393 | |||
| 1161 | Ga0105245_10002262 | |||
| 1162 | Ga0105245_10010146 | |||
| 1163 | Ga0105245_10589429 | |||
| 1164 | Ga0105245_10735571 | |||
| 1165 | Ga0105247_10292301 | |||
| 1166 | Ga0105243_10047697 | |||
| 1167 | Ga0105243_10083958 | |||
| 1168 | Ga0105243_10224256 | |||
| 1169 | Ga0105242_11308610 | |||
| 1170 | Ga0105248_10190351 | |||
| 1171 | Ga0105237_10071232 | |||
| 1172 | Ga0105237_10655307 | |||
| 1173 | Ga0105238_10807971 | |||
| 1174 | Ga0105249_10058933 | |||
| 1175 | Ga0105239_10001318 | |||
| 1176 | Ga0105239_10002798 | |||
| 1177 | Ga0105246_10014826 | |||
| 1178 | Ga0105246_10043532 | |||
| 1179 | Ga0157369_10095838 | |||
| 1180 | Ga0157369_10707971 | |||
| 1181 | Ga0157374_10702417 | |||
| 1182 | Ga0163162_10035603 | |||
| 1183 | Ga0157372_10027521 | |||
| 1184 | Ga0157372_10131496 | |||
| 1185 | Ga0157375_11307411 | |||
| 1186 | Ga0163163_10129334 | |||
| 1187 | Ga0163163_10160525 | |||
| 1188 | Ga0163163_10365416 | |||
| 1189 | Ga0157380_10005485 | |||
| 1190 | Ga0182008_10016002 | |||
| 1191 | Ga0157377_10026897 | |||
| 1192 | Ga0157379_10040240 | |||
| 1193 | Ga0157376_10216925 | |||
| 1194 | Ga0157376_10356554 | |||
| 1195 | Ga0182007_10001964 | |||
| 1196 | Ga0183367_1006 | |||
| 1197 | Ga0163161_10048837 | |||
| 1198 | Ga0197907_10046109 | |||
| 1199 | Ga0206351_10711097 | |||
| 1200 | Ga0206350_10490934 | |||
| 1201 | Ga0206350_11446792 | |||
| 1202 | Ga0206350_11624171 | |||
| 1203 | Ga0154015_1288929 | |||
| 1204 | Ga0213875_10025417 | |||
| 1205 | Ga0224712_10104738 | |||
| 1206 | Ga0209758_1003504 | |||
| 1207 | Ga0207426_1003149 | |||
| 1208 | Ga0207426_1016168 | |||
| 1209 | Ga0209051_1091365 | |||
| 1210 | Ga0207713_1013108 | |||
| 1211 | Ga0207688_10071323 | |||
| 1212 | Ga0207688_10347469 | |||
| 1213 | Ga0207647_10010116 | |||
| 1214 | Ga0207647_10011522 | |||
| 1215 | Ga0207647_10059649 | |||
| 1216 | Ga0207671_10087463 | |||
| 1217 | Ga0207671_10127920 | |||
| 1218 | Ga0207662_10079336 | |||
| 1219 | Ga0207662_10379942 | |||
| 1220 | Ga0207657_10042184 | |||
| 1221 | Ga0207646_10129704 | |||
| 1222 | Ga0207694_10095551 | |||
| 1223 | Ga0207650_10650748 | |||
| 1224 | Ga0207659_10187588 | |||
| 1225 | Ga0207659_10315041 | |||
| 1226 | Ga0207687_10010027 | |||
| 1227 | Ga0207687_10146799 | |||
| 1228 | Ga0207690_10014894 | |||
| 1229 | Ga0207690_10036521 | |||
| 1230 | Ga0207706_10165774 | |||
| 1231 | Ga0207706_10294118 | |||
| 1232 | Ga0207706_10490933 | |||
| 1233 | Ga0207686_10220313 | |||
| 1234 | Ga0207709_10005306 | |||
| 1235 | Ga0207709_10068435 | |||
| 1236 | Ga0207709_10506130 | |||
| 1237 | Ga0207669_10012594 | |||
| 1238 | Ga0207669_10190593 | |||
| 1239 | Ga0207691_10003002 | |||
| 1240 | Ga0207691_10081757 | |||
| 1241 | Ga0207711_10322118 | |||
| 1242 | Ga0207689_10427852 | |||
| 1243 | Ga0207689_10757743 | |||
| 1244 | Ga0207661_10005512 | |||
| 1245 | Ga0207661_10203304 | |||
| 1246 | Ga0207661_10764360 | |||
| 1247 | Ga0207651_10218246 | |||
| 1248 | Ga0207651_11014393 | |||
| 1249 | Ga0207712_10097291 | |||
| 1250 | Ga0207668_10340952 | |||
| 1251 | Ga0207668_11185697 | |||
| 1252 | Ga0207658_10013451 | |||
| 1253 | Ga0207658_10158162 | |||
| 1254 | Ga0207677_10004641 | |||
| 1255 | Ga0207677_10094319 | |||
| 1256 | Ga0207703_10794898 | |||
| 1257 | Ga0207678_10127572 | |||
| 1258 | Ga0207708_10001371 | |||
| 1259 | Ga0207708_10095894 | |||
| 1260 | Ga0207702_10126503 | |||
| 1261 | Ga0207641_10805802 | |||
| 1262 | Ga0207648_10056730 | |||
| 1263 | Ga0207648_10453504 | |||
| 1264 | Ga0207674_10007577 | |||
| 1265 | Ga0207674_10803636 | |||
| 1266 | Ga0207675_100007138 | |||
| 1267 | Ga0207675_100089750 | |||
| 1268 | Ga0207675_100118612 | |||
| 1269 | Ga0207683_10052995 | |||
| 1270 | Ga0207683_10093108 | |||
| 1271 | Ga0207683_10121129 | |||
| 1272 | Ga0207698_10019604 | |||
| 1273 | Ga0207698_10044631 | |||
| 1274 | Ga0209371_1009821 | |||
| 1275 | Ga0209371_1023114 | |||
| 1276 | Ga0209813_10000658 | |||
| 1277 | Ga0209813_10005764 | |||
| 1278 | Ga0209813_10050640 | |||
| 1279 | Ga0207428_10241590 | |||
| 1280 | Ga0268266_10001392 | |||
| 1281 | Ga0268266_10081155 | |||
| 1282 | Ga0268266_10121698 | |||
| 1283 | Ga0268264_10000387 | |||
| 1284 | Ga0307517_10003800 | |||
| 1285 | Ga0307517_10007226 | |||
| 1286 | Ga0307515_10002026 | |||
| 1287 | Ga0268256_1010880 | |||
| 1288 | Ga0307511_10001267 | |||
| 1289 | Ga0307511_10082268 | |||
| 1290 | Ga0307512_10013231 | |||
| 1291 | Ga0316183_1192358 | |||
| 1292 | Ga0316181_1029856 | |||
| 1293 | Ga0265340_10036704 | |||
| 1294 | Ga0307513_10210165 | |||
| 1295 | Ga0307513_10312574 | |||
| 1296 | Ga0307509_10121232 | |||
| 1297 | Ga0307509_10131531 | |||
| 1298 | Ga0307408_100320242 | |||
| 1299 | Ga0307508_10021403 | |||
| 1300 | Ga0307514_10078495 | |||
| 1301 | Ga0307514_10114213 | |||
| 1302 | Ga0307516_10059421 | |||
| 1303 | Ga0307516_10096309 | |||
| 1304 | Ga0307405_10231258 | |||
| 1305 | Ga0307405_10816385 | |||
| 1306 | Ga0307413_10132629 | |||
| 1307 | Ga0307413_10596728 | |||
| 1308 | Ga0307518_10126214 | |||
| 1309 | Ga0307518_10176835 | |||
| 1310 | Ga0307410_10094609 | |||
| 1311 | Ga0307406_10080163 | |||
| 1312 | Ga0307406_10300299 | |||
| 1313 | Ga0307407_10020689 | |||
| 1314 | Ga0307407_10102976 | |||
| 1315 | Ga0307407_10142825 | |||
| 1316 | Ga0307412_10050300 | |||
| 1317 | Ga0307412_10067839 | |||
| 1318 | Ga0307412_10166467 | |||
| 1319 | Ga0307412_10284600 | |||
| 1320 | Ga0307412_10768719 | |||
| 1321 | Ga0307409_100021958 | |||
| 1322 | Ga0307409_100069450 | |||
| 1323 | Ga0307409_100204584 | |||
| 1324 | Ga0307409_100393645 | |||
| 1325 | Ga0307409_100411779 | |||
| 1326 | Ga0307409_100717134 | |||
| 1327 | Ga0307409_100816992 | |||
| 1328 | Ga0307416_100068237 | |||
| 1329 | Ga0307416_100105910 | |||
| 1330 | Ga0307416_100284691 | |||
| 1331 | Ga0307416_100539334 | |||
| 1332 | Ga0307414_10361762 | |||
| 1333 | Ga0307411_10466321 | |||
| 1334 | Ga0307415_100293226 | |||
| 1335 | Ga0307415_100314316 | |||
| 1336 | Ga0307415_100353041 | |||
| 1337 | Ga0307507_10067643 | |||
| 1338 | Ga0307510_10200261 | |||
| 1339 | Ga0307510_10215164 | |||
| 1340 | Ga0373928_0045395 | |||
| 1341 | Ga0373952_0030824 | |||
| 1342 | Ga0395899_0203417 | |||
| 1343 | Ga0395899_0258850 | |||
| 1344 | Ga0395898_0029023 | |||
| 1345 | Ga0395898_0059562 | |||
| 1346 | Ga0395905_0012411 | |||
| 1347 | Ga0395905_0057280 | |||
| 1348 | Ga0395905_0216579 | |||
| 1349 | Ga0395905_0451928 | |||
| 1350 | Ga0395905_0761137 | |||
| 1351 | Ga0436364_0961922 | |||
| 1352 | Ga0436364_1191885 | |||
| 1353 | Ga0436364_1267828 | |||
| 1354 | Ga0436364_1376765 | |||
| 1355 | Ga0395901_0034440 | |||
| 1356 | Ga0395901_0081403 | |||
| 1357 | Ga0395901_0083782 | |||
| 1358 | Ga0395901_0140674 | |||
| 1359 | Ga0395901_0930851 | |||
| 1360 | Ga0242420_004572 | |||
| 1361 | Ga0400483_018528 | |||
| 1362 | Ga0400483_023161 | |||
| 1363 | Ga0400483_076896 | |||
| 1364 | Ga0400483_103660 | |||
| 1365 | Ga0400483_198923 | |||
| 1366 | Ga0400483_204522 | |||
| 1367 | Ga0400483_248013 | |||
| 1368 | Ga0400483_254236 | |||
| 1369 | Ga0436365_0096389 | |||
| 1370 | Ga0436365_1477850 | |||
| 1371 | Ga0439436_0005153 | |||
| 1372 | Ga0439465_0080308 | |||
| 1373 | Ga0451789_0623635 | |||
| 1374 | Ga0451797_1306219 | |||
| 1375 | Ga0451795_0427087 | |||
| 1376 | Ga0451798_1153288 | |||
| 1377 | Ga0451841_0903274 | |||
| 1378 | Ga0451847_0525880 | |||
| 1379 | Ga0451843_1108888 | |||
| 1380 | Ga0451853_0989324 | |||
| 1381 | Ga0451853_1505240 | |||
| 1382 | Ga0451853_1770887 | |||
| 1383 | Ga0439431_0003253 | |||
| 1384 | Ga0439433_0003818 | |||
| 1385 | Ga0439442_010904 | |||
| 1386 | Ga0439442_037697 | |||
| 1387 | Ga0439448_0003369 | |||
| 1388 | Ga0439448_0029859 | |||
| 1389 | Ga0439432_067955 | |||
| 1390 | Ga0439449_0009834 | |||
| 1391 | Ga0439455_0005439 | |||
| 1392 | Ga0439457_005336 | |||
| 1393 | Ga0439462_0057931 | |||
| 1394 | Ga0450890_018387 | |||
| 1395 | Ga0450897_016869 | |||
| 1396 | Ga0450895_009203 | |||
| 1397 | Ga0450896_019611 | |||
| 1398 | Ga0450898_015127 | |||
| 1399 | Ga0450899_001701 | |||
| 1400 | Ga0450900_021765 | |||
| 1401 | Ga0450903_000064 | |||
| 1402 | Ga0450904_014518 | |||
| 1403 | Ga0450906_001453 | |||
| 1404 | Ga0450907_017642 | |||
| 1405 | Ga0439458_0002342 | |||
| 1406 | Ga0439434_0014704 | |||
| 1407 | Ga0451577_0052176 | |||
| 1408 | Ga0466969_0004974 | |||
| 1409 | Ga0466969_0035054 | |||
| 1410 | Ga0466969_0056306 | |||
| 1411 | Ga0466969_0061669 | |||
| 1412 | Ga0466972_0006814 | |||
| 1413 | Ga0466972_0007313 | |||
| 1414 | Ga0466972_0020389 | |||
| 1415 | Ga0466972_0068328 | |||
| 1416 | Ga0466972_0070849 | |||
| 1417 | Ga0466972_0072263 | |||
| 1418 | Ga0466972_0133857 | |||
| 1419 | Ga0466972_0150263 | |||
| 1420 | Ga0466965_0000715 | |||
| 1421 | Ga0466965_0004463 | |||
| 1422 | Ga0466965_0014544 | |||
| 1423 | Ga0466965_0036099 | |||
| 1424 | Ga0466965_0047301 | |||
| 1425 | Ga0466965_0083675 | |||
| 1426 | Ga0466965_0118354 | |||
| 1427 | Ga0466965_0223760 | |||
| 1428 | Ga0466965_0254302 | |||
| 1429 | Ga0466965_0256161 | |||
| 1430 | Ga0466966_0023182 | |||
| 1431 | Ga0466966_0043589 | |||
| 1432 | Ga0466966_0059232 | |||
| 1433 | Ga0466966_0096465 | |||
| 1434 | Ga0466966_0120796 | |||
| 1435 | Ga0466966_0164873 | |||
| 1436 | Ga0466966_0329001 | |||
| 1437 | Ga0466961_0005346 | |||
| 1438 | Ga0466961_0021513 | |||
| 1439 | Ga0466961_0023802 | |||
| 1440 | Ga0466961_0045577 | |||
| 1441 | Ga0466961_0045889 | |||
| 1442 | Ga0466961_0059876 | |||
| 1443 | Ga0466961_0072868 | |||
| 1444 | Ga0466961_0121598 | |||
| 1445 | Ga0466961_0175550 | |||
| 1446 | Ga0466961_0290667 | |||
| 1447 | Ga0466961_0369938 | |||
| 1448 | Ga0466963_0004247 | |||
| 1449 | Ga0466963_0031776 | |||
| 1450 | Ga0466963_0167953 | |||
| 1451 | Ga0466963_0474135 | |||
| 1452 | Ga0466964_0007480 | |||
| 1453 | Ga0466964_0012185 | |||
| 1454 | Ga0466964_0040086 | |||
| 1455 | Ga0466964_0314419 | |||
| 1456 | Ga0453684_0074082 | |||
| 1457 | Ga0466971_0001330 | |||
| 1458 | Ga0466971_0006890 | |||
| 1459 | Ga0466971_0018948 | |||
| 1460 | Ga0466971_0023338 | |||
| 1461 | Ga0466971_0196136 | |||
| 1462 | Ga0466968_0063490 | |||
| 1463 | Ga0466970_0011013 | |||
| 1464 | Ga0466970_0022923 | |||
| 1465 | Ga0466970_0031983 | |||
| 1466 | Ga0466970_0039169 | |||
| 1467 | Ga0466970_0055806 | |||
| 1468 | Ga0466970_0062138 | |||
| 1469 | Ga0466970_0067473 | |||
| 1470 | Ga0466970_0073299 | |||
| 1471 | Ga0466970_0184461 | |||
| 1472 | Ga0466970_0246910 | |||
| 1473 | Ga0466970_0370736 | |||
| 1474 | Ga0466957_0002267 | |||
| 1475 | Ga0466957_0004703 | |||
| 1476 | Ga0466957_0012592 | |||
| 1477 | Ga0466957_0099303 | |||
| 1478 | Ga0466960_0006811 | |||
| 1479 | Ga0466960_0010425 | |||
| 1480 | Ga0466960_0015766 | |||
| 1481 | Ga0466960_0023436 | |||
| 1482 | Ga0466960_0030358 | |||
| 1483 | Ga0466960_0050125 | |||
| 1484 | Ga0466960_0186744 | |||
| 1485 | Ga0466960_0492422 | |||
| 1486 | Ga0466960_0500207 | |||
| 1487 | Ga0466959_0005786 | |||
| 1488 | Ga0466959_0026569 | |||
| 1489 | Ga0466959_0034787 | |||
| 1490 | Ga0466959_0038841 | |||
| 1491 | Ga0466959_0274011 | |||
| 1492 | Ga0466958_0016938 | |||
| 1493 | Ga0466958_0058011 | |||
| 1494 | Ga0466958_0201850 | |||
| 1495 | Ga0466958_0597288 | |||
| 1496 | Ga0466967_0028650 | |||
| 1497 | Ga0466967_0036868 | |||
| 1498 | Ga0466967_0063164 | |||
| 1499 | Ga0466967_0066702 | |||
| 1500 | Ga0466967_0118561 | |||
| 1501 | Ga0466967_0123701 | |||
| 1502 | Ga0466967_0194204 | |||
| 1503 | Ga0466967_0265494 | |||
| 1504 | Ga0466967_0307852 | |||
| 1505 | Ga0466967_0568035 | |||
| 1506 | Ga0466967_0650376 | |||
| 1507 | Ga0466967_0653931 | |||
| 1508 | Ga0466967_0655677 | |||
| 1509 | Ga0466967_1191049 | |||
| 1510 | Ga0466967_1254526 | |||
| 1511 | Ga0495617_006503 | |||
| 1512 | Ga0495592_0003095 | |||
| 1513 | Ga0495592_0019854 | |||
| 1514 | Ga0495592_0025032 | |||
| 1515 | Ga0495603_0078604 | |||
| 1516 | Ga0495590_0127995 | |||
| 1517 | Ga0495629_0005989 | |||
| 1518 | Ga0495629_0078762 | |||
| 1519 | Ga0495629_0331774 | |||
| 1520 | Ga0495629_0336737 | |||
| 1521 | Ga0495638_0021796 | |||
| 1522 | Ga0495638_0056550 | |||
| 1523 | Ga0495641_0086934 | |||
| 1524 | Ga0495651_0005161 | |||
| 1525 | Ga0495651_0034606 | |||
| 1526 | Ga0495651_0092796 | |||
| 1527 | Ga0495653_0003422 | |||
| 1528 | Ga0495580_0008997 | |||
| 1529 | Ga0495605_0001675 | |||
| 1530 | Ga0495639_0058635 | |||
| 1531 | Ga0495662_0004562 | |||
| 1532 | Ga0495664_0005608 | |||
| 1533 | Ga0495664_0067176 | |||
| 1534 | Ga0495664_0302484 | |||
| 1535 | Ga0495585_0008236 | |||
| 1536 | Ga0495585_0208841 | |||
| 1537 | Ga0495594_0053781 | |||
| 1538 | Ga0495594_0209768 | |||
| 1539 | Ga0495596_0099536 | |||
| 1540 | Ga0495596_0112765 | |||
| 1541 | Ga0495607_0325929 | |||
| 1542 | Ga0495583_0094465 | |||
| 1543 | Ga0495606_0001850 | |||
| 1544 | Ga0495608_0004003 | |||
| 1545 | Ga0495610_0015548 | |||
| 1546 | Ga0495616_0005137 | |||
| 1547 | Ga0495618_0038161 | |||
| 1548 | Ga0495618_0110900 | |||
| 1549 | Ga0495620_0071042 | |||
| 1550 | Ga0495628_0010442 | |||
| 1551 | Ga0495628_0052747 | |||
| 1552 | Ga0495630_0003722 | |||
| 1553 | Ga0495630_0259623 | |||
| 1554 | Ga0495631_0022038 | |||
| 1555 | Ga0495632_0166013 | |||
| 1556 | Ga0495643_0014861 | |||
| 1557 | Ga0495643_0016786 | |||
| 1558 | Ga0495648_0063869 | |||
| 1559 | Ga0495666_0002064 | |||
| 1560 | Ga0495666_0045916 | |||
| 1561 | Ga0495642_0297082 | |||
| 1562 | Ga0495652_0034123 | |||
| 1563 | Ga0495654_0006973 | |||
| 1564 | Ga0495665_0000429 | |||
| 1565 | Ga0495640_0002937 | |||
| 1566 | Ga0495640_0003552 | |||
| 1567 | Ga0495640_0010149 | |||
| 1568 | Ga0495609_0133817 | |||
| 1569 | Ga0495597_0070764 | |||
| 1570 | Ga0495645_0013370 | |||
| 1571 | Ga0495645_0168249 | |||
| 1572 | Ga0495633_0012373 | |||
| 1573 | Ga0495633_0047313 | |||
| 1574 | Ga0495667_0239208 | |||
| 1575 | Ga0495656_0149364 | |||
| 1576 | Ga0495668_0010309 | |||
| 1577 | Ga0495634_0006662 | |||
| 1578 | Ga0495634_0019788 | |||
| 1579 | Ga0495611_0159762 | |||
| 1580 | Ga0495625_0004464 | |||
| 1581 | Ga0495625_0020688 | |||
| 1582 | Ga0495661_0021798 | |||
| 1583 | Ga0495588_0001032 | |||
| 1584 | Ga0495657_0016668 | |||
| 1585 | Ga0495657_0042216 | |||
| 1586 | Ga0495657_0172428 | |||
| 1587 | Ga0495599_0014736 | |||
| 1588 | Ga0495599_0262545 | |||
| 1589 | Ga0495623_0016899 | |||
| 1590 | Ga0495623_0072393 | |||
| 1591 | Ga0495646_0008076 | |||
| 1592 | Ga0495658_0026150 | |||
| 1593 | Ga0495613_0019423 | |||
| 1594 | Ga0495613_0036762 | |||
| 1595 | Ga0495613_0308573 | |||
| 1596 | Ga0495624_0050354 | |||
| 1597 | Ga0495624_0112449 | |||
| 1598 | Ga0495670_0003415 | |||
| 1599 | Ga0495670_0079092 | |||
| 1600 | Ga0495671_0003551 | |||
| 1601 | Ga0495649_0188997 | |||
| 1602 | Ga0495649_0228648 | |||
| 1603 | Ga0495649_0260465 | |||
| 1604 | Ga0495589_0074225 | |||
| 1605 | Ga0495589_0136992 | |||
| 1606 | Ga0495600_0015742 | |||
| 1607 | Ga0495600_0036788 | |||
| 1608 | Ga0495600_0134806 | |||
| 1609 | Ga0495660_0029459 | |||
| 1610 | Ga0495581_0073414 | |||
| 1611 | Ga0495581_0218547 | |||
| 1612 | Ga0495604_0001544 | |||
| 1613 | Ga0495604_0017669 | |||
| 1614 | Ga0495604_0020517 | |||
| 1615 | Ga0495604_0038660 | |||
| 1616 | Ga0495674_0097685 | |||
| 1617 | Ga0495674_0100020 | |||
| 1618 | Ga0495672_0100087 | |||
| 1619 | Ga0495676_0004653 | |||
| 1620 | Ga0495676_0091066 | |||
| 1621 | Ga0495676_0480568 | |||
| 1622 | Ga0495680_0005653 | |||
| 1623 | Ga0495683_0015695 | |||
| 1624 | Ga0495687_013209 | |||
| 1625 | Ga0495687_019086 | |||
| 1626 | Ga0495687_034585 | |||
| 1627 | Ga0495675_0030475 | |||
| 1628 | Ga0495675_0108650 | |||
| 1629 | Ga0495675_0128999 | |||
| 1630 | Ga0495675_0136995 | |||
| 1631 | Ga0495677_0094431 | |||
| 1632 | Ga0495685_000208 | |||
| 1633 | Ga0495685_068751 | |||
| 1634 | Ga0495681_0001401 | |||
| 1635 | Ga0495681_0005767 | |||
| 1636 | Ga0495681_0082040 | |||
| 1637 | Ga0495684_0011563 | |||
| 1638 | Ga0495684_0316267 | |||
| 1639 | Ga0495686_0019900 | |||
| 1640 | Ga0495686_0067948 | |||
| 1641 | Ga0495686_0068230 | |||
| 1642 | Ga0495593_0025215 | |||
| 1643 | Ga0495602_0004329 | |||
| 1644 | Ga0495602_0186885 | |||
| 1645 | Ga0495614_0021191 | |||
| 1646 | Ga0495614_0061593 | |||
| 1647 | Ga0495626_0009338 | |||
| 1648 | Ga0496100_0557620 | |||
| 1649 | Ga0496101_0007043 | |||
| 1650 | Ga0496102_0059503 | |||
| 1651 | Ga0496102_0073936 | |||
| 1652 | Ga0496103_0017558 | |||
| 1653 | Ga0496103_0030095 | |||
| 1654 | Ga0496104_0214482 | |||
| 1655 | Ga0496106_0076410 | |||
| 1656 | Ga0496106_0202027 | |||
| 1657 | Ga0496106_0367620 | |||
| 1658 | Ga0496107_0089094 | |||
| 1659 | Ga0496107_0257936 | |||
| 1660 | Ga0496108_0020531 | |||
| 1661 | Ga0496108_0027320 | |||
| 1662 | Ga0496108_0116181 | |||
| 1663 | Ga0496108_0151100 | |||
| 1664 | Ga0496108_0545715 | |||
| 1665 | Ga0496109_0018653 | |||
| 1666 | Ga0496109_0214887 | |||
| 1667 | Ga0496109_0427587 | |||
| 1668 | Ga0496109_0594830 | |||
| 1669 | Ga0496110_0023038 | |||
| 1670 | Ga0496110_0070304 | |||
| 1671 | Ga0496110_0150551 | |||
| 1672 | Ga0496110_0195849 | |||
| 1673 | Ga0496111_0004558 | |||
| 1674 | Ga0496111_0092364 | |||
| 1675 | Ga0496111_0176670 | |||
| 1676 | Ga0496111_0415429 | |||
| 1677 | Ga0496111_0547580 | |||
| 1678 | Ga0496112_0700030 | |||
| 1679 | Ga0496114_0238270 | |||
| 1680 | Ga0496124_0185713 | |||
| 1681 | Ga0496124_0223077 | |||
| 1682 | Ga0501306_007606 | |||
| 1683 | Ga0501306_024658 | |||
| 1684 | Ga0501308_002154 | |||
| 1685 | Ga0501308_027399 | |||
| 1686 | Ga0501309_006033 | |||
| 1687 | Ga0501309_007585 | |||
| 1688 | Ga0501309_016816 | |||
| 1689 | Ga0501304_005879 | |||
| 1690 | Ga0501305_006624 | |||
| 1691 | Ga0495678_019451 | |||
| 1692 | Ga0495682_0012223 | |||
| 1693 | Ga0501298_045347 | |||
| 1694 | Ga0501311_001743 | |||
| 1695 | Ga0501311_007004 | |||
| 1696 | Ga0501312_015254 | |||
| 1697 | Ga0501313_030107 | |||
| 1698 | Ga0501313_034065 | |||
| 1699 | Ga0501315_005062 | |||
| 1700 | Ga0501315_036102 | |||
| 1701 | Ga0501316_004718 | |||
| 1702 | Ga0501316_007434 | |||
| 1703 | Ga0501316_028781 | |||
| 1704 | Ga0501317_041610 | |||
| 1705 | Ga0501318_001870 | |||
| 1706 | Ga0501318_005094 | |||
| 1707 | Ga0501319_003204 | |||
| 1708 | Ga0501319_010473 | |||
| 1709 | Ga0501320_001852 | |||
| 1710 | Ga0501320_014040 | |||
| 1711 | Ga0501321_001880 | |||
| 1712 | Ga0501321_013235 | |||
| 1713 | Ga0501322_009988 | |||
| 1714 | Ga0501323_000098 | |||
| 1715 | Ga0501323_009765 | |||
| 1716 | Ga0501323_020172 | |||
| 1717 | Ga0501323_022298 | |||
| 1718 | Ga0501324_000124 | |||
| 1719 | Ga0501324_001483 | |||
| 1720 | Ga0501325_003318 | |||
| 1721 | Ga0501325_030237 | |||
| 1722 | Ga0501031_0018454 | |||
| 1723 | Ga0501031_0041389 | |||
| 1724 | Ga0501031_0064199 | |||
| 1725 | Ga0501031_0110007 | |||
| 1726 | Ga0501031_0189540 | |||
| 1727 | Ga0501032_0073341 | |||
| 1728 | Ga0501032_0074874 | |||
| 1729 | Ga0501032_0140205 | |||
| 1730 | Ga0501032_0225998 | |||
| 1731 | Ga0501032_0229336 | |||
| 1732 | Ga0501032_0242330 | |||
| 1733 | Ga0501032_0500602 | |||
| 1734 | Ga0501033_0010580 | |||
| 1735 | Ga0501033_0018738 | |||
| 1736 | Ga0501033_0021776 | |||
| 1737 | Ga0501033_0043604 | |||
| 1738 | Ga0501033_0049426 | |||
| 1739 | Ga0501033_0096199 | |||
| 1740 | Ga0501034_0037146 | |||
| 1741 | Ga0501034_0068055 | |||
| 1742 | Ga0501034_0069400 | |||
| 1743 | Ga0501034_0098549 | |||
| 1744 | Ga0501034_0118128 | |||
| 1745 | Ga0501034_0179088 | |||
| 1746 | Ga0501034_0223953 | |||
| 1747 | Ga0501034_0250323 | |||
| 1748 | Ga0501034_0454361 | |||
| 1749 | Ga0501036_0000809 | |||
| 1750 | Ga0501036_0008414 | |||
| 1751 | Ga0501036_0022196 | |||
| 1752 | Ga0501036_0043265 | |||
| 1753 | Ga0501036_0051672 | |||
| 1754 | Ga0501036_0250173 | |||
| 1755 | Ga0501036_0277937 | |||
| 1756 | Ga0501036_0302994 | |||
| 1757 | Ga0501036_0587100 | |||
| 1758 | Ga0501037_0177644 | |||
| 1759 | Ga0501037_0180349 | |||
| 1760 | Ga0501037_0311826 | |||
| 1761 | Ga0501037_0314303 | |||
| 1762 | Ga0501037_0335339 | |||
| 1763 | Ga0501037_0344551 | |||
| 1764 | Ga0501038_0000986 | |||
| 1765 | Ga0501038_0004611 | |||
| 1766 | Ga0501038_0025754 | |||
| 1767 | Ga0501038_0054524 | |||
| 1768 | Ga0501038_0058470 | |||
| 1769 | Ga0501038_0361755 | |||
| 1770 | Ga0501039_0005182 | |||
| 1771 | Ga0501039_0111716 | |||
| 1772 | Ga0501039_0126406 | |||
| 1773 | Ga0501039_0174514 | |||
| 1774 | Ga0501039_0187343 | |||
| 1775 | Ga0501039_0245697 | |||
| 1776 | Ga0501039_0296390 | |||
| 1777 | Ga0501039_0321903 | |||
| 1778 | Ga0501039_0413472 | |||
| 1779 | Ga0501039_0487305 | |||
| 1780 | Ga0501040_0021720 | |||
| 1781 | Ga0501040_0119259 | |||
| 1782 | Ga0501040_0320098 | |||
| 1783 | Ga0501041_0104887 | |||
| 1784 | Ga0501042_0016910 | |||
| 1785 | Ga0501042_0107411 | |||
| 1786 | Ga0501042_0163598 | |||
| 1787 | Ga0501042_0292969 | |||
| 1788 | Ga0501043_0003346 | |||
| 1789 | Ga0501043_0011549 | |||
| 1790 | Ga0501043_0111139 | |||
| 1791 | Ga0501043_0132741 | |||
| 1792 | Ga0501043_0136150 | |||
| 1793 | Ga0501043_0157583 | |||
| 1794 | Ga0501043_0265341 | |||
| 1795 | Ga0501046_0017081 | |||
| 1796 | Ga0501046_0044895 | |||
| 1797 | Ga0501046_0048664 | |||
| 1798 | Ga0501046_0072458 | |||
| 1799 | Ga0501047_0000025 | |||
| 1800 | Ga0501047_0013895 | |||
| 1801 | Ga0501047_0086590 | |||
| 1802 | Ga0501047_0165882 | |||
| 1803 | Ga0501047_0269914 | |||
| 1804 | Ga0501047_0381684 | |||
| 1805 | Ga0501048_0007025 | |||
| 1806 | Ga0501048_0011025 | |||
| 1807 | Ga0501048_0023084 | |||
| 1808 | Ga0501048_0167883 | |||
| 1809 | Ga0501048_0604384 | |||
| 1810 | Ga0501067_0009172 | |||
| 1811 | Ga0501067_0031418 | |||
| 1812 | Ga0501067_0045352 | |||
| 1813 | Ga0501067_0062048 | |||
| 1814 | Ga0501067_0082480 | |||
| 1815 | Ga0501067_0098951 | |||
| 1816 | Ga0501067_0199471 | |||
| 1817 | Ga0501067_0344030 | |||
| 1818 | Ga0501067_0458346 | |||
| 1819 | Ga0501068_0060059 | |||
| 1820 | Ga0501068_0078144 | |||
| 1821 | Ga0501068_0568813 | |||
| 1822 | Ga0501069_0025074 | |||
| 1823 | Ga0501069_0086255 | |||
| 1824 | Ga0501069_0113884 | |||
| 1825 | Ga0501070_0001766 | |||
| 1826 | Ga0501070_0015466 | |||
| 1827 | Ga0501070_0024032 | |||
| 1828 | Ga0501070_0038518 | |||
| 1829 | Ga0501070_0101595 | |||
| 1830 | Ga0501070_0147922 | |||
| 1831 | Ga0501070_0154616 | |||
| 1832 | Ga0501070_0184600 | |||
| 1833 | Ga0501070_0560128 | |||
| 1834 | Ga0501070_0590632 | |||
| 1835 | Ga0501070_0863473 | |||
| 1836 | Ga0501071_0004926 | |||
| 1837 | Ga0501071_0022463 | |||
| 1838 | Ga0501071_0067578 | |||
| 1839 | Ga0501072_0014217 | |||
| 1840 | Ga0501072_0033664 | |||
| 1841 | Ga0501072_0049711 | |||
| 1842 | Ga0501072_0124844 | |||
| 1843 | Ga0501072_0332097 | |||
| 1844 | Ga0501073_0005833 | |||
| 1845 | Ga0501073_0032335 | |||
| 1846 | Ga0501073_0043777 | |||
| 1847 | Ga0501073_0073924 | |||
| 1848 | Ga0501073_0155986 | |||
| 1849 | Ga0501074_0000332 | |||
| 1850 | Ga0501074_0018619 | |||
| 1851 | Ga0501074_0163471 | |||
| 1852 | Ga0501075_0050601 | |||
| 1853 | Ga0501075_0483986 | |||
| 1854 | Ga0501076_0042229 | |||
| 1855 | Ga0501076_0109499 | |||
| 1856 | Ga0501076_0311498 | |||
| 1857 | Ga0501077_0001085 | |||
| 1858 | Ga0501077_0052451 | |||
| 1859 | Ga0501077_0324375 | |||
| 1860 | Ga0501206_004491 | |||
| 1861 | Ga0501208_075059 | |||
| 1862 | Ga0501233_040755 | |||
| 1863 | Ga0501257_129115 | |||
| 1864 | Ga0501079_0007427 | |||
| 1865 | Ga0501079_0106826 | |||
| 1866 | Ga0501079_0170974 | |||
| 1867 | Ga0501080_0058672 | |||
| 1868 | Ga0501080_0307712 | |||
| 1869 | Ga0501080_0370605 | |||
| 1870 | Ga0501081_0231559 | |||
| 1871 | Ga0501083_0004399 | |||
| 1872 | Ga0501035_0008456 | |||
| 1873 | Ga0501035_0015345 | |||
| 1874 | Ga0501035_0035265 | |||
| 1875 | Ga0501035_0046902 | |||
| 1876 | Ga0501035_0055144 | |||
| 1877 | Ga0501035_0177702 | |||
| 1878 | Ga0501035_0216133 | |||
| 1879 | Ga0501035_0253543 | |||
| 1880 | Ga0501035_0292545 | |||
| 1881 | Ga0501035_0308292 | |||
| 1882 | Ga0501035_0398510 | |||
| 1883 | Ga0501035_0507164 | |||
| 1884 | Ga0501035_0649653 | |||
| 1885 | Ga0501044_0005123 | |||
| 1886 | Ga0501044_0007826 | |||
| 1887 | Ga0501044_0029805 | |||
| 1888 | Ga0501044_0054400 | |||
| 1889 | Ga0501044_0397809 | |||
| 1890 | Ga0501044_0427169 | |||
| 1891 | Ga0501044_0460223 | |||
| 1892 | Ga0501044_0626536 | |||
| 1893 | Ga0501044_0627680 | |||
| 1894 | Ga0501045_0124139 | |||
| 1895 | Ga0501045_0217094 | |||
| 1896 | nmdc:mga03683_18082_c1 | |||
| 1897 | nmdc:mga03n38_108625_c1 | |||
| 1898 | nmdc:mga03n38_112337_c1 | |||
| 1899 | nmdc:mga03n38_14627_c1 | |||
| 1900 | nmdc:mga03n38_168573_c1 | |||
| 1901 | nmdc:mga03n38_198990_c1 | |||
| 1902 | nmdc:mga03n38_242525_c1 | |||
| 1903 | nmdc:mga03n38_263010_c1 | |||
| 1904 | nmdc:mga03n38_44072_c1 | |||
| 1905 | nmdc:mga03n38_57360_c1 | |||
| 1906 | nmdc:mga00v17_101889_c1 | |||
| 1907 | nmdc:mga00v17_103675_c1 | |||
| 1908 | nmdc:mga00v17_106534_c1 | |||
| 1909 | nmdc:mga00v17_146230_c1 | |||
| 1910 | nmdc:mga00v17_16796_c1 | |||
| 1911 | nmdc:mga00v17_26746_c1 | |||
| 1912 | nmdc:mga00v17_34082_c1 | |||
| 1913 | nmdc:mga00v17_83346_c1 | |||
| 1914 | nmdc:mga00v17_87190_c1 | |||
| 1915 | nmdc:mga0yw44_39695_c1 | |||
| 1916 | nmdc:mga0yw44_4297_c1 | |||
| 1917 | nmdc:mga0yw44_432338_c1 | |||
| 1918 | nmdc:mga0yw44_48106_c1 | |||
| 1919 | nmdc:mga0yw44_570_c2 | |||
| 1920 | nmdc:mga0yw44_593240_c1 | |||
| 1921 | nmdc:mga06z11_153311_c1 | |||
| 1922 | nmdc:mga06z11_153733_c1 | |||
| 1923 | nmdc:mga06z11_17729_c1 | |||
| 1924 | nmdc:mga06z11_21636_c1 | |||
| 1925 | nmdc:mga06z11_2888_c1 | |||
| 1926 | nmdc:mga06z11_29702_c1 | |||
| 1927 | nmdc:mga04h51_31060_c1 | |||
| 1928 | nmdc:mga04h51_346956_c1 | |||
| 1929 | nmdc:mga04h51_7896_c1 | |||
| 1930 | nmdc:mga04h51_8493_c1 | |||
| 1931 | nmdc:mga07m45_105263_c1 | |||
| 1932 | nmdc:mga07m45_111576_c1 | |||
| 1933 | nmdc:mga07m45_206501_c1 | |||
| 1934 | nmdc:mga07m45_299815_c1 | |||
| 1935 | nmdc:mga07m45_38031_c1 | |||
| 1936 | nmdc:mga07m45_45772_c1 | |||
| 1937 | nmdc:mga07m45_52993_c1 | |||
| 1938 | nmdc:mga07m45_81851_c1 | |||
| 1939 | nmdc:mga08y16_1503206_c1 | |||
| 1940 | nmdc:mga0n895_1175822_c1 | |||
| 1941 | Ga0495601_0007875 | |||
| 1942 | Ga0495601_0461798 | |||
| 1943 | Ga0500610_0093778 | |||
| 1944 | Ga0495655_0028678 | |||
| 1945 | Ga0495655_0037836 | |||
| 1946 | Ga0495655_0046328 | |||
| 1947 | Ga0495619_0010826 | |||
| 1948 | Ga0495619_0019030 | |||
| 1949 | Ga0500578_0011067 | |||
| 1950 | Ga0500644_0000315 | |||
| 1951 | Ga0500654_041639 | |||
| 1952 | Ga0500660_072870 | |||
| 1953 | Ga0500554_029427 | |||
| 1954 | Ga0500556_0003839 | |||
| 1955 | Ga0500560_002243 | |||
| 1956 | Ga0500560_068585 | |||
| 1957 | Ga0500569_001311 | |||
| 1958 | Ga0500593_000520 | |||
| 1959 | Ga0500594_0092057 | |||
| 1960 | Ga0500628_002039 | |||
| 1961 | Ga0500628_146037 | |||
| 1962 | Ga0500652_001328 | |||
| 1963 | Ga0500658_0009326 | |||
| 1964 | Ga0500561_0000210 | |||
| 1965 | Ga0500573_0003247 | |||
| 1966 | Ga0500573_0048333 | |||
| 1967 | Ga0500577_0259975 | |||
| 1968 | Ga0500579_056393 | |||
| 1969 | Ga0500600_0012307 | |||
| 1970 | Ga0500603_035556 | |||
| 1971 | Ga0500606_089661 | |||
| 1972 | Ga0500616_0002786 | |||
| 1973 | Ga0500633_0000718 | |||
| 1974 | Ga0500633_0228862 | |||
| 1975 | Ga0500634_0008013 | |||
| 1976 | Ga0500656_001093 | |||
| 1977 | Ga0500587_000429 | |||
| 1978 | Ga0501084_0232071 | |||
| 1979 | Ga0590075_059817 | |||
| 1980 | Ga0587098_004278 | |||
| 1981 | Ga0587106_051245 | |||
| 1982 | Ga0587099_008043 | |||
| 1983 | Ga0587062_016770 | |||
| 1984 | Ga0587119_022745 | |||
| 1985 | Ga0587071_066715 | |||
| 1986 | Ga0501082_0091447 | |||
| 1987 | Ga0501082_0177876 | |||
| 1988 | Ga0501082_0342366 | |||
| 1989 | Ga0466962_0005850 | |||
| 1990 | Ga0466962_0007798 | |||
| 1991 | Ga0466962_0007857 | |||
| 1992 | Ga0466962_0017971 | |||
| 1993 | Ga0466962_0063102 | |||
| 1994 | Ga0466962_0114975 | |||
| 1995 | Ga0530510_0218603 | |||
| 1996 | Ga0530510_0433236 | |||
| 1997 | 2547406852 | |||
| 1998 | 2585304821 | |||
| 1999 | 2585319465 | |||
| 2000 | 2616700748 | |||
| 2001 | 2643828098 | |||
| 2002 | 2643892430 | |||
| 2003 | 2643961482 | |||
| 2004 | 2644018675 | |||
| 2005 | 2644032417 | |||
| 2006 | 2644090745 | |||
| 2007 | 2644102694 | |||
| 2008 | 2644118356 | |||
| 2009 | 2644179810 | |||
| 2010 | 2644231289 | |||
| 2011 | 2644320549 | |||
| 2012 | 2644436398 | |||
| 2013 | 2644531187 | |||
| 2014 | 2644625750 | |||
| 2015 | 2738870595 | |||
| 2016 | 2740166616 | |||
| 2017 | 2768646032 | |||
| 2018 | 2774393803 | |||
| 2019 | 2784587879 | |||
| 2020 | 2785344267 | |||
| 2021 | 2785368602 | |||
| 2022 | 2786669706 | |||
| 2023 | 2804844894 | |||
| 2024 | 2808841286 | |||
| 2025 | 2808919794 | |||
| 2026 | 2809195322 | |||
| 2027 | 2809231466 | |||
| 2028 | 2812334123 | |||
| 2029 | 2812350196 | |||
| 2030 | 2812358972 | |||
| 2031 | 2812481218 | |||
| 2032 | 2819742836 | |||
| 2033 | 2819747076 | |||
| 2034 | 2852642212 | |||
| 2035 | 2855387439 | |||
| 2036 | 2857482791 | |||
| 2037 | 2862288129 | |||
| 2038 | 2862295660 | |||
| 2039 | 2862392446 | |||
| 2040 | 2862509502 | |||
| 2041 | 2862711030 | |||
| 2042 | 2863068556 | |||
| 2043 | 2863405520 | |||
| 2044 | 2867348148 | |||
| 2045 | 2867371109 | |||
| 2046 | 2867431826 | |||
| 2047 | 2867479683 | |||
| 2048 | 2867480750 | |||
| 2049 | 2877681925 | |||
| 2050 | 2891972179 | |||
| 2051 | 2912720894 | |||
| 2052 | 2918507061 | |||
| 2053 | 2919468687 | |||
| 2054 | 2946066905 | |||
| 2055 | 2954003640 | |||
| 2056 | 2954387049 | |||
| 2057 | 2954676114 | |||
| 2058 | 2954688053 | |||
| 2059 | 2954697885 | |||
| 2060 | 2954704331 | |||
| 2061 | 2954716996 | |||
| 2062 | 2954726947 | |||
| 2063 | 2954734850 | |||
| 2064 | 2954745868 | |||
| 2065 | 2954753722 | |||
| 2066 | 2954764841 | |||
| 2067 | 2984577143 | |||
| 2068 | 2990046520 | |||
| 2069 | 2990061882 | |||
| 2070 | 2990093401 | |||
| 2071 | 2990260464 | |||
| 2072 | 2995471131 | |||
| 2073 | 2997456562 | |||
| 2074 | 3006427300 | |||
| 2075 | 3006501785 | |||
| 2076 | 8008488822 | |||
| 2077 | 8008559553 | |||
| 2078 | 8023629284 | |||
| 2079 | 8025419332 | |||
| 2080 | 8025528305 | |||
| 2081 | 8033686010 | |||
| 2082 | 8048407143 | |||
| 2083 | 8054165018 | |||
| 2084 | 8054612347 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hln-assembly2.cif.gz_T | crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds | 0.9934 | 37 | 207 |
| 4emm-assembly1.cif.gz_B | crystal structure of staphylococcus aureus clpp in compact conformation | 0.9912 | 37 | 207 |
| 3hln-assembly2.cif.gz_1 | crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds | 0.9911 | 37 | 207 |
| 7p81-assembly2.cif.gz_R | crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) | 0.9906 | 37 | 207 |
| 3hln-assembly2.cif.gz_U | crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds | 0.9901 | 37 | 209 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2PMR0_6_196_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.981 | 37 | 207 | 3.90.226.10 |
| af_Q9SAA2_76_271_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9764 | 37 | 209 | 3.90.226.10 |
| 1yg8S00 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9664 | 32 | 209 | 3.90.226.10 |
| af_A0A0R0FC89_136_330_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9648 | 37 | 212 | 3.90.226.10 |
| af_P9WPC3_1_214_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9586 | 38 | 210 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B8IUF6-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 1.002 | 37 | 116 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |
| AF-A0A6M0C5U5-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 1.002 | 37 | 107 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |
| AF-A0A7V4Q6M0-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 1.001 | 37 | 125 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |
| AF-A0A1Y3JBH1-F1-model_v4 | deleted | 1.001 | 37 | 111 |
|
| AF-A0A355EXG5-F1-model_v4 | ATP-dependent Clp protease proteolytic subunit | 1 | 37 | 107 |
GO:0004176
GO:0004252 GO:0006515 GO:0009368 GO:0051117 |