F488892

General Info

Members Datasets Scaffolds Average Seq Length
1043 512 2084 207

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0008782|Ga0466969_0008782_3829_4521
Length 230
Sequence VTAAFDDQPSCQQRAGGYVTIPQISMPGLVTPRAAGDIGAGGLGDQVYNRLLNERIIFLGQQVDDDIANKITAQLLLLAADPEKDIFLYINSPGGSVTAGMAIYDTMQYIKNDVVTIAMGMAASMGQFLLTAGAKGKRFALPNAEILMHQPSAGLGGSATDIRIQAQQLVRMKHRMAELIAEHSGQTVDQITKDSDRDRWFTPIEAKEYGLIDNIMHSASDVPGGGGTGA

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
65 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
142 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
143 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
144 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
145 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
146 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
147 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
148 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
165 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
166 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
175 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
180 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
181 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
182 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
183 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
184 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
185 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
189 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
192 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
195 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
196 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
197 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
198 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
199 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
200 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
201 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
202 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
203 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
204 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
205 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
206 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
222 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
223 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
224 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
225 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
228 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
246 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
247 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
248 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
249 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
250 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
251 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
252 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
255 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
256 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
257 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
260 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
261 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
262 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
263 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
264 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
265 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
266 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
267 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
271 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
272 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
273 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
274 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
275 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
276 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
277 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
278 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
279 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
280 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
283 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
284 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
285 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
286 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
295 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
296 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
297 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
298 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
299 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
300 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
301 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
304 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
319 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
325 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
326 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
327 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
343 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
345 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
353 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
357 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
358 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
368 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
369 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
370 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
371 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
372 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
373 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
374 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
375 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
377 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
378 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
379 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
380 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
381 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
382 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
383 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
384 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
385 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
386 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
387 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
388 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
389 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
390 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
391 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
392 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
393 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
394 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
395 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
396 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
397 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
398 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
399 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
400 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
401 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
402 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
403 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
404 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
405 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
406 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
407 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
408 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
409 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
410 3300053152 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 endosphere Metagenome Endosphere
411 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
412 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
413 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
414 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
415 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
416 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
417 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
418 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
425 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
426 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
427 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
428 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
429 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
430 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
431 2643221561 Nocardioides sp. Root151 Isolate Unclassified
432 2643221576 Nocardioides sp. Root614 Isolate Unclassified
433 2643221590 Nocardioides sp. Root682 Isolate Unclassified
434 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
435 2643221604 Nocardioides sp. Root190 Isolate Unclassified
436 2643221615 Nocardioides sp. Root224 Isolate Unclassified
437 2643221617 Nocardioides sp. Root79 Isolate Unclassified
438 2643221620 Nocardioides sp. Root240 Isolate Unclassified
439 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
440 2643221641 Nocardioides sp. Root122 Isolate Unclassified
441 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
442 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
443 2643221696 Nocardioides sp. Root140 Isolate Unclassified
444 2643221714 Streptomyces sp. Root264 Isolate Unclassified
445 2738541305 Nocardioides sp. CF167 Isolate Unclassified
446 2739367898 Nocardioides sp. CF479 Isolate Unclassified
447 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
448 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
449 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
450 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
451 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
452 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
453 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
454 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
455 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
456 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
457 2808606448 Streptomyces sp. 193411 Isolate Unclassified
458 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
459 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
460 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
461 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
462 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
463 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
464 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
465 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
466 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
467 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
468 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
469 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
470 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
471 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
472 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
473 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
474 2867369537 Streptomyces sp. Z26 Isolate Unclassified
475 2867428634 Streptomyces sp. RP5T Isolate Unclassified
476 2867475112 Streptomyces sp. TM32 Isolate Unclassified
477 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
478 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
479 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
480 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
481 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
482 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
483 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
484 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
485 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
486 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
487 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
488 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
489 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
490 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
491 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
492 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
493 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
494 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
495 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
496 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
497 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
498 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
499 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
500 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
501 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
502 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
503 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
504 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
505 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
506 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
507 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
508 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
509 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
510 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
511 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
512 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.48
Metatranscriptomes 5.08
Isolates 8.44

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 10.35
Nodule 0.29
Rhizoplane 3.45
Rhizosphere 76.22
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0008782 3300044656 Bacteria 5356
2 LJQas_1005528 3300000549 Bacteria 1600
3 JGI24739J22299_10072289 3300001989 Bacteria 1072
4 JGI24737J22298_10009059 3300001990 Bacteria 3318
5 JGI24737J22298_10013219 3300001990 Bacteria 2688
6 JGI24735J21928_10012392 3300002067 Bacteria 2695
7 JGI24750J21931_1005874 3300002070 Bacteria 1516
8 JGI24738J21930_10004960 3300002075 Bacteria 3220
9 JGI24738J21930_10006440 3300002075 Bacteria 2753
10 JGI24744J21845_10000532 3300002077 Bacteria 6817
11 rootH1_10012683 3300003316 Bacteria 1356
12 rootH1_10012684 3300003316 Bacteria 3921
13 rootH2_10073426 3300003320 Bacteria 5794
14 rootH1_10019905 3300003323 Bacteria 2546
15 rootH1_10051264 3300003323 Bacteria 1568
16 Ga0006562J51391_1005843 3300003578 Bacteria 3210
17 Ga0007429J51699_1017997 3300003579 Bacteria 1215
18 Ga0058692_1045109 3300003856 Bacteria 753
19 Ga0058862_10006434 3300004803 Bacteria 1079
20 Ga0070676_10304244 3300005328 Bacteria 1082
21 Ga0070683_100013995 3300005329 Bacteria 7006
22 Ga0070683_100030501 3300005329 Bacteria 4896
23 Ga0070682_100011595 3300005337 Bacteria 5040
24 Ga0070682_100018717 3300005337 Bacteria 4053
25 Ga0070682_100132210 3300005337 Bacteria 1690
26 Ga0068868_100098699 3300005338 Bacteria 2361
27 Ga0068868_100325806 3300005338 Bacteria 1310
28 Ga0070660_100003302 3300005339 Bacteria 11087
29 Ga0070687_100718738 3300005343 Bacteria 699
30 Ga0070692_10020197 3300005345 Bacteria 3227
31 Ga0070692_10020439 3300005345 Bacteria 3211
32 Ga0070692_10201992 3300005345 Bacteria 1165
33 Ga0070692_10225107 3300005345 Bacteria 1111
34 Ga0070668_100116637 3300005347 Bacteria 2129
35 Ga0070668_100262850 3300005347 Bacteria 1436
36 Ga0070675_100182764 3300005354 Bacteria 1813
37 Ga0070675_100374960 3300005354 Bacteria 1265
38 Ga0070671_100548508 3300005355 Bacteria 997
39 Ga0070674_100005174 3300005356 Bacteria 7496
40 Ga0070674_100312722 3300005356 Bacteria 1256
41 Ga0070659_100019106 3300005366 Bacteria 5184
42 Ga0070659_100025275 3300005366 Bacteria 4558
43 Ga0070659_100277939 3300005366 Bacteria 1393
44 Ga0070659_100294972 3300005366 Bacteria 1351
45 Ga0070667_100072949 3300005367 Bacteria 2926
46 Ga0070667_100089384 3300005367 Bacteria 2646
47 Ga0070667_101097476 3300005367 Bacteria 744
48 Ga0070701_10094608 3300005438 Bacteria 1644
49 Ga0070700_100002303 3300005441 Bacteria 9716
50 Ga0070700_100020078 3300005441 Bacteria 3864
51 Ga0070663_100114837 3300005455 Bacteria 2027
52 Ga0070663_100685448 3300005455 Bacteria 870
53 Ga0070678_100030699 3300005456 Bacteria 3697
54 Ga0070678_100104615 3300005456 Bacteria 2202
55 Ga0070678_100265797 3300005456 Bacteria 1445
56 Ga0068867_100007389 3300005459 Bacteria 7773
57 Ga0068867_100278653 3300005459 Bacteria 1370
58 Ga0070685_10176701 3300005466 Bacteria 1371
59 Ga0070707_100400259 3300005468 Bacteria 1333
60 Ga0070698_100011005 3300005471 Bacteria 9624
61 Ga0070679_100809901 3300005530 Bacteria 880
62 Ga0070684_100004672 3300005535 Bacteria 10459
63 Ga0070684_100063833 3300005535 Bacteria 3230
64 Ga0070684_100468834 3300005535 Bacteria 1165
65 Ga0068853_100096039 3300005539 Bacteria 2614
66 Ga0068853_100137090 3300005539 Bacteria 2195
67 Ga0070672_100570698 3300005543 Bacteria 984
68 Ga0070665_100000868 3300005548 Bacteria 39125
69 Ga0068855_100248717 3300005563 Bacteria 1984
70 Ga0070664_100237931 3300005564 Bacteria 1634
71 Ga0068857_100014013 3300005577 Bacteria 6976
72 Ga0068856_100223417 3300005614 Bacteria 1899
73 Ga0068856_100240491 3300005614 Bacteria 1826
74 Ga0070702_100003489 3300005615 Bacteria 7037
75 Ga0070702_100026047 3300005615 Bacteria 3139
76 Ga0068852_100437444 3300005616 Bacteria 1292
77 Ga0068852_100456722 3300005616 Bacteria 1265
78 Ga0068861_100551188 3300005719 Bacteria 1051
79 Ga0068870_10061537 3300005840 Bacteria 2018
80 Ga0068863_100270128 3300005841 Bacteria 1646
81 Ga0068860_100000388 3300005843 Bacteria 57678
82 Ga0068860_100100623 3300005843 Bacteria 2758
83 Ga0081539_10045162 3300005985 Bacteria 2537
84 Ga0075365_10019907 3300006038 Bacteria 4152
85 Ga0075365_10050313 3300006038 Bacteria 2748
86 Ga0075365_10092348 3300006038 Bacteria 2064
87 Ga0075365_10163191 3300006038 Bacteria 1553
88 Ga0075365_10289099 3300006038 Bacteria 1153
89 Ga0075368_10000847 3300006042 Bacteria 9471
90 Ga0075368_10040813 3300006042 Bacteria 1822
91 Ga0075363_100046286 3300006048 Bacteria 2307
92 Ga0075363_100140083 3300006048 Bacteria 1361
93 Ga0075363_100193838 3300006048 Bacteria 1159
94 Ga0075364_10027506 3300006051 Bacteria 3633
95 Ga0075364_10045314 3300006051 Bacteria 2862
96 Ga0075364_10121077 3300006051 Bacteria 1751
97 Ga0075364_10255386 3300006051 Bacteria 1191
98 Ga0075364_10544477 3300006051 Bacteria 793
99 Ga0075362_10004276 3300006177 Bacteria 5104
100 Ga0075367_10000916 3300006178 Bacteria 11912
101 Ga0075367_10037203 3300006178 Bacteria 2827
102 Ga0075367_10051571 3300006178 Bacteria 2432
103 Ga0075367_10180919 3300006178 Bacteria 1314
104 Ga0075367_10298733 3300006178 Bacteria 1013
105 Ga0075370_10024322 3300006353 Bacteria 3345
106 Ga0075370_10033825 3300006353 Bacteria 2863
107 Ga0075370_10078090 3300006353 Bacteria 1900
108 Ga0075370_10094577 3300006353 Bacteria 1726
109 Ga0075370_10110304 3300006353 Bacteria 1597
110 Ga0075370_10150970 3300006353 Bacteria 1361
111 Ga0075370_10299968 3300006353 Bacteria 955
112 Ga0075428_100027812 3300006844 Bacteria 6256
113 Ga0075434_101136693 3300006871 Bacteria 794
114 Ga0068865_100004270 3300006881 Bacteria 8620
115 Ga0068865_100285919 3300006881 Bacteria 1314
116 Ga0105251_10026442 3300009011 Bacteria 2955
117 Ga0105244_10186991 3300009036 Bacteria 980
118 Ga0105250_10123393 3300009092 Bacteria 1066
119 Ga0105245_10002262 3300009098 Bacteria 17436
120 Ga0105245_10010146 3300009098 Bacteria 8202
121 Ga0105245_10589429 3300009098 Bacteria 1137
122 Ga0105245_10735571 3300009098 Bacteria 1022
123 Ga0105247_10292301 3300009101 Bacteria 1127
124 Ga0105243_10047697 3300009148 Bacteria 3374
125 Ga0105243_10083958 3300009148 Bacteria 2607
126 Ga0105243_10224256 3300009148 Bacteria 1663
127 Ga0105242_11308610 3300009176 Bacteria 749
128 Ga0105248_10190351 3300009177 Bacteria 2312
129 Ga0105237_10071232 3300009545 Bacteria 3471
130 Ga0105237_10655307 3300009545 Bacteria 1056
131 Ga0105238_10807971 3300009551 Bacteria 954
132 Ga0105249_10058933 3300009553 Bacteria 3521
133 Ga0105239_10001318 3300010375 Bacteria 33415
134 Ga0105239_10002798 3300010375 Bacteria 21821
135 Ga0105246_10014826 3300011119 Bacteria 4909
136 Ga0105246_10043532 3300011119 Bacteria 3047
137 Ga0157369_10095838 3300013105 Bacteria 3165
138 Ga0157369_10707971 3300013105 Bacteria 1037
139 Ga0157374_10702417 3300013296 Bacteria 1024
140 Ga0163162_10035603 3300013306 Bacteria 4960
141 Ga0157372_10027521 3300013307 Bacteria 6194
142 Ga0157372_10131496 3300013307 Bacteria 2880
143 Ga0157375_11307411 3300013308 Bacteria 853
144 Ga0163163_10129334 3300014325 Bacteria 2565
145 Ga0163163_10160525 3300014325 Bacteria 2293
146 Ga0163163_10365416 3300014325 Bacteria 1500
147 Ga0157380_10005485 3300014326 Bacteria 8863
148 Ga0182008_10016002 3300014497 Bacteria 3905
149 Ga0157377_10026897 3300014745 Bacteria 3083
150 Ga0157379_10040240 3300014968 Bacteria 4171
151 Ga0157376_10216925 3300014969 Bacteria 1770
152 Ga0157376_10356554 3300014969 Bacteria 1401
153 Ga0182007_10001964 3300015262 Bacteria 10620
154 Ga0183367_1006 3300015688 Bacteria 648044
155 Ga0163161_10048837 3300017792 Bacteria 3056
156 Ga0197907_10046109 3300020069 Bacteria 1203
157 Ga0206351_10711097 3300020077 Bacteria 2906
158 Ga0206350_10490934 3300020080 Bacteria 961
159 Ga0206350_11446792 3300020080 Bacteria 855
160 Ga0206350_11624171 3300020080 Bacteria 825
161 Ga0154015_1288929 3300020610 Bacteria 2267
162 Ga0213875_10025417 3300021388 Bacteria 2821
163 Ga0224712_10104738 3300022467 Bacteria 1205
164 Ga0209758_1003504 3300025297 Bacteria 14174
165 Ga0207426_1003149 3300025302 Bacteria 9372
166 Ga0207426_1016168 3300025302 Bacteria 2687
167 Ga0209051_1091365 3300025303 Bacteria 846
168 Ga0207713_1013108 3300025735 Bacteria 4390
169 Ga0207688_10071323 3300025901 Bacteria 1972
170 Ga0207688_10347469 3300025901 Bacteria 913
171 Ga0207647_10010116 3300025904 Bacteria 6669
172 Ga0207647_10011522 3300025904 Bacteria 6198
173 Ga0207647_10059649 3300025904 Bacteria 2334
174 Ga0207671_10087463 3300025914 Bacteria 2343
175 Ga0207671_10127920 3300025914 Bacteria 1948
176 Ga0207662_10079336 3300025918 Bacteria 2000
177 Ga0207662_10379942 3300025918 Bacteria 954
178 Ga0207657_10042184 3300025919 Bacteria 4027
179 Ga0207646_10129704 3300025922 Bacteria 2269
180 Ga0207694_10095551 3300025924 Bacteria 2350
181 Ga0207650_10650748 3300025925 Bacteria 888
182 Ga0207659_10187588 3300025926 Bacteria 1643
183 Ga0207659_10315041 3300025926 Bacteria 1289
184 Ga0207687_10010027 3300025927 Bacteria 6198
185 Ga0207687_10146799 3300025927 Bacteria 1795
186 Ga0207690_10014894 3300025932 Bacteria 4706
187 Ga0207690_10036521 3300025932 Bacteria 3182
188 Ga0207706_10165774 3300025933 Bacteria 1942
189 Ga0207706_10294118 3300025933 Bacteria 1415
190 Ga0207706_10490933 3300025933 Bacteria 1060
191 Ga0207686_10220313 3300025934 Bacteria 1370
192 Ga0207709_10005306 3300025935 Bacteria 7331
193 Ga0207709_10068435 3300025935 Bacteria 2244
194 Ga0207709_10506130 3300025935 Bacteria 943
195 Ga0207669_10012594 3300025937 Bacteria 4164
196 Ga0207669_10190593 3300025937 Bacteria 1479
197 Ga0207691_10003002 3300025940 Bacteria 16471
198 Ga0207691_10081757 3300025940 Bacteria 2903
199 Ga0207711_10322118 3300025941 Bacteria 1428
200 Ga0207689_10427852 3300025942 Bacteria 1105
201 Ga0207689_10757743 3300025942 Bacteria 819
202 Ga0207661_10005512 3300025944 Bacteria 8927
203 Ga0207661_10203304 3300025944 Bacteria 1742
204 Ga0207661_10764360 3300025944 Bacteria 889
205 Ga0207651_10218246 3300025960 Bacteria 1540
206 Ga0207651_11014393 3300025960 Bacteria 742
207 Ga0207712_10097291 3300025961 Bacteria 2180
208 Ga0207668_10340952 3300025972 Bacteria 1250
209 Ga0207668_11185697 3300025972 Bacteria 686
210 Ga0207658_10013451 3300025986 Bacteria 5590
211 Ga0207658_10158162 3300025986 Bacteria 1854
212 Ga0207677_10004641 3300026023 Bacteria 7397
213 Ga0207677_10094319 3300026023 Bacteria 2184
214 Ga0207703_10794898 3300026035 Bacteria 903
215 Ga0207678_10127572 3300026067 Bacteria 2170
216 Ga0207708_10001371 3300026075 Bacteria 18327
217 Ga0207708_10095894 3300026075 Bacteria 2291
218 Ga0207702_10126503 3300026078 Bacteria 2295
219 Ga0207641_10805802 3300026088 Bacteria 929
220 Ga0207648_10056730 3300026089 Bacteria 3417
221 Ga0207648_10453504 3300026089 Bacteria 1168
222 Ga0207674_10007577 3300026116 Bacteria 12649
223 Ga0207674_10803636 3300026116 Bacteria 908
224 Ga0207675_100007138 3300026118 Bacteria 10557
225 Ga0207675_100089750 3300026118 Bacteria 2889
226 Ga0207675_100118612 3300026118 Bacteria 2502
227 Ga0207683_10052995 3300026121 Bacteria 3556
228 Ga0207683_10093108 3300026121 Bacteria 2685
229 Ga0207683_10121129 3300026121 Bacteria 2349
230 Ga0207698_10019604 3300026142 Bacteria 4634
231 Ga0207698_10044631 3300026142 Bacteria 3332
232 Ga0209371_1009821 3300027312 Bacteria 3008
233 Ga0209371_1023114 3300027312 Bacteria 1470
234 Ga0209813_10000658 3300027866 Bacteria 7921
235 Ga0209813_10005764 3300027866 Bacteria 3025
236 Ga0209813_10050640 3300027866 Bacteria 1297
237 Ga0207428_10241590 3300027907 Bacteria 1349
238 Ga0268266_10001392 3300028379 Bacteria 28952
239 Ga0268266_10081155 3300028379 Bacteria 2827
240 Ga0268266_10121698 3300028379 Bacteria 2323
241 Ga0268264_10000387 3300028381 Bacteria 63349
242 Ga0307517_10003800 3300028786 Bacteria 23438
243 Ga0307517_10007226 3300028786 Bacteria 16257
244 Ga0307515_10002026 3300028794 Bacteria 44830
245 Ga0268256_1010880 3300030500 Bacteria 2921
246 Ga0307511_10001267 3300030521 Bacteria 26758
247 Ga0307511_10082268 3300030521 Bacteria 2253
248 Ga0307512_10013231 3300030522 Bacteria 7744
249 Ga0316183_1192358 3300030742 Bacteria 1265
250 Ga0316181_1029856 3300030744 Bacteria 1884
251 Ga0265340_10036704 3300031247 Bacteria 2428
252 Ga0307513_10210165 3300031456 Bacteria 1778
253 Ga0307513_10312574 3300031456 Bacteria 1332
254 Ga0307509_10121232 3300031507 Bacteria 2592
255 Ga0307509_10131531 3300031507 Bacteria 2457
256 Ga0307408_100320242 3300031548 Bacteria 1306
257 Ga0307508_10021403 3300031616 Bacteria 5879
258 Ga0307514_10078495 3300031649 Bacteria 2451
259 Ga0307514_10114213 3300031649 Bacteria 1904
260 Ga0307516_10059421 3300031730 Bacteria 3718
261 Ga0307516_10096309 3300031730 Bacteria 2780
262 Ga0307405_10231258 3300031731 Bacteria 1363
263 Ga0307405_10816385 3300031731 Bacteria 782
264 Ga0307413_10132629 3300031824 Bacteria 1708
265 Ga0307413_10596728 3300031824 Bacteria 903
266 Ga0307518_10126214 3300031838 Bacteria 1804
267 Ga0307518_10176835 3300031838 Bacteria 1448
268 Ga0307410_10094609 3300031852 Bacteria 2129
269 Ga0307406_10080163 3300031901 Bacteria 2167
270 Ga0307406_10300299 3300031901 Bacteria 1233
271 Ga0307407_10020689 3300031903 Bacteria 3376
272 Ga0307407_10102976 3300031903 Bacteria 1776
273 Ga0307407_10142825 3300031903 Bacteria 1546
274 Ga0307412_10050300 3300031911 Bacteria 2750
275 Ga0307412_10067839 3300031911 Bacteria 2423
276 Ga0307412_10166467 3300031911 Bacteria 1644
277 Ga0307412_10284600 3300031911 Bacteria 1299
278 Ga0307412_10768719 3300031911 Bacteria 833
279 Ga0307409_100021958 3300031995 Bacteria 4389
280 Ga0307409_100069450 3300031995 Bacteria 2791
281 Ga0307409_100204584 3300031995 Bacteria 1769
282 Ga0307409_100393645 3300031995 Bacteria 1321
283 Ga0307409_100411779 3300031995 Bacteria 1294
284 Ga0307409_100717134 3300031995 Bacteria 1001
285 Ga0307409_100816992 3300031995 Bacteria 941
286 Ga0307416_100068237 3300032002 Bacteria 2937
287 Ga0307416_100105910 3300032002 Bacteria 2463
288 Ga0307416_100284691 3300032002 Bacteria 1632
289 Ga0307416_100539334 3300032002 Bacteria 1238
290 Ga0307414_10361762 3300032004 Bacteria 1249
291 Ga0307411_10466321 3300032005 Bacteria 1060
292 Ga0307415_100293226 3300032126 Bacteria 1344
293 Ga0307415_100314316 3300032126 Bacteria 1303
294 Ga0307415_100353041 3300032126 Bacteria 1238
295 Ga0307507_10067643 3300033179 Bacteria 3265
296 Ga0307510_10200261 3300033180 Bacteria 1532
297 Ga0307510_10215164 3300033180 Bacteria 1439
298 Ga0373928_0045395 3300035084 Bacteria 1023
299 Ga0373952_0030824 3300035092 Bacteria 1190
300 Ga0395899_0203417 3300037312 Bacteria 1379
301 Ga0395899_0258850 3300037312 Bacteria 1191
302 Ga0395898_0029023 3300037466 Bacteria 5543
303 Ga0395898_0059562 3300037466 Bacteria 3713
304 Ga0395905_0012411 3300037471 Bacteria 8201
305 Ga0395905_0057280 3300037471 Bacteria 3646
306 Ga0395905_0216579 3300037471 Bacteria 1793
307 Ga0395905_0451928 3300037471 Bacteria 1183
308 Ga0395905_0761137 3300037471 Bacteria 871
309 Ga0436364_0961922 3300037853 Bacteria 760
310 Ga0436364_1191885 3300037853 Bacteria 734
311 Ga0436364_1267828 3300037853 Bacteria 8283
312 Ga0436364_1376765 3300037853 Bacteria 741
313 Ga0395901_0034440 3300038443 Bacteria 5230
314 Ga0395901_0081403 3300038443 Bacteria 3382
315 Ga0395901_0083782 3300038443 Bacteria 3333
316 Ga0395901_0140674 3300038443 Bacteria 2536
317 Ga0395901_0930851 3300038443 Bacteria 849
318 Ga0242420_004572 3300038996 Bacteria 2099
319 Ga0400483_018528 3300039062 Bacteria 3832
320 Ga0400483_023161 3300039062 Bacteria 3323
321 Ga0400483_076896 3300039062 Bacteria 54063
322 Ga0400483_103660 3300039062 Bacteria 17083
323 Ga0400483_198923 3300039062 Bacteria 2222
324 Ga0400483_204522 3300039062 Bacteria 44473
325 Ga0400483_248013 3300039062 Bacteria 2072
326 Ga0400483_254236 3300039062 Bacteria 8575
327 Ga0436365_0096389 3300039437 Bacteria 1009
328 Ga0436365_1477850 3300039437 Bacteria 859
329 Ga0439436_0005153 3300041404 Bacteria 4007
330 Ga0439465_0080308 3300041413 Bacteria 1105
331 Ga0451789_0623635 3300041443 Bacteria 681
332 Ga0451797_1306219 3300041453 Bacteria 840
333 Ga0451795_0427087 3300041456 Bacteria 926
334 Ga0451798_1153288 3300041458 Bacteria 744
335 Ga0451841_0903274 3300041498 Bacteria 996
336 Ga0451847_0525880 3300041503 Bacteria 1213
337 Ga0451843_1108888 3300041509 Bacteria 1223
338 Ga0451853_0989324 3300041512 Bacteria 1906
339 Ga0451853_1505240 3300041512 Bacteria 1760
340 Ga0451853_1770887 3300041512 Bacteria 7057
341 Ga0439431_0003253 3300041997 Bacteria 3574
342 Ga0439433_0003818 3300041999 Bacteria 3239
343 Ga0439442_010904 3300042002 Bacteria 1846
344 Ga0439442_037697 3300042002 Bacteria 1013
345 Ga0439448_0003369 3300042005 Bacteria 4427
346 Ga0439448_0029859 3300042005 Bacteria 1727
347 Ga0439432_067955 3300042006 Bacteria 1090
348 Ga0439449_0009834 3300042007 Bacteria 3619
349 Ga0439455_0005439 3300042012 Bacteria 2588
350 Ga0439457_005336 3300042014 Bacteria 3247
351 Ga0439462_0057931 3300042015 Bacteria 1047
352 Ga0450890_018387 3300042127 Bacteria 935
353 Ga0450897_016869 3300042128 Bacteria 756
354 Ga0450895_009203 3300042132 Bacteria 834
355 Ga0450896_019611 3300042133 Bacteria 985
356 Ga0450898_015127 3300042134 Bacteria 1304
357 Ga0450899_001701 3300042135 Bacteria 2433
358 Ga0450900_021765 3300042136 Bacteria 897
359 Ga0450903_000064 3300042138 Bacteria 21230
360 Ga0450904_014518 3300042139 Bacteria 786
361 Ga0450906_001453 3300042145 Bacteria 5158
362 Ga0450907_017642 3300042146 Bacteria 1191
363 Ga0439458_0002342 3300042157 Bacteria 4647
364 Ga0439434_0014704 3300042435 Bacteria 2329
365 Ga0451577_0052176 3300042876 Bacteria 3651
366 Ga0466969_0004974 3300044656 Bacteria 7078
367 Ga0466969_0035054 3300044656 Bacteria 2540
368 Ga0466969_0056306 3300044656 Bacteria 1920
369 Ga0466969_0061669 3300044656 Bacteria 1821
370 Ga0466972_0006814 3300044658 Bacteria 5734
371 Ga0466972_0007313 3300044658 Bacteria 5542
372 Ga0466972_0020389 3300044658 Bacteria 3313
373 Ga0466972_0068328 3300044658 Bacteria 1697
374 Ga0466972_0070849 3300044658 Bacteria 1663
375 Ga0466972_0072263 3300044658 Bacteria 1645
376 Ga0466972_0133857 3300044658 Bacteria 1167
377 Ga0466972_0150263 3300044658 Bacteria 1095
378 Ga0466965_0000715 3300044683 Bacteria 12381
379 Ga0466965_0004463 3300044683 Bacteria 6225
380 Ga0466965_0014544 3300044683 Bacteria 3726
381 Ga0466965_0036099 3300044683 Bacteria 2424
382 Ga0466965_0047301 3300044683 Bacteria 2130
383 Ga0466965_0083675 3300044683 Bacteria 1615
384 Ga0466965_0118354 3300044683 Bacteria 1366
385 Ga0466965_0223760 3300044683 Bacteria 1003
386 Ga0466965_0254302 3300044683 Bacteria 943
387 Ga0466965_0256161 3300044683 Bacteria 940
388 Ga0466966_0023182 3300044684 Bacteria 4065
389 Ga0466966_0043589 3300044684 Bacteria 2875
390 Ga0466966_0059232 3300044684 Bacteria 2418
391 Ga0466966_0096465 3300044684 Bacteria 1831
392 Ga0466966_0120796 3300044684 Bacteria 1609
393 Ga0466966_0164873 3300044684 Bacteria 1348
394 Ga0466966_0329001 3300044684 Bacteria 918
395 Ga0466961_0005346 3300044693 Bacteria 8083
396 Ga0466961_0021513 3300044693 Bacteria 4151
397 Ga0466961_0023802 3300044693 Bacteria 3941
398 Ga0466961_0045577 3300044693 Bacteria 2806
399 Ga0466961_0045889 3300044693 Bacteria 2795
400 Ga0466961_0059876 3300044693 Bacteria 2421
401 Ga0466961_0072868 3300044693 Bacteria 2178
402 Ga0466961_0121598 3300044693 Bacteria 1639
403 Ga0466961_0175550 3300044693 Bacteria 1331
404 Ga0466961_0290667 3300044693 Bacteria 999
405 Ga0466961_0369938 3300044693 Bacteria 871
406 Ga0466963_0004247 3300044694 Bacteria 8311
407 Ga0466963_0031776 3300044694 Bacteria 3414
408 Ga0466963_0167953 3300044694 Bacteria 1528
409 Ga0466963_0474135 3300044694 Bacteria 883
410 Ga0466964_0007480 3300044706 Bacteria 4088
411 Ga0466964_0012185 3300044706 Bacteria 3252
412 Ga0466964_0040086 3300044706 Bacteria 1890
413 Ga0466964_0314419 3300044706 Bacteria 794
414 Ga0453684_0074082 3300044712 Bacteria 4289
415 Ga0466971_0001330 3300044719 Bacteria 10335
416 Ga0466971_0006890 3300044719 Bacteria 4939
417 Ga0466971_0018948 3300044719 Bacteria 3052
418 Ga0466971_0023338 3300044719 Bacteria 2757
419 Ga0466971_0196136 3300044719 Bacteria 952
420 Ga0466968_0063490 3300044735 Bacteria 1596
421 Ga0466970_0011013 3300044765 Bacteria 4602
422 Ga0466970_0022923 3300044765 Bacteria 3257
423 Ga0466970_0031983 3300044765 Bacteria 2780
424 Ga0466970_0039169 3300044765 Bacteria 2515
425 Ga0466970_0055806 3300044765 Bacteria 2110
426 Ga0466970_0062138 3300044765 Bacteria 2002
427 Ga0466970_0067473 3300044765 Bacteria 1921
428 Ga0466970_0073299 3300044765 Bacteria 1842
429 Ga0466970_0184461 3300044765 Bacteria 1158
430 Ga0466970_0246910 3300044765 Bacteria 999
431 Ga0466970_0370736 3300044765 Bacteria 814
432 Ga0466957_0002267 3300044842 Bacteria 10304
433 Ga0466957_0004703 3300044842 Bacteria 7638
434 Ga0466957_0012592 3300044842 Bacteria 4897
435 Ga0466957_0099303 3300044842 Bacteria 1833
436 Ga0466960_0006811 3300044901 Bacteria 4604
437 Ga0466960_0010425 3300044901 Bacteria 3861
438 Ga0466960_0015766 3300044901 Bacteria 3264
439 Ga0466960_0023436 3300044901 Bacteria 2771
440 Ga0466960_0030358 3300044901 Bacteria 2486
441 Ga0466960_0050125 3300044901 Bacteria 2012
442 Ga0466960_0186744 3300044901 Bacteria 1126
443 Ga0466960_0492422 3300044901 Bacteria 717
444 Ga0466960_0500207 3300044901 Bacteria 712
445 Ga0466959_0005786 3300045049 Bacteria 8516
446 Ga0466959_0026569 3300045049 Bacteria 4290
447 Ga0466959_0034787 3300045049 Bacteria 3726
448 Ga0466959_0038841 3300045049 Bacteria 3517
449 Ga0466959_0274011 3300045049 Bacteria 1159
450 Ga0466958_0016938 3300045836 Bacteria 4204
451 Ga0466958_0058011 3300045836 Bacteria 2353
452 Ga0466958_0201850 3300045836 Bacteria 1265
453 Ga0466958_0597288 3300045836 Bacteria 718
454 Ga0466967_0028650 3300045976 Bacteria 4652
455 Ga0466967_0036868 3300045976 Bacteria 4178
456 Ga0466967_0063164 3300045976 Bacteria 3289
457 Ga0466967_0066702 3300045976 Bacteria 3207
458 Ga0466967_0118561 3300045976 Bacteria 2441
459 Ga0466967_0123701 3300045976 Bacteria 2393
460 Ga0466967_0194204 3300045976 Bacteria 1920
461 Ga0466967_0265494 3300045976 Bacteria 1643
462 Ga0466967_0307852 3300045976 Bacteria 1525
463 Ga0466967_0568035 3300045976 Bacteria 1117
464 Ga0466967_0650376 3300045976 Bacteria 1042
465 Ga0466967_0653931 3300045976 Bacteria 1039
466 Ga0466967_0655677 3300045976 Bacteria 1038
467 Ga0466967_1191049 3300045976 Bacteria 759
468 Ga0466967_1254526 3300045976 Bacteria 738
469 Ga0495617_006503 3300046452 Bacteria 4092
470 Ga0495592_0003095 3300046454 Bacteria 11879
471 Ga0495592_0019854 3300046454 Bacteria 5109
472 Ga0495592_0025032 3300046454 Bacteria 4533
473 Ga0495603_0078604 3300046455 Bacteria 1934
474 Ga0495590_0127995 3300046457 Bacteria 912
475 Ga0495629_0005989 3300046459 Bacteria 9044
476 Ga0495629_0078762 3300046459 Bacteria 2300
477 Ga0495629_0331774 3300046459 Bacteria 1039
478 Ga0495629_0336737 3300046459 Bacteria 1030
479 Ga0495638_0021796 3300046460 Bacteria 4213
480 Ga0495638_0056550 3300046460 Bacteria 2434
481 Ga0495641_0086934 3300046461 Bacteria 1399
482 Ga0495651_0005161 3300046462 Bacteria 9958
483 Ga0495651_0034606 3300046462 Bacteria 3937
484 Ga0495651_0092796 3300046462 Bacteria 2261
485 Ga0495653_0003422 3300046463 Bacteria 12760
486 Ga0495580_0008997 3300046472 Bacteria 7885
487 Ga0495605_0001675 3300046474 Bacteria 14245
488 Ga0495639_0058635 3300046475 Bacteria 1761
489 Ga0495662_0004562 3300046476 Bacteria 6947
490 Ga0495664_0005608 3300046477 Bacteria 6904
491 Ga0495664_0067176 3300046477 Bacteria 2139
492 Ga0495664_0302484 3300046477 Bacteria 965
493 Ga0495585_0008236 3300046492 Bacteria 6329
494 Ga0495585_0208841 3300046492 Bacteria 990
495 Ga0495594_0053781 3300046499 Bacteria 2218
496 Ga0495594_0209768 3300046499 Bacteria 1110
497 Ga0495596_0099536 3300046500 Bacteria 1129
498 Ga0495596_0112765 3300046500 Bacteria 1056
499 Ga0495607_0325929 3300046501 Bacteria 715
500 Ga0495583_0094465 3300046506 Bacteria 1283
501 Ga0495606_0001850 3300046507 Bacteria 26642
502 Ga0495608_0004003 3300046511 Bacteria 10578
503 Ga0495610_0015548 3300046512 Bacteria 4417
504 Ga0495616_0005137 3300046513 Bacteria 8123
505 Ga0495618_0038161 3300046514 Bacteria 3018
506 Ga0495618_0110900 3300046514 Bacteria 1756
507 Ga0495620_0071042 3300046515 Bacteria 1424
508 Ga0495628_0010442 3300046516 Bacteria 7886
509 Ga0495628_0052747 3300046516 Bacteria 3212
510 Ga0495630_0003722 3300046517 Bacteria 10632
511 Ga0495630_0259623 3300046517 Bacteria 1327
512 Ga0495631_0022038 3300046518 Bacteria 2962
513 Ga0495632_0166013 3300046519 Bacteria 1015
514 Ga0495643_0014861 3300046522 Bacteria 4620
515 Ga0495643_0016786 3300046522 Bacteria 4296
516 Ga0495648_0063869 3300046524 Bacteria 2171
517 Ga0495666_0002064 3300046526 Bacteria 9944
518 Ga0495666_0045916 3300046526 Bacteria 2106
519 Ga0495642_0297082 3300046528 Bacteria 707
520 Ga0495652_0034123 3300046529 Bacteria 4436
521 Ga0495654_0006973 3300046530 Bacteria 6365
522 Ga0495665_0000429 3300046531 Bacteria 21413
523 Ga0495640_0002937 3300046533 Bacteria 13724
524 Ga0495640_0003552 3300046533 Bacteria 12522
525 Ga0495640_0010149 3300046533 Bacteria 7299
526 Ga0495609_0133817 3300046538 Bacteria 1060
527 Ga0495597_0070764 3300046542 Bacteria 1503
528 Ga0495645_0013370 3300046543 Bacteria 5800
529 Ga0495645_0168249 3300046543 Bacteria 1510
530 Ga0495633_0012373 3300046558 Bacteria 4542
531 Ga0495633_0047313 3300046558 Bacteria 2033
532 Ga0495667_0239208 3300046559 Bacteria 1157
533 Ga0495656_0149364 3300046615 Bacteria 1127
534 Ga0495668_0010309 3300046616 Bacteria 5663
535 Ga0495634_0006662 3300046642 Bacteria 8759
536 Ga0495634_0019788 3300046642 Bacteria 4778
537 Ga0495611_0159762 3300046648 Bacteria 1053
538 Ga0495625_0004464 3300046660 Bacteria 13220
539 Ga0495625_0020688 3300046660 Bacteria 5072
540 Ga0495661_0021798 3300046665 Bacteria 4171
541 Ga0495588_0001032 3300046674 Bacteria 12113
542 Ga0495657_0016668 3300046675 Bacteria 5347
543 Ga0495657_0042216 3300046675 Bacteria 3115
544 Ga0495657_0172428 3300046675 Bacteria 1331
545 Ga0495599_0014736 3300046678 Bacteria 4840
546 Ga0495599_0262545 3300046678 Bacteria 1049
547 Ga0495623_0016899 3300046679 Bacteria 4712
548 Ga0495623_0072393 3300046679 Bacteria 2143
549 Ga0495646_0008076 3300046680 Bacteria 6688
550 Ga0495658_0026150 3300046683 Bacteria 3125
551 Ga0495613_0019423 3300046689 Bacteria 5063
552 Ga0495613_0036762 3300046689 Bacteria 3631
553 Ga0495613_0308573 3300046689 Bacteria 1094
554 Ga0495624_0050354 3300046690 Bacteria 2639
555 Ga0495624_0112449 3300046690 Bacteria 1674
556 Ga0495670_0003415 3300046691 Bacteria 7804
557 Ga0495670_0079092 3300046691 Bacteria 1673
558 Ga0495671_0003551 3300046692 Bacteria 9530
559 Ga0495649_0188997 3300046694 Bacteria 1072
560 Ga0495649_0228648 3300046694 Bacteria 960
561 Ga0495649_0260465 3300046694 Bacteria 889
562 Ga0495589_0074225 3300046794 Bacteria 1659
563 Ga0495589_0136992 3300046794 Bacteria 1173
564 Ga0495600_0015742 3300046809 Bacteria 4788
565 Ga0495600_0036788 3300046809 Bacteria 3181
566 Ga0495600_0134806 3300046809 Bacteria 1604
567 Ga0495660_0029459 3300046810 Bacteria 3096
568 Ga0495581_0073414 3300047315 Bacteria 1979
569 Ga0495581_0218547 3300047315 Bacteria 1114
570 Ga0495604_0001544 3300047317 Bacteria 18967
571 Ga0495604_0017669 3300047317 Bacteria 5708
572 Ga0495604_0020517 3300047317 Bacteria 5278
573 Ga0495604_0038660 3300047317 Bacteria 3753
574 Ga0495674_0097685 3300047319 Bacteria 2501
575 Ga0495674_0100020 3300047319 Bacteria 2468
576 Ga0495672_0100087 3300047320 Bacteria 1574
577 Ga0495676_0004653 3300047321 Bacteria 12570
578 Ga0495676_0091066 3300047321 Bacteria 2280
579 Ga0495676_0480568 3300047321 Bacteria 817
580 Ga0495680_0005653 3300047322 Bacteria 11711
581 Ga0495683_0015695 3300047323 Bacteria 3934
582 Ga0495687_013209 3300047443 Bacteria 4322
583 Ga0495687_019086 3300047443 Bacteria 3373
584 Ga0495687_034585 3300047443 Bacteria 2281
585 Ga0495675_0030475 3300047444 Bacteria 3441
586 Ga0495675_0108650 3300047444 Bacteria 1732
587 Ga0495675_0128999 3300047444 Bacteria 1572
588 Ga0495675_0136995 3300047444 Bacteria 1519
589 Ga0495677_0094431 3300047445 Bacteria 1129
590 Ga0495685_000208 3300047447 Bacteria 19755
591 Ga0495685_068751 3300047447 Bacteria 1188
592 Ga0495681_0001401 3300047470 Bacteria 18150
593 Ga0495681_0005767 3300047470 Bacteria 8234
594 Ga0495681_0082040 3300047470 Bacteria 1437
595 Ga0495684_0011563 3300047471 Bacteria 6816
596 Ga0495684_0316267 3300047471 Bacteria 1117
597 Ga0495686_0019900 3300047472 Bacteria 4479
598 Ga0495686_0067948 3300047472 Bacteria 2199
599 Ga0495686_0068230 3300047472 Bacteria 2194
600 Ga0495593_0025215 3300047673 Bacteria 3291
601 Ga0495602_0004329 3300048088 Bacteria 14797
602 Ga0495602_0186885 3300048088 Bacteria 1592
603 Ga0495614_0021191 3300048089 Bacteria 2808
604 Ga0495614_0061593 3300048089 Bacteria 1612
605 Ga0495626_0009338 3300048091 Bacteria 5305
606 Ga0496100_0557620 3300048903 Bacteria 887
607 Ga0496101_0007043 3300048904 Bacteria 7267
608 Ga0496102_0059503 3300048905 Bacteria 3493
609 Ga0496102_0073936 3300048905 Bacteria 3132
610 Ga0496103_0017558 3300048906 Bacteria 4283
611 Ga0496103_0030095 3300048906 Bacteria 3302
612 Ga0496104_0214482 3300048907 Bacteria 1837
613 Ga0496106_0076410 3300048909 Bacteria 2567
614 Ga0496106_0202027 3300048909 Bacteria 1582
615 Ga0496106_0367620 3300048909 Bacteria 1156
616 Ga0496107_0089094 3300048910 Bacteria 2253
617 Ga0496107_0257936 3300048910 Bacteria 1297
618 Ga0496108_0020531 3300048911 Bacteria 5429
619 Ga0496108_0027320 3300048911 Bacteria 4711
620 Ga0496108_0116181 3300048911 Bacteria 2292
621 Ga0496108_0151100 3300048911 Bacteria 2004
622 Ga0496108_0545715 3300048911 Bacteria 1011
623 Ga0496109_0018653 3300048912 Bacteria 6097
624 Ga0496109_0214887 3300048912 Bacteria 1808
625 Ga0496109_0427587 3300048912 Bacteria 1251
626 Ga0496109_0594830 3300048912 Bacteria 1042
627 Ga0496110_0023038 3300048913 Bacteria 5295
628 Ga0496110_0070304 3300048913 Bacteria 3101
629 Ga0496110_0150551 3300048913 Bacteria 2107
630 Ga0496110_0195849 3300048913 Bacteria 1835
631 Ga0496111_0004558 3300048914 Bacteria 8771
632 Ga0496111_0092364 3300048914 Bacteria 2218
633 Ga0496111_0176670 3300048914 Bacteria 1587
634 Ga0496111_0415429 3300048914 Bacteria 994
635 Ga0496111_0547580 3300048914 Bacteria 850
636 Ga0496112_0700030 3300048915 Bacteria 941
637 Ga0496114_0238270 3300048917 Bacteria 1599
638 Ga0496124_0185713 3300048927 Bacteria 1596
639 Ga0496124_0223077 3300048927 Bacteria 1416
640 Ga0501306_007606 3300049127 Bacteria 1301
641 Ga0501306_024658 3300049127 Bacteria 861
642 Ga0501308_002154 3300049128 Bacteria 1693
643 Ga0501308_027399 3300049128 Bacteria 748
644 Ga0501309_006033 3300049129 Bacteria 1464
645 Ga0501309_007585 3300049129 Bacteria 1348
646 Ga0501309_016816 3300049129 Bacteria 1000
647 Ga0501304_005879 3300049160 Bacteria 974
648 Ga0501305_006624 3300049161 Bacteria 1444
649 Ga0495678_019451 3300049459 Bacteria 3028
650 Ga0495682_0012223 3300049460 Bacteria 3294
651 Ga0501298_045347 3300049521 Bacteria 900
652 Ga0501311_001743 3300049527 Bacteria 1967
653 Ga0501311_007004 3300049527 Bacteria 1287
654 Ga0501312_015254 3300049528 Bacteria 1088
655 Ga0501313_030107 3300049529 Bacteria 701
656 Ga0501313_034065 3300049529 Bacteria 668
657 Ga0501315_005062 3300049531 Bacteria 1410
658 Ga0501315_036102 3300049531 Bacteria 732
659 Ga0501316_004718 3300049532 Bacteria 1381
660 Ga0501316_007434 3300049532 Bacteria 1190
661 Ga0501316_028781 3300049532 Bacteria 735
662 Ga0501317_041610 3300049533 Bacteria 703
663 Ga0501318_001870 3300049534 Bacteria 1740
664 Ga0501318_005094 3300049534 Bacteria 1288
665 Ga0501319_003204 3300049535 Bacteria 1083
666 Ga0501319_010473 3300049535 Bacteria 738
667 Ga0501320_001852 3300049536 Bacteria 1613
668 Ga0501320_014040 3300049536 Bacteria 861
669 Ga0501321_001880 3300049537 Bacteria 1748
670 Ga0501321_013235 3300049537 Bacteria 945
671 Ga0501322_009988 3300049538 Bacteria 725
672 Ga0501323_000098 3300049539 Bacteria 4633
673 Ga0501323_009765 3300049539 Bacteria 1135
674 Ga0501323_020172 3300049539 Bacteria 874
675 Ga0501323_022298 3300049539 Bacteria 843
676 Ga0501324_000124 3300049540 Bacteria 3139
677 Ga0501324_001483 3300049540 Bacteria 1570
678 Ga0501325_003318 3300049541 Bacteria 1165
679 Ga0501325_030237 3300049541 Bacteria 617
680 Ga0501031_0018454 3300049568 Bacteria 4539
681 Ga0501031_0041389 3300049568 Bacteria 3008
682 Ga0501031_0064199 3300049568 Bacteria 2391
683 Ga0501031_0110007 3300049568 Bacteria 1799
684 Ga0501031_0189540 3300049568 Bacteria 1343
685 Ga0501032_0073341 3300049569 Bacteria 2280
686 Ga0501032_0074874 3300049569 Bacteria 2255
687 Ga0501032_0140205 3300049569 Bacteria 1592
688 Ga0501032_0225998 3300049569 Bacteria 1217
689 Ga0501032_0229336 3300049569 Bacteria 1207
690 Ga0501032_0242330 3300049569 Bacteria 1171
691 Ga0501032_0500602 3300049569 Bacteria 776
692 Ga0501033_0010580 3300049570 Bacteria 7072
693 Ga0501033_0018738 3300049570 Bacteria 5231
694 Ga0501033_0021776 3300049570 Bacteria 4837
695 Ga0501033_0043604 3300049570 Bacteria 3341
696 Ga0501033_0049426 3300049570 Bacteria 3121
697 Ga0501033_0096199 3300049570 Bacteria 2164
698 Ga0501034_0037146 3300049571 Bacteria 4932
699 Ga0501034_0068055 3300049571 Bacteria 3572
700 Ga0501034_0069400 3300049571 Bacteria 3535
701 Ga0501034_0098549 3300049571 Bacteria 2918
702 Ga0501034_0118128 3300049571 Bacteria 2639
703 Ga0501034_0179088 3300049571 Bacteria 2085
704 Ga0501034_0223953 3300049571 Bacteria 1832
705 Ga0501034_0250323 3300049571 Bacteria 1716
706 Ga0501034_0454361 3300049571 Bacteria 1198
707 Ga0501036_0000809 3300049572 Bacteria 23223
708 Ga0501036_0008414 3300049572 Bacteria 8453
709 Ga0501036_0022196 3300049572 Bacteria 5338
710 Ga0501036_0043265 3300049572 Bacteria 3813
711 Ga0501036_0051672 3300049572 Bacteria 3480
712 Ga0501036_0250173 3300049572 Bacteria 1485
713 Ga0501036_0277937 3300049572 Bacteria 1401
714 Ga0501036_0302994 3300049572 Bacteria 1336
715 Ga0501036_0587100 3300049572 Bacteria 925
716 Ga0501037_0177644 3300049573 Bacteria 1511
717 Ga0501037_0180349 3300049573 Bacteria 1498
718 Ga0501037_0311826 3300049573 Bacteria 1090
719 Ga0501037_0314303 3300049573 Bacteria 1085
720 Ga0501037_0335339 3300049573 Bacteria 1045
721 Ga0501037_0344551 3300049573 Bacteria 1029
722 Ga0501038_0000986 3300049574 Bacteria 25579
723 Ga0501038_0004611 3300049574 Bacteria 12820
724 Ga0501038_0025754 3300049574 Bacteria 5240
725 Ga0501038_0054524 3300049574 Bacteria 3438
726 Ga0501038_0058470 3300049574 Bacteria 3306
727 Ga0501038_0361755 3300049574 Bacteria 1128
728 Ga0501039_0005182 3300049575 Bacteria 9869
729 Ga0501039_0111716 3300049575 Bacteria 2136
730 Ga0501039_0126406 3300049575 Bacteria 2005
731 Ga0501039_0174514 3300049575 Bacteria 1690
732 Ga0501039_0187343 3300049575 Bacteria 1627
733 Ga0501039_0245697 3300049575 Bacteria 1407
734 Ga0501039_0296390 3300049575 Bacteria 1271
735 Ga0501039_0321903 3300049575 Bacteria 1215
736 Ga0501039_0413472 3300049575 Bacteria 1059
737 Ga0501039_0487305 3300049575 Bacteria 968
738 Ga0501040_0021720 3300049576 Bacteria 4291
739 Ga0501040_0119259 3300049576 Bacteria 1850
740 Ga0501040_0320098 3300049576 Bacteria 1109
741 Ga0501041_0104887 3300049577 Bacteria 1751
742 Ga0501042_0016910 3300049578 Bacteria 5018
743 Ga0501042_0107411 3300049578 Bacteria 2009
744 Ga0501042_0163598 3300049578 Bacteria 1605
745 Ga0501042_0292969 3300049578 Bacteria 1175
746 Ga0501043_0003346 3300049579 Bacteria 13205
747 Ga0501043_0011549 3300049579 Bacteria 6913
748 Ga0501043_0111139 3300049579 Bacteria 2151
749 Ga0501043_0132741 3300049579 Bacteria 1951
750 Ga0501043_0136150 3300049579 Bacteria 1924
751 Ga0501043_0157583 3300049579 Bacteria 1775
752 Ga0501043_0265341 3300049579 Bacteria 1319
753 Ga0501046_0017081 3300049580 Bacteria 6064
754 Ga0501046_0044895 3300049580 Bacteria 3513
755 Ga0501046_0048664 3300049580 Bacteria 3356
756 Ga0501046_0072458 3300049580 Bacteria 2674
757 Ga0501047_0000025 3300049581 Bacteria 225560
758 Ga0501047_0013895 3300049581 Bacteria 7645
759 Ga0501047_0086590 3300049581 Bacteria 3010
760 Ga0501047_0165882 3300049581 Bacteria 2079
761 Ga0501047_0269914 3300049581 Bacteria 1547
762 Ga0501047_0381684 3300049581 Bacteria 1243
763 Ga0501048_0007025 3300049582 Bacteria 8552
764 Ga0501048_0011025 3300049582 Bacteria 6743
765 Ga0501048_0023084 3300049582 Bacteria 4547
766 Ga0501048_0167883 3300049582 Bacteria 1554
767 Ga0501048_0604384 3300049582 Bacteria 787
768 Ga0501067_0009172 3300049583 Bacteria 5478
769 Ga0501067_0031418 3300049583 Bacteria 2946
770 Ga0501067_0045352 3300049583 Bacteria 2441
771 Ga0501067_0062048 3300049583 Bacteria 2069
772 Ga0501067_0082480 3300049583 Bacteria 1783
773 Ga0501067_0098951 3300049583 Bacteria 1620
774 Ga0501067_0199471 3300049583 Bacteria 1114
775 Ga0501067_0344030 3300049583 Bacteria 831
776 Ga0501067_0458346 3300049583 Bacteria 712
777 Ga0501068_0060059 3300049584 Bacteria 2308
778 Ga0501068_0078144 3300049584 Bacteria 2027
779 Ga0501068_0568813 3300049584 Bacteria 737
780 Ga0501069_0025074 3300049585 Bacteria 3257
781 Ga0501069_0086255 3300049585 Bacteria 1772
782 Ga0501069_0113884 3300049585 Bacteria 1542
783 Ga0501070_0001766 3300049586 Bacteria 19131
784 Ga0501070_0015466 3300049586 Bacteria 6420
785 Ga0501070_0024032 3300049586 Bacteria 5110
786 Ga0501070_0038518 3300049586 Bacteria 3988
787 Ga0501070_0101595 3300049586 Bacteria 2378
788 Ga0501070_0147922 3300049586 Bacteria 1938
789 Ga0501070_0154616 3300049586 Bacteria 1892
790 Ga0501070_0184600 3300049586 Bacteria 1715
791 Ga0501070_0560128 3300049586 Bacteria 914
792 Ga0501070_0590632 3300049586 Bacteria 886
793 Ga0501070_0863473 3300049586 Bacteria 707
794 Ga0501071_0004926 3300049587 Bacteria 8522
795 Ga0501071_0022463 3300049587 Bacteria 4397
796 Ga0501071_0067578 3300049587 Bacteria 2600
797 Ga0501072_0014217 3300049588 Bacteria 6098
798 Ga0501072_0033664 3300049588 Bacteria 4015
799 Ga0501072_0049711 3300049588 Bacteria 3301
800 Ga0501072_0124844 3300049588 Bacteria 2050
801 Ga0501072_0332097 3300049588 Bacteria 1208
802 Ga0501073_0005833 3300049589 Bacteria 9189
803 Ga0501073_0032335 3300049589 Bacteria 3728
804 Ga0501073_0043777 3300049589 Bacteria 3156
805 Ga0501073_0073924 3300049589 Bacteria 2373
806 Ga0501073_0155986 3300049589 Bacteria 1582
807 Ga0501074_0000332 3300049590 Bacteria 27474
808 Ga0501074_0018619 3300049590 Bacteria 5045
809 Ga0501074_0163471 3300049590 Bacteria 1589
810 Ga0501075_0050601 3300049591 Bacteria 3123
811 Ga0501075_0483986 3300049591 Bacteria 944
812 Ga0501076_0042229 3300049592 Bacteria 3590
813 Ga0501076_0109499 3300049592 Bacteria 2232
814 Ga0501076_0311498 3300049592 Bacteria 1291
815 Ga0501077_0001085 3300049593 Bacteria 16408
816 Ga0501077_0052451 3300049593 Bacteria 2590
817 Ga0501077_0324375 3300049593 Bacteria 982
818 Ga0501206_004491 3300049653 Bacteria 1774
819 Ga0501208_075059 3300049655 Bacteria 686
820 Ga0501233_040755 3300049668 Bacteria 1090
821 Ga0501257_129115 3300049686 Bacteria 683
822 Ga0501079_0007427 3300049741 Bacteria 8294
823 Ga0501079_0106826 3300049741 Bacteria 2172
824 Ga0501079_0170974 3300049741 Bacteria 1694
825 Ga0501080_0058672 3300049742 Bacteria 3582
826 Ga0501080_0307712 3300049742 Bacteria 1436
827 Ga0501080_0370605 3300049742 Bacteria 1291
828 Ga0501081_0231559 3300049743 Bacteria 1346
829 Ga0501083_0004399 3300049744 Bacteria 9933
830 Ga0501035_0008456 3300049822 Bacteria 9587
831 Ga0501035_0015345 3300049822 Bacteria 7071
832 Ga0501035_0035265 3300049822 Bacteria 4540
833 Ga0501035_0046902 3300049822 Bacteria 3883
834 Ga0501035_0055144 3300049822 Bacteria 3549
835 Ga0501035_0177702 3300049822 Bacteria 1835
836 Ga0501035_0216133 3300049822 Bacteria 1638
837 Ga0501035_0253543 3300049822 Bacteria 1493
838 Ga0501035_0292545 3300049822 Bacteria 1374
839 Ga0501035_0308292 3300049822 Bacteria 1332
840 Ga0501035_0398510 3300049822 Bacteria 1145
841 Ga0501035_0507164 3300049822 Bacteria 992
842 Ga0501035_0649653 3300049822 Bacteria 855
843 Ga0501044_0005123 3300049823 Bacteria 14617
844 Ga0501044_0007826 3300049823 Bacteria 11745
845 Ga0501044_0029805 3300049823 Bacteria 5752
846 Ga0501044_0054400 3300049823 Bacteria 4114
847 Ga0501044_0397809 3300049823 Bacteria 1291
848 Ga0501044_0427169 3300049823 Bacteria 1234
849 Ga0501044_0460223 3300049823 Bacteria 1178
850 Ga0501044_0626536 3300049823 Bacteria 966
851 Ga0501044_0627680 3300049823 Bacteria 965
852 Ga0501045_0124139 3300049824 Bacteria 1917
853 Ga0501045_0217094 3300049824 Bacteria 1424
854 nmdc:mga03683_18082_c1 3300050489 Bacteria 2676
855 nmdc:mga03n38_108625_c1 3300050490 Bacteria 1348
856 nmdc:mga03n38_112337_c1 3300050490 Bacteria 1329
857 nmdc:mga03n38_14627_c1 3300050490 Bacteria 3012
858 nmdc:mga03n38_168573_c1 3300050490 Bacteria 1114
859 nmdc:mga03n38_198990_c1 3300050490 Bacteria 1036
860 nmdc:mga03n38_242525_c1 3300050490 Bacteria 949
861 nmdc:mga03n38_263010_c1 3300050490 Bacteria 915
862 nmdc:mga03n38_44072_c1 3300050490 Bacteria 1958
863 nmdc:mga03n38_57360_c1 3300050490 Bacteria 1761
864 nmdc:mga00v17_101889_c1 3300050491 Bacteria 1813
865 nmdc:mga00v17_103675_c1 3300050491 Bacteria 1798
866 nmdc:mga00v17_106534_c1 3300050491 Bacteria 1775
867 nmdc:mga00v17_146230_c1 3300050491 Bacteria 1517
868 nmdc:mga00v17_16796_c1 3300050491 Bacteria 4130
869 nmdc:mga00v17_26746_c1 3300050491 Bacteria 3364
870 nmdc:mga00v17_34082_c1 3300050491 Bacteria 3022
871 nmdc:mga00v17_83346_c1 3300050491 Bacteria 2000
872 nmdc:mga00v17_87190_c1 3300050491 Bacteria 1957
873 nmdc:mga0yw44_39695_c1 3300050492 Bacteria 2793
874 nmdc:mga0yw44_4297_c1 3300050492 Bacteria 6503
875 nmdc:mga0yw44_432338_c1 3300050492 Bacteria 892
876 nmdc:mga0yw44_48106_c1 3300050492 Bacteria 2571
877 nmdc:mga0yw44_570_c2 3300050492 Bacteria 9097
878 nmdc:mga0yw44_593240_c1 3300050492 Bacteria 753
879 nmdc:mga06z11_153311_c1 3300050494 Bacteria 1312
880 nmdc:mga06z11_153733_c1 3300050494 Bacteria 1310
881 nmdc:mga06z11_17729_c1 3300050494 Bacteria 3239
882 nmdc:mga06z11_21636_c1 3300050494 Bacteria 2992
883 nmdc:mga06z11_2888_c1 3300050494 Bacteria 6609
884 nmdc:mga06z11_29702_c1 3300050494 Bacteria 2636
885 nmdc:mga04h51_31060_c1 3300050495 Bacteria 1686
886 nmdc:mga04h51_346956_c1 3300050495 Bacteria 613
887 nmdc:mga04h51_7896_c1 3300050495 Bacteria 2829
888 nmdc:mga04h51_8493_c1 3300050495 Bacteria 2749
889 nmdc:mga07m45_105263_c1 3300050496 Bacteria 1623
890 nmdc:mga07m45_111576_c1 3300050496 Bacteria 1575
891 nmdc:mga07m45_206501_c1 3300050496 Bacteria 1143
892 nmdc:mga07m45_299815_c1 3300050496 Bacteria 935
893 nmdc:mga07m45_38031_c1 3300050496 Bacteria 2685
894 nmdc:mga07m45_45772_c1 3300050496 Bacteria 2457
895 nmdc:mga07m45_52993_c1 3300050496 Bacteria 1511
896 nmdc:mga07m45_81851_c1 3300050496 Bacteria 1844
897 nmdc:mga08y16_1503206_c1 3300050511 Bacteria 634
898 nmdc:mga0n895_1175822_c1 3300050512 Bacteria 742
899 Ga0495601_0007875 3300053077 Bacteria 6275
900 Ga0495601_0461798 3300053077 Bacteria 821
901 Ga0500610_0093778 3300053079 Bacteria 1558
902 Ga0495655_0028678 3300053083 Bacteria 1332
903 Ga0495655_0037836 3300053083 Bacteria 1214
904 Ga0495655_0046328 3300053083 Bacteria 1133
905 Ga0495619_0010826 3300053085 Bacteria 5740
906 Ga0495619_0019030 3300053085 Bacteria 4362
907 Ga0500578_0011067 3300053086 Bacteria 5830
908 Ga0500644_0000315 3300053088 Bacteria 25229
909 Ga0500654_041639 3300053099 Bacteria 2600
910 Ga0500660_072870 3300053100 Bacteria 1603
911 Ga0500554_029427 3300053102 Bacteria 1605
912 Ga0500556_0003839 3300053104 Bacteria 4357
913 Ga0500560_002243 3300053107 Bacteria 3642
914 Ga0500560_068585 3300053107 Bacteria 1166
915 Ga0500569_001311 3300053109 Bacteria 4653
916 Ga0500593_000520 3300053117 Bacteria 15117
917 Ga0500594_0092057 3300053118 Bacteria 922
918 Ga0500628_002039 3300053129 Bacteria 3394
919 Ga0500628_146037 3300053129 Bacteria 659
920 Ga0500652_001328 3300053131 Bacteria 7777
921 Ga0500658_0009326 3300053134 Bacteria 3619
922 Ga0500561_0000210 3300053137 Bacteria 10640
923 Ga0500573_0003247 3300053140 Bacteria 8373
924 Ga0500573_0048333 3300053140 Bacteria 2449
925 Ga0500577_0259975 3300053142 Bacteria 755
926 Ga0500579_056393 3300053143 Bacteria 2365
927 Ga0500600_0012307 3300053149 Bacteria 5192
928 Ga0500603_035556 3300053150 Bacteria 1307
929 Ga0500606_089661 3300053152 Bacteria 1040
930 Ga0500616_0002786 3300053153 Bacteria 14082
931 Ga0500633_0000718 3300053160 Bacteria 5617
932 Ga0500633_0228862 3300053160 Bacteria 693
933 Ga0500634_0008013 3300053161 Bacteria 5253
934 Ga0500656_001093 3300053732 Bacteria 2242
935 Ga0500587_000429 3300053739 Bacteria 4927
936 Ga0501084_0232071 3300054114 Bacteria 1557
937 Ga0590075_059817 3300059424 Bacteria 982
938 Ga0587098_004278 3300059604 Bacteria 1338
939 Ga0587106_051245 3300059605 Bacteria 732
940 Ga0587099_008043 3300059622 Bacteria 1010
941 Ga0587062_016770 3300059639 Bacteria 994
942 Ga0587119_022745 3300059658 Bacteria 811
943 Ga0587071_066715 3300060344 Bacteria 775
944 Ga0501082_0091447 3300060353 Bacteria 2627
945 Ga0501082_0177876 3300060353 Bacteria 1850
946 Ga0501082_0342366 3300060353 Bacteria 1303
947 Ga0466962_0005850 3300061719 Bacteria 5910
948 Ga0466962_0007798 3300061719 Bacteria 5131
949 Ga0466962_0007857 3300061719 Bacteria 5117
950 Ga0466962_0017971 3300061719 Bacteria 3403
951 Ga0466962_0063102 3300061719 Bacteria 1769
952 Ga0466962_0114975 3300061719 Bacteria 1296
953 Ga0530510_0218603 3300061734 Bacteria 1416
954 Ga0530510_0433236 3300061734 Bacteria 993
955 2547406852 2547132111 Bacteria 8013147
956 2585304821 2582581313 Bacteria 10042643
957 2585319465 2582581314 Bacteria 11452267
958 2616700748 2616644814 Bacteria 11555299
959 2643828098 2643221561 Bacteria 4984412
960 2643892430 2643221576 Bacteria 5214352
961 2643961482 2643221590 Bacteria 5214697
962 2644018675 2643221601 Bacteria 7493239
963 2644032417 2643221604 Bacteria 5014917
964 2644090745 2643221615 Bacteria 5487866
965 2644102694 2643221617 Bacteria 5139111
966 2644118356 2643221620 Bacteria 5134593
967 2644179810 2643221631 Bacteria 8168043
968 2644231289 2643221641 Bacteria 4490190
969 2644320549 2643221657 Bacteria 5490246
970 2644436398 2643221678 Bacteria 9540101
971 2644531187 2643221696 Bacteria 5431823
972 2644625750 2643221714 Bacteria 9015452
973 2738870595 2738541305 Bacteria 4910150
974 2740166616 2739367898 Bacteria 4367674
975 2768646032 2767802112 Bacteria 6465194
976 2774393803 2773857762 Bacteria 5971770
977 2784587879 2784132148 Bacteria 8627943
978 2785344267 2784746763 Bacteria 9783172
979 2785368602 2784746768 Bacteria 10036182
980 2786669706 2786546132 Bacteria 10419719
981 2804844894 2802429296 Bacteria 7227771
982 2808841286 2808606359 Bacteria 9866990
983 2808919794 2808606375 Bacteria 9466072
984 2809195322 2808606439 Bacteria 5952208
985 2809231466 2808606448 Bacteria 8656184
986 2812334123 2811994874 Bacteria 5367947
987 2812350196 2811994878 Bacteria 5992952
988 2812358972 2811994879 Bacteria 9313447
989 2812481218 2811994917 Bacteria 7761064
990 2819742836 2818991472 Bacteria 10089953
991 2819747076 2818991472 Bacteria 10089953
992 2852642212 2852635781 Bacteria 8251373
993 2855387439 2855386786 Bacteria 4752232
994 2857482791 2857481737 Bacteria 4761446
995 2862288129 2862281513 Bacteria 9621493
996 2862295660 2862290372 Bacteria 7471434
997 2862392446 2862382967 Bacteria 10317375
998 2862509502 2862507626 Bacteria 9425308
999 2862711030 2862705112 Bacteria 6563286
1000 2863068556 2863067949 Bacteria 8541735
1001 2863405520 2863404153 Bacteria 9672205
1002 2867348148 2867346516 Bacteria 7608576
1003 2867371109 2867369537 Bacteria 6501581
1004 2867431826 2867428634 Bacteria 9590268
1005 2867479683 2867475112 Bacteria 6909112
1006 2867480750 2867475112 Bacteria 6909112
1007 2877681925 2877676314 Bacteria 9512378
1008 2891972179 2891968417 Bacteria 5821697
1009 2912720894 2912715099 Bacteria 9460473
1010 2918507061 2918501144 Bacteria 8668083
1011 2919468687 2919468124 Bacteria 9133025
1012 2946066905 2946064051 Bacteria 8957905
1013 2954003640 2954002825 Bacteria 9173742
1014 2954387049 2954380949 Bacteria 10050426
1015 2954676114 2954673503 Bacteria 9685905
1016 2954688053 2954682443 Bacteria 9862841
1017 2954697885 2954691527 Bacteria 10720516
1018 2954704331 2954701450 Bacteria 10834262
1019 2954716996 2954711539 Bacteria 10867210
1020 2954726947 2954721474 Bacteria 10456478
1021 2954734850 2954731030 Bacteria 10243860
1022 2954745868 2954740390 Bacteria 10229294
1023 2954753722 2954749733 Bacteria 10366972
1024 2954764841 2954759201 Bacteria 9358192
1025 2984577143 2984576629 Bacteria 4248407
1026 2990046520 2990044586 Bacteria 6603797
1027 2990061882 2990059506 Bacteria 9321252
1028 2990093401 2990088156 Bacteria 6657676
1029 2990260464 2990256926 Bacteria 4252839
1030 2995471131 2995463766 Bacteria 8577691
1031 2997456562 2997451912 Bacteria 8492419
1032 3006427300 3006425503 Bacteria 6491253
1033 3006501785 3006493962 Bacteria 8825450
1034 8008488822 8008485437 Bacteria 7198341
1035 8008559553 8008558824 Bacteria 10610750
1036 8023629284 8023623736 Bacteria 8593882
1037 8025419332 8025413630 Bacteria 7014048
1038 8025528305 8025524527 Bacteria 7197316
1039 8033686010 8033684223 Bacteria 6906479
1040 8048407143 8048406513 Bacteria 8936924
1041 8054165018 8054160619 Bacteria 7783213
1042 8054612347 8054609563 Bacteria 5170090
1043 Ga0466969_0008782
1044 LJQas_1005528
1045 JGI24739J22299_10072289
1046 JGI24737J22298_10009059
1047 JGI24737J22298_10013219
1048 JGI24735J21928_10012392
1049 JGI24750J21931_1005874
1050 JGI24738J21930_10004960
1051 JGI24738J21930_10006440
1052 JGI24744J21845_10000532
1053 rootH1_10012683
1054 rootH1_10012684
1055 rootH2_10073426
1056 rootH1_10019905
1057 rootH1_10051264
1058 Ga0006562J51391_1005843
1059 Ga0007429J51699_1017997
1060 Ga0058692_1045109
1061 Ga0058862_10006434
1062 Ga0070676_10304244
1063 Ga0070683_100013995
1064 Ga0070683_100030501
1065 Ga0070682_100011595
1066 Ga0070682_100018717
1067 Ga0070682_100132210
1068 Ga0068868_100098699
1069 Ga0068868_100325806
1070 Ga0070660_100003302
1071 Ga0070687_100718738
1072 Ga0070692_10020197
1073 Ga0070692_10020439
1074 Ga0070692_10201992
1075 Ga0070692_10225107
1076 Ga0070668_100116637
1077 Ga0070668_100262850
1078 Ga0070675_100182764
1079 Ga0070675_100374960
1080 Ga0070671_100548508
1081 Ga0070674_100005174
1082 Ga0070674_100312722
1083 Ga0070659_100019106
1084 Ga0070659_100025275
1085 Ga0070659_100277939
1086 Ga0070659_100294972
1087 Ga0070667_100072949
1088 Ga0070667_100089384
1089 Ga0070667_101097476
1090 Ga0070701_10094608
1091 Ga0070700_100002303
1092 Ga0070700_100020078
1093 Ga0070663_100114837
1094 Ga0070663_100685448
1095 Ga0070678_100030699
1096 Ga0070678_100104615
1097 Ga0070678_100265797
1098 Ga0068867_100007389
1099 Ga0068867_100278653
1100 Ga0070685_10176701
1101 Ga0070707_100400259
1102 Ga0070698_100011005
1103 Ga0070679_100809901
1104 Ga0070684_100004672
1105 Ga0070684_100063833
1106 Ga0070684_100468834
1107 Ga0068853_100096039
1108 Ga0068853_100137090
1109 Ga0070672_100570698
1110 Ga0070665_100000868
1111 Ga0068855_100248717
1112 Ga0070664_100237931
1113 Ga0068857_100014013
1114 Ga0068856_100223417
1115 Ga0068856_100240491
1116 Ga0070702_100003489
1117 Ga0070702_100026047
1118 Ga0068852_100437444
1119 Ga0068852_100456722
1120 Ga0068861_100551188
1121 Ga0068870_10061537
1122 Ga0068863_100270128
1123 Ga0068860_100000388
1124 Ga0068860_100100623
1125 Ga0081539_10045162
1126 Ga0075365_10019907
1127 Ga0075365_10050313
1128 Ga0075365_10092348
1129 Ga0075365_10163191
1130 Ga0075365_10289099
1131 Ga0075368_10000847
1132 Ga0075368_10040813
1133 Ga0075363_100046286
1134 Ga0075363_100140083
1135 Ga0075363_100193838
1136 Ga0075364_10027506
1137 Ga0075364_10045314
1138 Ga0075364_10121077
1139 Ga0075364_10255386
1140 Ga0075364_10544477
1141 Ga0075362_10004276
1142 Ga0075367_10000916
1143 Ga0075367_10037203
1144 Ga0075367_10051571
1145 Ga0075367_10180919
1146 Ga0075367_10298733
1147 Ga0075370_10024322
1148 Ga0075370_10033825
1149 Ga0075370_10078090
1150 Ga0075370_10094577
1151 Ga0075370_10110304
1152 Ga0075370_10150970
1153 Ga0075370_10299968
1154 Ga0075428_100027812
1155 Ga0075434_101136693
1156 Ga0068865_100004270
1157 Ga0068865_100285919
1158 Ga0105251_10026442
1159 Ga0105244_10186991
1160 Ga0105250_10123393
1161 Ga0105245_10002262
1162 Ga0105245_10010146
1163 Ga0105245_10589429
1164 Ga0105245_10735571
1165 Ga0105247_10292301
1166 Ga0105243_10047697
1167 Ga0105243_10083958
1168 Ga0105243_10224256
1169 Ga0105242_11308610
1170 Ga0105248_10190351
1171 Ga0105237_10071232
1172 Ga0105237_10655307
1173 Ga0105238_10807971
1174 Ga0105249_10058933
1175 Ga0105239_10001318
1176 Ga0105239_10002798
1177 Ga0105246_10014826
1178 Ga0105246_10043532
1179 Ga0157369_10095838
1180 Ga0157369_10707971
1181 Ga0157374_10702417
1182 Ga0163162_10035603
1183 Ga0157372_10027521
1184 Ga0157372_10131496
1185 Ga0157375_11307411
1186 Ga0163163_10129334
1187 Ga0163163_10160525
1188 Ga0163163_10365416
1189 Ga0157380_10005485
1190 Ga0182008_10016002
1191 Ga0157377_10026897
1192 Ga0157379_10040240
1193 Ga0157376_10216925
1194 Ga0157376_10356554
1195 Ga0182007_10001964
1196 Ga0183367_1006
1197 Ga0163161_10048837
1198 Ga0197907_10046109
1199 Ga0206351_10711097
1200 Ga0206350_10490934
1201 Ga0206350_11446792
1202 Ga0206350_11624171
1203 Ga0154015_1288929
1204 Ga0213875_10025417
1205 Ga0224712_10104738
1206 Ga0209758_1003504
1207 Ga0207426_1003149
1208 Ga0207426_1016168
1209 Ga0209051_1091365
1210 Ga0207713_1013108
1211 Ga0207688_10071323
1212 Ga0207688_10347469
1213 Ga0207647_10010116
1214 Ga0207647_10011522
1215 Ga0207647_10059649
1216 Ga0207671_10087463
1217 Ga0207671_10127920
1218 Ga0207662_10079336
1219 Ga0207662_10379942
1220 Ga0207657_10042184
1221 Ga0207646_10129704
1222 Ga0207694_10095551
1223 Ga0207650_10650748
1224 Ga0207659_10187588
1225 Ga0207659_10315041
1226 Ga0207687_10010027
1227 Ga0207687_10146799
1228 Ga0207690_10014894
1229 Ga0207690_10036521
1230 Ga0207706_10165774
1231 Ga0207706_10294118
1232 Ga0207706_10490933
1233 Ga0207686_10220313
1234 Ga0207709_10005306
1235 Ga0207709_10068435
1236 Ga0207709_10506130
1237 Ga0207669_10012594
1238 Ga0207669_10190593
1239 Ga0207691_10003002
1240 Ga0207691_10081757
1241 Ga0207711_10322118
1242 Ga0207689_10427852
1243 Ga0207689_10757743
1244 Ga0207661_10005512
1245 Ga0207661_10203304
1246 Ga0207661_10764360
1247 Ga0207651_10218246
1248 Ga0207651_11014393
1249 Ga0207712_10097291
1250 Ga0207668_10340952
1251 Ga0207668_11185697
1252 Ga0207658_10013451
1253 Ga0207658_10158162
1254 Ga0207677_10004641
1255 Ga0207677_10094319
1256 Ga0207703_10794898
1257 Ga0207678_10127572
1258 Ga0207708_10001371
1259 Ga0207708_10095894
1260 Ga0207702_10126503
1261 Ga0207641_10805802
1262 Ga0207648_10056730
1263 Ga0207648_10453504
1264 Ga0207674_10007577
1265 Ga0207674_10803636
1266 Ga0207675_100007138
1267 Ga0207675_100089750
1268 Ga0207675_100118612
1269 Ga0207683_10052995
1270 Ga0207683_10093108
1271 Ga0207683_10121129
1272 Ga0207698_10019604
1273 Ga0207698_10044631
1274 Ga0209371_1009821
1275 Ga0209371_1023114
1276 Ga0209813_10000658
1277 Ga0209813_10005764
1278 Ga0209813_10050640
1279 Ga0207428_10241590
1280 Ga0268266_10001392
1281 Ga0268266_10081155
1282 Ga0268266_10121698
1283 Ga0268264_10000387
1284 Ga0307517_10003800
1285 Ga0307517_10007226
1286 Ga0307515_10002026
1287 Ga0268256_1010880
1288 Ga0307511_10001267
1289 Ga0307511_10082268
1290 Ga0307512_10013231
1291 Ga0316183_1192358
1292 Ga0316181_1029856
1293 Ga0265340_10036704
1294 Ga0307513_10210165
1295 Ga0307513_10312574
1296 Ga0307509_10121232
1297 Ga0307509_10131531
1298 Ga0307408_100320242
1299 Ga0307508_10021403
1300 Ga0307514_10078495
1301 Ga0307514_10114213
1302 Ga0307516_10059421
1303 Ga0307516_10096309
1304 Ga0307405_10231258
1305 Ga0307405_10816385
1306 Ga0307413_10132629
1307 Ga0307413_10596728
1308 Ga0307518_10126214
1309 Ga0307518_10176835
1310 Ga0307410_10094609
1311 Ga0307406_10080163
1312 Ga0307406_10300299
1313 Ga0307407_10020689
1314 Ga0307407_10102976
1315 Ga0307407_10142825
1316 Ga0307412_10050300
1317 Ga0307412_10067839
1318 Ga0307412_10166467
1319 Ga0307412_10284600
1320 Ga0307412_10768719
1321 Ga0307409_100021958
1322 Ga0307409_100069450
1323 Ga0307409_100204584
1324 Ga0307409_100393645
1325 Ga0307409_100411779
1326 Ga0307409_100717134
1327 Ga0307409_100816992
1328 Ga0307416_100068237
1329 Ga0307416_100105910
1330 Ga0307416_100284691
1331 Ga0307416_100539334
1332 Ga0307414_10361762
1333 Ga0307411_10466321
1334 Ga0307415_100293226
1335 Ga0307415_100314316
1336 Ga0307415_100353041
1337 Ga0307507_10067643
1338 Ga0307510_10200261
1339 Ga0307510_10215164
1340 Ga0373928_0045395
1341 Ga0373952_0030824
1342 Ga0395899_0203417
1343 Ga0395899_0258850
1344 Ga0395898_0029023
1345 Ga0395898_0059562
1346 Ga0395905_0012411
1347 Ga0395905_0057280
1348 Ga0395905_0216579
1349 Ga0395905_0451928
1350 Ga0395905_0761137
1351 Ga0436364_0961922
1352 Ga0436364_1191885
1353 Ga0436364_1267828
1354 Ga0436364_1376765
1355 Ga0395901_0034440
1356 Ga0395901_0081403
1357 Ga0395901_0083782
1358 Ga0395901_0140674
1359 Ga0395901_0930851
1360 Ga0242420_004572
1361 Ga0400483_018528
1362 Ga0400483_023161
1363 Ga0400483_076896
1364 Ga0400483_103660
1365 Ga0400483_198923
1366 Ga0400483_204522
1367 Ga0400483_248013
1368 Ga0400483_254236
1369 Ga0436365_0096389
1370 Ga0436365_1477850
1371 Ga0439436_0005153
1372 Ga0439465_0080308
1373 Ga0451789_0623635
1374 Ga0451797_1306219
1375 Ga0451795_0427087
1376 Ga0451798_1153288
1377 Ga0451841_0903274
1378 Ga0451847_0525880
1379 Ga0451843_1108888
1380 Ga0451853_0989324
1381 Ga0451853_1505240
1382 Ga0451853_1770887
1383 Ga0439431_0003253
1384 Ga0439433_0003818
1385 Ga0439442_010904
1386 Ga0439442_037697
1387 Ga0439448_0003369
1388 Ga0439448_0029859
1389 Ga0439432_067955
1390 Ga0439449_0009834
1391 Ga0439455_0005439
1392 Ga0439457_005336
1393 Ga0439462_0057931
1394 Ga0450890_018387
1395 Ga0450897_016869
1396 Ga0450895_009203
1397 Ga0450896_019611
1398 Ga0450898_015127
1399 Ga0450899_001701
1400 Ga0450900_021765
1401 Ga0450903_000064
1402 Ga0450904_014518
1403 Ga0450906_001453
1404 Ga0450907_017642
1405 Ga0439458_0002342
1406 Ga0439434_0014704
1407 Ga0451577_0052176
1408 Ga0466969_0004974
1409 Ga0466969_0035054
1410 Ga0466969_0056306
1411 Ga0466969_0061669
1412 Ga0466972_0006814
1413 Ga0466972_0007313
1414 Ga0466972_0020389
1415 Ga0466972_0068328
1416 Ga0466972_0070849
1417 Ga0466972_0072263
1418 Ga0466972_0133857
1419 Ga0466972_0150263
1420 Ga0466965_0000715
1421 Ga0466965_0004463
1422 Ga0466965_0014544
1423 Ga0466965_0036099
1424 Ga0466965_0047301
1425 Ga0466965_0083675
1426 Ga0466965_0118354
1427 Ga0466965_0223760
1428 Ga0466965_0254302
1429 Ga0466965_0256161
1430 Ga0466966_0023182
1431 Ga0466966_0043589
1432 Ga0466966_0059232
1433 Ga0466966_0096465
1434 Ga0466966_0120796
1435 Ga0466966_0164873
1436 Ga0466966_0329001
1437 Ga0466961_0005346
1438 Ga0466961_0021513
1439 Ga0466961_0023802
1440 Ga0466961_0045577
1441 Ga0466961_0045889
1442 Ga0466961_0059876
1443 Ga0466961_0072868
1444 Ga0466961_0121598
1445 Ga0466961_0175550
1446 Ga0466961_0290667
1447 Ga0466961_0369938
1448 Ga0466963_0004247
1449 Ga0466963_0031776
1450 Ga0466963_0167953
1451 Ga0466963_0474135
1452 Ga0466964_0007480
1453 Ga0466964_0012185
1454 Ga0466964_0040086
1455 Ga0466964_0314419
1456 Ga0453684_0074082
1457 Ga0466971_0001330
1458 Ga0466971_0006890
1459 Ga0466971_0018948
1460 Ga0466971_0023338
1461 Ga0466971_0196136
1462 Ga0466968_0063490
1463 Ga0466970_0011013
1464 Ga0466970_0022923
1465 Ga0466970_0031983
1466 Ga0466970_0039169
1467 Ga0466970_0055806
1468 Ga0466970_0062138
1469 Ga0466970_0067473
1470 Ga0466970_0073299
1471 Ga0466970_0184461
1472 Ga0466970_0246910
1473 Ga0466970_0370736
1474 Ga0466957_0002267
1475 Ga0466957_0004703
1476 Ga0466957_0012592
1477 Ga0466957_0099303
1478 Ga0466960_0006811
1479 Ga0466960_0010425
1480 Ga0466960_0015766
1481 Ga0466960_0023436
1482 Ga0466960_0030358
1483 Ga0466960_0050125
1484 Ga0466960_0186744
1485 Ga0466960_0492422
1486 Ga0466960_0500207
1487 Ga0466959_0005786
1488 Ga0466959_0026569
1489 Ga0466959_0034787
1490 Ga0466959_0038841
1491 Ga0466959_0274011
1492 Ga0466958_0016938
1493 Ga0466958_0058011
1494 Ga0466958_0201850
1495 Ga0466958_0597288
1496 Ga0466967_0028650
1497 Ga0466967_0036868
1498 Ga0466967_0063164
1499 Ga0466967_0066702
1500 Ga0466967_0118561
1501 Ga0466967_0123701
1502 Ga0466967_0194204
1503 Ga0466967_0265494
1504 Ga0466967_0307852
1505 Ga0466967_0568035
1506 Ga0466967_0650376
1507 Ga0466967_0653931
1508 Ga0466967_0655677
1509 Ga0466967_1191049
1510 Ga0466967_1254526
1511 Ga0495617_006503
1512 Ga0495592_0003095
1513 Ga0495592_0019854
1514 Ga0495592_0025032
1515 Ga0495603_0078604
1516 Ga0495590_0127995
1517 Ga0495629_0005989
1518 Ga0495629_0078762
1519 Ga0495629_0331774
1520 Ga0495629_0336737
1521 Ga0495638_0021796
1522 Ga0495638_0056550
1523 Ga0495641_0086934
1524 Ga0495651_0005161
1525 Ga0495651_0034606
1526 Ga0495651_0092796
1527 Ga0495653_0003422
1528 Ga0495580_0008997
1529 Ga0495605_0001675
1530 Ga0495639_0058635
1531 Ga0495662_0004562
1532 Ga0495664_0005608
1533 Ga0495664_0067176
1534 Ga0495664_0302484
1535 Ga0495585_0008236
1536 Ga0495585_0208841
1537 Ga0495594_0053781
1538 Ga0495594_0209768
1539 Ga0495596_0099536
1540 Ga0495596_0112765
1541 Ga0495607_0325929
1542 Ga0495583_0094465
1543 Ga0495606_0001850
1544 Ga0495608_0004003
1545 Ga0495610_0015548
1546 Ga0495616_0005137
1547 Ga0495618_0038161
1548 Ga0495618_0110900
1549 Ga0495620_0071042
1550 Ga0495628_0010442
1551 Ga0495628_0052747
1552 Ga0495630_0003722
1553 Ga0495630_0259623
1554 Ga0495631_0022038
1555 Ga0495632_0166013
1556 Ga0495643_0014861
1557 Ga0495643_0016786
1558 Ga0495648_0063869
1559 Ga0495666_0002064
1560 Ga0495666_0045916
1561 Ga0495642_0297082
1562 Ga0495652_0034123
1563 Ga0495654_0006973
1564 Ga0495665_0000429
1565 Ga0495640_0002937
1566 Ga0495640_0003552
1567 Ga0495640_0010149
1568 Ga0495609_0133817
1569 Ga0495597_0070764
1570 Ga0495645_0013370
1571 Ga0495645_0168249
1572 Ga0495633_0012373
1573 Ga0495633_0047313
1574 Ga0495667_0239208
1575 Ga0495656_0149364
1576 Ga0495668_0010309
1577 Ga0495634_0006662
1578 Ga0495634_0019788
1579 Ga0495611_0159762
1580 Ga0495625_0004464
1581 Ga0495625_0020688
1582 Ga0495661_0021798
1583 Ga0495588_0001032
1584 Ga0495657_0016668
1585 Ga0495657_0042216
1586 Ga0495657_0172428
1587 Ga0495599_0014736
1588 Ga0495599_0262545
1589 Ga0495623_0016899
1590 Ga0495623_0072393
1591 Ga0495646_0008076
1592 Ga0495658_0026150
1593 Ga0495613_0019423
1594 Ga0495613_0036762
1595 Ga0495613_0308573
1596 Ga0495624_0050354
1597 Ga0495624_0112449
1598 Ga0495670_0003415
1599 Ga0495670_0079092
1600 Ga0495671_0003551
1601 Ga0495649_0188997
1602 Ga0495649_0228648
1603 Ga0495649_0260465
1604 Ga0495589_0074225
1605 Ga0495589_0136992
1606 Ga0495600_0015742
1607 Ga0495600_0036788
1608 Ga0495600_0134806
1609 Ga0495660_0029459
1610 Ga0495581_0073414
1611 Ga0495581_0218547
1612 Ga0495604_0001544
1613 Ga0495604_0017669
1614 Ga0495604_0020517
1615 Ga0495604_0038660
1616 Ga0495674_0097685
1617 Ga0495674_0100020
1618 Ga0495672_0100087
1619 Ga0495676_0004653
1620 Ga0495676_0091066
1621 Ga0495676_0480568
1622 Ga0495680_0005653
1623 Ga0495683_0015695
1624 Ga0495687_013209
1625 Ga0495687_019086
1626 Ga0495687_034585
1627 Ga0495675_0030475
1628 Ga0495675_0108650
1629 Ga0495675_0128999
1630 Ga0495675_0136995
1631 Ga0495677_0094431
1632 Ga0495685_000208
1633 Ga0495685_068751
1634 Ga0495681_0001401
1635 Ga0495681_0005767
1636 Ga0495681_0082040
1637 Ga0495684_0011563
1638 Ga0495684_0316267
1639 Ga0495686_0019900
1640 Ga0495686_0067948
1641 Ga0495686_0068230
1642 Ga0495593_0025215
1643 Ga0495602_0004329
1644 Ga0495602_0186885
1645 Ga0495614_0021191
1646 Ga0495614_0061593
1647 Ga0495626_0009338
1648 Ga0496100_0557620
1649 Ga0496101_0007043
1650 Ga0496102_0059503
1651 Ga0496102_0073936
1652 Ga0496103_0017558
1653 Ga0496103_0030095
1654 Ga0496104_0214482
1655 Ga0496106_0076410
1656 Ga0496106_0202027
1657 Ga0496106_0367620
1658 Ga0496107_0089094
1659 Ga0496107_0257936
1660 Ga0496108_0020531
1661 Ga0496108_0027320
1662 Ga0496108_0116181
1663 Ga0496108_0151100
1664 Ga0496108_0545715
1665 Ga0496109_0018653
1666 Ga0496109_0214887
1667 Ga0496109_0427587
1668 Ga0496109_0594830
1669 Ga0496110_0023038
1670 Ga0496110_0070304
1671 Ga0496110_0150551
1672 Ga0496110_0195849
1673 Ga0496111_0004558
1674 Ga0496111_0092364
1675 Ga0496111_0176670
1676 Ga0496111_0415429
1677 Ga0496111_0547580
1678 Ga0496112_0700030
1679 Ga0496114_0238270
1680 Ga0496124_0185713
1681 Ga0496124_0223077
1682 Ga0501306_007606
1683 Ga0501306_024658
1684 Ga0501308_002154
1685 Ga0501308_027399
1686 Ga0501309_006033
1687 Ga0501309_007585
1688 Ga0501309_016816
1689 Ga0501304_005879
1690 Ga0501305_006624
1691 Ga0495678_019451
1692 Ga0495682_0012223
1693 Ga0501298_045347
1694 Ga0501311_001743
1695 Ga0501311_007004
1696 Ga0501312_015254
1697 Ga0501313_030107
1698 Ga0501313_034065
1699 Ga0501315_005062
1700 Ga0501315_036102
1701 Ga0501316_004718
1702 Ga0501316_007434
1703 Ga0501316_028781
1704 Ga0501317_041610
1705 Ga0501318_001870
1706 Ga0501318_005094
1707 Ga0501319_003204
1708 Ga0501319_010473
1709 Ga0501320_001852
1710 Ga0501320_014040
1711 Ga0501321_001880
1712 Ga0501321_013235
1713 Ga0501322_009988
1714 Ga0501323_000098
1715 Ga0501323_009765
1716 Ga0501323_020172
1717 Ga0501323_022298
1718 Ga0501324_000124
1719 Ga0501324_001483
1720 Ga0501325_003318
1721 Ga0501325_030237
1722 Ga0501031_0018454
1723 Ga0501031_0041389
1724 Ga0501031_0064199
1725 Ga0501031_0110007
1726 Ga0501031_0189540
1727 Ga0501032_0073341
1728 Ga0501032_0074874
1729 Ga0501032_0140205
1730 Ga0501032_0225998
1731 Ga0501032_0229336
1732 Ga0501032_0242330
1733 Ga0501032_0500602
1734 Ga0501033_0010580
1735 Ga0501033_0018738
1736 Ga0501033_0021776
1737 Ga0501033_0043604
1738 Ga0501033_0049426
1739 Ga0501033_0096199
1740 Ga0501034_0037146
1741 Ga0501034_0068055
1742 Ga0501034_0069400
1743 Ga0501034_0098549
1744 Ga0501034_0118128
1745 Ga0501034_0179088
1746 Ga0501034_0223953
1747 Ga0501034_0250323
1748 Ga0501034_0454361
1749 Ga0501036_0000809
1750 Ga0501036_0008414
1751 Ga0501036_0022196
1752 Ga0501036_0043265
1753 Ga0501036_0051672
1754 Ga0501036_0250173
1755 Ga0501036_0277937
1756 Ga0501036_0302994
1757 Ga0501036_0587100
1758 Ga0501037_0177644
1759 Ga0501037_0180349
1760 Ga0501037_0311826
1761 Ga0501037_0314303
1762 Ga0501037_0335339
1763 Ga0501037_0344551
1764 Ga0501038_0000986
1765 Ga0501038_0004611
1766 Ga0501038_0025754
1767 Ga0501038_0054524
1768 Ga0501038_0058470
1769 Ga0501038_0361755
1770 Ga0501039_0005182
1771 Ga0501039_0111716
1772 Ga0501039_0126406
1773 Ga0501039_0174514
1774 Ga0501039_0187343
1775 Ga0501039_0245697
1776 Ga0501039_0296390
1777 Ga0501039_0321903
1778 Ga0501039_0413472
1779 Ga0501039_0487305
1780 Ga0501040_0021720
1781 Ga0501040_0119259
1782 Ga0501040_0320098
1783 Ga0501041_0104887
1784 Ga0501042_0016910
1785 Ga0501042_0107411
1786 Ga0501042_0163598
1787 Ga0501042_0292969
1788 Ga0501043_0003346
1789 Ga0501043_0011549
1790 Ga0501043_0111139
1791 Ga0501043_0132741
1792 Ga0501043_0136150
1793 Ga0501043_0157583
1794 Ga0501043_0265341
1795 Ga0501046_0017081
1796 Ga0501046_0044895
1797 Ga0501046_0048664
1798 Ga0501046_0072458
1799 Ga0501047_0000025
1800 Ga0501047_0013895
1801 Ga0501047_0086590
1802 Ga0501047_0165882
1803 Ga0501047_0269914
1804 Ga0501047_0381684
1805 Ga0501048_0007025
1806 Ga0501048_0011025
1807 Ga0501048_0023084
1808 Ga0501048_0167883
1809 Ga0501048_0604384
1810 Ga0501067_0009172
1811 Ga0501067_0031418
1812 Ga0501067_0045352
1813 Ga0501067_0062048
1814 Ga0501067_0082480
1815 Ga0501067_0098951
1816 Ga0501067_0199471
1817 Ga0501067_0344030
1818 Ga0501067_0458346
1819 Ga0501068_0060059
1820 Ga0501068_0078144
1821 Ga0501068_0568813
1822 Ga0501069_0025074
1823 Ga0501069_0086255
1824 Ga0501069_0113884
1825 Ga0501070_0001766
1826 Ga0501070_0015466
1827 Ga0501070_0024032
1828 Ga0501070_0038518
1829 Ga0501070_0101595
1830 Ga0501070_0147922
1831 Ga0501070_0154616
1832 Ga0501070_0184600
1833 Ga0501070_0560128
1834 Ga0501070_0590632
1835 Ga0501070_0863473
1836 Ga0501071_0004926
1837 Ga0501071_0022463
1838 Ga0501071_0067578
1839 Ga0501072_0014217
1840 Ga0501072_0033664
1841 Ga0501072_0049711
1842 Ga0501072_0124844
1843 Ga0501072_0332097
1844 Ga0501073_0005833
1845 Ga0501073_0032335
1846 Ga0501073_0043777
1847 Ga0501073_0073924
1848 Ga0501073_0155986
1849 Ga0501074_0000332
1850 Ga0501074_0018619
1851 Ga0501074_0163471
1852 Ga0501075_0050601
1853 Ga0501075_0483986
1854 Ga0501076_0042229
1855 Ga0501076_0109499
1856 Ga0501076_0311498
1857 Ga0501077_0001085
1858 Ga0501077_0052451
1859 Ga0501077_0324375
1860 Ga0501206_004491
1861 Ga0501208_075059
1862 Ga0501233_040755
1863 Ga0501257_129115
1864 Ga0501079_0007427
1865 Ga0501079_0106826
1866 Ga0501079_0170974
1867 Ga0501080_0058672
1868 Ga0501080_0307712
1869 Ga0501080_0370605
1870 Ga0501081_0231559
1871 Ga0501083_0004399
1872 Ga0501035_0008456
1873 Ga0501035_0015345
1874 Ga0501035_0035265
1875 Ga0501035_0046902
1876 Ga0501035_0055144
1877 Ga0501035_0177702
1878 Ga0501035_0216133
1879 Ga0501035_0253543
1880 Ga0501035_0292545
1881 Ga0501035_0308292
1882 Ga0501035_0398510
1883 Ga0501035_0507164
1884 Ga0501035_0649653
1885 Ga0501044_0005123
1886 Ga0501044_0007826
1887 Ga0501044_0029805
1888 Ga0501044_0054400
1889 Ga0501044_0397809
1890 Ga0501044_0427169
1891 Ga0501044_0460223
1892 Ga0501044_0626536
1893 Ga0501044_0627680
1894 Ga0501045_0124139
1895 Ga0501045_0217094
1896 nmdc:mga03683_18082_c1
1897 nmdc:mga03n38_108625_c1
1898 nmdc:mga03n38_112337_c1
1899 nmdc:mga03n38_14627_c1
1900 nmdc:mga03n38_168573_c1
1901 nmdc:mga03n38_198990_c1
1902 nmdc:mga03n38_242525_c1
1903 nmdc:mga03n38_263010_c1
1904 nmdc:mga03n38_44072_c1
1905 nmdc:mga03n38_57360_c1
1906 nmdc:mga00v17_101889_c1
1907 nmdc:mga00v17_103675_c1
1908 nmdc:mga00v17_106534_c1
1909 nmdc:mga00v17_146230_c1
1910 nmdc:mga00v17_16796_c1
1911 nmdc:mga00v17_26746_c1
1912 nmdc:mga00v17_34082_c1
1913 nmdc:mga00v17_83346_c1
1914 nmdc:mga00v17_87190_c1
1915 nmdc:mga0yw44_39695_c1
1916 nmdc:mga0yw44_4297_c1
1917 nmdc:mga0yw44_432338_c1
1918 nmdc:mga0yw44_48106_c1
1919 nmdc:mga0yw44_570_c2
1920 nmdc:mga0yw44_593240_c1
1921 nmdc:mga06z11_153311_c1
1922 nmdc:mga06z11_153733_c1
1923 nmdc:mga06z11_17729_c1
1924 nmdc:mga06z11_21636_c1
1925 nmdc:mga06z11_2888_c1
1926 nmdc:mga06z11_29702_c1
1927 nmdc:mga04h51_31060_c1
1928 nmdc:mga04h51_346956_c1
1929 nmdc:mga04h51_7896_c1
1930 nmdc:mga04h51_8493_c1
1931 nmdc:mga07m45_105263_c1
1932 nmdc:mga07m45_111576_c1
1933 nmdc:mga07m45_206501_c1
1934 nmdc:mga07m45_299815_c1
1935 nmdc:mga07m45_38031_c1
1936 nmdc:mga07m45_45772_c1
1937 nmdc:mga07m45_52993_c1
1938 nmdc:mga07m45_81851_c1
1939 nmdc:mga08y16_1503206_c1
1940 nmdc:mga0n895_1175822_c1
1941 Ga0495601_0007875
1942 Ga0495601_0461798
1943 Ga0500610_0093778
1944 Ga0495655_0028678
1945 Ga0495655_0037836
1946 Ga0495655_0046328
1947 Ga0495619_0010826
1948 Ga0495619_0019030
1949 Ga0500578_0011067
1950 Ga0500644_0000315
1951 Ga0500654_041639
1952 Ga0500660_072870
1953 Ga0500554_029427
1954 Ga0500556_0003839
1955 Ga0500560_002243
1956 Ga0500560_068585
1957 Ga0500569_001311
1958 Ga0500593_000520
1959 Ga0500594_0092057
1960 Ga0500628_002039
1961 Ga0500628_146037
1962 Ga0500652_001328
1963 Ga0500658_0009326
1964 Ga0500561_0000210
1965 Ga0500573_0003247
1966 Ga0500573_0048333
1967 Ga0500577_0259975
1968 Ga0500579_056393
1969 Ga0500600_0012307
1970 Ga0500603_035556
1971 Ga0500606_089661
1972 Ga0500616_0002786
1973 Ga0500633_0000718
1974 Ga0500633_0228862
1975 Ga0500634_0008013
1976 Ga0500656_001093
1977 Ga0500587_000429
1978 Ga0501084_0232071
1979 Ga0590075_059817
1980 Ga0587098_004278
1981 Ga0587106_051245
1982 Ga0587099_008043
1983 Ga0587062_016770
1984 Ga0587119_022745
1985 Ga0587071_066715
1986 Ga0501082_0091447
1987 Ga0501082_0177876
1988 Ga0501082_0342366
1989 Ga0466962_0005850
1990 Ga0466962_0007798
1991 Ga0466962_0007857
1992 Ga0466962_0017971
1993 Ga0466962_0063102
1994 Ga0466962_0114975
1995 Ga0530510_0218603
1996 Ga0530510_0433236
1997 2547406852
1998 2585304821
1999 2585319465
2000 2616700748
2001 2643828098
2002 2643892430
2003 2643961482
2004 2644018675
2005 2644032417
2006 2644090745
2007 2644102694
2008 2644118356
2009 2644179810
2010 2644231289
2011 2644320549
2012 2644436398
2013 2644531187
2014 2644625750
2015 2738870595
2016 2740166616
2017 2768646032
2018 2774393803
2019 2784587879
2020 2785344267
2021 2785368602
2022 2786669706
2023 2804844894
2024 2808841286
2025 2808919794
2026 2809195322
2027 2809231466
2028 2812334123
2029 2812350196
2030 2812358972
2031 2812481218
2032 2819742836
2033 2819747076
2034 2852642212
2035 2855387439
2036 2857482791
2037 2862288129
2038 2862295660
2039 2862392446
2040 2862509502
2041 2862711030
2042 2863068556
2043 2863405520
2044 2867348148
2045 2867371109
2046 2867431826
2047 2867479683
2048 2867480750
2049 2877681925
2050 2891972179
2051 2912720894
2052 2918507061
2053 2919468687
2054 2946066905
2055 2954003640
2056 2954387049
2057 2954676114
2058 2954688053
2059 2954697885
2060 2954704331
2061 2954716996
2062 2954726947
2063 2954734850
2064 2954745868
2065 2954753722
2066 2954764841
2067 2984577143
2068 2990046520
2069 2990061882
2070 2990093401
2071 2990260464
2072 2995471131
2073 2997456562
2074 3006427300
2075 3006501785
2076 8008488822
2077 8008559553
2078 8023629284
2079 8025419332
2080 8025528305
2081 8033686010
2082 8048407143
2083 8054165018
2084 8054612347

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00574

CLP_protease

Clp protease

40

219

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hln-assembly2.cif.gz_T crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds 0.9934 37 207
4emm-assembly1.cif.gz_B crystal structure of staphylococcus aureus clpp in compact conformation 0.9912 37 207
3hln-assembly2.cif.gz_1 crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds 0.9911 37 207
7p81-assembly2.cif.gz_R crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) 0.9906 37 207
3hln-assembly2.cif.gz_U crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds 0.9901 37 209
ID Description Score Start End Superfamily
af_Q2PMR0_6_196_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.981 37 207 3.90.226.10
af_Q9SAA2_76_271_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9764 37 209 3.90.226.10
1yg8S00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9664 32 209 3.90.226.10
af_A0A0R0FC89_136_330_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9648 37 212 3.90.226.10
af_P9WPC3_1_214_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9586 38 210 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A3B8IUF6-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 1.002 37 116 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117
AF-A0A6M0C5U5-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 1.002 37 107 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117
AF-A0A7V4Q6M0-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 1.001 37 125 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117
AF-A0A1Y3JBH1-F1-model_v4 deleted 1.001 37 111
AF-A0A355EXG5-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 1 37 107 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117

Map