F488849
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1041 | 334 | 1041 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300050512|nmdc:mga0n895_582121_c1|nmdc:mga0n895_582121_c1_77_955 |
| Length | 284 |
| Sequence | LRSTRGSRVAPPRGATARVILDAAQPAEDPMISASLIRAPELSLRWIPVWRRNLLVWRKLAIASVLGNIADPLLYMLALGYGIGSFVPEVGGMKYIAFIGTGMVCQSAMFTSSFEAMYSAFSRMHVQRTWEAIINAPLSLDDVVLAEWIWAATKSVMSLVLGFGHSLLALWVLPLGFIVGLTFGAFGLVMNSLAPGYDFFTYFFTLVLTPMLLLSGVFFPVDQMPAALQGVAKTLPLSHAIDIARPLLLGRIPDDIPLHIAVLLAYAFAAYYIALVLTRRRLLK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 196 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 197 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 198 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 199 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 200 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 203 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 204 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 206 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 207 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 208 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 216 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 218 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 219 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 220 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 221 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 222 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 224 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 225 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 227 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 231 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 232 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 237 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 238 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 239 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 240 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 241 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 242 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 243 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 244 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 245 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 246 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 247 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 248 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 249 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 250 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 251 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 313 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 317 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.1 |
| Nodule | 0 |
| Rhizoplane | 2.69 |
| Rhizosphere | 97.12 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1006625 | 3300001976 | Bacteria | 1515 |
| 2 | JGI24742J22300_10017488 | 3300002244 | Bacteria | 1212 |
| 3 | JGI24751J29686_10009515 | 3300002459 | Bacteria | 1999 |
| 4 | Ga0065712_10026653 | 3300005290 | Bacteria | 1253 |
| 5 | Ga0070658_10006851 | 3300005327 | Bacteria | 9212 |
| 6 | Ga0070676_10000545 | 3300005328 | Bacteria | 18256 |
| 7 | Ga0070676_10018052 | 3300005328 | Bacteria | 3906 |
| 8 | Ga0070676_10340738 | 3300005328 | Unclassified | 1028 |
| 9 | Ga0070683_100027006 | 3300005329 | Bacteria | 5175 |
| 10 | Ga0070683_100102802 | 3300005329 | Bacteria | 2691 |
| 11 | Ga0070690_100016791 | 3300005330 | Bacteria | 4394 |
| 12 | Ga0070690_100135392 | 3300005330 | Bacteria | 1668 |
| 13 | Ga0070690_100139830 | 3300005330 | Bacteria | 1642 |
| 14 | Ga0070670_100009503 | 3300005331 | Bacteria | 8300 |
| 15 | Ga0070670_100032729 | 3300005331 | Bacteria | 4479 |
| 16 | Ga0070670_100036494 | 3300005331 | Bacteria | 4230 |
| 17 | Ga0070670_100287364 | 3300005331 | Bacteria | 1436 |
| 18 | Ga0070677_10000343 | 3300005333 | Bacteria | 16239 |
| 19 | Ga0070677_10037091 | 3300005333 | Bacteria | 1899 |
| 20 | Ga0070677_10097736 | 3300005333 | Bacteria | 1289 |
| 21 | Ga0070677_10119846 | 3300005333 | Bacteria | 1187 |
| 22 | Ga0068869_100002553 | 3300005334 | Bacteria | 10982 |
| 23 | Ga0068869_100009240 | 3300005334 | Bacteria | 6390 |
| 24 | Ga0068869_100043670 | 3300005334 | Bacteria | 3221 |
| 25 | Ga0068869_100132350 | 3300005334 | Bacteria | 1918 |
| 26 | Ga0068869_100229283 | 3300005334 | Bacteria | 1475 |
| 27 | Ga0070666_10002371 | 3300005335 | Bacteria | 11382 |
| 28 | Ga0070666_10007974 | 3300005335 | Bacteria | 6548 |
| 29 | Ga0070666_10029575 | 3300005335 | Bacteria | 3602 |
| 30 | Ga0070666_10042572 | 3300005335 | Bacteria | 3040 |
| 31 | Ga0070666_10096294 | 3300005335 | Bacteria | 2037 |
| 32 | Ga0070666_10181936 | 3300005335 | Bacteria | 1475 |
| 33 | Ga0070666_10333214 | 3300005335 | Bacteria | 1084 |
| 34 | Ga0070680_100049152 | 3300005336 | Bacteria | 3438 |
| 35 | Ga0070680_100100690 | 3300005336 | Bacteria | 2398 |
| 36 | Ga0070680_100253535 | 3300005336 | Bacteria | 1488 |
| 37 | Ga0070682_100032822 | 3300005337 | Bacteria | 3151 |
| 38 | Ga0068868_100029854 | 3300005338 | Bacteria | 4178 |
| 39 | Ga0068868_100057869 | 3300005338 | Bacteria | 3063 |
| 40 | Ga0068868_100232934 | 3300005338 | Bacteria | 1545 |
| 41 | Ga0070660_100013019 | 3300005339 | Bacteria | 5952 |
| 42 | Ga0070660_100028623 | 3300005339 | Bacteria | 4170 |
| 43 | Ga0070660_100252435 | 3300005339 | Bacteria | 1439 |
| 44 | Ga0070689_100031936 | 3300005340 | Bacteria | 4002 |
| 45 | Ga0070689_100123480 | 3300005340 | Bacteria | 2070 |
| 46 | Ga0070689_100396085 | 3300005340 | Bacteria | 1166 |
| 47 | Ga0070689_100500294 | 3300005340 | Bacteria | 1041 |
| 48 | Ga0070687_100274129 | 3300005343 | Bacteria | 1059 |
| 49 | Ga0070687_100444479 | 3300005343 | Bacteria | 861 |
| 50 | Ga0070661_100003520 | 3300005344 | Bacteria | 10792 |
| 51 | Ga0070661_100011229 | 3300005344 | Bacteria | 6240 |
| 52 | Ga0070661_100016045 | 3300005344 | Bacteria | 5287 |
| 53 | Ga0070661_100016963 | 3300005344 | Bacteria | 5158 |
| 54 | Ga0070661_100090424 | 3300005344 | Bacteria | 2267 |
| 55 | Ga0070661_100103983 | 3300005344 | Bacteria | 2115 |
| 56 | Ga0070692_10016897 | 3300005345 | Bacteria | 3477 |
| 57 | Ga0070668_100000206 | 3300005347 | Bacteria | 38630 |
| 58 | Ga0070668_100002549 | 3300005347 | Bacteria | 13404 |
| 59 | Ga0070668_100006137 | 3300005347 | Bacteria | 8907 |
| 60 | Ga0070668_100007175 | 3300005347 | Bacteria | 8262 |
| 61 | Ga0070668_100062215 | 3300005347 | Bacteria | 2892 |
| 62 | Ga0070668_100266306 | 3300005347 | Bacteria | 1427 |
| 63 | Ga0070668_100322569 | 3300005347 | Bacteria | 1301 |
| 64 | Ga0070668_100334024 | 3300005347 | Bacteria | 1279 |
| 65 | Ga0070668_100340424 | 3300005347 | Bacteria | 1267 |
| 66 | Ga0070669_100018043 | 3300005353 | Bacteria | 5040 |
| 67 | Ga0070669_100031588 | 3300005353 | Bacteria | 3825 |
| 68 | Ga0070669_100053736 | 3300005353 | Bacteria | 2949 |
| 69 | Ga0070669_100141733 | 3300005353 | Bacteria | 1854 |
| 70 | Ga0070669_100158042 | 3300005353 | Bacteria | 1759 |
| 71 | Ga0070669_100162155 | 3300005353 | Bacteria | 1738 |
| 72 | Ga0070669_100415760 | 3300005353 | Bacteria | 1103 |
| 73 | Ga0070675_100001498 | 3300005354 | Bacteria | 17241 |
| 74 | Ga0070675_100004730 | 3300005354 | Bacteria | 10391 |
| 75 | Ga0070675_100004965 | 3300005354 | Bacteria | 10153 |
| 76 | Ga0070675_100020158 | 3300005354 | Bacteria | 5321 |
| 77 | Ga0070675_100210522 | 3300005354 | Bacteria | 1690 |
| 78 | Ga0070675_100309694 | 3300005354 | Bacteria | 1393 |
| 79 | Ga0070675_100751310 | 3300005354 | Bacteria | 890 |
| 80 | Ga0070671_100002054 | 3300005355 | Bacteria | 15515 |
| 81 | Ga0070671_100015348 | 3300005355 | Bacteria | 6186 |
| 82 | Ga0070671_100052938 | 3300005355 | Bacteria | 3375 |
| 83 | Ga0070671_100109036 | 3300005355 | Bacteria | 2325 |
| 84 | Ga0070671_100133619 | 3300005355 | Bacteria | 2091 |
| 85 | Ga0070671_100190605 | 3300005355 | Bacteria | 1738 |
| 86 | Ga0070671_100263014 | 3300005355 | Bacteria | 1466 |
| 87 | Ga0070671_100393186 | 3300005355 | Bacteria | 1186 |
| 88 | Ga0070674_100017565 | 3300005356 | Bacteria | 4505 |
| 89 | Ga0070674_100144914 | 3300005356 | Bacteria | 1786 |
| 90 | Ga0070674_100167731 | 3300005356 | Bacteria | 1671 |
| 91 | Ga0070674_100274136 | 3300005356 | Bacteria | 1334 |
| 92 | Ga0070674_100326499 | 3300005356 | Bacteria | 1232 |
| 93 | Ga0070673_100001140 | 3300005364 | Bacteria | 15254 |
| 94 | Ga0070673_100001547 | 3300005364 | Bacteria | 13536 |
| 95 | Ga0070673_100011534 | 3300005364 | Bacteria | 6036 |
| 96 | Ga0070673_100014398 | 3300005364 | Bacteria | 5507 |
| 97 | Ga0070673_100031620 | 3300005364 | Bacteria | 3975 |
| 98 | Ga0070673_100140304 | 3300005364 | Bacteria | 2038 |
| 99 | Ga0070688_100025653 | 3300005365 | Bacteria | 3492 |
| 100 | Ga0070688_100049809 | 3300005365 | Bacteria | 2608 |
| 101 | Ga0070688_100057364 | 3300005365 | Bacteria | 2447 |
| 102 | Ga0070688_100299197 | 3300005365 | Bacteria | 1162 |
| 103 | Ga0070659_100002218 | 3300005366 | Bacteria | 13805 |
| 104 | Ga0070659_100024728 | 3300005366 | Bacteria | 4606 |
| 105 | Ga0070659_100104784 | 3300005366 | Bacteria | 2279 |
| 106 | Ga0070659_100456049 | 3300005366 | Bacteria | 1085 |
| 107 | Ga0070667_100001933 | 3300005367 | Bacteria | 18388 |
| 108 | Ga0070667_100002979 | 3300005367 | Bacteria | 14550 |
| 109 | Ga0070667_100049464 | 3300005367 | Bacteria | 3541 |
| 110 | Ga0070667_100068013 | 3300005367 | Bacteria | 3030 |
| 111 | Ga0070667_100110048 | 3300005367 | Bacteria | 2388 |
| 112 | Ga0070667_100180102 | 3300005367 | Bacteria | 1869 |
| 113 | Ga0070667_100181683 | 3300005367 | Bacteria | 1860 |
| 114 | Ga0070667_100363890 | 3300005367 | Bacteria | 1311 |
| 115 | Ga0070703_10011705 | 3300005406 | Bacteria | 2482 |
| 116 | Ga0070709_10005119 | 3300005434 | Bacteria | 7089 |
| 117 | Ga0070709_10052832 | 3300005434 | Bacteria | 2556 |
| 118 | Ga0070714_100127254 | 3300005435 | Bacteria | 2273 |
| 119 | Ga0070713_100000031 | 3300005436 | Bacteria | 88727 |
| 120 | Ga0070713_100001967 | 3300005436 | Bacteria | 13255 |
| 121 | Ga0070713_100016486 | 3300005436 | Bacteria | 5556 |
| 122 | Ga0070713_100167194 | 3300005436 | Bacteria | 1967 |
| 123 | Ga0070713_100254758 | 3300005436 | Bacteria | 1602 |
| 124 | Ga0070701_10005021 | 3300005438 | Bacteria | 5425 |
| 125 | Ga0070701_10023917 | 3300005438 | Bacteria | 2949 |
| 126 | Ga0070711_100027155 | 3300005439 | Bacteria | 3756 |
| 127 | Ga0070711_100256135 | 3300005439 | Bacteria | 1375 |
| 128 | Ga0070705_100085793 | 3300005440 | Bacteria | 1947 |
| 129 | Ga0070705_100176305 | 3300005440 | Bacteria | 1444 |
| 130 | Ga0070705_100360792 | 3300005440 | Bacteria | 1063 |
| 131 | Ga0070700_100050457 | 3300005441 | Bacteria | 2586 |
| 132 | Ga0070700_100144855 | 3300005441 | Bacteria | 1618 |
| 133 | Ga0070694_100023264 | 3300005444 | Bacteria | 3982 |
| 134 | Ga0070694_100097376 | 3300005444 | Bacteria | 2075 |
| 135 | Ga0070708_100018090 | 3300005445 | Bacteria | 5895 |
| 136 | Ga0070708_100034792 | 3300005445 | Bacteria | 4385 |
| 137 | Ga0070708_100102774 | 3300005445 | Bacteria | 2619 |
| 138 | Ga0070663_100001186 | 3300005455 | Bacteria | 14326 |
| 139 | Ga0070663_100008129 | 3300005455 | Bacteria | 6436 |
| 140 | Ga0070663_100040592 | 3300005455 | Bacteria | 3259 |
| 141 | Ga0070663_100266308 | 3300005455 | Bacteria | 1361 |
| 142 | Ga0070678_100000259 | 3300005456 | Bacteria | 24382 |
| 143 | Ga0070678_100004102 | 3300005456 | Bacteria | 8204 |
| 144 | Ga0070678_100223702 | 3300005456 | Bacteria | 1565 |
| 145 | Ga0070678_100526582 | 3300005456 | Bacteria | 1046 |
| 146 | Ga0070662_100000582 | 3300005457 | Bacteria | 22250 |
| 147 | Ga0070662_100060315 | 3300005457 | Bacteria | 2766 |
| 148 | Ga0070662_100264419 | 3300005457 | Bacteria | 1387 |
| 149 | Ga0070681_10004606 | 3300005458 | Bacteria | 13167 |
| 150 | Ga0070681_10020531 | 3300005458 | Bacteria | 6621 |
| 151 | Ga0070681_10104122 | 3300005458 | Bacteria | 2781 |
| 152 | Ga0070681_10160385 | 3300005458 | Bacteria | 2173 |
| 153 | Ga0070681_10200210 | 3300005458 | Bacteria | 1915 |
| 154 | Ga0068867_100001543 | 3300005459 | Bacteria | 15998 |
| 155 | Ga0068867_100001753 | 3300005459 | Bacteria | 15109 |
| 156 | Ga0068867_100002252 | 3300005459 | Bacteria | 13567 |
| 157 | Ga0068867_100050245 | 3300005459 | Bacteria | 3072 |
| 158 | Ga0068867_100052859 | 3300005459 | Bacteria | 2999 |
| 159 | Ga0068867_100077168 | 3300005459 | Bacteria | 2503 |
| 160 | Ga0068867_100107300 | 3300005459 | Bacteria | 2140 |
| 161 | Ga0068867_100143122 | 3300005459 | Bacteria | 1871 |
| 162 | Ga0068867_100161458 | 3300005459 | Bacteria | 1767 |
| 163 | Ga0068867_100275790 | 3300005459 | Bacteria | 1377 |
| 164 | Ga0070685_10001891 | 3300005466 | Bacteria | 10892 |
| 165 | Ga0070685_10057686 | 3300005466 | Bacteria | 2261 |
| 166 | Ga0070685_10113051 | 3300005466 | Bacteria | 1676 |
| 167 | Ga0070685_10324771 | 3300005466 | Bacteria | 1044 |
| 168 | Ga0070706_100040808 | 3300005467 | Bacteria | 4284 |
| 169 | Ga0070706_100056378 | 3300005467 | Bacteria | 3626 |
| 170 | Ga0070706_100293177 | 3300005467 | Bacteria | 1518 |
| 171 | Ga0070698_100198187 | 3300005471 | Bacteria | 1944 |
| 172 | Ga0070699_100002810 | 3300005518 | Bacteria | 15538 |
| 173 | Ga0070699_100008896 | 3300005518 | Bacteria | 8698 |
| 174 | Ga0070679_100031838 | 3300005530 | Bacteria | 5215 |
| 175 | Ga0070679_100079385 | 3300005530 | Bacteria | 3271 |
| 176 | Ga0070679_100082903 | 3300005530 | Bacteria | 3196 |
| 177 | Ga0070679_100188946 | 3300005530 | Bacteria | 2029 |
| 178 | Ga0070679_100252229 | 3300005530 | Bacteria | 1720 |
| 179 | Ga0070684_100040176 | 3300005535 | Bacteria | 4027 |
| 180 | Ga0070684_100106172 | 3300005535 | Bacteria | 2514 |
| 181 | Ga0070697_100007116 | 3300005536 | Bacteria | 8698 |
| 182 | Ga0070697_100533234 | 3300005536 | Bacteria | 1028 |
| 183 | Ga0068853_100018287 | 3300005539 | Bacteria | 5798 |
| 184 | Ga0068853_100025596 | 3300005539 | Bacteria | 4953 |
| 185 | Ga0068853_100075502 | 3300005539 | Bacteria | 2942 |
| 186 | Ga0068853_100086660 | 3300005539 | Bacteria | 2746 |
| 187 | Ga0068853_100105741 | 3300005539 | Bacteria | 2493 |
| 188 | Ga0068853_100330484 | 3300005539 | Bacteria | 1414 |
| 189 | Ga0068853_100382442 | 3300005539 | Bacteria | 1315 |
| 190 | Ga0068853_100448093 | 3300005539 | Bacteria | 1214 |
| 191 | Ga0070672_100000960 | 3300005543 | Bacteria | 17405 |
| 192 | Ga0070672_100022218 | 3300005543 | Bacteria | 4655 |
| 193 | Ga0070672_100023349 | 3300005543 | Bacteria | 4558 |
| 194 | Ga0070672_100030863 | 3300005543 | Bacteria | 4030 |
| 195 | Ga0070672_100084812 | 3300005543 | Bacteria | 2545 |
| 196 | Ga0070672_100264392 | 3300005543 | Bacteria | 1451 |
| 197 | Ga0070672_100424987 | 3300005543 | Bacteria | 1142 |
| 198 | Ga0070686_100016443 | 3300005544 | Bacteria | 4304 |
| 199 | Ga0070695_100011248 | 3300005545 | Bacteria | 5353 |
| 200 | Ga0070696_100017107 | 3300005546 | Bacteria | 4894 |
| 201 | Ga0070696_100056927 | 3300005546 | Bacteria | 2728 |
| 202 | Ga0070696_100066883 | 3300005546 | Bacteria | 2521 |
| 203 | Ga0070696_100358700 | 3300005546 | Bacteria | 1131 |
| 204 | Ga0070693_100006875 | 3300005547 | Bacteria | 5529 |
| 205 | Ga0070693_100017583 | 3300005547 | Bacteria | 3720 |
| 206 | Ga0070693_100127465 | 3300005547 | Bacteria | 1586 |
| 207 | Ga0070693_100400105 | 3300005547 | Bacteria | 952 |
| 208 | Ga0070665_100002580 | 3300005548 | Bacteria | 19847 |
| 209 | Ga0070665_100005936 | 3300005548 | Bacteria | 12507 |
| 210 | Ga0070665_100008185 | 3300005548 | Bacteria | 10589 |
| 211 | Ga0070665_100035193 | 3300005548 | Bacteria | 5035 |
| 212 | Ga0070665_100072122 | 3300005548 | Bacteria | 3461 |
| 213 | Ga0070665_100246051 | 3300005548 | Bacteria | 1789 |
| 214 | Ga0070665_100310401 | 3300005548 | Bacteria | 1581 |
| 215 | Ga0070704_100014002 | 3300005549 | Bacteria | 4997 |
| 216 | Ga0070704_100026382 | 3300005549 | Bacteria | 3837 |
| 217 | Ga0070704_100032975 | 3300005549 | Bacteria | 3499 |
| 218 | Ga0070704_100078596 | 3300005549 | Bacteria | 2421 |
| 219 | Ga0070704_100144198 | 3300005549 | Bacteria | 1864 |
| 220 | Ga0068855_100005529 | 3300005563 | Bacteria | 15420 |
| 221 | Ga0068855_100026941 | 3300005563 | Bacteria | 6878 |
| 222 | Ga0068855_100059007 | 3300005563 | Bacteria | 4491 |
| 223 | Ga0068855_100078768 | 3300005563 | Bacteria | 3823 |
| 224 | Ga0068855_100294394 | 3300005563 | Bacteria | 1799 |
| 225 | Ga0068855_100402743 | 3300005563 | Bacteria | 1499 |
| 226 | Ga0068855_100451937 | 3300005563 | Bacteria | 1402 |
| 227 | Ga0068855_100471248 | 3300005563 | Bacteria | 1368 |
| 228 | Ga0070664_100002314 | 3300005564 | Bacteria | 15313 |
| 229 | Ga0070664_100006795 | 3300005564 | Bacteria | 9224 |
| 230 | Ga0070664_100051277 | 3300005564 | Bacteria | 3494 |
| 231 | Ga0070664_100071856 | 3300005564 | Bacteria | 2966 |
| 232 | Ga0070664_100140654 | 3300005564 | Bacteria | 2125 |
| 233 | Ga0070664_100152650 | 3300005564 | Bacteria | 2040 |
| 234 | Ga0070664_100203952 | 3300005564 | Bacteria | 1765 |
| 235 | Ga0070664_100373670 | 3300005564 | Bacteria | 1300 |
| 236 | Ga0070664_100471277 | 3300005564 | Bacteria | 1155 |
| 237 | Ga0068857_100030274 | 3300005577 | Bacteria | 4778 |
| 238 | Ga0068857_100040036 | 3300005577 | Bacteria | 4155 |
| 239 | Ga0068854_100009659 | 3300005578 | Bacteria | 6230 |
| 240 | Ga0068854_100062585 | 3300005578 | Bacteria | 2698 |
| 241 | Ga0068854_100084378 | 3300005578 | Bacteria | 2350 |
| 242 | Ga0068854_100141712 | 3300005578 | Bacteria | 1845 |
| 243 | Ga0068854_100230556 | 3300005578 | Bacteria | 1469 |
| 244 | Ga0068854_100373897 | 3300005578 | Bacteria | 1172 |
| 245 | Ga0068856_100000093 | 3300005614 | Bacteria | 84752 |
| 246 | Ga0068856_100014926 | 3300005614 | Bacteria | 7500 |
| 247 | Ga0068856_100015908 | 3300005614 | Bacteria | 7272 |
| 248 | Ga0068856_100023886 | 3300005614 | Bacteria | 5946 |
| 249 | Ga0068856_100044836 | 3300005614 | Bacteria | 4352 |
| 250 | Ga0068856_100192724 | 3300005614 | Bacteria | 2052 |
| 251 | Ga0068856_100256471 | 3300005614 | Bacteria | 1764 |
| 252 | Ga0068856_100742572 | 3300005614 | Bacteria | 1001 |
| 253 | Ga0070702_100086916 | 3300005615 | Bacteria | 1887 |
| 254 | Ga0070702_100094957 | 3300005615 | Bacteria | 1816 |
| 255 | Ga0068852_100007757 | 3300005616 | Bacteria | 7854 |
| 256 | Ga0068852_100035485 | 3300005616 | Bacteria | 4161 |
| 257 | Ga0068852_100070955 | 3300005616 | Bacteria | 3057 |
| 258 | Ga0068852_100071009 | 3300005616 | Bacteria | 3056 |
| 259 | Ga0068852_100090719 | 3300005616 | Bacteria | 2733 |
| 260 | Ga0068852_100592848 | 3300005616 | Bacteria | 1112 |
| 261 | Ga0068859_100001177 | 3300005617 | Bacteria | 26708 |
| 262 | Ga0068859_100002682 | 3300005617 | Bacteria | 18068 |
| 263 | Ga0068859_100010733 | 3300005617 | Bacteria | 9219 |
| 264 | Ga0068859_100032436 | 3300005617 | Bacteria | 5247 |
| 265 | Ga0068859_100090057 | 3300005617 | Bacteria | 3118 |
| 266 | Ga0068859_100091024 | 3300005617 | Bacteria | 3101 |
| 267 | Ga0068859_100209166 | 3300005617 | Bacteria | 2037 |
| 268 | Ga0068859_100592423 | 3300005617 | Bacteria | 1202 |
| 269 | Ga0068864_100002535 | 3300005618 | Bacteria | 15082 |
| 270 | Ga0068864_100003419 | 3300005618 | Bacteria | 13129 |
| 271 | Ga0068864_100003579 | 3300005618 | Bacteria | 12843 |
| 272 | Ga0068864_100018393 | 3300005618 | Bacteria | 5838 |
| 273 | Ga0068864_100080019 | 3300005618 | Bacteria | 2862 |
| 274 | Ga0068864_100082429 | 3300005618 | Bacteria | 2822 |
| 275 | Ga0068864_100302402 | 3300005618 | Bacteria | 1498 |
| 276 | Ga0068864_100401908 | 3300005618 | Bacteria | 1302 |
| 277 | Ga0068866_10002777 | 3300005718 | Bacteria | 7222 |
| 278 | Ga0068861_100000930 | 3300005719 | Bacteria | 17788 |
| 279 | Ga0068861_100190133 | 3300005719 | Bacteria | 1715 |
| 280 | Ga0068851_10001833 | 3300005834 | Bacteria | 9309 |
| 281 | Ga0068851_10003969 | 3300005834 | Bacteria | 6626 |
| 282 | Ga0068851_10008843 | 3300005834 | Bacteria | 4668 |
| 283 | Ga0068851_10012795 | 3300005834 | Bacteria | 3963 |
| 284 | Ga0068851_10079555 | 3300005834 | Bacteria | 1710 |
| 285 | Ga0068870_10004563 | 3300005840 | Bacteria | 5969 |
| 286 | Ga0068870_10011298 | 3300005840 | Bacteria | 4136 |
| 287 | Ga0068870_10037219 | 3300005840 | Bacteria | 2507 |
| 288 | Ga0068863_100002938 | 3300005841 | Bacteria | 16850 |
| 289 | Ga0068863_100046106 | 3300005841 | Bacteria | 4137 |
| 290 | Ga0068863_100059141 | 3300005841 | Bacteria | 3626 |
| 291 | Ga0068863_100093802 | 3300005841 | Bacteria | 2848 |
| 292 | Ga0068863_100101671 | 3300005841 | Bacteria | 2732 |
| 293 | Ga0068863_100124228 | 3300005841 | Bacteria | 2462 |
| 294 | Ga0068863_100140224 | 3300005841 | Bacteria | 2310 |
| 295 | Ga0068863_100141986 | 3300005841 | Bacteria | 2295 |
| 296 | Ga0068858_100008579 | 3300005842 | Bacteria | 9815 |
| 297 | Ga0068858_100025315 | 3300005842 | Bacteria | 5522 |
| 298 | Ga0068858_100039701 | 3300005842 | Bacteria | 4364 |
| 299 | Ga0068858_100054531 | 3300005842 | Bacteria | 3696 |
| 300 | Ga0068858_100144291 | 3300005842 | Bacteria | 2236 |
| 301 | Ga0068858_100207244 | 3300005842 | Bacteria | 1855 |
| 302 | Ga0068858_100211598 | 3300005842 | Bacteria | 1835 |
| 303 | Ga0068858_100601281 | 3300005842 | Unclassified | 1067 |
| 304 | Ga0068858_100771939 | 3300005842 | Bacteria | 937 |
| 305 | Ga0068860_100001191 | 3300005843 | Bacteria | 28399 |
| 306 | Ga0068860_100013607 | 3300005843 | Bacteria | 7975 |
| 307 | Ga0068860_100018869 | 3300005843 | Bacteria | 6701 |
| 308 | Ga0068860_100019078 | 3300005843 | Bacteria | 6657 |
| 309 | Ga0068860_100037773 | 3300005843 | Bacteria | 4622 |
| 310 | Ga0068860_100056604 | 3300005843 | Bacteria | 3727 |
| 311 | Ga0068860_100255261 | 3300005843 | Bacteria | 1708 |
| 312 | Ga0068860_100391047 | 3300005843 | Bacteria | 1374 |
| 313 | Ga0068862_100047830 | 3300005844 | Bacteria | 3651 |
| 314 | Ga0068862_100063344 | 3300005844 | Bacteria | 3182 |
| 315 | Ga0070716_100034262 | 3300006173 | Bacteria | 2783 |
| 316 | Ga0070712_100044645 | 3300006175 | Bacteria | 3056 |
| 317 | Ga0070712_100058044 | 3300006175 | Bacteria | 2721 |
| 318 | Ga0097621_100000696 | 3300006237 | Bacteria | 23599 |
| 319 | Ga0097621_100003701 | 3300006237 | Bacteria | 10579 |
| 320 | Ga0097621_100008390 | 3300006237 | Bacteria | 7435 |
| 321 | Ga0097621_100015241 | 3300006237 | Bacteria | 5778 |
| 322 | Ga0097621_100026548 | 3300006237 | Bacteria | 4544 |
| 323 | Ga0097621_100054192 | 3300006237 | Bacteria | 3270 |
| 324 | Ga0097621_100104271 | 3300006237 | Bacteria | 2389 |
| 325 | Ga0097621_100127721 | 3300006237 | Bacteria | 2161 |
| 326 | Ga0097621_100313231 | 3300006237 | Bacteria | 1389 |
| 327 | Ga0097621_100403263 | 3300006237 | Bacteria | 1224 |
| 328 | Ga0068871_100000472 | 3300006358 | Bacteria | 27578 |
| 329 | Ga0068871_100124841 | 3300006358 | Bacteria | 2178 |
| 330 | Ga0068871_100158004 | 3300006358 | Bacteria | 1937 |
| 331 | Ga0068871_100254953 | 3300006358 | Bacteria | 1529 |
| 332 | Ga0068871_100354285 | 3300006358 | Bacteria | 1299 |
| 333 | Ga0075428_100010320 | 3300006844 | Bacteria | 10367 |
| 334 | Ga0075428_100084684 | 3300006844 | Bacteria | 3459 |
| 335 | Ga0075428_100107723 | 3300006844 | Bacteria | 3037 |
| 336 | Ga0075428_100117321 | 3300006844 | Bacteria | 2899 |
| 337 | Ga0075430_100213379 | 3300006846 | Bacteria | 1601 |
| 338 | Ga0075431_100019537 | 3300006847 | Bacteria | 6910 |
| 339 | Ga0075431_100024857 | 3300006847 | Bacteria | 6142 |
| 340 | Ga0075433_10014465 | 3300006852 | Bacteria | 6449 |
| 341 | Ga0075433_10139232 | 3300006852 | Bacteria | 2157 |
| 342 | Ga0075434_100010242 | 3300006871 | Bacteria | 8780 |
| 343 | Ga0075434_100119033 | 3300006871 | Bacteria | 2655 |
| 344 | Ga0075434_100152502 | 3300006871 | Bacteria | 2331 |
| 345 | Ga0075434_100292901 | 3300006871 | Bacteria | 1648 |
| 346 | Ga0075429_100000175 | 3300006880 | Bacteria | 41423 |
| 347 | Ga0075429_100034410 | 3300006880 | Bacteria | 4402 |
| 348 | Ga0068865_100036414 | 3300006881 | Bacteria | 3317 |
| 349 | Ga0068865_100073431 | 3300006881 | Bacteria | 2432 |
| 350 | Ga0068865_100133683 | 3300006881 | Bacteria | 1861 |
| 351 | Ga0068865_100214888 | 3300006881 | Bacteria | 1500 |
| 352 | Ga0068865_100353811 | 3300006881 | Bacteria | 1191 |
| 353 | Ga0068865_100394832 | 3300006881 | Bacteria | 1132 |
| 354 | Ga0075436_100022726 | 3300006914 | Bacteria | 4309 |
| 355 | Ga0075436_100175164 | 3300006914 | Bacteria | 1515 |
| 356 | Ga0097620_100001177 | 3300006931 | Bacteria | 26708 |
| 357 | Ga0097620_100002682 | 3300006931 | Bacteria | 18068 |
| 358 | Ga0097620_100010733 | 3300006931 | Bacteria | 9219 |
| 359 | Ga0097620_100032436 | 3300006931 | Bacteria | 5247 |
| 360 | Ga0097620_100090057 | 3300006931 | Bacteria | 3118 |
| 361 | Ga0097620_100091021 | 3300006931 | Bacteria | 3101 |
| 362 | Ga0097620_100209170 | 3300006931 | Bacteria | 2037 |
| 363 | Ga0097620_100592423 | 3300006931 | Bacteria | 1202 |
| 364 | Ga0075435_100000996 | 3300007076 | Bacteria | 17936 |
| 365 | Ga0075435_100206571 | 3300007076 | Bacteria | 1665 |
| 366 | Ga0105240_10045447 | 3300009093 | Bacteria | 5570 |
| 367 | Ga0105240_10052230 | 3300009093 | Bacteria | 5139 |
| 368 | Ga0111539_10142481 | 3300009094 | Bacteria | 2806 |
| 369 | Ga0111539_10331248 | 3300009094 | Bacteria | 1772 |
| 370 | Ga0111539_10659496 | 3300009094 | Bacteria | 1218 |
| 371 | Ga0105245_10021563 | 3300009098 | Bacteria | 5653 |
| 372 | Ga0105245_10030966 | 3300009098 | Bacteria | 4733 |
| 373 | Ga0105245_10108538 | 3300009098 | Bacteria | 2578 |
| 374 | Ga0105245_10358242 | 3300009098 | Bacteria | 1447 |
| 375 | Ga0105245_10368171 | 3300009098 | Bacteria | 1428 |
| 376 | Ga0105245_10716880 | 3300009098 | Bacteria | 1034 |
| 377 | Ga0105247_10018828 | 3300009101 | Bacteria | 4145 |
| 378 | Ga0114129_10046258 | 3300009147 | Bacteria | 6116 |
| 379 | Ga0114129_10056041 | 3300009147 | Bacteria | 5523 |
| 380 | Ga0114129_11024070 | 3300009147 | Bacteria | 1038 |
| 381 | Ga0105243_10236361 | 3300009148 | Bacteria | 1624 |
| 382 | Ga0105243_10307794 | 3300009148 | Bacteria | 1438 |
| 383 | Ga0105241_10004906 | 3300009174 | Bacteria | 9867 |
| 384 | Ga0105241_10138001 | 3300009174 | Bacteria | 1982 |
| 385 | Ga0105241_10372640 | 3300009174 | Bacteria | 1245 |
| 386 | Ga0105241_10415779 | 3300009174 | Bacteria | 1182 |
| 387 | Ga0105242_10009513 | 3300009176 | Bacteria | 7448 |
| 388 | Ga0105242_10034566 | 3300009176 | Bacteria | 4053 |
| 389 | Ga0105242_10044321 | 3300009176 | Bacteria | 3602 |
| 390 | Ga0105242_10072045 | 3300009176 | Bacteria | 2869 |
| 391 | Ga0105242_10459533 | 3300009176 | Bacteria | 1202 |
| 392 | Ga0105242_10819496 | 3300009176 | Bacteria | 923 |
| 393 | Ga0105248_10001670 | 3300009177 | Bacteria | 24699 |
| 394 | Ga0105248_10011976 | 3300009177 | Bacteria | 9565 |
| 395 | Ga0105248_10013498 | 3300009177 | Bacteria | 8994 |
| 396 | Ga0105248_10025672 | 3300009177 | Bacteria | 6552 |
| 397 | Ga0105248_10048753 | 3300009177 | Bacteria | 4751 |
| 398 | Ga0105248_10165601 | 3300009177 | Bacteria | 2493 |
| 399 | Ga0105248_10202940 | 3300009177 | Bacteria | 2234 |
| 400 | Ga0105248_10395398 | 3300009177 | Bacteria | 1556 |
| 401 | Ga0105237_10042280 | 3300009545 | Bacteria | 4597 |
| 402 | Ga0105237_10131252 | 3300009545 | Bacteria | 2500 |
| 403 | Ga0105237_10293452 | 3300009545 | Bacteria | 1629 |
| 404 | Ga0105238_10062479 | 3300009551 | Bacteria | 3725 |
| 405 | Ga0105238_10499899 | 3300009551 | Bacteria | 1217 |
| 406 | Ga0105249_10004775 | 3300009553 | Bacteria | 11693 |
| 407 | Ga0105249_10124073 | 3300009553 | Bacteria | 2458 |
| 408 | Ga0105249_10188497 | 3300009553 | Bacteria | 2011 |
| 409 | Ga0105249_10309895 | 3300009553 | Bacteria | 1586 |
| 410 | Ga0105239_10458469 | 3300010375 | Bacteria | 1447 |
| 411 | Ga0105239_10733907 | 3300010375 | Bacteria | 1130 |
| 412 | Ga0105246_10119689 | 3300011119 | Bacteria | 1949 |
| 413 | Ga0105246_10328817 | 3300011119 | Bacteria | 1245 |
| 414 | Ga0157373_10001205 | 3300013100 | Bacteria | 19754 |
| 415 | Ga0157373_10002005 | 3300013100 | Bacteria | 15435 |
| 416 | Ga0157373_10049919 | 3300013100 | Bacteria | 2980 |
| 417 | Ga0157371_10000228 | 3300013102 | Bacteria | 81797 |
| 418 | Ga0157371_10045890 | 3300013102 | Bacteria | 3109 |
| 419 | Ga0157371_10123177 | 3300013102 | Bacteria | 1844 |
| 420 | Ga0157371_10291975 | 3300013102 | Bacteria | 1179 |
| 421 | Ga0157370_10011607 | 3300013104 | Bacteria | 9197 |
| 422 | Ga0157370_10020629 | 3300013104 | Bacteria | 6579 |
| 423 | Ga0157370_10036807 | 3300013104 | Bacteria | 4747 |
| 424 | Ga0157370_10039006 | 3300013104 | Bacteria | 4593 |
| 425 | Ga0157370_10048439 | 3300013104 | Bacteria | 4071 |
| 426 | Ga0157370_10107088 | 3300013104 | Bacteria | 2615 |
| 427 | Ga0157370_10134194 | 3300013104 | Bacteria | 2308 |
| 428 | Ga0157370_10330831 | 3300013104 | Bacteria | 1405 |
| 429 | Ga0157369_10004565 | 3300013105 | Bacteria | 16276 |
| 430 | Ga0157369_10100242 | 3300013105 | Bacteria | 3087 |
| 431 | Ga0157369_10127131 | 3300013105 | Bacteria | 2701 |
| 432 | Ga0157369_10151720 | 3300013105 | Bacteria | 2449 |
| 433 | Ga0157369_10236246 | 3300013105 | Bacteria | 1910 |
| 434 | Ga0157374_10002207 | 3300013296 | Bacteria | 16415 |
| 435 | Ga0157374_10010560 | 3300013296 | Bacteria | 7949 |
| 436 | Ga0157374_10456941 | 3300013296 | Bacteria | 1279 |
| 437 | Ga0157378_10009398 | 3300013297 | Bacteria | 8518 |
| 438 | Ga0157378_10012711 | 3300013297 | Bacteria | 7365 |
| 439 | Ga0157378_10123850 | 3300013297 | Bacteria | 2386 |
| 440 | Ga0157378_10129837 | 3300013297 | Bacteria | 2332 |
| 441 | Ga0157378_10672319 | 3300013297 | Bacteria | 1053 |
| 442 | Ga0157378_10936551 | 3300013297 | Bacteria | 898 |
| 443 | Ga0163162_10000619 | 3300013306 | Bacteria | 32928 |
| 444 | Ga0163162_10008387 | 3300013306 | Bacteria | 10078 |
| 445 | Ga0163162_10013531 | 3300013306 | Bacteria | 7967 |
| 446 | Ga0163162_10086076 | 3300013306 | Bacteria | 3220 |
| 447 | Ga0163162_10216232 | 3300013306 | Bacteria | 2047 |
| 448 | Ga0163162_10217241 | 3300013306 | Bacteria | 2042 |
| 449 | Ga0157372_10009636 | 3300013307 | Bacteria | 10267 |
| 450 | Ga0157372_10037205 | 3300013307 | Bacteria | 5366 |
| 451 | Ga0157372_10045381 | 3300013307 | Bacteria | 4875 |
| 452 | Ga0157372_10214336 | 3300013307 | Bacteria | 2231 |
| 453 | Ga0157372_10254938 | 3300013307 | Bacteria | 2037 |
| 454 | Ga0157372_10750287 | 3300013307 | Bacteria | 1135 |
| 455 | Ga0157375_10003009 | 3300013308 | Bacteria | 14635 |
| 456 | Ga0157375_10019692 | 3300013308 | Bacteria | 6145 |
| 457 | Ga0157375_10119523 | 3300013308 | Bacteria | 2743 |
| 458 | Ga0157375_10146613 | 3300013308 | Bacteria | 2491 |
| 459 | Ga0157375_10738056 | 3300013308 | Bacteria | 1137 |
| 460 | Ga0157375_10850331 | 3300013308 | Bacteria | 1059 |
| 461 | Ga0157375_11064402 | 3300013308 | Bacteria | 946 |
| 462 | Ga0163163_10003372 | 3300014325 | Bacteria | 13559 |
| 463 | Ga0163163_10018845 | 3300014325 | Bacteria | 6472 |
| 464 | Ga0163163_10089598 | 3300014325 | Bacteria | 3089 |
| 465 | Ga0163163_10100389 | 3300014325 | Bacteria | 2916 |
| 466 | Ga0163163_10116793 | 3300014325 | Bacteria | 2699 |
| 467 | Ga0163163_10186639 | 3300014325 | Bacteria | 2121 |
| 468 | Ga0157380_10022406 | 3300014326 | Bacteria | 4754 |
| 469 | Ga0157380_10054788 | 3300014326 | Bacteria | 3166 |
| 470 | Ga0157380_10083960 | 3300014326 | Bacteria | 2610 |
| 471 | Ga0157380_10279086 | 3300014326 | Bacteria | 1528 |
| 472 | Ga0182008_10071251 | 3300014497 | Bacteria | 1710 |
| 473 | Ga0157379_10001443 | 3300014968 | Bacteria | 19514 |
| 474 | Ga0157379_10022156 | 3300014968 | Bacteria | 5631 |
| 475 | Ga0157379_10023178 | 3300014968 | Bacteria | 5506 |
| 476 | Ga0157379_10466201 | 3300014968 | Bacteria | 1168 |
| 477 | Ga0157379_10525751 | 3300014968 | Bacteria | 1099 |
| 478 | Ga0157376_10035683 | 3300014969 | Bacteria | 4023 |
| 479 | Ga0157376_10050661 | 3300014969 | Bacteria | 3445 |
| 480 | Ga0157376_10065570 | 3300014969 | Bacteria | 3067 |
| 481 | Ga0157376_10118977 | 3300014969 | Bacteria | 2338 |
| 482 | Ga0157376_10395243 | 3300014969 | Bacteria | 1335 |
| 483 | Ga0163161_10009380 | 3300017792 | Bacteria | 6775 |
| 484 | Ga0163161_10019666 | 3300017792 | Bacteria | 4736 |
| 485 | Ga0163161_10021646 | 3300017792 | Bacteria | 4518 |
| 486 | Ga0163161_10090394 | 3300017792 | Bacteria | 2265 |
| 487 | Ga0163161_10548064 | 3300017792 | Bacteria | 948 |
| 488 | Ga0207673_1000490 | 3300025290 | Bacteria | 4156 |
| 489 | Ga0207697_10000152 | 3300025315 | Bacteria | 34092 |
| 490 | Ga0207697_10008287 | 3300025315 | Bacteria | 4562 |
| 491 | Ga0207656_10011875 | 3300025321 | Bacteria | 3300 |
| 492 | Ga0207656_10018233 | 3300025321 | Bacteria | 2760 |
| 493 | Ga0207656_10040771 | 3300025321 | Bacteria | 1970 |
| 494 | Ga0207653_10045344 | 3300025885 | Bacteria | 1452 |
| 495 | Ga0207682_10000198 | 3300025893 | Bacteria | 27362 |
| 496 | Ga0207682_10000277 | 3300025893 | Bacteria | 23286 |
| 497 | Ga0207682_10010491 | 3300025893 | Bacteria | 3631 |
| 498 | Ga0207682_10087131 | 3300025893 | Bacteria | 1348 |
| 499 | Ga0207682_10151509 | 3300025893 | Bacteria | 1046 |
| 500 | Ga0207692_10005904 | 3300025898 | Bacteria | 4938 |
| 501 | Ga0207692_10132069 | 3300025898 | Bacteria | 1411 |
| 502 | Ga0207642_10031819 | 3300025899 | Bacteria | 2214 |
| 503 | Ga0207710_10089917 | 3300025900 | Bacteria | 1436 |
| 504 | Ga0207688_10049854 | 3300025901 | Bacteria | 2341 |
| 505 | Ga0207688_10171422 | 3300025901 | Bacteria | 1290 |
| 506 | Ga0207680_10001163 | 3300025903 | Bacteria | 12405 |
| 507 | Ga0207680_10004517 | 3300025903 | Bacteria | 6600 |
| 508 | Ga0207680_10115652 | 3300025903 | Bacteria | 1747 |
| 509 | Ga0207680_10298566 | 3300025903 | Bacteria | 1122 |
| 510 | Ga0207680_10322419 | 3300025903 | Bacteria | 1080 |
| 511 | Ga0207645_10000095 | 3300025907 | Bacteria | 64667 |
| 512 | Ga0207645_10000676 | 3300025907 | Bacteria | 28210 |
| 513 | Ga0207645_10002695 | 3300025907 | Bacteria | 13841 |
| 514 | Ga0207645_10009493 | 3300025907 | Bacteria | 6724 |
| 515 | Ga0207645_10041702 | 3300025907 | Bacteria | 2937 |
| 516 | Ga0207645_10063263 | 3300025907 | Bacteria | 2364 |
| 517 | Ga0207645_10094687 | 3300025907 | Bacteria | 1922 |
| 518 | Ga0207645_10158198 | 3300025907 | Bacteria | 1481 |
| 519 | Ga0207643_10000311 | 3300025908 | Bacteria | 33638 |
| 520 | Ga0207643_10015525 | 3300025908 | Bacteria | 4146 |
| 521 | Ga0207643_10019620 | 3300025908 | Bacteria | 3706 |
| 522 | Ga0207643_10043085 | 3300025908 | Bacteria | 2546 |
| 523 | Ga0207684_10061016 | 3300025910 | Bacteria | 3202 |
| 524 | Ga0207684_10128792 | 3300025910 | Bacteria | 2172 |
| 525 | Ga0207684_10553508 | 3300025910 | Bacteria | 984 |
| 526 | Ga0207654_10028623 | 3300025911 | Bacteria | 3039 |
| 527 | Ga0207707_10002449 | 3300025912 | Bacteria | 16703 |
| 528 | Ga0207707_10004319 | 3300025912 | Bacteria | 12584 |
| 529 | Ga0207707_10131617 | 3300025912 | Bacteria | 2188 |
| 530 | Ga0207707_10314313 | 3300025912 | Bacteria | 1353 |
| 531 | Ga0207695_10014284 | 3300025913 | Bacteria | 9418 |
| 532 | Ga0207671_10095653 | 3300025914 | Bacteria | 2243 |
| 533 | Ga0207671_10311892 | 3300025914 | Bacteria | 1244 |
| 534 | Ga0207693_10000070 | 3300025915 | Bacteria | 90057 |
| 535 | Ga0207693_10126993 | 3300025915 | Bacteria | 2005 |
| 536 | Ga0207693_10226978 | 3300025915 | Bacteria | 1467 |
| 537 | Ga0207663_10134118 | 3300025916 | Bacteria | 1716 |
| 538 | Ga0207663_10240988 | 3300025916 | Bacteria | 1326 |
| 539 | Ga0207660_10138111 | 3300025917 | Bacteria | 1861 |
| 540 | Ga0207660_10182054 | 3300025917 | Bacteria | 1632 |
| 541 | Ga0207660_10435334 | 3300025917 | Bacteria | 1059 |
| 542 | Ga0207662_10016821 | 3300025918 | Bacteria | 4130 |
| 543 | Ga0207657_10000045 | 3300025919 | Bacteria | 114661 |
| 544 | Ga0207657_10000645 | 3300025919 | Bacteria | 37069 |
| 545 | Ga0207657_10018126 | 3300025919 | Bacteria | 6735 |
| 546 | Ga0207649_10009634 | 3300025920 | Bacteria | 5288 |
| 547 | Ga0207649_10029299 | 3300025920 | Bacteria | 3251 |
| 548 | Ga0207649_10030611 | 3300025920 | Bacteria | 3190 |
| 549 | Ga0207649_10116236 | 3300025920 | Bacteria | 1796 |
| 550 | Ga0207649_10151367 | 3300025920 | Bacteria | 1598 |
| 551 | Ga0207652_10005836 | 3300025921 | Bacteria | 9975 |
| 552 | Ga0207652_10015307 | 3300025921 | Bacteria | 6229 |
| 553 | Ga0207652_10042383 | 3300025921 | Bacteria | 3874 |
| 554 | Ga0207652_10077355 | 3300025921 | Bacteria | 2903 |
| 555 | Ga0207652_10094074 | 3300025921 | Bacteria | 2639 |
| 556 | Ga0207646_10006400 | 3300025922 | Bacteria | 12179 |
| 557 | Ga0207646_10119191 | 3300025922 | Bacteria | 2371 |
| 558 | Ga0207681_10005063 | 3300025923 | Bacteria | 8100 |
| 559 | Ga0207681_10005688 | 3300025923 | Bacteria | 7657 |
| 560 | Ga0207681_10110212 | 3300025923 | Bacteria | 2001 |
| 561 | Ga0207681_10222013 | 3300025923 | Bacteria | 1462 |
| 562 | Ga0207681_10511610 | 3300025923 | Bacteria | 984 |
| 563 | Ga0207694_10277570 | 3300025924 | Bacteria | 1376 |
| 564 | Ga0207694_10328029 | 3300025924 | Bacteria | 1264 |
| 565 | Ga0207694_10519609 | 3300025924 | Bacteria | 998 |
| 566 | Ga0207650_10003084 | 3300025925 | Bacteria | 11475 |
| 567 | Ga0207650_10004678 | 3300025925 | Bacteria | 9354 |
| 568 | Ga0207650_10007756 | 3300025925 | Bacteria | 7318 |
| 569 | Ga0207650_10012522 | 3300025925 | Bacteria | 5854 |
| 570 | Ga0207650_10019765 | 3300025925 | Bacteria | 4737 |
| 571 | Ga0207650_10031990 | 3300025925 | Bacteria | 3804 |
| 572 | Ga0207650_10036416 | 3300025925 | Bacteria | 3580 |
| 573 | Ga0207650_10045310 | 3300025925 | Bacteria | 3236 |
| 574 | Ga0207650_10057952 | 3300025925 | Bacteria | 2882 |
| 575 | Ga0207650_10094404 | 3300025925 | Bacteria | 2291 |
| 576 | Ga0207650_10450989 | 3300025925 | Bacteria | 1070 |
| 577 | Ga0207650_10550446 | 3300025925 | Bacteria | 967 |
| 578 | Ga0207659_10005942 | 3300025926 | Bacteria | 7448 |
| 579 | Ga0207659_10016534 | 3300025926 | Bacteria | 4803 |
| 580 | Ga0207659_10024036 | 3300025926 | Bacteria | 4076 |
| 581 | Ga0207659_10027681 | 3300025926 | Bacteria | 3842 |
| 582 | Ga0207659_10062877 | 3300025926 | Bacteria | 2681 |
| 583 | Ga0207659_10092013 | 3300025926 | Bacteria | 2267 |
| 584 | Ga0207659_10255625 | 3300025926 | Bacteria | 1423 |
| 585 | Ga0207659_10557973 | 3300025926 | Bacteria | 974 |
| 586 | Ga0207700_10000084 | 3300025928 | Bacteria | 58386 |
| 587 | Ga0207700_10002711 | 3300025928 | Bacteria | 10209 |
| 588 | Ga0207700_10008158 | 3300025928 | Bacteria | 6468 |
| 589 | Ga0207664_10001330 | 3300025929 | Bacteria | 16288 |
| 590 | Ga0207664_10076261 | 3300025929 | Bacteria | 2713 |
| 591 | Ga0207644_10010936 | 3300025931 | Bacteria | 5996 |
| 592 | Ga0207644_10019180 | 3300025931 | Bacteria | 4637 |
| 593 | Ga0207644_10025898 | 3300025931 | Bacteria | 4036 |
| 594 | Ga0207644_10141927 | 3300025931 | Bacteria | 1850 |
| 595 | Ga0207690_10000461 | 3300025932 | Bacteria | 26139 |
| 596 | Ga0207690_10030150 | 3300025932 | Bacteria | 3457 |
| 597 | Ga0207690_10114046 | 3300025932 | Bacteria | 1951 |
| 598 | Ga0207690_10591812 | 3300025932 | Bacteria | 905 |
| 599 | Ga0207706_10000014 | 3300025933 | Bacteria | 177082 |
| 600 | Ga0207706_10003500 | 3300025933 | Bacteria | 14990 |
| 601 | Ga0207706_10004135 | 3300025933 | Bacteria | 13683 |
| 602 | Ga0207706_10007454 | 3300025933 | Bacteria | 10119 |
| 603 | Ga0207706_10068549 | 3300025933 | Bacteria | 3121 |
| 604 | Ga0207706_10358564 | 3300025933 | Bacteria | 1267 |
| 605 | Ga0207709_10017317 | 3300025935 | Bacteria | 4020 |
| 606 | Ga0207709_10190176 | 3300025935 | Bacteria | 1457 |
| 607 | Ga0207670_10089839 | 3300025936 | Bacteria | 2169 |
| 608 | Ga0207670_10384997 | 3300025936 | Bacteria | 1118 |
| 609 | Ga0207669_10018360 | 3300025937 | Bacteria | 3614 |
| 610 | Ga0207669_10023528 | 3300025937 | Bacteria | 3293 |
| 611 | Ga0207669_10028655 | 3300025937 | Bacteria | 3067 |
| 612 | Ga0207669_10043965 | 3300025937 | Bacteria | 2620 |
| 613 | Ga0207704_10040558 | 3300025938 | Bacteria | 2722 |
| 614 | Ga0207704_10128961 | 3300025938 | Bacteria | 1747 |
| 615 | Ga0207665_10022565 | 3300025939 | Bacteria | 4141 |
| 616 | Ga0207665_10024165 | 3300025939 | Bacteria | 4006 |
| 617 | Ga0207665_10050727 | 3300025939 | Bacteria | 2791 |
| 618 | Ga0207691_10000243 | 3300025940 | Bacteria | 53649 |
| 619 | Ga0207691_10000488 | 3300025940 | Bacteria | 39341 |
| 620 | Ga0207691_10000999 | 3300025940 | Bacteria | 28088 |
| 621 | Ga0207691_10004761 | 3300025940 | Bacteria | 13124 |
| 622 | Ga0207691_10008651 | 3300025940 | Bacteria | 9767 |
| 623 | Ga0207691_10026704 | 3300025940 | Bacteria | 5417 |
| 624 | Ga0207691_10036107 | 3300025940 | Bacteria | 4580 |
| 625 | Ga0207691_10082927 | 3300025940 | Bacteria | 2879 |
| 626 | Ga0207691_10084355 | 3300025940 | Bacteria | 2852 |
| 627 | Ga0207691_10100420 | 3300025940 | Bacteria | 2583 |
| 628 | Ga0207691_10202759 | 3300025940 | Bacteria | 1726 |
| 629 | Ga0207711_10003675 | 3300025941 | Bacteria | 13250 |
| 630 | Ga0207711_10006583 | 3300025941 | Bacteria | 9783 |
| 631 | Ga0207711_10015861 | 3300025941 | Bacteria | 6250 |
| 632 | Ga0207711_10162506 | 3300025941 | Bacteria | 2023 |
| 633 | Ga0207711_10231454 | 3300025941 | Bacteria | 1692 |
| 634 | Ga0207711_10267141 | 3300025941 | Bacteria | 1573 |
| 635 | Ga0207711_10364257 | 3300025941 | Bacteria | 1340 |
| 636 | Ga0207689_10000066 | 3300025942 | Bacteria | 84063 |
| 637 | Ga0207689_10002822 | 3300025942 | Bacteria | 16042 |
| 638 | Ga0207689_10011021 | 3300025942 | Bacteria | 7769 |
| 639 | Ga0207689_10104281 | 3300025942 | Bacteria | 2330 |
| 640 | Ga0207689_10234290 | 3300025942 | Bacteria | 1517 |
| 641 | Ga0207689_10287106 | 3300025942 | Bacteria | 1363 |
| 642 | Ga0207661_10170759 | 3300025944 | Bacteria | 1893 |
| 643 | Ga0207679_10007025 | 3300025945 | Bacteria | 7136 |
| 644 | Ga0207679_10016970 | 3300025945 | Bacteria | 4843 |
| 645 | Ga0207679_10019385 | 3300025945 | Bacteria | 4568 |
| 646 | Ga0207679_10047362 | 3300025945 | Bacteria | 3123 |
| 647 | Ga0207679_10058944 | 3300025945 | Bacteria | 2847 |
| 648 | Ga0207679_10146953 | 3300025945 | Bacteria | 1913 |
| 649 | Ga0207679_10149368 | 3300025945 | Bacteria | 1900 |
| 650 | Ga0207679_10295983 | 3300025945 | Bacteria | 1393 |
| 651 | Ga0207667_10001516 | 3300025949 | Bacteria | 29182 |
| 652 | Ga0207667_10004276 | 3300025949 | Bacteria | 17516 |
| 653 | Ga0207667_10133835 | 3300025949 | Bacteria | 2553 |
| 654 | Ga0207667_10492828 | 3300025949 | Bacteria | 1243 |
| 655 | Ga0207667_10702577 | 3300025949 | Bacteria | 1013 |
| 656 | Ga0207651_10002560 | 3300025960 | Bacteria | 8691 |
| 657 | Ga0207651_10014470 | 3300025960 | Bacteria | 4558 |
| 658 | Ga0207651_10050332 | 3300025960 | Bacteria | 2828 |
| 659 | Ga0207651_10095405 | 3300025960 | Bacteria | 2190 |
| 660 | Ga0207651_10099865 | 3300025960 | Bacteria | 2150 |
| 661 | Ga0207712_10264735 | 3300025961 | Bacteria | 1396 |
| 662 | Ga0207668_10003885 | 3300025972 | Bacteria | 8805 |
| 663 | Ga0207668_10005128 | 3300025972 | Bacteria | 7706 |
| 664 | Ga0207668_10028489 | 3300025972 | Bacteria | 3652 |
| 665 | Ga0207668_10040243 | 3300025972 | Bacteria | 3152 |
| 666 | Ga0207668_10123010 | 3300025972 | Bacteria | 1968 |
| 667 | Ga0207668_10177701 | 3300025972 | Bacteria | 1676 |
| 668 | Ga0207668_10422234 | 3300025972 | Bacteria | 1132 |
| 669 | Ga0207640_10035273 | 3300025981 | Bacteria | 3129 |
| 670 | Ga0207640_10102928 | 3300025981 | Bacteria | 2006 |
| 671 | Ga0207640_10110004 | 3300025981 | Bacteria | 1951 |
| 672 | Ga0207640_10161768 | 3300025981 | Bacteria | 1657 |
| 673 | Ga0207640_10194037 | 3300025981 | Bacteria | 1533 |
| 674 | Ga0207658_10002734 | 3300025986 | Bacteria | 12742 |
| 675 | Ga0207658_10031204 | 3300025986 | Bacteria | 3782 |
| 676 | Ga0207658_10044942 | 3300025986 | Bacteria | 3217 |
| 677 | Ga0207658_10088286 | 3300025986 | Bacteria | 2397 |
| 678 | Ga0207658_10111361 | 3300025986 | Bacteria | 2165 |
| 679 | Ga0207658_10129024 | 3300025986 | Bacteria | 2029 |
| 680 | Ga0207658_10229652 | 3300025986 | Bacteria | 1566 |
| 681 | Ga0207658_10403883 | 3300025986 | Bacteria | 1201 |
| 682 | Ga0207658_10606902 | 3300025986 | Bacteria | 983 |
| 683 | Ga0207677_10000509 | 3300026023 | Bacteria | 25064 |
| 684 | Ga0207677_10010048 | 3300026023 | Bacteria | 5342 |
| 685 | Ga0207677_10269476 | 3300026023 | Bacteria | 1392 |
| 686 | Ga0207677_10303435 | 3300026023 | Bacteria | 1320 |
| 687 | Ga0207677_10340878 | 3300026023 | Bacteria | 1252 |
| 688 | Ga0207677_10401211 | 3300026023 | Bacteria | 1163 |
| 689 | Ga0207703_10002220 | 3300026035 | Bacteria | 17031 |
| 690 | Ga0207703_10007367 | 3300026035 | Bacteria | 8743 |
| 691 | Ga0207703_10041493 | 3300026035 | Bacteria | 3687 |
| 692 | Ga0207703_10114228 | 3300026035 | Bacteria | 2309 |
| 693 | Ga0207703_10146979 | 3300026035 | Bacteria | 2051 |
| 694 | Ga0207703_10357076 | 3300026035 | Bacteria | 1347 |
| 695 | Ga0207703_10382253 | 3300026035 | Bacteria | 1303 |
| 696 | Ga0207703_10424048 | 3300026035 | Unclassified | 1238 |
| 697 | Ga0207703_10743375 | 3300026035 | Bacteria | 934 |
| 698 | Ga0207639_10006616 | 3300026041 | Bacteria | 7882 |
| 699 | Ga0207639_10042662 | 3300026041 | Bacteria | 3401 |
| 700 | Ga0207639_10078990 | 3300026041 | Bacteria | 2599 |
| 701 | Ga0207639_10088963 | 3300026041 | Bacteria | 2466 |
| 702 | Ga0207639_10167299 | 3300026041 | Bacteria | 1859 |
| 703 | Ga0207678_10002320 | 3300026067 | Bacteria | 17245 |
| 704 | Ga0207678_10003040 | 3300026067 | Bacteria | 15175 |
| 705 | Ga0207678_10010401 | 3300026067 | Bacteria | 8166 |
| 706 | Ga0207678_10159463 | 3300026067 | Bacteria | 1927 |
| 707 | Ga0207678_10296964 | 3300026067 | Bacteria | 1388 |
| 708 | Ga0207708_10000789 | 3300026075 | Bacteria | 23888 |
| 709 | Ga0207708_10013596 | 3300026075 | Bacteria | 6082 |
| 710 | Ga0207708_10216442 | 3300026075 | Bacteria | 1533 |
| 711 | Ga0207708_10216938 | 3300026075 | Bacteria | 1531 |
| 712 | Ga0207702_10006446 | 3300026078 | Bacteria | 10118 |
| 713 | Ga0207702_10007617 | 3300026078 | Bacteria | 9216 |
| 714 | Ga0207702_10054685 | 3300026078 | Bacteria | 3383 |
| 715 | Ga0207702_10077073 | 3300026078 | Bacteria | 2882 |
| 716 | Ga0207702_10095911 | 3300026078 | Bacteria | 2607 |
| 717 | Ga0207702_10162999 | 3300026078 | Bacteria | 2037 |
| 718 | Ga0207702_10191476 | 3300026078 | Bacteria | 1890 |
| 719 | Ga0207702_10260659 | 3300026078 | Bacteria | 1632 |
| 720 | Ga0207641_10001273 | 3300026088 | Bacteria | 25089 |
| 721 | Ga0207641_10055724 | 3300026088 | Bacteria | 3357 |
| 722 | Ga0207641_10064921 | 3300026088 | Bacteria | 3121 |
| 723 | Ga0207641_10081947 | 3300026088 | Bacteria | 2802 |
| 724 | Ga0207641_10146479 | 3300026088 | Bacteria | 2135 |
| 725 | Ga0207641_10148418 | 3300026088 | Bacteria | 2122 |
| 726 | Ga0207641_10266722 | 3300026088 | Bacteria | 1605 |
| 727 | Ga0207648_10000324 | 3300026089 | Bacteria | 52466 |
| 728 | Ga0207648_10004321 | 3300026089 | Bacteria | 14629 |
| 729 | Ga0207648_10007292 | 3300026089 | Bacteria | 10899 |
| 730 | Ga0207648_10028539 | 3300026089 | Bacteria | 4946 |
| 731 | Ga0207648_10037581 | 3300026089 | Bacteria | 4266 |
| 732 | Ga0207648_10075672 | 3300026089 | Bacteria | 2934 |
| 733 | Ga0207648_10102339 | 3300026089 | Bacteria | 2511 |
| 734 | Ga0207648_10236451 | 3300026089 | Bacteria | 1626 |
| 735 | Ga0207648_10251926 | 3300026089 | Bacteria | 1574 |
| 736 | Ga0207648_10260239 | 3300026089 | Bacteria | 1548 |
| 737 | Ga0207648_10422947 | 3300026089 | Bacteria | 1210 |
| 738 | Ga0207648_10786708 | 3300026089 | Bacteria | 885 |
| 739 | Ga0207676_10001121 | 3300026095 | Bacteria | 20306 |
| 740 | Ga0207676_10016929 | 3300026095 | Bacteria | 5279 |
| 741 | Ga0207676_10040004 | 3300026095 | Bacteria | 3590 |
| 742 | Ga0207676_10069163 | 3300026095 | Bacteria | 2826 |
| 743 | Ga0207676_10076314 | 3300026095 | Bacteria | 2707 |
| 744 | Ga0207676_10098876 | 3300026095 | Bacteria | 2413 |
| 745 | Ga0207676_10169818 | 3300026095 | Bacteria | 1899 |
| 746 | Ga0207676_10249897 | 3300026095 | Bacteria | 1596 |
| 747 | Ga0207676_10252263 | 3300026095 | Bacteria | 1589 |
| 748 | Ga0207676_10366551 | 3300026095 | Bacteria | 1337 |
| 749 | Ga0207676_10583057 | 3300026095 | Bacteria | 1072 |
| 750 | Ga0207676_10592949 | 3300026095 | Bacteria | 1063 |
| 751 | Ga0207674_10000052 | 3300026116 | Bacteria | 115252 |
| 752 | Ga0207674_10003215 | 3300026116 | Bacteria | 20119 |
| 753 | Ga0207674_10024058 | 3300026116 | Bacteria | 6514 |
| 754 | Ga0207674_10833134 | 3300026116 | Bacteria | 890 |
| 755 | Ga0207675_100005143 | 3300026118 | Bacteria | 12595 |
| 756 | Ga0207675_100023263 | 3300026118 | Bacteria | 5763 |
| 757 | Ga0207675_100025891 | 3300026118 | Bacteria | 5458 |
| 758 | Ga0207675_100069867 | 3300026118 | Bacteria | 3282 |
| 759 | Ga0207675_100089474 | 3300026118 | Bacteria | 2893 |
| 760 | Ga0207675_100120329 | 3300026118 | Bacteria | 2484 |
| 761 | Ga0207675_100176921 | 3300026118 | Bacteria | 2042 |
| 762 | Ga0207683_10000109 | 3300026121 | Bacteria | 66727 |
| 763 | Ga0207683_10000308 | 3300026121 | Bacteria | 44216 |
| 764 | Ga0207683_10000448 | 3300026121 | Bacteria | 38154 |
| 765 | Ga0207683_10014491 | 3300026121 | Bacteria | 6713 |
| 766 | Ga0207683_10017509 | 3300026121 | Bacteria | 6108 |
| 767 | Ga0207683_10052382 | 3300026121 | Bacteria | 3576 |
| 768 | Ga0207683_10065953 | 3300026121 | Bacteria | 3192 |
| 769 | Ga0207683_10118857 | 3300026121 | Bacteria | 2371 |
| 770 | Ga0207683_10260185 | 3300026121 | Bacteria | 1584 |
| 771 | Ga0207683_10281467 | 3300026121 | Bacteria | 1520 |
| 772 | Ga0207683_10384386 | 3300026121 | Bacteria | 1290 |
| 773 | Ga0207698_10012326 | 3300026142 | Bacteria | 5591 |
| 774 | Ga0207698_10027547 | 3300026142 | Bacteria | 4036 |
| 775 | Ga0207698_10119642 | 3300026142 | Bacteria | 2226 |
| 776 | Ga0207698_10166923 | 3300026142 | Bacteria | 1933 |
| 777 | Ga0207698_10230311 | 3300026142 | Bacteria | 1681 |
| 778 | Ga0207698_10254739 | 3300026142 | Bacteria | 1608 |
| 779 | Ga0207698_10542072 | 3300026142 | Bacteria | 1139 |
| 780 | Ga0209967_1003926 | 3300027364 | Bacteria | 1963 |
| 781 | Ga0209996_1009615 | 3300027395 | Bacteria | 1276 |
| 782 | Ga0209995_1004680 | 3300027471 | Bacteria | 2195 |
| 783 | Ga0209995_1007358 | 3300027471 | Bacteria | 1775 |
| 784 | Ga0209971_1007375 | 3300027682 | Bacteria | 2609 |
| 785 | Ga0209971_1033627 | 3300027682 | Bacteria | 1232 |
| 786 | Ga0209998_10012548 | 3300027717 | Bacteria | 1760 |
| 787 | Ga0209974_10081434 | 3300027876 | Bacteria | 1115 |
| 788 | Ga0207428_10289644 | 3300027907 | Bacteria | 1214 |
| 789 | Ga0268266_10006219 | 3300028379 | Bacteria | 10966 |
| 790 | Ga0268266_10034794 | 3300028379 | Bacteria | 4285 |
| 791 | Ga0268266_10063084 | 3300028379 | Bacteria | 3199 |
| 792 | Ga0268266_10082586 | 3300028379 | Bacteria | 2803 |
| 793 | Ga0268266_10095303 | 3300028379 | Bacteria | 2614 |
| 794 | Ga0268266_10120278 | 3300028379 | Bacteria | 2336 |
| 795 | Ga0268266_10180135 | 3300028379 | Bacteria | 1923 |
| 796 | Ga0268266_10189694 | 3300028379 | Bacteria | 1876 |
| 797 | Ga0268265_10061720 | 3300028380 | Bacteria | 2877 |
| 798 | Ga0268265_10088938 | 3300028380 | Bacteria | 2462 |
| 799 | Ga0268265_10187464 | 3300028380 | Bacteria | 1783 |
| 800 | Ga0268265_10250419 | 3300028380 | Bacteria | 1569 |
| 801 | Ga0268265_10261357 | 3300028380 | Bacteria | 1539 |
| 802 | Ga0268264_10003053 | 3300028381 | Bacteria | 14505 |
| 803 | Ga0268264_10011874 | 3300028381 | Bacteria | 7175 |
| 804 | Ga0268264_10016863 | 3300028381 | Bacteria | 5979 |
| 805 | Ga0268264_10040223 | 3300028381 | Bacteria | 3863 |
| 806 | Ga0268264_10110484 | 3300028381 | Bacteria | 2407 |
| 807 | Ga0268264_10367583 | 3300028381 | Bacteria | 1374 |
| 808 | Ga0268264_10612146 | 3300028381 | Bacteria | 1074 |
| 809 | Ga0265330_10001397 | 3300031235 | Bacteria | 14121 |
| 810 | Ga0265332_10002014 | 3300031238 | Bacteria | 10662 |
| 811 | Ga0265328_10004196 | 3300031239 | Bacteria | 6278 |
| 812 | Ga0265325_10007694 | 3300031241 | Bacteria | 6429 |
| 813 | Ga0265329_10001268 | 3300031242 | Bacteria | 12331 |
| 814 | Ga0265339_10010535 | 3300031249 | Bacteria | 5739 |
| 815 | Ga0265331_10000571 | 3300031250 | Bacteria | 33044 |
| 816 | Ga0265327_10012687 | 3300031251 | Bacteria | 5664 |
| 817 | Ga0307408_100013018 | 3300031548 | Bacteria | 5516 |
| 818 | Ga0307408_100024299 | 3300031548 | Bacteria | 4136 |
| 819 | Ga0307408_100075280 | 3300031548 | Bacteria | 2508 |
| 820 | Ga0316575_10044862 | 3300031665 | Bacteria | 1754 |
| 821 | Ga0265342_10009557 | 3300031712 | Bacteria | 6816 |
| 822 | Ga0307405_10029581 | 3300031731 | Bacteria | 3203 |
| 823 | Ga0307413_10019256 | 3300031824 | Bacteria | 3602 |
| 824 | Ga0307413_10101746 | 3300031824 | Bacteria | 1900 |
| 825 | Ga0307413_10118932 | 3300031824 | Bacteria | 1785 |
| 826 | Ga0307410_10051735 | 3300031852 | Bacteria | 2770 |
| 827 | Ga0307406_10011440 | 3300031901 | Bacteria | 5037 |
| 828 | Ga0307406_10127824 | 3300031901 | Bacteria | 1778 |
| 829 | Ga0307407_10079432 | 3300031903 | Bacteria | 1979 |
| 830 | Ga0307407_10197414 | 3300031903 | Bacteria | 1346 |
| 831 | Ga0307412_10012352 | 3300031911 | Bacteria | 4975 |
| 832 | Ga0307412_10025898 | 3300031911 | Bacteria | 3639 |
| 833 | Ga0307412_10030282 | 3300031911 | Bacteria | 3406 |
| 834 | Ga0307409_100010606 | 3300031995 | Bacteria | 5742 |
| 835 | Ga0307409_100034813 | 3300031995 | Bacteria | 3684 |
| 836 | Ga0307409_100143631 | 3300031995 | Bacteria | 2060 |
| 837 | Ga0307416_100011079 | 3300032002 | Bacteria | 5993 |
| 838 | Ga0307416_100044964 | 3300032002 | Bacteria | 3472 |
| 839 | Ga0307416_100301042 | 3300032002 | Bacteria | 1594 |
| 840 | Ga0307416_100770557 | 3300032002 | Bacteria | 1056 |
| 841 | Ga0307414_10022232 | 3300032004 | Bacteria | 3996 |
| 842 | Ga0307414_10397975 | 3300032004 | Bacteria | 1195 |
| 843 | Ga0307411_10010633 | 3300032005 | Bacteria | 4917 |
| 844 | Ga0307411_10012990 | 3300032005 | Bacteria | 4574 |
| 845 | Ga0307411_10034751 | 3300032005 | Bacteria | 3140 |
| 846 | Ga0307411_10059616 | 3300032005 | Bacteria | 2531 |
| 847 | Ga0307415_100002355 | 3300032126 | Bacteria | 9398 |
| 848 | Ga0307415_100044261 | 3300032126 | Bacteria | 2975 |
| 849 | Ga0373926_0123227 | 3300035083 | Bacteria | 978 |
| 850 | Ga0373934_0007738 | 3300035086 | Bacteria | 3994 |
| 851 | Ga0373934_0066283 | 3300035086 | Bacteria | 1442 |
| 852 | Ga0373944_0008903 | 3300035089 | Bacteria | 2714 |
| 853 | Ga0373923_0093502 | 3300035111 | Bacteria | 1318 |
| 854 | Ga0373953_0018437 | 3300035117 | Bacteria | 2583 |
| 855 | Ga0373956_0018822 | 3300035119 | Bacteria | 2926 |
| 856 | Ga0373957_0038473 | 3300035120 | Bacteria | 1791 |
| 857 | Ga0373943_0021205 | 3300035170 | Bacteria | 2998 |
| 858 | Ga0373943_0034999 | 3300035170 | Bacteria | 2398 |
| 859 | Ga0373946_0057991 | 3300035171 | Bacteria | 1639 |
| 860 | Ga0373955_0043583 | 3300035172 | Bacteria | 2414 |
| 861 | Ga0373962_0071153 | 3300035242 | Bacteria | 1040 |
| 862 | Ga0316574_0001281 | 3300035398 | Bacteria | 11739 |
| 863 | Ga0373924_0007020 | 3300035410 | Bacteria | 4054 |
| 864 | Ga0373931_0379053 | 3300035691 | Bacteria | 891 |
| 865 | Ga0373935_0010797 | 3300035692 | Bacteria | 5487 |
| 866 | Ga0373935_0028283 | 3300035692 | Bacteria | 3465 |
| 867 | Ga0373927_0018269 | 3300035695 | Bacteria | 4609 |
| 868 | Ga0373927_0082309 | 3300035695 | Bacteria | 2086 |
| 869 | Ga0373927_0084882 | 3300035695 | Bacteria | 2054 |
| 870 | Ga0373933_0026233 | 3300035724 | Bacteria | 3345 |
| 871 | Ga0373947_0089921 | 3300035725 | Bacteria | 1913 |
| 872 | Ga0373937_0007010 | 3300036401 | Bacteria | 9727 |
| 873 | Ga0373937_0051347 | 3300036401 | Bacteria | 3779 |
| 874 | Ga0373937_0085960 | 3300036401 | Bacteria | 2910 |
| 875 | Ga0373937_0138616 | 3300036401 | Bacteria | 2275 |
| 876 | Ga0373937_0299680 | 3300036401 | Bacteria | 1519 |
| 877 | Ga0373937_0457156 | 3300036401 | Bacteria | 1213 |
| 878 | Ga0373925_0045702 | 3300037068 | Bacteria | 3253 |
| 879 | Ga0373925_0071771 | 3300037068 | Bacteria | 2619 |
| 880 | Ga0373925_0314604 | 3300037068 | Bacteria | 1266 |
| 881 | Ga0395900_0269502 | 3300037418 | Bacteria | 1698 |
| 882 | Ga0395905_0047248 | 3300037471 | Bacteria | 4035 |
| 883 | Ga0395901_0073870 | 3300038443 | Bacteria | 3557 |
| 884 | Ga0395901_0901079 | 3300038443 | Bacteria | 866 |
| 885 | Ga0436365_0614334 | 3300039437 | Bacteria | 3305 |
| 886 | Ga0439461_0001830 | 3300041410 | Bacteria | 3346 |
| 887 | Ga0439441_000116 | 3300042001 | Bacteria | 6525 |
| 888 | Ga0450896_008703 | 3300042133 | Bacteria | 1410 |
| 889 | Ga0439446_0060604 | 3300042156 | Bacteria | 1143 |
| 890 | Ga0439435_0008479 | 3300042436 | Bacteria | 2383 |
| 891 | Ga0439435_0014960 | 3300042436 | Bacteria | 1924 |
| 892 | Ga0439460_0007421 | 3300042461 | Bacteria | 2742 |
| 893 | Ga0451577_0209475 | 3300042876 | Bacteria | 1761 |
| 894 | Ga0451577_0244960 | 3300042876 | Bacteria | 1622 |
| 895 | Ga0466969_0016926 | 3300044656 | Bacteria | 3810 |
| 896 | Ga0453683_0173079 | 3300044673 | Bacteria | 1368 |
| 897 | Ga0466965_0009563 | 3300044683 | Bacteria | 4507 |
| 898 | Ga0466966_0018973 | 3300044684 | Bacteria | 4532 |
| 899 | Ga0466961_0087899 | 3300044693 | Bacteria | 1963 |
| 900 | Ga0466971_0028406 | 3300044719 | Bacteria | 2502 |
| 901 | Ga0466959_0244136 | 3300045049 | Bacteria | 1239 |
| 902 | Ga0451576_0051484 | 3300045051 | Bacteria | 4317 |
| 903 | Ga0451576_0162159 | 3300045051 | Bacteria | 2334 |
| 904 | Ga0451576_0422338 | 3300045051 | Bacteria | 1399 |
| 905 | Ga0451576_0485017 | 3300045051 | Bacteria | 1298 |
| 906 | Ga0466958_0048829 | 3300045836 | Bacteria | 2559 |
| 907 | Ga0466967_0001049 | 3300045976 | Bacteria | 15200 |
| 908 | Ga0495592_0000711 | 3300046454 | Bacteria | 23301 |
| 909 | Ga0495603_0023863 | 3300046455 | Bacteria | 3700 |
| 910 | Ga0495629_0074680 | 3300046459 | Bacteria | 2367 |
| 911 | Ga0495629_0188846 | 3300046459 | Bacteria | 1426 |
| 912 | Ga0495580_0071206 | 3300046472 | Bacteria | 2429 |
| 913 | Ga0495662_0011906 | 3300046476 | Bacteria | 4251 |
| 914 | Ga0495628_0001663 | 3300046516 | Bacteria | 20314 |
| 915 | Ga0495630_0404662 | 3300046517 | Bacteria | 1046 |
| 916 | Ga0495642_0251434 | 3300046528 | Bacteria | 773 |
| 917 | Ga0495652_0004318 | 3300046529 | Bacteria | 13622 |
| 918 | Ga0495665_0014048 | 3300046531 | Bacteria | 4324 |
| 919 | Ga0495640_0313258 | 3300046533 | Bacteria | 973 |
| 920 | Ga0495645_0001291 | 3300046543 | Bacteria | 17090 |
| 921 | Ga0495645_0125988 | 3300046543 | Bacteria | 1799 |
| 922 | Ga0495645_0174887 | 3300046543 | Bacteria | 1475 |
| 923 | Ga0495667_0021442 | 3300046559 | Bacteria | 4360 |
| 924 | Ga0495634_0077998 | 3300046642 | Bacteria | 2171 |
| 925 | Ga0495635_0076517 | 3300046663 | Bacteria | 2293 |
| 926 | Ga0495659_0016833 | 3300046664 | Bacteria | 2416 |
| 927 | Ga0495588_0038495 | 3300046674 | Bacteria | 2433 |
| 928 | Ga0495599_0001351 | 3300046678 | Bacteria | 14001 |
| 929 | Ga0495647_0003600 | 3300046681 | Bacteria | 4968 |
| 930 | Ga0495658_0052988 | 3300046683 | Bacteria | 2302 |
| 931 | Ga0495600_0039369 | 3300046809 | Bacteria | 3078 |
| 932 | Ga0495581_0000428 | 3300047315 | Bacteria | 21379 |
| 933 | Ga0495680_0024970 | 3300047322 | Bacteria | 4949 |
| 934 | Ga0495684_0077021 | 3300047471 | Bacteria | 2532 |
| 935 | Ga0495684_0326176 | 3300047471 | Bacteria | 1096 |
| 936 | Ga0495614_0011142 | 3300048089 | Bacteria | 3957 |
| 937 | Ga0496100_0305132 | 3300048903 | Bacteria | 1192 |
| 938 | Ga0496101_0052367 | 3300048904 | Bacteria | 2943 |
| 939 | Ga0496101_0131533 | 3300048904 | Bacteria | 1900 |
| 940 | Ga0496102_0047644 | 3300048905 | Bacteria | 3896 |
| 941 | Ga0496102_0109864 | 3300048905 | Bacteria | 2570 |
| 942 | Ga0496104_0008934 | 3300048907 | Bacteria | 8906 |
| 943 | Ga0496104_0273506 | 3300048907 | Bacteria | 1602 |
| 944 | Ga0496105_0020136 | 3300048908 | Bacteria | 5387 |
| 945 | Ga0496105_0205335 | 3300048908 | Bacteria | 1607 |
| 946 | Ga0496106_0009881 | 3300048909 | Bacteria | 7043 |
| 947 | Ga0496106_0288770 | 3300048909 | Bacteria | 1315 |
| 948 | Ga0496106_0379166 | 3300048909 | Bacteria | 1136 |
| 949 | Ga0496107_0005246 | 3300048910 | Bacteria | 8844 |
| 950 | Ga0496107_0113805 | 3300048910 | Bacteria | 1990 |
| 951 | Ga0496108_0007673 | 3300048911 | Bacteria | 8736 |
| 952 | Ga0496108_0258668 | 3300048911 | Bacteria | 1515 |
| 953 | Ga0496108_0776128 | 3300048911 | Bacteria | 828 |
| 954 | Ga0496109_0004576 | 3300048912 | Bacteria | 11543 |
| 955 | Ga0496109_0051045 | 3300048912 | Bacteria | 3767 |
| 956 | Ga0496109_0165458 | 3300048912 | Bacteria | 2073 |
| 957 | Ga0496109_0281233 | 3300048912 | Bacteria | 1568 |
| 958 | Ga0496110_0009595 | 3300048913 | Bacteria | 7833 |
| 959 | Ga0496110_0098431 | 3300048913 | Bacteria | 2621 |
| 960 | Ga0496110_0413349 | 3300048913 | Bacteria | 1230 |
| 961 | Ga0496110_0615931 | 3300048913 | Bacteria | 984 |
| 962 | Ga0496112_0070721 | 3300048915 | Bacteria | 3448 |
| 963 | Ga0496112_0316424 | 3300048915 | Bacteria | 1505 |
| 964 | Ga0496114_0121527 | 3300048917 | Bacteria | 2246 |
| 965 | Ga0501034_0053868 | 3300049571 | Bacteria | 4050 |
| 966 | Ga0501037_0095336 | 3300049573 | Bacteria | 2151 |
| 967 | Ga0501038_0056483 | 3300049574 | Bacteria | 3371 |
| 968 | Ga0501039_0048882 | 3300049575 | Bacteria | 3270 |
| 969 | Ga0501040_0015144 | 3300049576 | Bacteria | 5095 |
| 970 | Ga0501041_0012873 | 3300049577 | Bacteria | 4956 |
| 971 | Ga0501041_0034122 | 3300049577 | Bacteria | 3081 |
| 972 | Ga0501042_0039822 | 3300049578 | Bacteria | 3341 |
| 973 | Ga0501042_0083239 | 3300049578 | Bacteria | 2294 |
| 974 | Ga0501042_0093899 | 3300049578 | Bacteria | 2155 |
| 975 | Ga0501046_0254081 | 3300049580 | Bacteria | 1293 |
| 976 | Ga0501047_0141911 | 3300049581 | Bacteria | 2280 |
| 977 | Ga0501048_0408809 | 3300049582 | Bacteria | 970 |
| 978 | Ga0501068_0160653 | 3300049584 | Bacteria | 1416 |
| 979 | Ga0501068_0209068 | 3300049584 | Bacteria | 1239 |
| 980 | Ga0501069_0300568 | 3300049585 | Bacteria | 941 |
| 981 | Ga0501069_0377594 | 3300049585 | Bacteria | 837 |
| 982 | Ga0501071_0011960 | 3300049587 | Bacteria | 5863 |
| 983 | Ga0501071_0097100 | 3300049587 | Bacteria | 2169 |
| 984 | Ga0501072_0005486 | 3300049588 | Bacteria | 9656 |
| 985 | Ga0501072_0043870 | 3300049588 | Bacteria | 3516 |
| 986 | Ga0501073_0079883 | 3300049589 | Bacteria | 2276 |
| 987 | Ga0501073_0100219 | 3300049589 | Bacteria | 2011 |
| 988 | Ga0501073_0124510 | 3300049589 | Bacteria | 1787 |
| 989 | Ga0501074_0051011 | 3300049590 | Bacteria | 2986 |
| 990 | Ga0501074_0100336 | 3300049590 | Bacteria | 2072 |
| 991 | Ga0501075_0022495 | 3300049591 | Bacteria | 4605 |
| 992 | Ga0501075_0022605 | 3300049591 | Bacteria | 4595 |
| 993 | Ga0501076_0017570 | 3300049592 | Bacteria | 5438 |
| 994 | Ga0501076_0019108 | 3300049592 | Bacteria | 5231 |
| 995 | Ga0501076_0061214 | 3300049592 | Bacteria | 2996 |
| 996 | Ga0501077_0086648 | 3300049593 | Bacteria | 1985 |
| 997 | Ga0501216_038488 | 3300049660 | Bacteria | 907 |
| 998 | Ga0501079_0231182 | 3300049741 | Bacteria | 1444 |
| 999 | Ga0501080_0017072 | 3300049742 | Bacteria | 6704 |
| 1000 | Ga0501080_0057569 | 3300049742 | Bacteria | 3619 |
| 1001 | Ga0501081_0043996 | 3300049743 | Bacteria | 3064 |
| 1002 | Ga0501283_009322 | 3300049779 | Bacteria | 1429 |
| 1003 | Ga0501045_0017955 | 3300049824 | Bacteria | 5024 |
| 1004 | Ga0501045_0024324 | 3300049824 | Bacteria | 4348 |
| 1005 | Ga0501045_0085799 | 3300049824 | Bacteria | 2324 |
| 1006 | Ga0501045_0254582 | 3300049824 | Bacteria | 1307 |
| 1007 | nmdc:mga0k408_4139_c1 | 3300050493 | Bacteria | 7703 |
| 1008 | nmdc:mga05p37_12648_c1 | 3300050507 | Bacteria | 10081 |
| 1009 | nmdc:mga09592_16924_c1 | 3300050508 | Bacteria | 5967 |
| 1010 | nmdc:mga09592_72973_c1 | 3300050508 | Bacteria | 2916 |
| 1011 | nmdc:mga0qj67_236455_c1 | 3300050509 | Bacteria | 1482 |
| 1012 | nmdc:mga06r32_271528_c1 | 3300050510 | Bacteria | 1683 |
| 1013 | nmdc:mga06r32_77800_c1 | 3300050510 | Bacteria | 3223 |
| 1014 | nmdc:mga08y16_111854_c1 | 3300050511 | Bacteria | 2843 |
| 1015 | nmdc:mga08y16_172275_c1 | 3300050511 | Bacteria | 2248 |
| 1016 | nmdc:mga08y16_222801_c1 | 3300050511 | Bacteria | 1952 |
| 1017 | nmdc:mga08y16_567992_c1 | 3300050511 | Bacteria | 1146 |
| 1018 | nmdc:mga0n895_153747_c1 | 3300050512 | Bacteria | 2331 |
| 1019 | nmdc:mga0n895_240727_c1 | 3300050512 | Bacteria | 1836 |
| 1020 | nmdc:mga0n895_287847_c1 | 3300050512 | Bacteria | 1666 |
| 1021 | nmdc:mga0n895_582121_c1 | 3300050512 | Bacteria | 1123 |
| 1022 | nmdc:mga0n895_763351_c1 | 3300050512 | Bacteria | 959 |
| 1023 | nmdc:mga0n895_83941_c1 | 3300050512 | Bacteria | 3178 |
| 1024 | nmdc:mga0rr50_439911_c1 | 3300050513 | Bacteria | 1104 |
| 1025 | nmdc:mga0rr50_454081_c1 | 3300050513 | Bacteria | 1086 |
| 1026 | nmdc:mga08x19_103372_c1 | 3300050514 | Bacteria | 1892 |
| 1027 | nmdc:mga08x19_107230_c1 | 3300050514 | Bacteria | 1859 |
| 1028 | nmdc:mga08x19_426545_c1 | 3300050514 | Bacteria | 932 |
| 1029 | nmdc:mga0a205_113116_c1 | 3300050515 | Bacteria | 2613 |
| 1030 | nmdc:mga0a205_18359_c1 | 3300050515 | Bacteria | 6574 |
| 1031 | nmdc:mga0a205_495975_c1 | 3300050515 | Bacteria | 1078 |
| 1032 | Ga0495601_0005658 | 3300053077 | Bacteria | 7289 |
| 1033 | Ga0495601_0017412 | 3300053077 | Bacteria | 4362 |
| 1034 | Ga0495619_0019782 | 3300053085 | Bacteria | 4283 |
| 1035 | Ga0495619_0189201 | 3300053085 | Bacteria | 1425 |
| 1036 | Ga0501084_0079863 | 3300054114 | Bacteria | 2742 |
| 1037 | Ga0590071_023203 | 3300059421 | Bacteria | 1466 |
| 1038 | Ga0501082_0031776 | 3300060353 | Bacteria | 4553 |
| 1039 | Ga0501082_0173491 | 3300060353 | Bacteria | 1875 |
| 1040 | Ga0466962_0000421 | 3300061719 | Bacteria | 18318 |
| 1041 | Ga0530510_0006768 | 3300061734 | Bacteria | 7987 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049582 | Ga0501048_0408809 | Ga0501048_0408809_10_603 | 196 |
| 2 | 3300050512 | nmdc:mga0n895_763351_c1 | nmdc:mga0n895_763351_c1_126_842 | 198 |
| 3 | 3300035695 | Ga0373927_0082309 | Ga0373927_0082309_526_1314 | 225 |
| 4 | 3300009551 | Ga0105238_10499899 | Ga0105238_104998992 | 230 |
| 5 | 3300046454 | Ga0495592_0000711 | Ga0495592_0000711_14903_15682 | 235 |
| 6 | 3300046516 | Ga0495628_0001663 | Ga0495628_0001663_11156_11935 | 235 |
| 7 | 3300046529 | Ga0495652_0004318 | Ga0495652_0004318_6240_7019 | 235 |
| 8 | 3300046543 | Ga0495645_0001291 | Ga0495645_0001291_11023_11802 | 235 |
| 9 | 3300046678 | Ga0495599_0001351 | Ga0495599_0001351_9349_10128 | 235 |
| 10 | 3300053077 | Ga0495601_0005658 | Ga0495601_0005658_4591_5370 | 235 |
| 11 | 3300005549 | Ga0070704_100014002 | Ga0070704_1000140022 | 238 |
| 12 | 3300049779 | Ga0501283_009322 | Ga0501283_009322_110_829 | 238 |
| 13 | 3300046528 | Ga0495642_0251434 | Ga0495642_0251434_26_745 | 239 |
| 14 | 3300049577 | Ga0501041_0034122 | Ga0501041_0034122_739_1461 | 239 |
| 15 | 3300049578 | Ga0501042_0093899 | Ga0501042_0093899_1229_1951 | 239 |
| 16 | 3300049587 | Ga0501071_0097100 | Ga0501071_0097100_343_1065 | 239 |
| 17 | 3300049824 | Ga0501045_0254582 | Ga0501045_0254582_118_840 | 239 |
| 18 | 3300009147 | Ga0114129_11024070 | Ga0114129_110240701 | 240 |
| 19 | 3300027682 | Ga0209971_1007375 | Ga0209971_10073754 | 240 |
| 20 | 3300027717 | Ga0209998_10012548 | Ga0209998_100125482 | 240 |
| 21 | 3300042001 | Ga0439441_000116 | Ga0439441_000116_104_889 | 240 |
| 22 | 3300045976 | Ga0466967_0001049 | Ga0466967_0001049_14157_14906 | 240 |
| 23 | 3300006844 | Ga0075428_100107723 | Ga0075428_1001077233 | 241 |
| 24 | 3300014325 | Ga0163163_10100389 | Ga0163163_101003894 | 241 |
| 25 | 3300005347 | Ga0070668_100334024 | Ga0070668_1003340242 | 242 |
| 26 | 3300005355 | Ga0070671_100002054 | Ga0070671_1000020544 | 242 |
| 27 | 3300009098 | Ga0105245_10716880 | Ga0105245_107168802 | 242 |
| 28 | 3300025931 | Ga0207644_10019180 | Ga0207644_100191803 | 243 |
| 29 | 3300026089 | Ga0207648_10422947 | Ga0207648_104229471 | 243 |
| 30 | 3300031548 | Ga0307408_100075280 | Ga0307408_1000752802 | 243 |
| 31 | 3300031911 | Ga0307412_10030282 | Ga0307412_100302824 | 243 |
| 32 | 3300032004 | Ga0307414_10397975 | Ga0307414_103979751 | 243 |
| 33 | 3300046543 | Ga0495645_0125988 | Ga0495645_0125988_443_1231 | 243 |
| 34 | 3300053077 | Ga0495601_0017412 | Ga0495601_0017412_3501_4289 | 243 |
| 35 | 3300005618 | Ga0068864_100302402 | Ga0068864_1003024023 | 247 |
| 36 | 3300005841 | Ga0068863_100101671 | Ga0068863_1001016713 | 247 |
| 37 | 3300025925 | Ga0207650_10450989 | Ga0207650_104509892 | 247 |
| 38 | 3300026095 | Ga0207676_10249897 | Ga0207676_102498972 | 247 |
| 39 | 3300006844 | Ga0075428_100010320 | Ga0075428_1000103204 | 248 |
| 40 | 3300006846 | Ga0075430_100213379 | Ga0075430_1002133792 | 248 |
| 41 | 3300006880 | Ga0075429_100034410 | Ga0075429_1000344102 | 248 |
| 42 | 3300009147 | Ga0114129_10056041 | Ga0114129_100560413 | 248 |
| 43 | 3300025924 | Ga0207694_10519609 | Ga0207694_105196092 | 248 |
| 44 | 3300027471 | Ga0209995_1007358 | Ga0209995_10073581 | 248 |
| 45 | 3300032005 | Ga0307411_10034751 | Ga0307411_100347514 | 248 |
| 46 | 3300042436 | Ga0439435_0008479 | Ga0439435_0008479_1616_2365 | 248 |
| 47 | 3300042461 | Ga0439460_0007421 | Ga0439460_0007421_1793_2542 | 248 |
| 48 | 3300049660 | Ga0501216_038488 | Ga0501216_038488_54_803 | 248 |
| 49 | 3300050508 | nmdc:mga09592_72973_c1 | nmdc:mga09592_72973_c1_532_1281 | 248 |
| 50 | 3300005354 | Ga0070675_100004965 | Ga0070675_1000049659 | 249 |
| 51 | 3300006844 | Ga0075428_100084684 | Ga0075428_1000846843 | 249 |
| 52 | 3300006847 | Ga0075431_100019537 | Ga0075431_1000195375 | 249 |
| 53 | 3300006880 | Ga0075429_100000175 | Ga0075429_1000001757 | 249 |
| 54 | 3300009147 | Ga0114129_10046258 | Ga0114129_100462583 | 249 |
| 55 | 3300025901 | Ga0207688_10171422 | Ga0207688_101714222 | 249 |
| 56 | 3300025925 | Ga0207650_10031990 | Ga0207650_100319902 | 249 |
| 57 | 3300025926 | Ga0207659_10062877 | Ga0207659_100628772 | 249 |
| 58 | 3300025940 | Ga0207691_10084355 | Ga0207691_100843553 | 249 |
| 59 | 3300026089 | Ga0207648_10251926 | Ga0207648_102519262 | 249 |
| 60 | 3300026121 | Ga0207683_10384386 | Ga0207683_103843862 | 249 |
| 61 | 3300027395 | Ga0209996_1009615 | Ga0209996_10096152 | 249 |
| 62 | 3300027682 | Ga0209971_1033627 | Ga0209971_10336272 | 249 |
| 63 | 3300028379 | Ga0268266_10063084 | Ga0268266_100630843 | 249 |
| 64 | 3300035117 | Ga0373953_0018437 | Ga0373953_0018437_1169_1954 | 249 |
| 65 | 3300035120 | Ga0373957_0038473 | Ga0373957_0038473_228_1013 | 249 |
| 66 | 3300035242 | Ga0373962_0071153 | Ga0373962_0071153_38_787 | 249 |
| 67 | 3300036401 | Ga0373937_0007010 | Ga0373937_0007010_1777_2562 | 249 |
| 68 | 3300044673 | Ga0453683_0173079 | Ga0453683_0173079_42_791 | 249 |
| 69 | 3300050507 | nmdc:mga05p37_12648_c1 | nmdc:mga05p37_12648_c1_8541_9290 | 249 |
| 70 | 3300050508 | nmdc:mga09592_16924_c1 | nmdc:mga09592_16924_c1_4063_4812 | 249 |
| 71 | 3300050510 | nmdc:mga06r32_77800_c1 | nmdc:mga06r32_77800_c1_1054_1803 | 249 |
| 72 | 3300050511 | nmdc:mga08y16_222801_c1 | nmdc:mga08y16_222801_c1_737_1531 | 249 |
| 73 | 3300059421 | Ga0590071_023203 | Ga0590071_023203_667_1419 | 249 |
| 74 | 3300005334 | Ga0068869_100002553 | Ga0068869_10000255310 | 250 |
| 75 | 3300005335 | Ga0070666_10096294 | Ga0070666_100962941 | 250 |
| 76 | 3300005338 | Ga0068868_100029854 | Ga0068868_1000298545 | 250 |
| 77 | 3300005338 | Ga0068868_100057869 | Ga0068868_1000578694 | 250 |
| 78 | 3300005344 | Ga0070661_100090424 | Ga0070661_1000904243 | 250 |
| 79 | 3300005345 | Ga0070692_10016897 | Ga0070692_100168973 | 250 |
| 80 | 3300005347 | Ga0070668_100322569 | Ga0070668_1003225691 | 250 |
| 81 | 3300005353 | Ga0070669_100162155 | Ga0070669_1001621552 | 250 |
| 82 | 3300005354 | Ga0070675_100309694 | Ga0070675_1003096941 | 250 |
| 83 | 3300005367 | Ga0070667_100002979 | Ga0070667_1000029797 | 250 |
| 84 | 3300005406 | Ga0070703_10011705 | Ga0070703_100117052 | 250 |
| 85 | 3300005436 | Ga0070713_100001967 | Ga0070713_1000019673 | 250 |
| 86 | 3300005441 | Ga0070700_100144855 | Ga0070700_1001448553 | 250 |
| 87 | 3300005444 | Ga0070694_100023264 | Ga0070694_1000232642 | 250 |
| 88 | 3300005444 | Ga0070694_100097376 | Ga0070694_1000973762 | 250 |
| 89 | 3300005445 | Ga0070708_100034792 | Ga0070708_1000347925 | 250 |
| 90 | 3300005457 | Ga0070662_100060315 | Ga0070662_1000603153 | 250 |
| 91 | 3300005457 | Ga0070662_100264419 | Ga0070662_1002644192 | 250 |
| 92 | 3300005459 | Ga0068867_100002252 | Ga0068867_10000225215 | 250 |
| 93 | 3300005467 | Ga0070706_100056378 | Ga0070706_1000563782 | 250 |
| 94 | 3300005518 | Ga0070699_100002810 | Ga0070699_1000028105 | 250 |
| 95 | 3300005530 | Ga0070679_100188946 | Ga0070679_1001889461 | 250 |
| 96 | 3300005535 | Ga0070684_100106172 | Ga0070684_1001061722 | 250 |
| 97 | 3300005536 | Ga0070697_100533234 | Ga0070697_1005332341 | 250 |
| 98 | 3300005539 | Ga0068853_100330484 | Ga0068853_1003304842 | 250 |
| 99 | 3300005545 | Ga0070695_100011248 | Ga0070695_1000112483 | 250 |
| 100 | 3300005546 | Ga0070696_100066883 | Ga0070696_1000668832 | 250 |
| 101 | 3300005547 | Ga0070693_100127465 | Ga0070693_1001274652 | 250 |
| 102 | 3300005549 | Ga0070704_100026382 | Ga0070704_1000263822 | 250 |
| 103 | 3300005563 | Ga0068855_100402743 | Ga0068855_1004027432 | 250 |
| 104 | 3300005577 | Ga0068857_100030274 | Ga0068857_1000302742 | 250 |
| 105 | 3300005578 | Ga0068854_100373897 | Ga0068854_1003738972 | 250 |
| 106 | 3300005616 | Ga0068852_100090719 | Ga0068852_1000907194 | 250 |
| 107 | 3300005617 | Ga0068859_100002682 | Ga0068859_10000268214 | 250 |
| 108 | 3300005618 | Ga0068864_100003419 | Ga0068864_10000341910 | 250 |
| 109 | 3300005719 | Ga0068861_100000930 | Ga0068861_1000009307 | 250 |
| 110 | 3300005834 | Ga0068851_10008843 | Ga0068851_100088433 | 250 |
| 111 | 3300005840 | Ga0068870_10011298 | Ga0068870_100112985 | 250 |
| 112 | 3300005841 | Ga0068863_100002938 | Ga0068863_10000293814 | 250 |
| 113 | 3300005842 | Ga0068858_100008579 | Ga0068858_1000085795 | 250 |
| 114 | 3300005843 | Ga0068860_100018869 | Ga0068860_1000188692 | 250 |
| 115 | 3300006881 | Ga0068865_100394832 | Ga0068865_1003948321 | 250 |
| 116 | 3300006914 | Ga0075436_100022726 | Ga0075436_1000227262 | 250 |
| 117 | 3300006931 | Ga0097620_100002682 | Ga0097620_10000268214 | 250 |
| 118 | 3300009098 | Ga0105245_10030966 | Ga0105245_100309665 | 250 |
| 119 | 3300009098 | Ga0105245_10108538 | Ga0105245_101085381 | 250 |
| 120 | 3300009148 | Ga0105243_10307794 | Ga0105243_103077942 | 250 |
| 121 | 3300009177 | Ga0105248_10011976 | Ga0105248_100119762 | 250 |
| 122 | 3300009545 | Ga0105237_10042280 | Ga0105237_100422805 | 250 |
| 123 | 3300010375 | Ga0105239_10458469 | Ga0105239_104584692 | 250 |
| 124 | 3300011119 | Ga0105246_10119689 | Ga0105246_101196892 | 250 |
| 125 | 3300013104 | Ga0157370_10039006 | Ga0157370_100390063 | 250 |
| 126 | 3300013105 | Ga0157369_10151720 | Ga0157369_101517203 | 250 |
| 127 | 3300013297 | Ga0157378_10123850 | Ga0157378_101238502 | 250 |
| 128 | 3300013307 | Ga0157372_10750287 | Ga0157372_107502871 | 250 |
| 129 | 3300014326 | Ga0157380_10083960 | Ga0157380_100839602 | 250 |
| 130 | 3300025898 | Ga0207692_10132069 | Ga0207692_101320692 | 250 |
| 131 | 3300025903 | Ga0207680_10322419 | Ga0207680_103224192 | 250 |
| 132 | 3300025907 | Ga0207645_10041702 | Ga0207645_100417023 | 250 |
| 133 | 3300025908 | Ga0207643_10015525 | Ga0207643_100155255 | 250 |
| 134 | 3300025910 | Ga0207684_10553508 | Ga0207684_105535082 | 250 |
| 135 | 3300025911 | Ga0207654_10028623 | Ga0207654_100286235 | 250 |
| 136 | 3300025914 | Ga0207671_10311892 | Ga0207671_103118922 | 250 |
| 137 | 3300025915 | Ga0207693_10226978 | Ga0207693_102269782 | 250 |
| 138 | 3300025919 | Ga0207657_10018126 | Ga0207657_100181264 | 250 |
| 139 | 3300025920 | Ga0207649_10151367 | Ga0207649_101513672 | 250 |
| 140 | 3300025925 | Ga0207650_10550446 | Ga0207650_105504461 | 250 |
| 141 | 3300025928 | Ga0207700_10002711 | Ga0207700_100027113 | 250 |
| 142 | 3300025932 | Ga0207690_10114046 | Ga0207690_101140462 | 250 |
| 143 | 3300025933 | Ga0207706_10068549 | Ga0207706_100685493 | 250 |
| 144 | 3300025935 | Ga0207709_10190176 | Ga0207709_101901762 | 250 |
| 145 | 3300025939 | Ga0207665_10022565 | Ga0207665_100225655 | 250 |
| 146 | 3300025941 | Ga0207711_10267141 | Ga0207711_102671412 | 250 |
| 147 | 3300025942 | Ga0207689_10000066 | Ga0207689_1000006615 | 250 |
| 148 | 3300025942 | Ga0207689_10234290 | Ga0207689_102342902 | 250 |
| 149 | 3300025944 | Ga0207661_10170759 | Ga0207661_101707592 | 250 |
| 150 | 3300025949 | Ga0207667_10492828 | Ga0207667_104928281 | 250 |
| 151 | 3300025972 | Ga0207668_10422234 | Ga0207668_104222342 | 250 |
| 152 | 3300025981 | Ga0207640_10161768 | Ga0207640_101617683 | 250 |
| 153 | 3300025986 | Ga0207658_10403883 | Ga0207658_104038832 | 250 |
| 154 | 3300026023 | Ga0207677_10269476 | Ga0207677_102694762 | 250 |
| 155 | 3300026023 | Ga0207677_10303435 | Ga0207677_103034352 | 250 |
| 156 | 3300026035 | Ga0207703_10007367 | Ga0207703_100073679 | 250 |
| 157 | 3300026075 | Ga0207708_10216938 | Ga0207708_102169381 | 250 |
| 158 | 3300026078 | Ga0207702_10095911 | Ga0207702_100959113 | 250 |
| 159 | 3300026089 | Ga0207648_10007292 | Ga0207648_100072927 | 250 |
| 160 | 3300026089 | Ga0207648_10075672 | Ga0207648_100756723 | 250 |
| 161 | 3300026095 | Ga0207676_10001121 | Ga0207676_1000112115 | 250 |
| 162 | 3300026116 | Ga0207674_10003215 | Ga0207674_100032155 | 250 |
| 163 | 3300026118 | Ga0207675_100005143 | Ga0207675_1000051437 | 250 |
| 164 | 3300026142 | Ga0207698_10166923 | Ga0207698_101669232 | 250 |
| 165 | 3300028380 | Ga0268265_10261357 | Ga0268265_102613572 | 250 |
| 166 | 3300028381 | Ga0268264_10003053 | Ga0268264_100030533 | 250 |
| 167 | 3300048905 | Ga0496102_0109864 | Ga0496102_0109864_424_1224 | 250 |
| 168 | 3300048910 | Ga0496107_0113805 | Ga0496107_0113805_465_1349 | 250 |
| 169 | 3300048912 | Ga0496109_0281233 | Ga0496109_0281233_367_1167 | 250 |
| 170 | 3300050514 | nmdc:mga08x19_426545_c1 | nmdc:mga08x19_426545_c1_16_894 | 250 |
| 171 | 3300005440 | Ga0070705_100360792 | Ga0070705_1003607921 | 251 |
| 172 | 3300005445 | Ga0070708_100102774 | Ga0070708_1001027743 | 251 |
| 173 | 3300005467 | Ga0070706_100040808 | Ga0070706_1000408083 | 251 |
| 174 | 3300005536 | Ga0070697_100007116 | Ga0070697_1000071166 | 251 |
| 175 | 3300005546 | Ga0070696_100358700 | Ga0070696_1003587002 | 251 |
| 176 | 3300005549 | Ga0070704_100078596 | Ga0070704_1000785962 | 251 |
| 177 | 3300025910 | Ga0207684_10061016 | Ga0207684_100610162 | 251 |
| 178 | 3300049589 | Ga0501073_0100219 | Ga0501073_0100219_181_963 | 251 |
| 179 | 3300049742 | Ga0501080_0057569 | Ga0501080_0057569_1645_2427 | 251 |
| 180 | 3300013297 | Ga0157378_10672319 | Ga0157378_106723191 | 252 |
| 181 | 3300031852 | Ga0307410_10051735 | Ga0307410_100517352 | 252 |
| 182 | 3300031995 | Ga0307409_100034813 | Ga0307409_1000348134 | 252 |
| 183 | 3300032002 | Ga0307416_100770557 | Ga0307416_1007705572 | 252 |
| 184 | 3300035695 | Ga0373927_0018269 | Ga0373927_0018269_1923_2711 | 252 |
| 185 | 3300005618 | Ga0068864_100401908 | Ga0068864_1004019082 | 253 |
| 186 | 3300005842 | Ga0068858_100601281 | Ga0068858_1006012812 | 253 |
| 187 | 3300006852 | Ga0075433_10139232 | Ga0075433_101392323 | 253 |
| 188 | 3300026035 | Ga0207703_10424048 | Ga0207703_104240482 | 253 |
| 189 | 3300035692 | Ga0373935_0028283 | Ga0373935_0028283_1389_2177 | 253 |
| 190 | 3300050511 | nmdc:mga08y16_567992_c1 | nmdc:mga08y16_567992_c1_29_811 | 253 |
| 191 | 3300005290 | Ga0065712_10026653 | Ga0065712_100266531 | 254 |
| 192 | 3300005328 | Ga0070676_10340738 | Ga0070676_103407382 | 254 |
| 193 | 3300005330 | Ga0070690_100139830 | Ga0070690_1001398301 | 254 |
| 194 | 3300005331 | Ga0070670_100287364 | Ga0070670_1002873642 | 254 |
| 195 | 3300005335 | Ga0070666_10029575 | Ga0070666_100295753 | 254 |
| 196 | 3300005340 | Ga0070689_100123480 | Ga0070689_1001234803 | 254 |
| 197 | 3300005354 | Ga0070675_100751310 | Ga0070675_1007513101 | 254 |
| 198 | 3300005364 | Ga0070673_100001547 | Ga0070673_1000015472 | 254 |
| 199 | 3300005365 | Ga0070688_100057364 | Ga0070688_1000573641 | 254 |
| 200 | 3300005367 | Ga0070667_100181683 | Ga0070667_1001816832 | 254 |
| 201 | 3300005436 | Ga0070713_100016486 | Ga0070713_1000164862 | 254 |
| 202 | 3300005440 | Ga0070705_100085793 | Ga0070705_1000857932 | 254 |
| 203 | 3300005456 | Ga0070678_100004102 | Ga0070678_1000041027 | 254 |
| 204 | 3300005466 | Ga0070685_10001891 | Ga0070685_100018914 | 254 |
| 205 | 3300005543 | Ga0070672_100084812 | Ga0070672_1000848121 | 254 |
| 206 | 3300005544 | Ga0070686_100016443 | Ga0070686_1000164432 | 254 |
| 207 | 3300005546 | Ga0070696_100056927 | Ga0070696_1000569273 | 254 |
| 208 | 3300005547 | Ga0070693_100006875 | Ga0070693_1000068754 | 254 |
| 209 | 3300005548 | Ga0070665_100005936 | Ga0070665_1000059363 | 254 |
| 210 | 3300005564 | Ga0070664_100152650 | Ga0070664_1001526502 | 254 |
| 211 | 3300005578 | Ga0068854_100141712 | Ga0068854_1001417122 | 254 |
| 212 | 3300005614 | Ga0068856_100044836 | Ga0068856_1000448363 | 254 |
| 213 | 3300005615 | Ga0070702_100094957 | Ga0070702_1000949572 | 254 |
| 214 | 3300005617 | Ga0068859_100091024 | Ga0068859_1000910245 | 254 |
| 215 | 3300005834 | Ga0068851_10079555 | Ga0068851_100795552 | 254 |
| 216 | 3300005841 | Ga0068863_100140224 | Ga0068863_1001402242 | 254 |
| 217 | 3300006173 | Ga0070716_100034262 | Ga0070716_1000342623 | 254 |
| 218 | 3300006175 | Ga0070712_100058044 | Ga0070712_1000580443 | 254 |
| 219 | 3300006237 | Ga0097621_100015241 | Ga0097621_1000152416 | 254 |
| 220 | 3300006358 | Ga0068871_100158004 | Ga0068871_1001580042 | 254 |
| 221 | 3300006871 | Ga0075434_100292901 | Ga0075434_1002929011 | 254 |
| 222 | 3300006881 | Ga0068865_100214888 | Ga0068865_1002148882 | 254 |
| 223 | 3300006931 | Ga0097620_100091021 | Ga0097620_1000910215 | 254 |
| 224 | 3300009098 | Ga0105245_10021563 | Ga0105245_100215637 | 254 |
| 225 | 3300009101 | Ga0105247_10018828 | Ga0105247_100188283 | 254 |
| 226 | 3300009176 | Ga0105242_10009513 | Ga0105242_100095135 | 254 |
| 227 | 3300009176 | Ga0105242_10044321 | Ga0105242_100443215 | 254 |
| 228 | 3300009177 | Ga0105248_10165601 | Ga0105248_101656012 | 254 |
| 229 | 3300009553 | Ga0105249_10309895 | Ga0105249_103098952 | 254 |
| 230 | 3300011119 | Ga0105246_10328817 | Ga0105246_103288172 | 254 |
| 231 | 3300013297 | Ga0157378_10012711 | Ga0157378_100127117 | 254 |
| 232 | 3300013297 | Ga0157378_10129837 | Ga0157378_101298373 | 254 |
| 233 | 3300013306 | Ga0163162_10008387 | Ga0163162_100083878 | 254 |
| 234 | 3300013306 | Ga0163162_10217241 | Ga0163162_102172412 | 254 |
| 235 | 3300013308 | Ga0157375_10019692 | Ga0157375_100196926 | 254 |
| 236 | 3300014325 | Ga0163163_10018845 | Ga0163163_100188453 | 254 |
| 237 | 3300014968 | Ga0157379_10023178 | Ga0157379_100231785 | 254 |
| 238 | 3300017792 | Ga0163161_10548064 | Ga0163161_105480641 | 254 |
| 239 | 3300025321 | Ga0207656_10040771 | Ga0207656_100407712 | 254 |
| 240 | 3300025898 | Ga0207692_10005904 | Ga0207692_100059042 | 254 |
| 241 | 3300025899 | Ga0207642_10031819 | Ga0207642_100318193 | 254 |
| 242 | 3300025900 | Ga0207710_10089917 | Ga0207710_100899173 | 254 |
| 243 | 3300025907 | Ga0207645_10158198 | Ga0207645_101581982 | 254 |
| 244 | 3300025915 | Ga0207693_10000070 | Ga0207693_1000007076 | 254 |
| 245 | 3300025924 | Ga0207694_10277570 | Ga0207694_102775702 | 254 |
| 246 | 3300025925 | Ga0207650_10045310 | Ga0207650_100453103 | 254 |
| 247 | 3300025926 | Ga0207659_10557973 | Ga0207659_105579732 | 254 |
| 248 | 3300025928 | Ga0207700_10008158 | Ga0207700_100081587 | 254 |
| 249 | 3300025933 | Ga0207706_10003500 | Ga0207706_1000350018 | 254 |
| 250 | 3300025939 | Ga0207665_10024165 | Ga0207665_100241655 | 254 |
| 251 | 3300025940 | Ga0207691_10100420 | Ga0207691_101004201 | 254 |
| 252 | 3300025941 | Ga0207711_10003675 | Ga0207711_100036755 | 254 |
| 253 | 3300025945 | Ga0207679_10295983 | Ga0207679_102959832 | 254 |
| 254 | 3300025981 | Ga0207640_10102928 | Ga0207640_101029282 | 254 |
| 255 | 3300026023 | Ga0207677_10000509 | Ga0207677_1000050917 | 254 |
| 256 | 3300026035 | Ga0207703_10041493 | Ga0207703_100414932 | 254 |
| 257 | 3300026067 | Ga0207678_10159463 | Ga0207678_101594632 | 254 |
| 258 | 3300026088 | Ga0207641_10081947 | Ga0207641_100819473 | 254 |
| 259 | 3300026095 | Ga0207676_10069163 | Ga0207676_100691633 | 254 |
| 260 | 3300026118 | Ga0207675_100120329 | Ga0207675_1001203292 | 254 |
| 261 | 3300026121 | Ga0207683_10000448 | Ga0207683_1000044825 | 254 |
| 262 | 3300028379 | Ga0268266_10034794 | Ga0268266_100347944 | 254 |
| 263 | 3300035083 | Ga0373926_0123227 | Ga0373926_0123227_79_867 | 254 |
| 264 | 3300035086 | Ga0373934_0007738 | Ga0373934_0007738_1264_2052 | 254 |
| 265 | 3300035089 | Ga0373944_0008903 | Ga0373944_0008903_429_1217 | 254 |
| 266 | 3300035111 | Ga0373923_0093502 | Ga0373923_0093502_179_967 | 254 |
| 267 | 3300035695 | Ga0373927_0084882 | Ga0373927_0084882_479_1267 | 254 |
| 268 | 3300036401 | Ga0373937_0051347 | Ga0373937_0051347_1288_2076 | 254 |
| 269 | 3300037068 | Ga0373925_0045702 | Ga0373925_0045702_830_1618 | 254 |
| 270 | 3300046664 | Ga0495659_0016833 | Ga0495659_0016833_667_1455 | 254 |
| 271 | 3300047471 | Ga0495684_0326176 | Ga0495684_0326176_194_982 | 254 |
| 272 | 3300048904 | Ga0496101_0052367 | Ga0496101_0052367_2080_2868 | 254 |
| 273 | 3300048907 | Ga0496104_0008934 | Ga0496104_0008934_4660_5448 | 254 |
| 274 | 3300048908 | Ga0496105_0020136 | Ga0496105_0020136_283_1071 | 254 |
| 275 | 3300048909 | Ga0496106_0288770 | Ga0496106_0288770_384_1172 | 254 |
| 276 | 3300048911 | Ga0496108_0776128 | Ga0496108_0776128_29_817 | 254 |
| 277 | 3300048912 | Ga0496109_0165458 | Ga0496109_0165458_324_1112 | 254 |
| 278 | 3300048913 | Ga0496110_0615931 | Ga0496110_0615931_59_847 | 254 |
| 279 | 3300048915 | Ga0496112_0316424 | Ga0496112_0316424_545_1333 | 254 |
| 280 | 3300050512 | nmdc:mga0n895_582121_c1 | nmdc:mga0n895_582121_c1_77_955 | 254 |
| 281 | 3300005328 | Ga0070676_10000545 | Ga0070676_100005459 | 255 |
| 282 | 3300005330 | Ga0070690_100016791 | Ga0070690_1000167915 | 255 |
| 283 | 3300005333 | Ga0070677_10119846 | Ga0070677_101198462 | 255 |
| 284 | 3300005335 | Ga0070666_10002371 | Ga0070666_100023716 | 255 |
| 285 | 3300005338 | Ga0068868_100232934 | Ga0068868_1002329342 | 255 |
| 286 | 3300005347 | Ga0070668_100000206 | Ga0070668_10000020636 | 255 |
| 287 | 3300005353 | Ga0070669_100031588 | Ga0070669_1000315884 | 255 |
| 288 | 3300005354 | Ga0070675_100001498 | Ga0070675_1000014987 | 255 |
| 289 | 3300005355 | Ga0070671_100015348 | Ga0070671_1000153485 | 255 |
| 290 | 3300005364 | Ga0070673_100140304 | Ga0070673_1001403042 | 255 |
| 291 | 3300005365 | Ga0070688_100025653 | Ga0070688_1000256532 | 255 |
| 292 | 3300005367 | Ga0070667_100001933 | Ga0070667_10000193320 | 255 |
| 293 | 3300005455 | Ga0070663_100266308 | Ga0070663_1002663082 | 255 |
| 294 | 3300005456 | Ga0070678_100000259 | Ga0070678_10000025910 | 255 |
| 295 | 3300005459 | Ga0068867_100001543 | Ga0068867_1000015437 | 255 |
| 296 | 3300005466 | Ga0070685_10057686 | Ga0070685_100576862 | 255 |
| 297 | 3300005543 | Ga0070672_100000960 | Ga0070672_1000009607 | 255 |
| 298 | 3300005548 | Ga0070665_100002580 | Ga0070665_10000258019 | 255 |
| 299 | 3300005617 | Ga0068859_100001177 | Ga0068859_10000117710 | 255 |
| 300 | 3300005618 | Ga0068864_100002535 | Ga0068864_1000025357 | 255 |
| 301 | 3300005842 | Ga0068858_100025315 | Ga0068858_1000253153 | 255 |
| 302 | 3300005843 | Ga0068860_100001191 | Ga0068860_1000011913 | 255 |
| 303 | 3300005844 | Ga0068862_100047830 | Ga0068862_1000478304 | 255 |
| 304 | 3300006237 | Ga0097621_100000696 | Ga0097621_10000069614 | 255 |
| 305 | 3300006358 | Ga0068871_100000472 | Ga0068871_10000047210 | 255 |
| 306 | 3300006881 | Ga0068865_100073431 | Ga0068865_1000734313 | 255 |
| 307 | 3300006931 | Ga0097620_100001177 | Ga0097620_10000117717 | 255 |
| 308 | 3300009177 | Ga0105248_10001670 | Ga0105248_100016707 | 255 |
| 309 | 3300013296 | Ga0157374_10002207 | Ga0157374_1000220711 | 255 |
| 310 | 3300013306 | Ga0163162_10000619 | Ga0163162_1000061929 | 255 |
| 311 | 3300013308 | Ga0157375_10003009 | Ga0157375_100030097 | 255 |
| 312 | 3300014325 | Ga0163163_10186639 | Ga0163163_101866392 | 255 |
| 313 | 3300014968 | Ga0157379_10001443 | Ga0157379_1000144312 | 255 |
| 314 | 3300014969 | Ga0157376_10050661 | Ga0157376_100506612 | 255 |
| 315 | 3300026095 | Ga0207676_10252263 | Ga0207676_102522632 | 255 |
| 316 | 3300031824 | Ga0307413_10019256 | Ga0307413_100192564 | 256 |
| 317 | 3300035170 | Ga0373943_0034999 | Ga0373943_0034999_1040_1828 | 256 |
| 318 | 3300042133 | Ga0450896_008703 | Ga0450896_008703_546_1334 | 256 |
| 319 | 3300025315 | Ga0207697_10008287 | Ga0207697_100082875 | 257 |
| 320 | 3300025893 | Ga0207682_10151509 | Ga0207682_101515092 | 257 |
| 321 | 3300025903 | Ga0207680_10001163 | Ga0207680_100011637 | 257 |
| 322 | 3300025907 | Ga0207645_10000095 | Ga0207645_1000009552 | 257 |
| 323 | 3300025923 | Ga0207681_10005063 | Ga0207681_100050634 | 257 |
| 324 | 3300025926 | Ga0207659_10016534 | Ga0207659_100165344 | 257 |
| 325 | 3300025931 | Ga0207644_10025898 | Ga0207644_100258985 | 257 |
| 326 | 3300025938 | Ga0207704_10040558 | Ga0207704_100405583 | 257 |
| 327 | 3300025940 | Ga0207691_10000488 | Ga0207691_1000048819 | 257 |
| 328 | 3300025941 | Ga0207711_10006583 | Ga0207711_100065835 | 257 |
| 329 | 3300025960 | Ga0207651_10002560 | Ga0207651_100025606 | 257 |
| 330 | 3300025972 | Ga0207668_10003885 | Ga0207668_100038855 | 257 |
| 331 | 3300025986 | Ga0207658_10002734 | Ga0207658_100027347 | 257 |
| 332 | 3300026023 | Ga0207677_10010048 | Ga0207677_100100482 | 257 |
| 333 | 3300026035 | Ga0207703_10002220 | Ga0207703_100022208 | 257 |
| 334 | 3300026067 | Ga0207678_10296964 | Ga0207678_102969642 | 257 |
| 335 | 3300026088 | Ga0207641_10001273 | Ga0207641_100012737 | 257 |
| 336 | 3300026089 | Ga0207648_10000324 | Ga0207648_1000032445 | 257 |
| 337 | 3300026121 | Ga0207683_10000109 | Ga0207683_1000010939 | 257 |
| 338 | 3300028379 | Ga0268266_10006219 | Ga0268266_100062197 | 257 |
| 339 | 3300028380 | Ga0268265_10061720 | Ga0268265_100617202 | 257 |
| 340 | 3300028381 | Ga0268264_10040223 | Ga0268264_100402234 | 257 |
| 341 | 3300031903 | Ga0307407_10197414 | Ga0307407_101974142 | 257 |
| 342 | 3300032005 | Ga0307411_10059616 | Ga0307411_100596162 | 257 |
| 343 | 3300048912 | Ga0496109_0051045 | Ga0496109_0051045_1635_2435 | 257 |
| 344 | 3300048913 | Ga0496110_0098431 | Ga0496110_0098431_273_1073 | 257 |
| 345 | 3300048917 | Ga0496114_0121527 | Ga0496114_0121527_435_1235 | 257 |
| 346 | 3300049573 | Ga0501037_0095336 | Ga0501037_0095336_1166_1948 | 257 |
| 347 | 3300049574 | Ga0501038_0056483 | Ga0501038_0056483_1134_1916 | 257 |
| 348 | 3300049575 | Ga0501039_0048882 | Ga0501039_0048882_1960_2742 | 257 |
| 349 | 3300049576 | Ga0501040_0015144 | Ga0501040_0015144_1571_2353 | 257 |
| 350 | 3300049577 | Ga0501041_0012873 | Ga0501041_0012873_833_1615 | 257 |
| 351 | 3300049578 | Ga0501042_0039822 | Ga0501042_0039822_1669_2451 | 257 |
| 352 | 3300049578 | Ga0501042_0083239 | Ga0501042_0083239_965_1747 | 257 |
| 353 | 3300049580 | Ga0501046_0254081 | Ga0501046_0254081_223_1005 | 257 |
| 354 | 3300049584 | Ga0501068_0160653 | Ga0501068_0160653_415_1197 | 257 |
| 355 | 3300049587 | Ga0501071_0011960 | Ga0501071_0011960_1857_2639 | 257 |
| 356 | 3300049588 | Ga0501072_0005486 | Ga0501072_0005486_821_1603 | 257 |
| 357 | 3300049588 | Ga0501072_0043870 | Ga0501072_0043870_2530_3312 | 257 |
| 358 | 3300049589 | Ga0501073_0124510 | Ga0501073_0124510_950_1732 | 257 |
| 359 | 3300049590 | Ga0501074_0100336 | Ga0501074_0100336_760_1542 | 257 |
| 360 | 3300049591 | Ga0501075_0022495 | Ga0501075_0022495_3189_3971 | 257 |
| 361 | 3300049591 | Ga0501075_0022605 | Ga0501075_0022605_1277_2059 | 257 |
| 362 | 3300049592 | Ga0501076_0017570 | Ga0501076_0017570_1566_2348 | 257 |
| 363 | 3300049592 | Ga0501076_0019108 | Ga0501076_0019108_2937_3719 | 257 |
| 364 | 3300049593 | Ga0501077_0086648 | Ga0501077_0086648_155_937 | 257 |
| 365 | 3300049741 | Ga0501079_0231182 | Ga0501079_0231182_30_812 | 257 |
| 366 | 3300049742 | Ga0501080_0017072 | Ga0501080_0017072_3272_4054 | 257 |
| 367 | 3300049743 | Ga0501081_0043996 | Ga0501081_0043996_914_1696 | 257 |
| 368 | 3300049824 | Ga0501045_0017955 | Ga0501045_0017955_1623_2405 | 257 |
| 369 | 3300049824 | Ga0501045_0024324 | Ga0501045_0024324_2767_3549 | 257 |
| 370 | 3300054114 | Ga0501084_0079863 | Ga0501084_0079863_17_799 | 257 |
| 371 | 3300060353 | Ga0501082_0031776 | Ga0501082_0031776_2290_3072 | 257 |
| 372 | 3300061734 | Ga0530510_0006768 | Ga0530510_0006768_3020_3802 | 257 |
| 373 | 3300005466 | Ga0070685_10324771 | Ga0070685_103247711 | 258 |
| 374 | 3300035410 | Ga0373924_0007020 | Ga0373924_0007020_2876_3661 | 258 |
| 375 | 3300045836 | Ga0466958_0048829 | Ga0466958_0048829_631_1416 | 258 |
| 376 | 3300050493 | nmdc:mga0k408_4139_c1 | nmdc:mga0k408_4139_c1_1643_2425 | 258 |
| 377 | 3300005336 | Ga0070680_100049152 | Ga0070680_1000491524 | 260 |
| 378 | 3300005367 | Ga0070667_100049464 | Ga0070667_1000494644 | 260 |
| 379 | 3300005435 | Ga0070714_100127254 | Ga0070714_1001272544 | 260 |
| 380 | 3300005436 | Ga0070713_100254758 | Ga0070713_1002547582 | 260 |
| 381 | 3300005458 | Ga0070681_10004606 | Ga0070681_100046067 | 260 |
| 382 | 3300005530 | Ga0070679_100031838 | Ga0070679_1000318386 | 260 |
| 383 | 3300005539 | Ga0068853_100075502 | Ga0068853_1000755024 | 260 |
| 384 | 3300005563 | Ga0068855_100026941 | Ga0068855_1000269419 | 260 |
| 385 | 3300005614 | Ga0068856_100023886 | Ga0068856_1000238862 | 260 |
| 386 | 3300005617 | Ga0068859_100209166 | Ga0068859_1002091663 | 260 |
| 387 | 3300006931 | Ga0097620_100209170 | Ga0097620_1002091703 | 260 |
| 388 | 3300009093 | Ga0105240_10045447 | Ga0105240_100454475 | 260 |
| 389 | 3300013104 | Ga0157370_10134194 | Ga0157370_101341942 | 260 |
| 390 | 3300013105 | Ga0157369_10236246 | Ga0157369_102362461 | 260 |
| 391 | 3300013307 | Ga0157372_10045381 | Ga0157372_100453816 | 260 |
| 392 | 3300025912 | Ga0207707_10004319 | Ga0207707_100043194 | 260 |
| 393 | 3300025917 | Ga0207660_10138111 | Ga0207660_101381112 | 260 |
| 394 | 3300025920 | Ga0207649_10029299 | Ga0207649_100292994 | 260 |
| 395 | 3300025921 | Ga0207652_10077355 | Ga0207652_100773554 | 260 |
| 396 | 3300025924 | Ga0207694_10328029 | Ga0207694_103280292 | 260 |
| 397 | 3300025929 | Ga0207664_10076261 | Ga0207664_100762614 | 260 |
| 398 | 3300025945 | Ga0207679_10047362 | Ga0207679_100473622 | 260 |
| 399 | 3300025949 | Ga0207667_10133835 | Ga0207667_101338352 | 260 |
| 400 | 3300025981 | Ga0207640_10194037 | Ga0207640_101940372 | 260 |
| 401 | 3300026041 | Ga0207639_10167299 | Ga0207639_101672992 | 260 |
| 402 | 3300026078 | Ga0207702_10007617 | Ga0207702_1000761711 | 260 |
| 403 | 3300031665 | Ga0316575_10044862 | Ga0316575_100448623 | 260 |
| 404 | 3300035398 | Ga0316574_0001281 | Ga0316574_0001281_8903_9685 | 260 |
| 405 | 3300042876 | Ga0451577_0209475 | Ga0451577_0209475_722_1504 | 260 |
| 406 | 3300045051 | Ga0451576_0422338 | Ga0451576_0422338_297_1079 | 260 |
| 407 | 3300005335 | Ga0070666_10333214 | Ga0070666_103332142 | 261 |
| 408 | 3300005339 | Ga0070660_100013019 | Ga0070660_1000130192 | 261 |
| 409 | 3300005340 | Ga0070689_100396085 | Ga0070689_1003960852 | 261 |
| 410 | 3300005343 | Ga0070687_100274129 | Ga0070687_1002741292 | 261 |
| 411 | 3300005344 | Ga0070661_100011229 | Ga0070661_1000112297 | 261 |
| 412 | 3300005347 | Ga0070668_100340424 | Ga0070668_1003404241 | 261 |
| 413 | 3300005354 | Ga0070675_100020158 | Ga0070675_1000201586 | 261 |
| 414 | 3300005355 | Ga0070671_100393186 | Ga0070671_1003931861 | 261 |
| 415 | 3300005364 | Ga0070673_100014398 | Ga0070673_1000143982 | 261 |
| 416 | 3300005366 | Ga0070659_100002218 | Ga0070659_10000221814 | 261 |
| 417 | 3300005440 | Ga0070705_100176305 | Ga0070705_1001763052 | 261 |
| 418 | 3300005457 | Ga0070662_100000582 | Ga0070662_10000058214 | 261 |
| 419 | 3300005458 | Ga0070681_10160385 | Ga0070681_101603852 | 261 |
| 420 | 3300005471 | Ga0070698_100198187 | Ga0070698_1001981873 | 261 |
| 421 | 3300005530 | Ga0070679_100252229 | Ga0070679_1002522292 | 261 |
| 422 | 3300005539 | Ga0068853_100018287 | Ga0068853_1000182872 | 261 |
| 423 | 3300005549 | Ga0070704_100032975 | Ga0070704_1000329752 | 261 |
| 424 | 3300005563 | Ga0068855_100005529 | Ga0068855_1000055292 | 261 |
| 425 | 3300005564 | Ga0070664_100002314 | Ga0070664_1000023142 | 261 |
| 426 | 3300005564 | Ga0070664_100140654 | Ga0070664_1001406542 | 261 |
| 427 | 3300005578 | Ga0068854_100009659 | Ga0068854_1000096592 | 261 |
| 428 | 3300005614 | Ga0068856_100000093 | Ga0068856_1000000939 | 261 |
| 429 | 3300005616 | Ga0068852_100035485 | Ga0068852_1000354852 | 261 |
| 430 | 3300005617 | Ga0068859_100010733 | Ga0068859_1000107338 | 261 |
| 431 | 3300005842 | Ga0068858_100771939 | Ga0068858_1007719392 | 261 |
| 432 | 3300006847 | Ga0075431_100024857 | Ga0075431_1000248573 | 261 |
| 433 | 3300006931 | Ga0097620_100010733 | Ga0097620_1000107338 | 261 |
| 434 | 3300009094 | Ga0111539_10331248 | Ga0111539_103312482 | 261 |
| 435 | 3300009094 | Ga0111539_10659496 | Ga0111539_106594962 | 261 |
| 436 | 3300009174 | Ga0105241_10415779 | Ga0105241_104157792 | 261 |
| 437 | 3300009176 | Ga0105242_10459533 | Ga0105242_104595332 | 261 |
| 438 | 3300009553 | Ga0105249_10188497 | Ga0105249_101884972 | 261 |
| 439 | 3300013100 | Ga0157373_10001205 | Ga0157373_100012057 | 261 |
| 440 | 3300013102 | Ga0157371_10000228 | Ga0157371_1000022815 | 261 |
| 441 | 3300013104 | Ga0157370_10020629 | Ga0157370_100206294 | 261 |
| 442 | 3300013105 | Ga0157369_10100242 | Ga0157369_101002425 | 261 |
| 443 | 3300013307 | Ga0157372_10009636 | Ga0157372_100096366 | 261 |
| 444 | 3300025885 | Ga0207653_10045344 | Ga0207653_100453442 | 261 |
| 445 | 3300025912 | Ga0207707_10131617 | Ga0207707_101316172 | 261 |
| 446 | 3300025919 | Ga0207657_10000645 | Ga0207657_1000064519 | 261 |
| 447 | 3300025920 | Ga0207649_10030611 | Ga0207649_100306111 | 261 |
| 448 | 3300025920 | Ga0207649_10116236 | Ga0207649_101162362 | 261 |
| 449 | 3300025922 | Ga0207646_10119191 | Ga0207646_101191912 | 261 |
| 450 | 3300025926 | Ga0207659_10027681 | Ga0207659_100276812 | 261 |
| 451 | 3300025931 | Ga0207644_10141927 | Ga0207644_101419272 | 261 |
| 452 | 3300025932 | Ga0207690_10000461 | Ga0207690_1000046124 | 261 |
| 453 | 3300025933 | Ga0207706_10000014 | Ga0207706_1000001465 | 261 |
| 454 | 3300025936 | Ga0207670_10384997 | Ga0207670_103849971 | 261 |
| 455 | 3300025940 | Ga0207691_10026704 | Ga0207691_100267046 | 261 |
| 456 | 3300025945 | Ga0207679_10016970 | Ga0207679_100169706 | 261 |
| 457 | 3300025945 | Ga0207679_10149368 | Ga0207679_101493682 | 261 |
| 458 | 3300025949 | Ga0207667_10004276 | Ga0207667_1000427614 | 261 |
| 459 | 3300025981 | Ga0207640_10110004 | Ga0207640_101100042 | 261 |
| 460 | 3300025986 | Ga0207658_10606902 | Ga0207658_106069021 | 261 |
| 461 | 3300026035 | Ga0207703_10743375 | Ga0207703_107433751 | 261 |
| 462 | 3300026041 | Ga0207639_10042662 | Ga0207639_100426622 | 261 |
| 463 | 3300026078 | Ga0207702_10006446 | Ga0207702_100064466 | 261 |
| 464 | 3300026121 | Ga0207683_10260185 | Ga0207683_102601852 | 261 |
| 465 | 3300026142 | Ga0207698_10027547 | Ga0207698_100275474 | 261 |
| 466 | 3300027364 | Ga0209967_1003926 | Ga0209967_10039263 | 261 |
| 467 | 3300027471 | Ga0209995_1004680 | Ga0209995_10046803 | 261 |
| 468 | 3300027876 | Ga0209974_10081434 | Ga0209974_100814342 | 261 |
| 469 | 3300027907 | Ga0207428_10289644 | Ga0207428_102896442 | 261 |
| 470 | 3300028380 | Ga0268265_10250419 | Ga0268265_102504192 | 261 |
| 471 | 3300031548 | Ga0307408_100024299 | Ga0307408_1000242992 | 261 |
| 472 | 3300031731 | Ga0307405_10029581 | Ga0307405_100295814 | 261 |
| 473 | 3300031824 | Ga0307413_10101746 | Ga0307413_101017462 | 261 |
| 474 | 3300031901 | Ga0307406_10011440 | Ga0307406_100114405 | 261 |
| 475 | 3300031903 | Ga0307407_10079432 | Ga0307407_100794322 | 261 |
| 476 | 3300031911 | Ga0307412_10025898 | Ga0307412_100258985 | 261 |
| 477 | 3300031995 | Ga0307409_100143631 | Ga0307409_1001436312 | 261 |
| 478 | 3300032002 | Ga0307416_100044964 | Ga0307416_1000449642 | 261 |
| 479 | 3300032002 | Ga0307416_100301042 | Ga0307416_1003010422 | 261 |
| 480 | 3300032005 | Ga0307411_10012990 | Ga0307411_100129907 | 261 |
| 481 | 3300032126 | Ga0307415_100044261 | Ga0307415_1000442613 | 261 |
| 482 | 3300038443 | Ga0395901_0073870 | Ga0395901_0073870_1933_2721 | 261 |
| 483 | 3300041410 | Ga0439461_0001830 | Ga0439461_0001830_874_1659 | 261 |
| 484 | 3300042156 | Ga0439446_0060604 | Ga0439446_0060604_321_1106 | 261 |
| 485 | 3300044656 | Ga0466969_0016926 | Ga0466969_0016926_2585_3370 | 261 |
| 486 | 3300044683 | Ga0466965_0009563 | Ga0466965_0009563_2086_2871 | 261 |
| 487 | 3300044684 | Ga0466966_0018973 | Ga0466966_0018973_2645_3430 | 261 |
| 488 | 3300044693 | Ga0466961_0087899 | Ga0466961_0087899_228_1013 | 261 |
| 489 | 3300044719 | Ga0466971_0028406 | Ga0466971_0028406_126_911 | 261 |
| 490 | 3300045049 | Ga0466959_0244136 | Ga0466959_0244136_139_924 | 261 |
| 491 | 3300045051 | Ga0451576_0051484 | Ga0451576_0051484_371_1156 | 261 |
| 492 | 3300048905 | Ga0496102_0047644 | Ga0496102_0047644_2315_3100 | 261 |
| 493 | 3300048909 | Ga0496106_0009881 | Ga0496106_0009881_1930_2715 | 261 |
| 494 | 3300048910 | Ga0496107_0005246 | Ga0496107_0005246_7267_8052 | 261 |
| 495 | 3300049585 | Ga0501069_0377594 | Ga0501069_0377594_32_823 | 261 |
| 496 | 3300050510 | nmdc:mga06r32_271528_c1 | nmdc:mga06r32_271528_c1_882_1667 | 261 |
| 497 | 3300050511 | nmdc:mga08y16_172275_c1 | nmdc:mga08y16_172275_c1_525_1310 | 261 |
| 498 | 3300050515 | nmdc:mga0a205_113116_c1 | nmdc:mga0a205_113116_c1_1329_2114 | 261 |
| 499 | 3300061719 | Ga0466962_0000421 | Ga0466962_0000421_14581_15366 | 261 |
| 500 | 3300001976 | JGI24752J21851_1006625 | JGI24752J21851_10066252 | 262 |
| 501 | 3300002244 | JGI24742J22300_10017488 | JGI24742J22300_100174881 | 262 |
| 502 | 3300002459 | JGI24751J29686_10009515 | JGI24751J29686_100095153 | 262 |
| 503 | 3300005327 | Ga0070658_10006851 | Ga0070658_100068518 | 262 |
| 504 | 3300005328 | Ga0070676_10018052 | Ga0070676_100180525 | 262 |
| 505 | 3300005329 | Ga0070683_100027006 | Ga0070683_1000270066 | 262 |
| 506 | 3300005329 | Ga0070683_100102802 | Ga0070683_1001028023 | 262 |
| 507 | 3300005330 | Ga0070690_100135392 | Ga0070690_1001353922 | 262 |
| 508 | 3300005331 | Ga0070670_100009503 | Ga0070670_1000095036 | 262 |
| 509 | 3300005331 | Ga0070670_100032729 | Ga0070670_1000327293 | 262 |
| 510 | 3300005331 | Ga0070670_100036494 | Ga0070670_1000364943 | 262 |
| 511 | 3300005333 | Ga0070677_10000343 | Ga0070677_1000034310 | 262 |
| 512 | 3300005333 | Ga0070677_10037091 | Ga0070677_100370912 | 262 |
| 513 | 3300005333 | Ga0070677_10097736 | Ga0070677_100977362 | 262 |
| 514 | 3300005334 | Ga0068869_100009240 | Ga0068869_1000092404 | 262 |
| 515 | 3300005334 | Ga0068869_100043670 | Ga0068869_1000436703 | 262 |
| 516 | 3300005334 | Ga0068869_100132350 | Ga0068869_1001323502 | 262 |
| 517 | 3300005334 | Ga0068869_100229283 | Ga0068869_1002292832 | 262 |
| 518 | 3300005335 | Ga0070666_10007974 | Ga0070666_100079743 | 262 |
| 519 | 3300005335 | Ga0070666_10042572 | Ga0070666_100425723 | 262 |
| 520 | 3300005335 | Ga0070666_10181936 | Ga0070666_101819362 | 262 |
| 521 | 3300005336 | Ga0070680_100100690 | Ga0070680_1001006904 | 262 |
| 522 | 3300005336 | Ga0070680_100253535 | Ga0070680_1002535352 | 262 |
| 523 | 3300005337 | Ga0070682_100032822 | Ga0070682_1000328226 | 262 |
| 524 | 3300005339 | Ga0070660_100028623 | Ga0070660_1000286232 | 262 |
| 525 | 3300005339 | Ga0070660_100252435 | Ga0070660_1002524352 | 262 |
| 526 | 3300005340 | Ga0070689_100031936 | Ga0070689_1000319365 | 262 |
| 527 | 3300005340 | Ga0070689_100500294 | Ga0070689_1005002941 | 262 |
| 528 | 3300005343 | Ga0070687_100444479 | Ga0070687_1004444791 | 262 |
| 529 | 3300005344 | Ga0070661_100003520 | Ga0070661_1000035202 | 262 |
| 530 | 3300005344 | Ga0070661_100016045 | Ga0070661_1000160457 | 262 |
| 531 | 3300005344 | Ga0070661_100016963 | Ga0070661_1000169632 | 262 |
| 532 | 3300005344 | Ga0070661_100103983 | Ga0070661_1001039833 | 262 |
| 533 | 3300005347 | Ga0070668_100002549 | Ga0070668_1000025499 | 262 |
| 534 | 3300005347 | Ga0070668_100006137 | Ga0070668_1000061373 | 262 |
| 535 | 3300005347 | Ga0070668_100007175 | Ga0070668_1000071754 | 262 |
| 536 | 3300005347 | Ga0070668_100062215 | Ga0070668_1000622153 | 262 |
| 537 | 3300005347 | Ga0070668_100266306 | Ga0070668_1002663062 | 262 |
| 538 | 3300005353 | Ga0070669_100018043 | Ga0070669_1000180435 | 262 |
| 539 | 3300005353 | Ga0070669_100053736 | Ga0070669_1000537363 | 262 |
| 540 | 3300005353 | Ga0070669_100141733 | Ga0070669_1001417332 | 262 |
| 541 | 3300005353 | Ga0070669_100158042 | Ga0070669_1001580422 | 262 |
| 542 | 3300005353 | Ga0070669_100415760 | Ga0070669_1004157601 | 262 |
| 543 | 3300005354 | Ga0070675_100004730 | Ga0070675_1000047309 | 262 |
| 544 | 3300005354 | Ga0070675_100210522 | Ga0070675_1002105222 | 262 |
| 545 | 3300005355 | Ga0070671_100052938 | Ga0070671_1000529383 | 262 |
| 546 | 3300005355 | Ga0070671_100109036 | Ga0070671_1001090363 | 262 |
| 547 | 3300005355 | Ga0070671_100133619 | Ga0070671_1001336192 | 262 |
| 548 | 3300005355 | Ga0070671_100190605 | Ga0070671_1001906052 | 262 |
| 549 | 3300005355 | Ga0070671_100263014 | Ga0070671_1002630141 | 262 |
| 550 | 3300005356 | Ga0070674_100017565 | Ga0070674_1000175656 | 262 |
| 551 | 3300005356 | Ga0070674_100144914 | Ga0070674_1001449141 | 262 |
| 552 | 3300005356 | Ga0070674_100167731 | Ga0070674_1001677313 | 262 |
| 553 | 3300005356 | Ga0070674_100274136 | Ga0070674_1002741362 | 262 |
| 554 | 3300005356 | Ga0070674_100326499 | Ga0070674_1003264992 | 262 |
| 555 | 3300005364 | Ga0070673_100001140 | Ga0070673_10000114012 | 262 |
| 556 | 3300005364 | Ga0070673_100011534 | Ga0070673_1000115347 | 262 |
| 557 | 3300005364 | Ga0070673_100031620 | Ga0070673_1000316201 | 262 |
| 558 | 3300005365 | Ga0070688_100049809 | Ga0070688_1000498092 | 262 |
| 559 | 3300005365 | Ga0070688_100299197 | Ga0070688_1002991972 | 262 |
| 560 | 3300005366 | Ga0070659_100024728 | Ga0070659_1000247284 | 262 |
| 561 | 3300005366 | Ga0070659_100104784 | Ga0070659_1001047842 | 262 |
| 562 | 3300005366 | Ga0070659_100456049 | Ga0070659_1004560492 | 262 |
| 563 | 3300005367 | Ga0070667_100068013 | Ga0070667_1000680132 | 262 |
| 564 | 3300005367 | Ga0070667_100110048 | Ga0070667_1001100482 | 262 |
| 565 | 3300005367 | Ga0070667_100180102 | Ga0070667_1001801021 | 262 |
| 566 | 3300005367 | Ga0070667_100363890 | Ga0070667_1003638902 | 262 |
| 567 | 3300005434 | Ga0070709_10005119 | Ga0070709_100051197 | 262 |
| 568 | 3300005434 | Ga0070709_10052832 | Ga0070709_100528323 | 262 |
| 569 | 3300005436 | Ga0070713_100000031 | Ga0070713_10000003156 | 262 |
| 570 | 3300005436 | Ga0070713_100167194 | Ga0070713_1001671942 | 262 |
| 571 | 3300005438 | Ga0070701_10005021 | Ga0070701_100050216 | 262 |
| 572 | 3300005438 | Ga0070701_10023917 | Ga0070701_100239173 | 262 |
| 573 | 3300005439 | Ga0070711_100027155 | Ga0070711_1000271552 | 262 |
| 574 | 3300005439 | Ga0070711_100256135 | Ga0070711_1002561352 | 262 |
| 575 | 3300005441 | Ga0070700_100050457 | Ga0070700_1000504572 | 262 |
| 576 | 3300005445 | Ga0070708_100018090 | Ga0070708_1000180903 | 262 |
| 577 | 3300005455 | Ga0070663_100001186 | Ga0070663_1000011869 | 262 |
| 578 | 3300005455 | Ga0070663_100008129 | Ga0070663_1000081296 | 262 |
| 579 | 3300005455 | Ga0070663_100040592 | Ga0070663_1000405924 | 262 |
| 580 | 3300005456 | Ga0070678_100223702 | Ga0070678_1002237022 | 262 |
| 581 | 3300005456 | Ga0070678_100526582 | Ga0070678_1005265821 | 262 |
| 582 | 3300005458 | Ga0070681_10020531 | Ga0070681_100205318 | 262 |
| 583 | 3300005458 | Ga0070681_10104122 | Ga0070681_101041223 | 262 |
| 584 | 3300005458 | Ga0070681_10200210 | Ga0070681_102002103 | 262 |
| 585 | 3300005459 | Ga0068867_100001753 | Ga0068867_1000017539 | 262 |
| 586 | 3300005459 | Ga0068867_100050245 | Ga0068867_1000502454 | 262 |
| 587 | 3300005459 | Ga0068867_100052859 | Ga0068867_1000528593 | 262 |
| 588 | 3300005459 | Ga0068867_100077168 | Ga0068867_1000771682 | 262 |
| 589 | 3300005459 | Ga0068867_100107300 | Ga0068867_1001073003 | 262 |
| 590 | 3300005459 | Ga0068867_100143122 | Ga0068867_1001431222 | 262 |
| 591 | 3300005459 | Ga0068867_100161458 | Ga0068867_1001614582 | 262 |
| 592 | 3300005459 | Ga0068867_100275790 | Ga0068867_1002757902 | 262 |
| 593 | 3300005466 | Ga0070685_10113051 | Ga0070685_101130511 | 262 |
| 594 | 3300005467 | Ga0070706_100293177 | Ga0070706_1002931772 | 262 |
| 595 | 3300005518 | Ga0070699_100008896 | Ga0070699_1000088968 | 262 |
| 596 | 3300005530 | Ga0070679_100079385 | Ga0070679_1000793853 | 262 |
| 597 | 3300005530 | Ga0070679_100082903 | Ga0070679_1000829032 | 262 |
| 598 | 3300005535 | Ga0070684_100040176 | Ga0070684_1000401765 | 262 |
| 599 | 3300005539 | Ga0068853_100025596 | Ga0068853_1000255964 | 262 |
| 600 | 3300005539 | Ga0068853_100086660 | Ga0068853_1000866602 | 262 |
| 601 | 3300005539 | Ga0068853_100105741 | Ga0068853_1001057412 | 262 |
| 602 | 3300005539 | Ga0068853_100382442 | Ga0068853_1003824421 | 262 |
| 603 | 3300005539 | Ga0068853_100448093 | Ga0068853_1004480932 | 262 |
| 604 | 3300005543 | Ga0070672_100022218 | Ga0070672_1000222185 | 262 |
| 605 | 3300005543 | Ga0070672_100023349 | Ga0070672_1000233492 | 262 |
| 606 | 3300005543 | Ga0070672_100030863 | Ga0070672_1000308634 | 262 |
| 607 | 3300005543 | Ga0070672_100264392 | Ga0070672_1002643922 | 262 |
| 608 | 3300005543 | Ga0070672_100424987 | Ga0070672_1004249871 | 262 |
| 609 | 3300005546 | Ga0070696_100017107 | Ga0070696_1000171073 | 262 |
| 610 | 3300005547 | Ga0070693_100017583 | Ga0070693_1000175832 | 262 |
| 611 | 3300005547 | Ga0070693_100400105 | Ga0070693_1004001051 | 262 |
| 612 | 3300005548 | Ga0070665_100008185 | Ga0070665_1000081856 | 262 |
| 613 | 3300005548 | Ga0070665_100035193 | Ga0070665_1000351933 | 262 |
| 614 | 3300005548 | Ga0070665_100072122 | Ga0070665_1000721225 | 262 |
| 615 | 3300005548 | Ga0070665_100246051 | Ga0070665_1002460512 | 262 |
| 616 | 3300005548 | Ga0070665_100310401 | Ga0070665_1003104012 | 262 |
| 617 | 3300005549 | Ga0070704_100144198 | Ga0070704_1001441982 | 262 |
| 618 | 3300005563 | Ga0068855_100059007 | Ga0068855_1000590073 | 262 |
| 619 | 3300005563 | Ga0068855_100078768 | Ga0068855_1000787685 | 262 |
| 620 | 3300005563 | Ga0068855_100294394 | Ga0068855_1002943942 | 262 |
| 621 | 3300005563 | Ga0068855_100451937 | Ga0068855_1004519371 | 262 |
| 622 | 3300005563 | Ga0068855_100471248 | Ga0068855_1004712482 | 262 |
| 623 | 3300005564 | Ga0070664_100006795 | Ga0070664_1000067958 | 262 |
| 624 | 3300005564 | Ga0070664_100051277 | Ga0070664_1000512771 | 262 |
| 625 | 3300005564 | Ga0070664_100071856 | Ga0070664_1000718563 | 262 |
| 626 | 3300005564 | Ga0070664_100203952 | Ga0070664_1002039522 | 262 |
| 627 | 3300005564 | Ga0070664_100373670 | Ga0070664_1003736702 | 262 |
| 628 | 3300005564 | Ga0070664_100471277 | Ga0070664_1004712772 | 262 |
| 629 | 3300005577 | Ga0068857_100040036 | Ga0068857_1000400364 | 262 |
| 630 | 3300005578 | Ga0068854_100062585 | Ga0068854_1000625854 | 262 |
| 631 | 3300005578 | Ga0068854_100084378 | Ga0068854_1000843782 | 262 |
| 632 | 3300005578 | Ga0068854_100230556 | Ga0068854_1002305562 | 262 |
| 633 | 3300005614 | Ga0068856_100014926 | Ga0068856_1000149268 | 262 |
| 634 | 3300005614 | Ga0068856_100015908 | Ga0068856_1000159084 | 262 |
| 635 | 3300005614 | Ga0068856_100192724 | Ga0068856_1001927243 | 262 |
| 636 | 3300005614 | Ga0068856_100256471 | Ga0068856_1002564713 | 262 |
| 637 | 3300005614 | Ga0068856_100742572 | Ga0068856_1007425721 | 262 |
| 638 | 3300005615 | Ga0070702_100086916 | Ga0070702_1000869163 | 262 |
| 639 | 3300005616 | Ga0068852_100007757 | Ga0068852_1000077576 | 262 |
| 640 | 3300005616 | Ga0068852_100070955 | Ga0068852_1000709552 | 262 |
| 641 | 3300005616 | Ga0068852_100071009 | Ga0068852_1000710093 | 262 |
| 642 | 3300005616 | Ga0068852_100592848 | Ga0068852_1005928481 | 262 |
| 643 | 3300005617 | Ga0068859_100032436 | Ga0068859_1000324362 | 262 |
| 644 | 3300005617 | Ga0068859_100090057 | Ga0068859_1000900572 | 262 |
| 645 | 3300005617 | Ga0068859_100592423 | Ga0068859_1005924232 | 262 |
| 646 | 3300005618 | Ga0068864_100003579 | Ga0068864_1000035799 | 262 |
| 647 | 3300005618 | Ga0068864_100018393 | Ga0068864_1000183934 | 262 |
| 648 | 3300005618 | Ga0068864_100080019 | Ga0068864_1000800192 | 262 |
| 649 | 3300005618 | Ga0068864_100082429 | Ga0068864_1000824292 | 262 |
| 650 | 3300005718 | Ga0068866_10002777 | Ga0068866_100027773 | 262 |
| 651 | 3300005719 | Ga0068861_100190133 | Ga0068861_1001901332 | 262 |
| 652 | 3300005834 | Ga0068851_10001833 | Ga0068851_100018336 | 262 |
| 653 | 3300005834 | Ga0068851_10003969 | Ga0068851_100039697 | 262 |
| 654 | 3300005834 | Ga0068851_10012795 | Ga0068851_100127956 | 262 |
| 655 | 3300005840 | Ga0068870_10004563 | Ga0068870_100045637 | 262 |
| 656 | 3300005840 | Ga0068870_10037219 | Ga0068870_100372192 | 262 |
| 657 | 3300005841 | Ga0068863_100046106 | Ga0068863_1000461065 | 262 |
| 658 | 3300005841 | Ga0068863_100059141 | Ga0068863_1000591412 | 262 |
| 659 | 3300005841 | Ga0068863_100093802 | Ga0068863_1000938024 | 262 |
| 660 | 3300005841 | Ga0068863_100124228 | Ga0068863_1001242282 | 262 |
| 661 | 3300005841 | Ga0068863_100141986 | Ga0068863_1001419862 | 262 |
| 662 | 3300005842 | Ga0068858_100039701 | Ga0068858_1000397013 | 262 |
| 663 | 3300005842 | Ga0068858_100054531 | Ga0068858_1000545314 | 262 |
| 664 | 3300005842 | Ga0068858_100144291 | Ga0068858_1001442912 | 262 |
| 665 | 3300005842 | Ga0068858_100207244 | Ga0068858_1002072443 | 262 |
| 666 | 3300005842 | Ga0068858_100211598 | Ga0068858_1002115982 | 262 |
| 667 | 3300005843 | Ga0068860_100013607 | Ga0068860_1000136073 | 262 |
| 668 | 3300005843 | Ga0068860_100019078 | Ga0068860_1000190786 | 262 |
| 669 | 3300005843 | Ga0068860_100037773 | Ga0068860_1000377735 | 262 |
| 670 | 3300005843 | Ga0068860_100056604 | Ga0068860_1000566045 | 262 |
| 671 | 3300005843 | Ga0068860_100255261 | Ga0068860_1002552612 | 262 |
| 672 | 3300005843 | Ga0068860_100391047 | Ga0068860_1003910472 | 262 |
| 673 | 3300005844 | Ga0068862_100063344 | Ga0068862_1000633442 | 262 |
| 674 | 3300006175 | Ga0070712_100044645 | Ga0070712_1000446453 | 262 |
| 675 | 3300006237 | Ga0097621_100003701 | Ga0097621_1000037016 | 262 |
| 676 | 3300006237 | Ga0097621_100008390 | Ga0097621_1000083906 | 262 |
| 677 | 3300006237 | Ga0097621_100026548 | Ga0097621_1000265482 | 262 |
| 678 | 3300006237 | Ga0097621_100054192 | Ga0097621_1000541923 | 262 |
| 679 | 3300006237 | Ga0097621_100104271 | Ga0097621_1001042713 | 262 |
| 680 | 3300006237 | Ga0097621_100127721 | Ga0097621_1001277212 | 262 |
| 681 | 3300006237 | Ga0097621_100313231 | Ga0097621_1003132312 | 262 |
| 682 | 3300006237 | Ga0097621_100403263 | Ga0097621_1004032632 | 262 |
| 683 | 3300006358 | Ga0068871_100124841 | Ga0068871_1001248412 | 262 |
| 684 | 3300006358 | Ga0068871_100254953 | Ga0068871_1002549532 | 262 |
| 685 | 3300006358 | Ga0068871_100354285 | Ga0068871_1003542852 | 262 |
| 686 | 3300006844 | Ga0075428_100117321 | Ga0075428_1001173212 | 262 |
| 687 | 3300006852 | Ga0075433_10014465 | Ga0075433_100144655 | 262 |
| 688 | 3300006871 | Ga0075434_100010242 | Ga0075434_10001024211 | 262 |
| 689 | 3300006871 | Ga0075434_100119033 | Ga0075434_1001190333 | 262 |
| 690 | 3300006871 | Ga0075434_100152502 | Ga0075434_1001525021 | 262 |
| 691 | 3300006881 | Ga0068865_100036414 | Ga0068865_1000364142 | 262 |
| 692 | 3300006881 | Ga0068865_100133683 | Ga0068865_1001336832 | 262 |
| 693 | 3300006881 | Ga0068865_100353811 | Ga0068865_1003538112 | 262 |
| 694 | 3300006914 | Ga0075436_100175164 | Ga0075436_1001751642 | 262 |
| 695 | 3300006931 | Ga0097620_100032436 | Ga0097620_1000324362 | 262 |
| 696 | 3300006931 | Ga0097620_100090057 | Ga0097620_1000900572 | 262 |
| 697 | 3300006931 | Ga0097620_100592423 | Ga0097620_1005924232 | 262 |
| 698 | 3300007076 | Ga0075435_100000996 | Ga0075435_10000099610 | 262 |
| 699 | 3300007076 | Ga0075435_100206571 | Ga0075435_1002065712 | 262 |
| 700 | 3300009093 | Ga0105240_10052230 | Ga0105240_100522306 | 262 |
| 701 | 3300009094 | Ga0111539_10142481 | Ga0111539_101424811 | 262 |
| 702 | 3300009098 | Ga0105245_10358242 | Ga0105245_103582421 | 262 |
| 703 | 3300009098 | Ga0105245_10368171 | Ga0105245_103681712 | 262 |
| 704 | 3300009148 | Ga0105243_10236361 | Ga0105243_102363611 | 262 |
| 705 | 3300009174 | Ga0105241_10004906 | Ga0105241_100049068 | 262 |
| 706 | 3300009174 | Ga0105241_10138001 | Ga0105241_101380012 | 262 |
| 707 | 3300009174 | Ga0105241_10372640 | Ga0105241_103726402 | 262 |
| 708 | 3300009176 | Ga0105242_10034566 | Ga0105242_100345664 | 262 |
| 709 | 3300009176 | Ga0105242_10072045 | Ga0105242_100720453 | 262 |
| 710 | 3300009176 | Ga0105242_10819496 | Ga0105242_108194961 | 262 |
| 711 | 3300009177 | Ga0105248_10013498 | Ga0105248_100134988 | 262 |
| 712 | 3300009177 | Ga0105248_10025672 | Ga0105248_100256726 | 262 |
| 713 | 3300009177 | Ga0105248_10048753 | Ga0105248_100487533 | 262 |
| 714 | 3300009177 | Ga0105248_10202940 | Ga0105248_102029403 | 262 |
| 715 | 3300009177 | Ga0105248_10395398 | Ga0105248_103953982 | 262 |
| 716 | 3300009545 | Ga0105237_10131252 | Ga0105237_101312522 | 262 |
| 717 | 3300009545 | Ga0105237_10293452 | Ga0105237_102934523 | 262 |
| 718 | 3300009551 | Ga0105238_10062479 | Ga0105238_100624792 | 262 |
| 719 | 3300009553 | Ga0105249_10004775 | Ga0105249_100047759 | 262 |
| 720 | 3300009553 | Ga0105249_10124073 | Ga0105249_101240733 | 262 |
| 721 | 3300010375 | Ga0105239_10733907 | Ga0105239_107339072 | 262 |
| 722 | 3300013100 | Ga0157373_10002005 | Ga0157373_100020057 | 262 |
| 723 | 3300013100 | Ga0157373_10049919 | Ga0157373_100499193 | 262 |
| 724 | 3300013102 | Ga0157371_10045890 | Ga0157371_100458902 | 262 |
| 725 | 3300013102 | Ga0157371_10123177 | Ga0157371_101231772 | 262 |
| 726 | 3300013102 | Ga0157371_10291975 | Ga0157371_102919751 | 262 |
| 727 | 3300013104 | Ga0157370_10011607 | Ga0157370_100116074 | 262 |
| 728 | 3300013104 | Ga0157370_10036807 | Ga0157370_100368073 | 262 |
| 729 | 3300013104 | Ga0157370_10048439 | Ga0157370_100484391 | 262 |
| 730 | 3300013104 | Ga0157370_10107088 | Ga0157370_101070882 | 262 |
| 731 | 3300013104 | Ga0157370_10330831 | Ga0157370_103308312 | 262 |
| 732 | 3300013105 | Ga0157369_10004565 | Ga0157369_1000456512 | 262 |
| 733 | 3300013105 | Ga0157369_10127131 | Ga0157369_101271312 | 262 |
| 734 | 3300013296 | Ga0157374_10010560 | Ga0157374_100105609 | 262 |
| 735 | 3300013296 | Ga0157374_10456941 | Ga0157374_104569412 | 262 |
| 736 | 3300013297 | Ga0157378_10009398 | Ga0157378_100093982 | 262 |
| 737 | 3300013297 | Ga0157378_10936551 | Ga0157378_109365511 | 262 |
| 738 | 3300013306 | Ga0163162_10013531 | Ga0163162_100135318 | 262 |
| 739 | 3300013306 | Ga0163162_10086076 | Ga0163162_100860762 | 262 |
| 740 | 3300013306 | Ga0163162_10216232 | Ga0163162_102162322 | 262 |
| 741 | 3300013307 | Ga0157372_10037205 | Ga0157372_100372052 | 262 |
| 742 | 3300013307 | Ga0157372_10214336 | Ga0157372_102143363 | 262 |
| 743 | 3300013307 | Ga0157372_10254938 | Ga0157372_102549383 | 262 |
| 744 | 3300013308 | Ga0157375_10119523 | Ga0157375_101195233 | 262 |
| 745 | 3300013308 | Ga0157375_10146613 | Ga0157375_101466132 | 262 |
| 746 | 3300013308 | Ga0157375_10738056 | Ga0157375_107380562 | 262 |
| 747 | 3300013308 | Ga0157375_10850331 | Ga0157375_108503312 | 262 |
| 748 | 3300013308 | Ga0157375_11064402 | Ga0157375_110644021 | 262 |
| 749 | 3300014325 | Ga0163163_10003372 | Ga0163163_100033729 | 262 |
| 750 | 3300014325 | Ga0163163_10089598 | Ga0163163_100895982 | 262 |
| 751 | 3300014325 | Ga0163163_10116793 | Ga0163163_101167932 | 262 |
| 752 | 3300014326 | Ga0157380_10022406 | Ga0157380_100224063 | 262 |
| 753 | 3300014326 | Ga0157380_10054788 | Ga0157380_100547882 | 262 |
| 754 | 3300014326 | Ga0157380_10279086 | Ga0157380_102790862 | 262 |
| 755 | 3300014497 | Ga0182008_10071251 | Ga0182008_100712512 | 262 |
| 756 | 3300014968 | Ga0157379_10022156 | Ga0157379_100221566 | 262 |
| 757 | 3300014968 | Ga0157379_10466201 | Ga0157379_104662012 | 262 |
| 758 | 3300014968 | Ga0157379_10525751 | Ga0157379_105257512 | 262 |
| 759 | 3300014969 | Ga0157376_10035683 | Ga0157376_100356834 | 262 |
| 760 | 3300014969 | Ga0157376_10065570 | Ga0157376_100655703 | 262 |
| 761 | 3300014969 | Ga0157376_10118977 | Ga0157376_101189772 | 262 |
| 762 | 3300014969 | Ga0157376_10395243 | Ga0157376_103952432 | 262 |
| 763 | 3300017792 | Ga0163161_10009380 | Ga0163161_100093805 | 262 |
| 764 | 3300017792 | Ga0163161_10019666 | Ga0163161_100196663 | 262 |
| 765 | 3300017792 | Ga0163161_10021646 | Ga0163161_100216464 | 262 |
| 766 | 3300017792 | Ga0163161_10090394 | Ga0163161_100903943 | 262 |
| 767 | 3300025290 | Ga0207673_1000490 | Ga0207673_10004904 | 262 |
| 768 | 3300025315 | Ga0207697_10000152 | Ga0207697_1000015231 | 262 |
| 769 | 3300025321 | Ga0207656_10011875 | Ga0207656_100118753 | 262 |
| 770 | 3300025321 | Ga0207656_10018233 | Ga0207656_100182332 | 262 |
| 771 | 3300025893 | Ga0207682_10000198 | Ga0207682_1000019824 | 262 |
| 772 | 3300025893 | Ga0207682_10000277 | Ga0207682_100002775 | 262 |
| 773 | 3300025893 | Ga0207682_10010491 | Ga0207682_100104913 | 262 |
| 774 | 3300025893 | Ga0207682_10087131 | Ga0207682_100871312 | 262 |
| 775 | 3300025901 | Ga0207688_10049854 | Ga0207688_100498542 | 262 |
| 776 | 3300025903 | Ga0207680_10004517 | Ga0207680_100045175 | 262 |
| 777 | 3300025903 | Ga0207680_10115652 | Ga0207680_101156522 | 262 |
| 778 | 3300025903 | Ga0207680_10298566 | Ga0207680_102985662 | 262 |
| 779 | 3300025907 | Ga0207645_10000676 | Ga0207645_1000067624 | 262 |
| 780 | 3300025907 | Ga0207645_10002695 | Ga0207645_1000269511 | 262 |
| 781 | 3300025907 | Ga0207645_10009493 | Ga0207645_100094932 | 262 |
| 782 | 3300025907 | Ga0207645_10063263 | Ga0207645_100632632 | 262 |
| 783 | 3300025907 | Ga0207645_10094687 | Ga0207645_100946872 | 262 |
| 784 | 3300025908 | Ga0207643_10000311 | Ga0207643_1000031120 | 262 |
| 785 | 3300025908 | Ga0207643_10019620 | Ga0207643_100196202 | 262 |
| 786 | 3300025908 | Ga0207643_10043085 | Ga0207643_100430852 | 262 |
| 787 | 3300025910 | Ga0207684_10128792 | Ga0207684_101287924 | 262 |
| 788 | 3300025912 | Ga0207707_10002449 | Ga0207707_100024497 | 262 |
| 789 | 3300025912 | Ga0207707_10314313 | Ga0207707_103143131 | 262 |
| 790 | 3300025913 | Ga0207695_10014284 | Ga0207695_100142846 | 262 |
| 791 | 3300025914 | Ga0207671_10095653 | Ga0207671_100956533 | 262 |
| 792 | 3300025915 | Ga0207693_10126993 | Ga0207693_101269933 | 262 |
| 793 | 3300025916 | Ga0207663_10134118 | Ga0207663_101341183 | 262 |
| 794 | 3300025916 | Ga0207663_10240988 | Ga0207663_102409883 | 262 |
| 795 | 3300025917 | Ga0207660_10182054 | Ga0207660_101820542 | 262 |
| 796 | 3300025917 | Ga0207660_10435334 | Ga0207660_104353342 | 262 |
| 797 | 3300025918 | Ga0207662_10016821 | Ga0207662_100168216 | 262 |
| 798 | 3300025919 | Ga0207657_10000045 | Ga0207657_1000004549 | 262 |
| 799 | 3300025920 | Ga0207649_10009634 | Ga0207649_100096347 | 262 |
| 800 | 3300025921 | Ga0207652_10005836 | Ga0207652_100058363 | 262 |
| 801 | 3300025921 | Ga0207652_10015307 | Ga0207652_100153072 | 262 |
| 802 | 3300025921 | Ga0207652_10042383 | Ga0207652_100423835 | 262 |
| 803 | 3300025921 | Ga0207652_10094074 | Ga0207652_100940741 | 262 |
| 804 | 3300025922 | Ga0207646_10006400 | Ga0207646_100064008 | 262 |
| 805 | 3300025923 | Ga0207681_10005688 | Ga0207681_100056882 | 262 |
| 806 | 3300025923 | Ga0207681_10110212 | Ga0207681_101102123 | 262 |
| 807 | 3300025923 | Ga0207681_10222013 | Ga0207681_102220132 | 262 |
| 808 | 3300025923 | Ga0207681_10511610 | Ga0207681_105116101 | 262 |
| 809 | 3300025925 | Ga0207650_10003084 | Ga0207650_100030847 | 262 |
| 810 | 3300025925 | Ga0207650_10004678 | Ga0207650_100046786 | 262 |
| 811 | 3300025925 | Ga0207650_10007756 | Ga0207650_100077566 | 262 |
| 812 | 3300025925 | Ga0207650_10012522 | Ga0207650_100125225 | 262 |
| 813 | 3300025925 | Ga0207650_10019765 | Ga0207650_100197654 | 262 |
| 814 | 3300025925 | Ga0207650_10036416 | Ga0207650_100364164 | 262 |
| 815 | 3300025925 | Ga0207650_10057952 | Ga0207650_100579524 | 262 |
| 816 | 3300025925 | Ga0207650_10094404 | Ga0207650_100944042 | 262 |
| 817 | 3300025926 | Ga0207659_10005942 | Ga0207659_100059422 | 262 |
| 818 | 3300025926 | Ga0207659_10024036 | Ga0207659_100240362 | 262 |
| 819 | 3300025926 | Ga0207659_10092013 | Ga0207659_100920132 | 262 |
| 820 | 3300025926 | Ga0207659_10255625 | Ga0207659_102556252 | 262 |
| 821 | 3300025928 | Ga0207700_10000084 | Ga0207700_100000844 | 262 |
| 822 | 3300025929 | Ga0207664_10001330 | Ga0207664_100013309 | 262 |
| 823 | 3300025931 | Ga0207644_10010936 | Ga0207644_100109366 | 262 |
| 824 | 3300025932 | Ga0207690_10030150 | Ga0207690_100301502 | 262 |
| 825 | 3300025932 | Ga0207690_10591812 | Ga0207690_105918121 | 262 |
| 826 | 3300025933 | Ga0207706_10004135 | Ga0207706_100041356 | 262 |
| 827 | 3300025933 | Ga0207706_10007454 | Ga0207706_100074546 | 262 |
| 828 | 3300025933 | Ga0207706_10358564 | Ga0207706_103585642 | 262 |
| 829 | 3300025935 | Ga0207709_10017317 | Ga0207709_100173174 | 262 |
| 830 | 3300025936 | Ga0207670_10089839 | Ga0207670_100898392 | 262 |
| 831 | 3300025937 | Ga0207669_10018360 | Ga0207669_100183602 | 262 |
| 832 | 3300025937 | Ga0207669_10023528 | Ga0207669_100235283 | 262 |
| 833 | 3300025937 | Ga0207669_10028655 | Ga0207669_100286552 | 262 |
| 834 | 3300025937 | Ga0207669_10043965 | Ga0207669_100439652 | 262 |
| 835 | 3300025938 | Ga0207704_10128961 | Ga0207704_101289612 | 262 |
| 836 | 3300025939 | Ga0207665_10050727 | Ga0207665_100507273 | 262 |
| 837 | 3300025940 | Ga0207691_10000243 | Ga0207691_1000024324 | 262 |
| 838 | 3300025940 | Ga0207691_10000999 | Ga0207691_100009994 | 262 |
| 839 | 3300025940 | Ga0207691_10004761 | Ga0207691_100047619 | 262 |
| 840 | 3300025940 | Ga0207691_10008651 | Ga0207691_100086519 | 262 |
| 841 | 3300025940 | Ga0207691_10036107 | Ga0207691_100361075 | 262 |
| 842 | 3300025940 | Ga0207691_10082927 | Ga0207691_100829272 | 262 |
| 843 | 3300025940 | Ga0207691_10202759 | Ga0207691_102027592 | 262 |
| 844 | 3300025941 | Ga0207711_10015861 | Ga0207711_100158612 | 262 |
| 845 | 3300025941 | Ga0207711_10162506 | Ga0207711_101625062 | 262 |
| 846 | 3300025941 | Ga0207711_10231454 | Ga0207711_102314542 | 262 |
| 847 | 3300025941 | Ga0207711_10364257 | Ga0207711_103642572 | 262 |
| 848 | 3300025942 | Ga0207689_10002822 | Ga0207689_100028229 | 262 |
| 849 | 3300025942 | Ga0207689_10011021 | Ga0207689_100110216 | 262 |
| 850 | 3300025942 | Ga0207689_10104281 | Ga0207689_101042812 | 262 |
| 851 | 3300025942 | Ga0207689_10287106 | Ga0207689_102871062 | 262 |
| 852 | 3300025945 | Ga0207679_10007025 | Ga0207679_100070256 | 262 |
| 853 | 3300025945 | Ga0207679_10019385 | Ga0207679_100193853 | 262 |
| 854 | 3300025945 | Ga0207679_10058944 | Ga0207679_100589443 | 262 |
| 855 | 3300025945 | Ga0207679_10146953 | Ga0207679_101469532 | 262 |
| 856 | 3300025949 | Ga0207667_10001516 | Ga0207667_1000151625 | 262 |
| 857 | 3300025949 | Ga0207667_10702577 | Ga0207667_107025772 | 262 |
| 858 | 3300025960 | Ga0207651_10014470 | Ga0207651_100144704 | 262 |
| 859 | 3300025960 | Ga0207651_10050332 | Ga0207651_100503321 | 262 |
| 860 | 3300025960 | Ga0207651_10095405 | Ga0207651_100954052 | 262 |
| 861 | 3300025960 | Ga0207651_10099865 | Ga0207651_100998652 | 262 |
| 862 | 3300025961 | Ga0207712_10264735 | Ga0207712_102647352 | 262 |
| 863 | 3300025972 | Ga0207668_10005128 | Ga0207668_100051282 | 262 |
| 864 | 3300025972 | Ga0207668_10028489 | Ga0207668_100284895 | 262 |
| 865 | 3300025972 | Ga0207668_10040243 | Ga0207668_100402433 | 262 |
| 866 | 3300025972 | Ga0207668_10123010 | Ga0207668_101230102 | 262 |
| 867 | 3300025972 | Ga0207668_10177701 | Ga0207668_101777012 | 262 |
| 868 | 3300025981 | Ga0207640_10035273 | Ga0207640_100352735 | 262 |
| 869 | 3300025986 | Ga0207658_10031204 | Ga0207658_100312042 | 262 |
| 870 | 3300025986 | Ga0207658_10044942 | Ga0207658_100449425 | 262 |
| 871 | 3300025986 | Ga0207658_10088286 | Ga0207658_100882862 | 262 |
| 872 | 3300025986 | Ga0207658_10111361 | Ga0207658_101113613 | 262 |
| 873 | 3300025986 | Ga0207658_10129024 | Ga0207658_101290242 | 262 |
| 874 | 3300025986 | Ga0207658_10229652 | Ga0207658_102296522 | 262 |
| 875 | 3300026023 | Ga0207677_10340878 | Ga0207677_103408782 | 262 |
| 876 | 3300026023 | Ga0207677_10401211 | Ga0207677_104012112 | 262 |
| 877 | 3300026035 | Ga0207703_10114228 | Ga0207703_101142282 | 262 |
| 878 | 3300026035 | Ga0207703_10146979 | Ga0207703_101469792 | 262 |
| 879 | 3300026035 | Ga0207703_10357076 | Ga0207703_103570762 | 262 |
| 880 | 3300026035 | Ga0207703_10382253 | Ga0207703_103822532 | 262 |
| 881 | 3300026041 | Ga0207639_10006616 | Ga0207639_100066166 | 262 |
| 882 | 3300026041 | Ga0207639_10078990 | Ga0207639_100789902 | 262 |
| 883 | 3300026041 | Ga0207639_10088963 | Ga0207639_100889633 | 262 |
| 884 | 3300026067 | Ga0207678_10002320 | Ga0207678_100023202 | 262 |
| 885 | 3300026067 | Ga0207678_10003040 | Ga0207678_100030404 | 262 |
| 886 | 3300026067 | Ga0207678_10010401 | Ga0207678_100104016 | 262 |
| 887 | 3300026075 | Ga0207708_10000789 | Ga0207708_100007896 | 262 |
| 888 | 3300026075 | Ga0207708_10013596 | Ga0207708_100135966 | 262 |
| 889 | 3300026075 | Ga0207708_10216442 | Ga0207708_102164422 | 262 |
| 890 | 3300026078 | Ga0207702_10054685 | Ga0207702_100546854 | 262 |
| 891 | 3300026078 | Ga0207702_10077073 | Ga0207702_100770732 | 262 |
| 892 | 3300026078 | Ga0207702_10162999 | Ga0207702_101629992 | 262 |
| 893 | 3300026078 | Ga0207702_10191476 | Ga0207702_101914763 | 262 |
| 894 | 3300026078 | Ga0207702_10260659 | Ga0207702_102606591 | 262 |
| 895 | 3300026088 | Ga0207641_10055724 | Ga0207641_100557244 | 262 |
| 896 | 3300026088 | Ga0207641_10064921 | Ga0207641_100649214 | 262 |
| 897 | 3300026088 | Ga0207641_10146479 | Ga0207641_101464792 | 262 |
| 898 | 3300026088 | Ga0207641_10148418 | Ga0207641_101484183 | 262 |
| 899 | 3300026088 | Ga0207641_10266722 | Ga0207641_102667222 | 262 |
| 900 | 3300026089 | Ga0207648_10004321 | Ga0207648_100043218 | 262 |
| 901 | 3300026089 | Ga0207648_10028539 | Ga0207648_100285396 | 262 |
| 902 | 3300026089 | Ga0207648_10037581 | Ga0207648_100375813 | 262 |
| 903 | 3300026089 | Ga0207648_10102339 | Ga0207648_101023392 | 262 |
| 904 | 3300026089 | Ga0207648_10236451 | Ga0207648_102364512 | 262 |
| 905 | 3300026089 | Ga0207648_10260239 | Ga0207648_102602392 | 262 |
| 906 | 3300026089 | Ga0207648_10786708 | Ga0207648_107867081 | 262 |
| 907 | 3300026095 | Ga0207676_10016929 | Ga0207676_100169296 | 262 |
| 908 | 3300026095 | Ga0207676_10040004 | Ga0207676_100400045 | 262 |
| 909 | 3300026095 | Ga0207676_10076314 | Ga0207676_100763142 | 262 |
| 910 | 3300026095 | Ga0207676_10098876 | Ga0207676_100988762 | 262 |
| 911 | 3300026095 | Ga0207676_10169818 | Ga0207676_101698182 | 262 |
| 912 | 3300026095 | Ga0207676_10366551 | Ga0207676_103665512 | 262 |
| 913 | 3300026095 | Ga0207676_10583057 | Ga0207676_105830572 | 262 |
| 914 | 3300026095 | Ga0207676_10592949 | Ga0207676_105929492 | 262 |
| 915 | 3300026116 | Ga0207674_10000052 | Ga0207674_1000005269 | 262 |
| 916 | 3300026116 | Ga0207674_10024058 | Ga0207674_100240586 | 262 |
| 917 | 3300026116 | Ga0207674_10833134 | Ga0207674_108331341 | 262 |
| 918 | 3300026118 | Ga0207675_100023263 | Ga0207675_1000232632 | 262 |
| 919 | 3300026118 | Ga0207675_100025891 | Ga0207675_1000258916 | 262 |
| 920 | 3300026118 | Ga0207675_100069867 | Ga0207675_1000698673 | 262 |
| 921 | 3300026118 | Ga0207675_100089474 | Ga0207675_1000894742 | 262 |
| 922 | 3300026118 | Ga0207675_100176921 | Ga0207675_1001769212 | 262 |
| 923 | 3300026121 | Ga0207683_10000308 | Ga0207683_1000030824 | 262 |
| 924 | 3300026121 | Ga0207683_10014491 | Ga0207683_100144915 | 262 |
| 925 | 3300026121 | Ga0207683_10017509 | Ga0207683_100175093 | 262 |
| 926 | 3300026121 | Ga0207683_10052382 | Ga0207683_100523822 | 262 |
| 927 | 3300026121 | Ga0207683_10065953 | Ga0207683_100659533 | 262 |
| 928 | 3300026121 | Ga0207683_10118857 | Ga0207683_101188572 | 262 |
| 929 | 3300026121 | Ga0207683_10281467 | Ga0207683_102814672 | 262 |
| 930 | 3300026142 | Ga0207698_10012326 | Ga0207698_100123263 | 262 |
| 931 | 3300026142 | Ga0207698_10119642 | Ga0207698_101196423 | 262 |
| 932 | 3300026142 | Ga0207698_10230311 | Ga0207698_102303113 | 262 |
| 933 | 3300026142 | Ga0207698_10254739 | Ga0207698_102547391 | 262 |
| 934 | 3300026142 | Ga0207698_10542072 | Ga0207698_105420722 | 262 |
| 935 | 3300028379 | Ga0268266_10082586 | Ga0268266_100825862 | 262 |
| 936 | 3300028379 | Ga0268266_10095303 | Ga0268266_100953033 | 262 |
| 937 | 3300028379 | Ga0268266_10120278 | Ga0268266_101202782 | 262 |
| 938 | 3300028379 | Ga0268266_10180135 | Ga0268266_101801352 | 262 |
| 939 | 3300028379 | Ga0268266_10189694 | Ga0268266_101896942 | 262 |
| 940 | 3300028380 | Ga0268265_10088938 | Ga0268265_100889382 | 262 |
| 941 | 3300028380 | Ga0268265_10187464 | Ga0268265_101874642 | 262 |
| 942 | 3300028381 | Ga0268264_10011874 | Ga0268264_100118743 | 262 |
| 943 | 3300028381 | Ga0268264_10016863 | Ga0268264_100168635 | 262 |
| 944 | 3300028381 | Ga0268264_10110484 | Ga0268264_101104843 | 262 |
| 945 | 3300028381 | Ga0268264_10367583 | Ga0268264_103675832 | 262 |
| 946 | 3300028381 | Ga0268264_10612146 | Ga0268264_106121461 | 262 |
| 947 | 3300031235 | Ga0265330_10001397 | Ga0265330_100013976 | 262 |
| 948 | 3300031238 | Ga0265332_10002014 | Ga0265332_100020148 | 262 |
| 949 | 3300031239 | Ga0265328_10004196 | Ga0265328_100041966 | 262 |
| 950 | 3300031241 | Ga0265325_10007694 | Ga0265325_100076946 | 262 |
| 951 | 3300031242 | Ga0265329_10001268 | Ga0265329_100012685 | 262 |
| 952 | 3300031249 | Ga0265339_10010535 | Ga0265339_100105355 | 262 |
| 953 | 3300031250 | Ga0265331_10000571 | Ga0265331_1000057129 | 262 |
| 954 | 3300031251 | Ga0265327_10012687 | Ga0265327_100126874 | 262 |
| 955 | 3300031548 | Ga0307408_100013018 | Ga0307408_1000130182 | 262 |
| 956 | 3300031712 | Ga0265342_10009557 | Ga0265342_100095576 | 262 |
| 957 | 3300031824 | Ga0307413_10118932 | Ga0307413_101189322 | 262 |
| 958 | 3300031901 | Ga0307406_10127824 | Ga0307406_101278242 | 262 |
| 959 | 3300031911 | Ga0307412_10012352 | Ga0307412_100123522 | 262 |
| 960 | 3300031995 | Ga0307409_100010606 | Ga0307409_1000106063 | 262 |
| 961 | 3300032002 | Ga0307416_100011079 | Ga0307416_1000110792 | 262 |
| 962 | 3300032004 | Ga0307414_10022232 | Ga0307414_100222324 | 262 |
| 963 | 3300032005 | Ga0307411_10010633 | Ga0307411_100106335 | 262 |
| 964 | 3300032126 | Ga0307415_100002355 | Ga0307415_1000023555 | 262 |
| 965 | 3300035086 | Ga0373934_0066283 | Ga0373934_0066283_389_1177 | 262 |
| 966 | 3300035119 | Ga0373956_0018822 | Ga0373956_0018822_1192_1980 | 262 |
| 967 | 3300035170 | Ga0373943_0021205 | Ga0373943_0021205_608_1396 | 262 |
| 968 | 3300035171 | Ga0373946_0057991 | Ga0373946_0057991_326_1114 | 262 |
| 969 | 3300035172 | Ga0373955_0043583 | Ga0373955_0043583_1106_1894 | 262 |
| 970 | 3300035691 | Ga0373931_0379053 | Ga0373931_0379053_31_819 | 262 |
| 971 | 3300035692 | Ga0373935_0010797 | Ga0373935_0010797_3843_4631 | 262 |
| 972 | 3300035724 | Ga0373933_0026233 | Ga0373933_0026233_1004_1792 | 262 |
| 973 | 3300035725 | Ga0373947_0089921 | Ga0373947_0089921_200_988 | 262 |
| 974 | 3300036401 | Ga0373937_0085960 | Ga0373937_0085960_907_1695 | 262 |
| 975 | 3300036401 | Ga0373937_0138616 | Ga0373937_0138616_442_1230 | 262 |
| 976 | 3300036401 | Ga0373937_0299680 | Ga0373937_0299680_16_807 | 262 |
| 977 | 3300036401 | Ga0373937_0457156 | Ga0373937_0457156_49_837 | 262 |
| 978 | 3300037068 | Ga0373925_0071771 | Ga0373925_0071771_1770_2558 | 262 |
| 979 | 3300037068 | Ga0373925_0314604 | Ga0373925_0314604_59_847 | 262 |
| 980 | 3300037418 | Ga0395900_0269502 | Ga0395900_0269502_193_981 | 262 |
| 981 | 3300037471 | Ga0395905_0047248 | Ga0395905_0047248_1087_1875 | 262 |
| 982 | 3300038443 | Ga0395901_0901079 | Ga0395901_0901079_44_832 | 262 |
| 983 | 3300039437 | Ga0436365_0614334 | Ga0436365_0614334_1701_2510 | 262 |
| 984 | 3300042436 | Ga0439435_0014960 | Ga0439435_0014960_389_1192 | 262 |
| 985 | 3300042876 | Ga0451577_0244960 | Ga0451577_0244960_44_844 | 262 |
| 986 | 3300045051 | Ga0451576_0162159 | Ga0451576_0162159_1336_2136 | 262 |
| 987 | 3300045051 | Ga0451576_0485017 | Ga0451576_0485017_134_922 | 262 |
| 988 | 3300046455 | Ga0495603_0023863 | Ga0495603_0023863_951_1739 | 262 |
| 989 | 3300046459 | Ga0495629_0074680 | Ga0495629_0074680_824_1612 | 262 |
| 990 | 3300046459 | Ga0495629_0188846 | Ga0495629_0188846_271_1059 | 262 |
| 991 | 3300046472 | Ga0495580_0071206 | Ga0495580_0071206_1161_1949 | 262 |
| 992 | 3300046476 | Ga0495662_0011906 | Ga0495662_0011906_1767_2555 | 262 |
| 993 | 3300046517 | Ga0495630_0404662 | Ga0495630_0404662_143_931 | 262 |
| 994 | 3300046531 | Ga0495665_0014048 | Ga0495665_0014048_2459_3247 | 262 |
| 995 | 3300046533 | Ga0495640_0313258 | Ga0495640_0313258_139_927 | 262 |
| 996 | 3300046543 | Ga0495645_0174887 | Ga0495645_0174887_177_968 | 262 |
| 997 | 3300046559 | Ga0495667_0021442 | Ga0495667_0021442_3192_3980 | 262 |
| 998 | 3300046642 | Ga0495634_0077998 | Ga0495634_0077998_495_1283 | 262 |
| 999 | 3300046663 | Ga0495635_0076517 | Ga0495635_0076517_279_1067 | 262 |
| 1000 | 3300046674 | Ga0495588_0038495 | Ga0495588_0038495_1003_1791 | 262 |
| 1001 | 3300046681 | Ga0495647_0003600 | Ga0495647_0003600_1061_1849 | 262 |
| 1002 | 3300046683 | Ga0495658_0052988 | Ga0495658_0052988_521_1309 | 262 |
| 1003 | 3300046809 | Ga0495600_0039369 | Ga0495600_0039369_1226_2014 | 262 |
| 1004 | 3300047315 | Ga0495581_0000428 | Ga0495581_0000428_17522_18310 | 262 |
| 1005 | 3300047322 | Ga0495680_0024970 | Ga0495680_0024970_1263_2051 | 262 |
| 1006 | 3300047471 | Ga0495684_0077021 | Ga0495684_0077021_1226_2014 | 262 |
| 1007 | 3300048089 | Ga0495614_0011142 | Ga0495614_0011142_1941_2729 | 262 |
| 1008 | 3300048903 | Ga0496100_0305132 | Ga0496100_0305132_203_991 | 262 |
| 1009 | 3300048904 | Ga0496101_0131533 | Ga0496101_0131533_314_1102 | 262 |
| 1010 | 3300048907 | Ga0496104_0273506 | Ga0496104_0273506_741_1529 | 262 |
| 1011 | 3300048908 | Ga0496105_0205335 | Ga0496105_0205335_353_1141 | 262 |
| 1012 | 3300048909 | Ga0496106_0379166 | Ga0496106_0379166_141_929 | 262 |
| 1013 | 3300048911 | Ga0496108_0007673 | Ga0496108_0007673_5565_6353 | 262 |
| 1014 | 3300048911 | Ga0496108_0258668 | Ga0496108_0258668_308_1096 | 262 |
| 1015 | 3300048912 | Ga0496109_0004576 | Ga0496109_0004576_10299_11087 | 262 |
| 1016 | 3300048913 | Ga0496110_0009595 | Ga0496110_0009595_4228_5016 | 262 |
| 1017 | 3300048913 | Ga0496110_0413349 | Ga0496110_0413349_427_1215 | 262 |
| 1018 | 3300048915 | Ga0496112_0070721 | Ga0496112_0070721_90_878 | 262 |
| 1019 | 3300049571 | Ga0501034_0053868 | Ga0501034_0053868_3001_3795 | 262 |
| 1020 | 3300049581 | Ga0501047_0141911 | Ga0501047_0141911_326_1120 | 262 |
| 1021 | 3300049584 | Ga0501068_0209068 | Ga0501068_0209068_122_916 | 262 |
| 1022 | 3300049585 | Ga0501069_0300568 | Ga0501069_0300568_21_809 | 262 |
| 1023 | 3300049589 | Ga0501073_0079883 | Ga0501073_0079883_140_934 | 262 |
| 1024 | 3300049590 | Ga0501074_0051011 | Ga0501074_0051011_268_1062 | 262 |
| 1025 | 3300049592 | Ga0501076_0061214 | Ga0501076_0061214_1868_2656 | 262 |
| 1026 | 3300049824 | Ga0501045_0085799 | Ga0501045_0085799_1339_2127 | 262 |
| 1027 | 3300050509 | nmdc:mga0qj67_236455_c1 | nmdc:mga0qj67_236455_c1_173_961 | 262 |
| 1028 | 3300050511 | nmdc:mga08y16_111854_c1 | nmdc:mga08y16_111854_c1_514_1302 | 262 |
| 1029 | 3300050512 | nmdc:mga0n895_153747_c1 | nmdc:mga0n895_153747_c1_1333_2124 | 262 |
| 1030 | 3300050512 | nmdc:mga0n895_240727_c1 | nmdc:mga0n895_240727_c1_911_1711 | 262 |
| 1031 | 3300050512 | nmdc:mga0n895_287847_c1 | nmdc:mga0n895_287847_c1_559_1347 | 262 |
| 1032 | 3300050512 | nmdc:mga0n895_83941_c1 | nmdc:mga0n895_83941_c1_290_1078 | 262 |
| 1033 | 3300050513 | nmdc:mga0rr50_439911_c1 | nmdc:mga0rr50_439911_c1_207_1007 | 262 |
| 1034 | 3300050513 | nmdc:mga0rr50_454081_c1 | nmdc:mga0rr50_454081_c1_41_829 | 262 |
| 1035 | 3300050514 | nmdc:mga08x19_103372_c1 | nmdc:mga08x19_103372_c1_198_986 | 262 |
| 1036 | 3300050514 | nmdc:mga08x19_107230_c1 | nmdc:mga08x19_107230_c1_560_1348 | 262 |
| 1037 | 3300050515 | nmdc:mga0a205_18359_c1 | nmdc:mga0a205_18359_c1_2012_2800 | 262 |
| 1038 | 3300050515 | nmdc:mga0a205_495975_c1 | nmdc:mga0a205_495975_c1_50_838 | 262 |
| 1039 | 3300053085 | Ga0495619_0019782 | Ga0495619_0019782_2587_3375 | 262 |
| 1040 | 3300053085 | Ga0495619_0189201 | Ga0495619_0189201_167_955 | 262 |
| 1041 | 3300060353 | Ga0501082_0173491 | Ga0501082_0173491_497_1285 | 262 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lkz-assembly1.cif.gz_A | structure of atp-bound human abca4 | 0.7556 | 66 | 257 |
| 8i3d-assembly1.cif.gz_B | cryo-em structure of abscisic acid transporter atabcg25 | 0.7248 | 14 | 258 |
| 7r88-assembly1.cif.gz_B | the structure of human abcg5-i529w/abcg8-wt | 0.7164 | 16 | 257 |
| 6hbu-assembly1.cif.gz_A | cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium | 0.7067 | 19 | 256 |
| 7p05-assembly1.cif.gz_A | cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation with adp/atp and rhodamine 6g | 0.6872 | 16 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.8228 | 59 | 255 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.8203 | 59 | 255 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.82 | 59 | 252 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6335 | 59 | 255 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6331 | 59 | 255 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-V4Y4G7-F1-model_v4 | Transport permease protein | 0.9856 | 6 | 262 |
GO:0015772
GO:0043190 GO:0140359 |
| AF-A0A536VL93-F1-model_v4 | Transport permease protein | 0.982 | 6 | 262 |
GO:0015772
GO:0043190 GO:0140359 |
| AF-A0A2N9LEA2-F1-model_v4 | Transport permease protein | 0.9817 | 4 | 262 |
GO:0043190
GO:0140359 |
| AF-A0A2M7C2L9-F1-model_v4 | Transport permease protein | 0.9806 | 59 | 262 |
GO:0043190
GO:0140359 |
| AF-A0A1H7XBK7-F1-model_v4 | Transport permease protein | 0.9804 | 6 | 262 |
GO:0043190
GO:0140359 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar