F488849

General Info

Members Datasets Scaffolds Average Seq Length
1041 334 1041 259

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_582121_c1|nmdc:mga0n895_582121_c1_77_955
Length 284
Sequence LRSTRGSRVAPPRGATARVILDAAQPAEDPMISASLIRAPELSLRWIPVWRRNLLVWRKLAIASVLGNIADPLLYMLALGYGIGSFVPEVGGMKYIAFIGTGMVCQSAMFTSSFEAMYSAFSRMHVQRTWEAIINAPLSLDDVVLAEWIWAATKSVMSLVLGFGHSLLALWVLPLGFIVGLTFGAFGLVMNSLAPGYDFFTYFFTLVLTPMLLLSGVFFPVDQMPAALQGVAKTLPLSHAIDIARPLLLGRIPDDIPLHIAVLLAYAFAAYYIALVLTRRRLLK

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
107 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
108 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
195 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
198 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
199 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
200 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
203 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
206 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
216 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
219 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
220 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
221 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
224 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
227 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
229 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
230 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
231 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
232 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
240 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
241 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
242 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
249 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
250 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
257 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
258 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
261 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
266 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
270 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
275 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
280 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
305 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
306 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
307 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
308 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
311 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
312 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
313 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.1
Nodule 0
Rhizoplane 2.69
Rhizosphere 97.12
Stem 0
Stem Tuber 0
Unclassified 0.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1006625 3300001976 Bacteria 1515
2 JGI24742J22300_10017488 3300002244 Bacteria 1212
3 JGI24751J29686_10009515 3300002459 Bacteria 1999
4 Ga0065712_10026653 3300005290 Bacteria 1253
5 Ga0070658_10006851 3300005327 Bacteria 9212
6 Ga0070676_10000545 3300005328 Bacteria 18256
7 Ga0070676_10018052 3300005328 Bacteria 3906
8 Ga0070676_10340738 3300005328 Unclassified 1028
9 Ga0070683_100027006 3300005329 Bacteria 5175
10 Ga0070683_100102802 3300005329 Bacteria 2691
11 Ga0070690_100016791 3300005330 Bacteria 4394
12 Ga0070690_100135392 3300005330 Bacteria 1668
13 Ga0070690_100139830 3300005330 Bacteria 1642
14 Ga0070670_100009503 3300005331 Bacteria 8300
15 Ga0070670_100032729 3300005331 Bacteria 4479
16 Ga0070670_100036494 3300005331 Bacteria 4230
17 Ga0070670_100287364 3300005331 Bacteria 1436
18 Ga0070677_10000343 3300005333 Bacteria 16239
19 Ga0070677_10037091 3300005333 Bacteria 1899
20 Ga0070677_10097736 3300005333 Bacteria 1289
21 Ga0070677_10119846 3300005333 Bacteria 1187
22 Ga0068869_100002553 3300005334 Bacteria 10982
23 Ga0068869_100009240 3300005334 Bacteria 6390
24 Ga0068869_100043670 3300005334 Bacteria 3221
25 Ga0068869_100132350 3300005334 Bacteria 1918
26 Ga0068869_100229283 3300005334 Bacteria 1475
27 Ga0070666_10002371 3300005335 Bacteria 11382
28 Ga0070666_10007974 3300005335 Bacteria 6548
29 Ga0070666_10029575 3300005335 Bacteria 3602
30 Ga0070666_10042572 3300005335 Bacteria 3040
31 Ga0070666_10096294 3300005335 Bacteria 2037
32 Ga0070666_10181936 3300005335 Bacteria 1475
33 Ga0070666_10333214 3300005335 Bacteria 1084
34 Ga0070680_100049152 3300005336 Bacteria 3438
35 Ga0070680_100100690 3300005336 Bacteria 2398
36 Ga0070680_100253535 3300005336 Bacteria 1488
37 Ga0070682_100032822 3300005337 Bacteria 3151
38 Ga0068868_100029854 3300005338 Bacteria 4178
39 Ga0068868_100057869 3300005338 Bacteria 3063
40 Ga0068868_100232934 3300005338 Bacteria 1545
41 Ga0070660_100013019 3300005339 Bacteria 5952
42 Ga0070660_100028623 3300005339 Bacteria 4170
43 Ga0070660_100252435 3300005339 Bacteria 1439
44 Ga0070689_100031936 3300005340 Bacteria 4002
45 Ga0070689_100123480 3300005340 Bacteria 2070
46 Ga0070689_100396085 3300005340 Bacteria 1166
47 Ga0070689_100500294 3300005340 Bacteria 1041
48 Ga0070687_100274129 3300005343 Bacteria 1059
49 Ga0070687_100444479 3300005343 Bacteria 861
50 Ga0070661_100003520 3300005344 Bacteria 10792
51 Ga0070661_100011229 3300005344 Bacteria 6240
52 Ga0070661_100016045 3300005344 Bacteria 5287
53 Ga0070661_100016963 3300005344 Bacteria 5158
54 Ga0070661_100090424 3300005344 Bacteria 2267
55 Ga0070661_100103983 3300005344 Bacteria 2115
56 Ga0070692_10016897 3300005345 Bacteria 3477
57 Ga0070668_100000206 3300005347 Bacteria 38630
58 Ga0070668_100002549 3300005347 Bacteria 13404
59 Ga0070668_100006137 3300005347 Bacteria 8907
60 Ga0070668_100007175 3300005347 Bacteria 8262
61 Ga0070668_100062215 3300005347 Bacteria 2892
62 Ga0070668_100266306 3300005347 Bacteria 1427
63 Ga0070668_100322569 3300005347 Bacteria 1301
64 Ga0070668_100334024 3300005347 Bacteria 1279
65 Ga0070668_100340424 3300005347 Bacteria 1267
66 Ga0070669_100018043 3300005353 Bacteria 5040
67 Ga0070669_100031588 3300005353 Bacteria 3825
68 Ga0070669_100053736 3300005353 Bacteria 2949
69 Ga0070669_100141733 3300005353 Bacteria 1854
70 Ga0070669_100158042 3300005353 Bacteria 1759
71 Ga0070669_100162155 3300005353 Bacteria 1738
72 Ga0070669_100415760 3300005353 Bacteria 1103
73 Ga0070675_100001498 3300005354 Bacteria 17241
74 Ga0070675_100004730 3300005354 Bacteria 10391
75 Ga0070675_100004965 3300005354 Bacteria 10153
76 Ga0070675_100020158 3300005354 Bacteria 5321
77 Ga0070675_100210522 3300005354 Bacteria 1690
78 Ga0070675_100309694 3300005354 Bacteria 1393
79 Ga0070675_100751310 3300005354 Bacteria 890
80 Ga0070671_100002054 3300005355 Bacteria 15515
81 Ga0070671_100015348 3300005355 Bacteria 6186
82 Ga0070671_100052938 3300005355 Bacteria 3375
83 Ga0070671_100109036 3300005355 Bacteria 2325
84 Ga0070671_100133619 3300005355 Bacteria 2091
85 Ga0070671_100190605 3300005355 Bacteria 1738
86 Ga0070671_100263014 3300005355 Bacteria 1466
87 Ga0070671_100393186 3300005355 Bacteria 1186
88 Ga0070674_100017565 3300005356 Bacteria 4505
89 Ga0070674_100144914 3300005356 Bacteria 1786
90 Ga0070674_100167731 3300005356 Bacteria 1671
91 Ga0070674_100274136 3300005356 Bacteria 1334
92 Ga0070674_100326499 3300005356 Bacteria 1232
93 Ga0070673_100001140 3300005364 Bacteria 15254
94 Ga0070673_100001547 3300005364 Bacteria 13536
95 Ga0070673_100011534 3300005364 Bacteria 6036
96 Ga0070673_100014398 3300005364 Bacteria 5507
97 Ga0070673_100031620 3300005364 Bacteria 3975
98 Ga0070673_100140304 3300005364 Bacteria 2038
99 Ga0070688_100025653 3300005365 Bacteria 3492
100 Ga0070688_100049809 3300005365 Bacteria 2608
101 Ga0070688_100057364 3300005365 Bacteria 2447
102 Ga0070688_100299197 3300005365 Bacteria 1162
103 Ga0070659_100002218 3300005366 Bacteria 13805
104 Ga0070659_100024728 3300005366 Bacteria 4606
105 Ga0070659_100104784 3300005366 Bacteria 2279
106 Ga0070659_100456049 3300005366 Bacteria 1085
107 Ga0070667_100001933 3300005367 Bacteria 18388
108 Ga0070667_100002979 3300005367 Bacteria 14550
109 Ga0070667_100049464 3300005367 Bacteria 3541
110 Ga0070667_100068013 3300005367 Bacteria 3030
111 Ga0070667_100110048 3300005367 Bacteria 2388
112 Ga0070667_100180102 3300005367 Bacteria 1869
113 Ga0070667_100181683 3300005367 Bacteria 1860
114 Ga0070667_100363890 3300005367 Bacteria 1311
115 Ga0070703_10011705 3300005406 Bacteria 2482
116 Ga0070709_10005119 3300005434 Bacteria 7089
117 Ga0070709_10052832 3300005434 Bacteria 2556
118 Ga0070714_100127254 3300005435 Bacteria 2273
119 Ga0070713_100000031 3300005436 Bacteria 88727
120 Ga0070713_100001967 3300005436 Bacteria 13255
121 Ga0070713_100016486 3300005436 Bacteria 5556
122 Ga0070713_100167194 3300005436 Bacteria 1967
123 Ga0070713_100254758 3300005436 Bacteria 1602
124 Ga0070701_10005021 3300005438 Bacteria 5425
125 Ga0070701_10023917 3300005438 Bacteria 2949
126 Ga0070711_100027155 3300005439 Bacteria 3756
127 Ga0070711_100256135 3300005439 Bacteria 1375
128 Ga0070705_100085793 3300005440 Bacteria 1947
129 Ga0070705_100176305 3300005440 Bacteria 1444
130 Ga0070705_100360792 3300005440 Bacteria 1063
131 Ga0070700_100050457 3300005441 Bacteria 2586
132 Ga0070700_100144855 3300005441 Bacteria 1618
133 Ga0070694_100023264 3300005444 Bacteria 3982
134 Ga0070694_100097376 3300005444 Bacteria 2075
135 Ga0070708_100018090 3300005445 Bacteria 5895
136 Ga0070708_100034792 3300005445 Bacteria 4385
137 Ga0070708_100102774 3300005445 Bacteria 2619
138 Ga0070663_100001186 3300005455 Bacteria 14326
139 Ga0070663_100008129 3300005455 Bacteria 6436
140 Ga0070663_100040592 3300005455 Bacteria 3259
141 Ga0070663_100266308 3300005455 Bacteria 1361
142 Ga0070678_100000259 3300005456 Bacteria 24382
143 Ga0070678_100004102 3300005456 Bacteria 8204
144 Ga0070678_100223702 3300005456 Bacteria 1565
145 Ga0070678_100526582 3300005456 Bacteria 1046
146 Ga0070662_100000582 3300005457 Bacteria 22250
147 Ga0070662_100060315 3300005457 Bacteria 2766
148 Ga0070662_100264419 3300005457 Bacteria 1387
149 Ga0070681_10004606 3300005458 Bacteria 13167
150 Ga0070681_10020531 3300005458 Bacteria 6621
151 Ga0070681_10104122 3300005458 Bacteria 2781
152 Ga0070681_10160385 3300005458 Bacteria 2173
153 Ga0070681_10200210 3300005458 Bacteria 1915
154 Ga0068867_100001543 3300005459 Bacteria 15998
155 Ga0068867_100001753 3300005459 Bacteria 15109
156 Ga0068867_100002252 3300005459 Bacteria 13567
157 Ga0068867_100050245 3300005459 Bacteria 3072
158 Ga0068867_100052859 3300005459 Bacteria 2999
159 Ga0068867_100077168 3300005459 Bacteria 2503
160 Ga0068867_100107300 3300005459 Bacteria 2140
161 Ga0068867_100143122 3300005459 Bacteria 1871
162 Ga0068867_100161458 3300005459 Bacteria 1767
163 Ga0068867_100275790 3300005459 Bacteria 1377
164 Ga0070685_10001891 3300005466 Bacteria 10892
165 Ga0070685_10057686 3300005466 Bacteria 2261
166 Ga0070685_10113051 3300005466 Bacteria 1676
167 Ga0070685_10324771 3300005466 Bacteria 1044
168 Ga0070706_100040808 3300005467 Bacteria 4284
169 Ga0070706_100056378 3300005467 Bacteria 3626
170 Ga0070706_100293177 3300005467 Bacteria 1518
171 Ga0070698_100198187 3300005471 Bacteria 1944
172 Ga0070699_100002810 3300005518 Bacteria 15538
173 Ga0070699_100008896 3300005518 Bacteria 8698
174 Ga0070679_100031838 3300005530 Bacteria 5215
175 Ga0070679_100079385 3300005530 Bacteria 3271
176 Ga0070679_100082903 3300005530 Bacteria 3196
177 Ga0070679_100188946 3300005530 Bacteria 2029
178 Ga0070679_100252229 3300005530 Bacteria 1720
179 Ga0070684_100040176 3300005535 Bacteria 4027
180 Ga0070684_100106172 3300005535 Bacteria 2514
181 Ga0070697_100007116 3300005536 Bacteria 8698
182 Ga0070697_100533234 3300005536 Bacteria 1028
183 Ga0068853_100018287 3300005539 Bacteria 5798
184 Ga0068853_100025596 3300005539 Bacteria 4953
185 Ga0068853_100075502 3300005539 Bacteria 2942
186 Ga0068853_100086660 3300005539 Bacteria 2746
187 Ga0068853_100105741 3300005539 Bacteria 2493
188 Ga0068853_100330484 3300005539 Bacteria 1414
189 Ga0068853_100382442 3300005539 Bacteria 1315
190 Ga0068853_100448093 3300005539 Bacteria 1214
191 Ga0070672_100000960 3300005543 Bacteria 17405
192 Ga0070672_100022218 3300005543 Bacteria 4655
193 Ga0070672_100023349 3300005543 Bacteria 4558
194 Ga0070672_100030863 3300005543 Bacteria 4030
195 Ga0070672_100084812 3300005543 Bacteria 2545
196 Ga0070672_100264392 3300005543 Bacteria 1451
197 Ga0070672_100424987 3300005543 Bacteria 1142
198 Ga0070686_100016443 3300005544 Bacteria 4304
199 Ga0070695_100011248 3300005545 Bacteria 5353
200 Ga0070696_100017107 3300005546 Bacteria 4894
201 Ga0070696_100056927 3300005546 Bacteria 2728
202 Ga0070696_100066883 3300005546 Bacteria 2521
203 Ga0070696_100358700 3300005546 Bacteria 1131
204 Ga0070693_100006875 3300005547 Bacteria 5529
205 Ga0070693_100017583 3300005547 Bacteria 3720
206 Ga0070693_100127465 3300005547 Bacteria 1586
207 Ga0070693_100400105 3300005547 Bacteria 952
208 Ga0070665_100002580 3300005548 Bacteria 19847
209 Ga0070665_100005936 3300005548 Bacteria 12507
210 Ga0070665_100008185 3300005548 Bacteria 10589
211 Ga0070665_100035193 3300005548 Bacteria 5035
212 Ga0070665_100072122 3300005548 Bacteria 3461
213 Ga0070665_100246051 3300005548 Bacteria 1789
214 Ga0070665_100310401 3300005548 Bacteria 1581
215 Ga0070704_100014002 3300005549 Bacteria 4997
216 Ga0070704_100026382 3300005549 Bacteria 3837
217 Ga0070704_100032975 3300005549 Bacteria 3499
218 Ga0070704_100078596 3300005549 Bacteria 2421
219 Ga0070704_100144198 3300005549 Bacteria 1864
220 Ga0068855_100005529 3300005563 Bacteria 15420
221 Ga0068855_100026941 3300005563 Bacteria 6878
222 Ga0068855_100059007 3300005563 Bacteria 4491
223 Ga0068855_100078768 3300005563 Bacteria 3823
224 Ga0068855_100294394 3300005563 Bacteria 1799
225 Ga0068855_100402743 3300005563 Bacteria 1499
226 Ga0068855_100451937 3300005563 Bacteria 1402
227 Ga0068855_100471248 3300005563 Bacteria 1368
228 Ga0070664_100002314 3300005564 Bacteria 15313
229 Ga0070664_100006795 3300005564 Bacteria 9224
230 Ga0070664_100051277 3300005564 Bacteria 3494
231 Ga0070664_100071856 3300005564 Bacteria 2966
232 Ga0070664_100140654 3300005564 Bacteria 2125
233 Ga0070664_100152650 3300005564 Bacteria 2040
234 Ga0070664_100203952 3300005564 Bacteria 1765
235 Ga0070664_100373670 3300005564 Bacteria 1300
236 Ga0070664_100471277 3300005564 Bacteria 1155
237 Ga0068857_100030274 3300005577 Bacteria 4778
238 Ga0068857_100040036 3300005577 Bacteria 4155
239 Ga0068854_100009659 3300005578 Bacteria 6230
240 Ga0068854_100062585 3300005578 Bacteria 2698
241 Ga0068854_100084378 3300005578 Bacteria 2350
242 Ga0068854_100141712 3300005578 Bacteria 1845
243 Ga0068854_100230556 3300005578 Bacteria 1469
244 Ga0068854_100373897 3300005578 Bacteria 1172
245 Ga0068856_100000093 3300005614 Bacteria 84752
246 Ga0068856_100014926 3300005614 Bacteria 7500
247 Ga0068856_100015908 3300005614 Bacteria 7272
248 Ga0068856_100023886 3300005614 Bacteria 5946
249 Ga0068856_100044836 3300005614 Bacteria 4352
250 Ga0068856_100192724 3300005614 Bacteria 2052
251 Ga0068856_100256471 3300005614 Bacteria 1764
252 Ga0068856_100742572 3300005614 Bacteria 1001
253 Ga0070702_100086916 3300005615 Bacteria 1887
254 Ga0070702_100094957 3300005615 Bacteria 1816
255 Ga0068852_100007757 3300005616 Bacteria 7854
256 Ga0068852_100035485 3300005616 Bacteria 4161
257 Ga0068852_100070955 3300005616 Bacteria 3057
258 Ga0068852_100071009 3300005616 Bacteria 3056
259 Ga0068852_100090719 3300005616 Bacteria 2733
260 Ga0068852_100592848 3300005616 Bacteria 1112
261 Ga0068859_100001177 3300005617 Bacteria 26708
262 Ga0068859_100002682 3300005617 Bacteria 18068
263 Ga0068859_100010733 3300005617 Bacteria 9219
264 Ga0068859_100032436 3300005617 Bacteria 5247
265 Ga0068859_100090057 3300005617 Bacteria 3118
266 Ga0068859_100091024 3300005617 Bacteria 3101
267 Ga0068859_100209166 3300005617 Bacteria 2037
268 Ga0068859_100592423 3300005617 Bacteria 1202
269 Ga0068864_100002535 3300005618 Bacteria 15082
270 Ga0068864_100003419 3300005618 Bacteria 13129
271 Ga0068864_100003579 3300005618 Bacteria 12843
272 Ga0068864_100018393 3300005618 Bacteria 5838
273 Ga0068864_100080019 3300005618 Bacteria 2862
274 Ga0068864_100082429 3300005618 Bacteria 2822
275 Ga0068864_100302402 3300005618 Bacteria 1498
276 Ga0068864_100401908 3300005618 Bacteria 1302
277 Ga0068866_10002777 3300005718 Bacteria 7222
278 Ga0068861_100000930 3300005719 Bacteria 17788
279 Ga0068861_100190133 3300005719 Bacteria 1715
280 Ga0068851_10001833 3300005834 Bacteria 9309
281 Ga0068851_10003969 3300005834 Bacteria 6626
282 Ga0068851_10008843 3300005834 Bacteria 4668
283 Ga0068851_10012795 3300005834 Bacteria 3963
284 Ga0068851_10079555 3300005834 Bacteria 1710
285 Ga0068870_10004563 3300005840 Bacteria 5969
286 Ga0068870_10011298 3300005840 Bacteria 4136
287 Ga0068870_10037219 3300005840 Bacteria 2507
288 Ga0068863_100002938 3300005841 Bacteria 16850
289 Ga0068863_100046106 3300005841 Bacteria 4137
290 Ga0068863_100059141 3300005841 Bacteria 3626
291 Ga0068863_100093802 3300005841 Bacteria 2848
292 Ga0068863_100101671 3300005841 Bacteria 2732
293 Ga0068863_100124228 3300005841 Bacteria 2462
294 Ga0068863_100140224 3300005841 Bacteria 2310
295 Ga0068863_100141986 3300005841 Bacteria 2295
296 Ga0068858_100008579 3300005842 Bacteria 9815
297 Ga0068858_100025315 3300005842 Bacteria 5522
298 Ga0068858_100039701 3300005842 Bacteria 4364
299 Ga0068858_100054531 3300005842 Bacteria 3696
300 Ga0068858_100144291 3300005842 Bacteria 2236
301 Ga0068858_100207244 3300005842 Bacteria 1855
302 Ga0068858_100211598 3300005842 Bacteria 1835
303 Ga0068858_100601281 3300005842 Unclassified 1067
304 Ga0068858_100771939 3300005842 Bacteria 937
305 Ga0068860_100001191 3300005843 Bacteria 28399
306 Ga0068860_100013607 3300005843 Bacteria 7975
307 Ga0068860_100018869 3300005843 Bacteria 6701
308 Ga0068860_100019078 3300005843 Bacteria 6657
309 Ga0068860_100037773 3300005843 Bacteria 4622
310 Ga0068860_100056604 3300005843 Bacteria 3727
311 Ga0068860_100255261 3300005843 Bacteria 1708
312 Ga0068860_100391047 3300005843 Bacteria 1374
313 Ga0068862_100047830 3300005844 Bacteria 3651
314 Ga0068862_100063344 3300005844 Bacteria 3182
315 Ga0070716_100034262 3300006173 Bacteria 2783
316 Ga0070712_100044645 3300006175 Bacteria 3056
317 Ga0070712_100058044 3300006175 Bacteria 2721
318 Ga0097621_100000696 3300006237 Bacteria 23599
319 Ga0097621_100003701 3300006237 Bacteria 10579
320 Ga0097621_100008390 3300006237 Bacteria 7435
321 Ga0097621_100015241 3300006237 Bacteria 5778
322 Ga0097621_100026548 3300006237 Bacteria 4544
323 Ga0097621_100054192 3300006237 Bacteria 3270
324 Ga0097621_100104271 3300006237 Bacteria 2389
325 Ga0097621_100127721 3300006237 Bacteria 2161
326 Ga0097621_100313231 3300006237 Bacteria 1389
327 Ga0097621_100403263 3300006237 Bacteria 1224
328 Ga0068871_100000472 3300006358 Bacteria 27578
329 Ga0068871_100124841 3300006358 Bacteria 2178
330 Ga0068871_100158004 3300006358 Bacteria 1937
331 Ga0068871_100254953 3300006358 Bacteria 1529
332 Ga0068871_100354285 3300006358 Bacteria 1299
333 Ga0075428_100010320 3300006844 Bacteria 10367
334 Ga0075428_100084684 3300006844 Bacteria 3459
335 Ga0075428_100107723 3300006844 Bacteria 3037
336 Ga0075428_100117321 3300006844 Bacteria 2899
337 Ga0075430_100213379 3300006846 Bacteria 1601
338 Ga0075431_100019537 3300006847 Bacteria 6910
339 Ga0075431_100024857 3300006847 Bacteria 6142
340 Ga0075433_10014465 3300006852 Bacteria 6449
341 Ga0075433_10139232 3300006852 Bacteria 2157
342 Ga0075434_100010242 3300006871 Bacteria 8780
343 Ga0075434_100119033 3300006871 Bacteria 2655
344 Ga0075434_100152502 3300006871 Bacteria 2331
345 Ga0075434_100292901 3300006871 Bacteria 1648
346 Ga0075429_100000175 3300006880 Bacteria 41423
347 Ga0075429_100034410 3300006880 Bacteria 4402
348 Ga0068865_100036414 3300006881 Bacteria 3317
349 Ga0068865_100073431 3300006881 Bacteria 2432
350 Ga0068865_100133683 3300006881 Bacteria 1861
351 Ga0068865_100214888 3300006881 Bacteria 1500
352 Ga0068865_100353811 3300006881 Bacteria 1191
353 Ga0068865_100394832 3300006881 Bacteria 1132
354 Ga0075436_100022726 3300006914 Bacteria 4309
355 Ga0075436_100175164 3300006914 Bacteria 1515
356 Ga0097620_100001177 3300006931 Bacteria 26708
357 Ga0097620_100002682 3300006931 Bacteria 18068
358 Ga0097620_100010733 3300006931 Bacteria 9219
359 Ga0097620_100032436 3300006931 Bacteria 5247
360 Ga0097620_100090057 3300006931 Bacteria 3118
361 Ga0097620_100091021 3300006931 Bacteria 3101
362 Ga0097620_100209170 3300006931 Bacteria 2037
363 Ga0097620_100592423 3300006931 Bacteria 1202
364 Ga0075435_100000996 3300007076 Bacteria 17936
365 Ga0075435_100206571 3300007076 Bacteria 1665
366 Ga0105240_10045447 3300009093 Bacteria 5570
367 Ga0105240_10052230 3300009093 Bacteria 5139
368 Ga0111539_10142481 3300009094 Bacteria 2806
369 Ga0111539_10331248 3300009094 Bacteria 1772
370 Ga0111539_10659496 3300009094 Bacteria 1218
371 Ga0105245_10021563 3300009098 Bacteria 5653
372 Ga0105245_10030966 3300009098 Bacteria 4733
373 Ga0105245_10108538 3300009098 Bacteria 2578
374 Ga0105245_10358242 3300009098 Bacteria 1447
375 Ga0105245_10368171 3300009098 Bacteria 1428
376 Ga0105245_10716880 3300009098 Bacteria 1034
377 Ga0105247_10018828 3300009101 Bacteria 4145
378 Ga0114129_10046258 3300009147 Bacteria 6116
379 Ga0114129_10056041 3300009147 Bacteria 5523
380 Ga0114129_11024070 3300009147 Bacteria 1038
381 Ga0105243_10236361 3300009148 Bacteria 1624
382 Ga0105243_10307794 3300009148 Bacteria 1438
383 Ga0105241_10004906 3300009174 Bacteria 9867
384 Ga0105241_10138001 3300009174 Bacteria 1982
385 Ga0105241_10372640 3300009174 Bacteria 1245
386 Ga0105241_10415779 3300009174 Bacteria 1182
387 Ga0105242_10009513 3300009176 Bacteria 7448
388 Ga0105242_10034566 3300009176 Bacteria 4053
389 Ga0105242_10044321 3300009176 Bacteria 3602
390 Ga0105242_10072045 3300009176 Bacteria 2869
391 Ga0105242_10459533 3300009176 Bacteria 1202
392 Ga0105242_10819496 3300009176 Bacteria 923
393 Ga0105248_10001670 3300009177 Bacteria 24699
394 Ga0105248_10011976 3300009177 Bacteria 9565
395 Ga0105248_10013498 3300009177 Bacteria 8994
396 Ga0105248_10025672 3300009177 Bacteria 6552
397 Ga0105248_10048753 3300009177 Bacteria 4751
398 Ga0105248_10165601 3300009177 Bacteria 2493
399 Ga0105248_10202940 3300009177 Bacteria 2234
400 Ga0105248_10395398 3300009177 Bacteria 1556
401 Ga0105237_10042280 3300009545 Bacteria 4597
402 Ga0105237_10131252 3300009545 Bacteria 2500
403 Ga0105237_10293452 3300009545 Bacteria 1629
404 Ga0105238_10062479 3300009551 Bacteria 3725
405 Ga0105238_10499899 3300009551 Bacteria 1217
406 Ga0105249_10004775 3300009553 Bacteria 11693
407 Ga0105249_10124073 3300009553 Bacteria 2458
408 Ga0105249_10188497 3300009553 Bacteria 2011
409 Ga0105249_10309895 3300009553 Bacteria 1586
410 Ga0105239_10458469 3300010375 Bacteria 1447
411 Ga0105239_10733907 3300010375 Bacteria 1130
412 Ga0105246_10119689 3300011119 Bacteria 1949
413 Ga0105246_10328817 3300011119 Bacteria 1245
414 Ga0157373_10001205 3300013100 Bacteria 19754
415 Ga0157373_10002005 3300013100 Bacteria 15435
416 Ga0157373_10049919 3300013100 Bacteria 2980
417 Ga0157371_10000228 3300013102 Bacteria 81797
418 Ga0157371_10045890 3300013102 Bacteria 3109
419 Ga0157371_10123177 3300013102 Bacteria 1844
420 Ga0157371_10291975 3300013102 Bacteria 1179
421 Ga0157370_10011607 3300013104 Bacteria 9197
422 Ga0157370_10020629 3300013104 Bacteria 6579
423 Ga0157370_10036807 3300013104 Bacteria 4747
424 Ga0157370_10039006 3300013104 Bacteria 4593
425 Ga0157370_10048439 3300013104 Bacteria 4071
426 Ga0157370_10107088 3300013104 Bacteria 2615
427 Ga0157370_10134194 3300013104 Bacteria 2308
428 Ga0157370_10330831 3300013104 Bacteria 1405
429 Ga0157369_10004565 3300013105 Bacteria 16276
430 Ga0157369_10100242 3300013105 Bacteria 3087
431 Ga0157369_10127131 3300013105 Bacteria 2701
432 Ga0157369_10151720 3300013105 Bacteria 2449
433 Ga0157369_10236246 3300013105 Bacteria 1910
434 Ga0157374_10002207 3300013296 Bacteria 16415
435 Ga0157374_10010560 3300013296 Bacteria 7949
436 Ga0157374_10456941 3300013296 Bacteria 1279
437 Ga0157378_10009398 3300013297 Bacteria 8518
438 Ga0157378_10012711 3300013297 Bacteria 7365
439 Ga0157378_10123850 3300013297 Bacteria 2386
440 Ga0157378_10129837 3300013297 Bacteria 2332
441 Ga0157378_10672319 3300013297 Bacteria 1053
442 Ga0157378_10936551 3300013297 Bacteria 898
443 Ga0163162_10000619 3300013306 Bacteria 32928
444 Ga0163162_10008387 3300013306 Bacteria 10078
445 Ga0163162_10013531 3300013306 Bacteria 7967
446 Ga0163162_10086076 3300013306 Bacteria 3220
447 Ga0163162_10216232 3300013306 Bacteria 2047
448 Ga0163162_10217241 3300013306 Bacteria 2042
449 Ga0157372_10009636 3300013307 Bacteria 10267
450 Ga0157372_10037205 3300013307 Bacteria 5366
451 Ga0157372_10045381 3300013307 Bacteria 4875
452 Ga0157372_10214336 3300013307 Bacteria 2231
453 Ga0157372_10254938 3300013307 Bacteria 2037
454 Ga0157372_10750287 3300013307 Bacteria 1135
455 Ga0157375_10003009 3300013308 Bacteria 14635
456 Ga0157375_10019692 3300013308 Bacteria 6145
457 Ga0157375_10119523 3300013308 Bacteria 2743
458 Ga0157375_10146613 3300013308 Bacteria 2491
459 Ga0157375_10738056 3300013308 Bacteria 1137
460 Ga0157375_10850331 3300013308 Bacteria 1059
461 Ga0157375_11064402 3300013308 Bacteria 946
462 Ga0163163_10003372 3300014325 Bacteria 13559
463 Ga0163163_10018845 3300014325 Bacteria 6472
464 Ga0163163_10089598 3300014325 Bacteria 3089
465 Ga0163163_10100389 3300014325 Bacteria 2916
466 Ga0163163_10116793 3300014325 Bacteria 2699
467 Ga0163163_10186639 3300014325 Bacteria 2121
468 Ga0157380_10022406 3300014326 Bacteria 4754
469 Ga0157380_10054788 3300014326 Bacteria 3166
470 Ga0157380_10083960 3300014326 Bacteria 2610
471 Ga0157380_10279086 3300014326 Bacteria 1528
472 Ga0182008_10071251 3300014497 Bacteria 1710
473 Ga0157379_10001443 3300014968 Bacteria 19514
474 Ga0157379_10022156 3300014968 Bacteria 5631
475 Ga0157379_10023178 3300014968 Bacteria 5506
476 Ga0157379_10466201 3300014968 Bacteria 1168
477 Ga0157379_10525751 3300014968 Bacteria 1099
478 Ga0157376_10035683 3300014969 Bacteria 4023
479 Ga0157376_10050661 3300014969 Bacteria 3445
480 Ga0157376_10065570 3300014969 Bacteria 3067
481 Ga0157376_10118977 3300014969 Bacteria 2338
482 Ga0157376_10395243 3300014969 Bacteria 1335
483 Ga0163161_10009380 3300017792 Bacteria 6775
484 Ga0163161_10019666 3300017792 Bacteria 4736
485 Ga0163161_10021646 3300017792 Bacteria 4518
486 Ga0163161_10090394 3300017792 Bacteria 2265
487 Ga0163161_10548064 3300017792 Bacteria 948
488 Ga0207673_1000490 3300025290 Bacteria 4156
489 Ga0207697_10000152 3300025315 Bacteria 34092
490 Ga0207697_10008287 3300025315 Bacteria 4562
491 Ga0207656_10011875 3300025321 Bacteria 3300
492 Ga0207656_10018233 3300025321 Bacteria 2760
493 Ga0207656_10040771 3300025321 Bacteria 1970
494 Ga0207653_10045344 3300025885 Bacteria 1452
495 Ga0207682_10000198 3300025893 Bacteria 27362
496 Ga0207682_10000277 3300025893 Bacteria 23286
497 Ga0207682_10010491 3300025893 Bacteria 3631
498 Ga0207682_10087131 3300025893 Bacteria 1348
499 Ga0207682_10151509 3300025893 Bacteria 1046
500 Ga0207692_10005904 3300025898 Bacteria 4938
501 Ga0207692_10132069 3300025898 Bacteria 1411
502 Ga0207642_10031819 3300025899 Bacteria 2214
503 Ga0207710_10089917 3300025900 Bacteria 1436
504 Ga0207688_10049854 3300025901 Bacteria 2341
505 Ga0207688_10171422 3300025901 Bacteria 1290
506 Ga0207680_10001163 3300025903 Bacteria 12405
507 Ga0207680_10004517 3300025903 Bacteria 6600
508 Ga0207680_10115652 3300025903 Bacteria 1747
509 Ga0207680_10298566 3300025903 Bacteria 1122
510 Ga0207680_10322419 3300025903 Bacteria 1080
511 Ga0207645_10000095 3300025907 Bacteria 64667
512 Ga0207645_10000676 3300025907 Bacteria 28210
513 Ga0207645_10002695 3300025907 Bacteria 13841
514 Ga0207645_10009493 3300025907 Bacteria 6724
515 Ga0207645_10041702 3300025907 Bacteria 2937
516 Ga0207645_10063263 3300025907 Bacteria 2364
517 Ga0207645_10094687 3300025907 Bacteria 1922
518 Ga0207645_10158198 3300025907 Bacteria 1481
519 Ga0207643_10000311 3300025908 Bacteria 33638
520 Ga0207643_10015525 3300025908 Bacteria 4146
521 Ga0207643_10019620 3300025908 Bacteria 3706
522 Ga0207643_10043085 3300025908 Bacteria 2546
523 Ga0207684_10061016 3300025910 Bacteria 3202
524 Ga0207684_10128792 3300025910 Bacteria 2172
525 Ga0207684_10553508 3300025910 Bacteria 984
526 Ga0207654_10028623 3300025911 Bacteria 3039
527 Ga0207707_10002449 3300025912 Bacteria 16703
528 Ga0207707_10004319 3300025912 Bacteria 12584
529 Ga0207707_10131617 3300025912 Bacteria 2188
530 Ga0207707_10314313 3300025912 Bacteria 1353
531 Ga0207695_10014284 3300025913 Bacteria 9418
532 Ga0207671_10095653 3300025914 Bacteria 2243
533 Ga0207671_10311892 3300025914 Bacteria 1244
534 Ga0207693_10000070 3300025915 Bacteria 90057
535 Ga0207693_10126993 3300025915 Bacteria 2005
536 Ga0207693_10226978 3300025915 Bacteria 1467
537 Ga0207663_10134118 3300025916 Bacteria 1716
538 Ga0207663_10240988 3300025916 Bacteria 1326
539 Ga0207660_10138111 3300025917 Bacteria 1861
540 Ga0207660_10182054 3300025917 Bacteria 1632
541 Ga0207660_10435334 3300025917 Bacteria 1059
542 Ga0207662_10016821 3300025918 Bacteria 4130
543 Ga0207657_10000045 3300025919 Bacteria 114661
544 Ga0207657_10000645 3300025919 Bacteria 37069
545 Ga0207657_10018126 3300025919 Bacteria 6735
546 Ga0207649_10009634 3300025920 Bacteria 5288
547 Ga0207649_10029299 3300025920 Bacteria 3251
548 Ga0207649_10030611 3300025920 Bacteria 3190
549 Ga0207649_10116236 3300025920 Bacteria 1796
550 Ga0207649_10151367 3300025920 Bacteria 1598
551 Ga0207652_10005836 3300025921 Bacteria 9975
552 Ga0207652_10015307 3300025921 Bacteria 6229
553 Ga0207652_10042383 3300025921 Bacteria 3874
554 Ga0207652_10077355 3300025921 Bacteria 2903
555 Ga0207652_10094074 3300025921 Bacteria 2639
556 Ga0207646_10006400 3300025922 Bacteria 12179
557 Ga0207646_10119191 3300025922 Bacteria 2371
558 Ga0207681_10005063 3300025923 Bacteria 8100
559 Ga0207681_10005688 3300025923 Bacteria 7657
560 Ga0207681_10110212 3300025923 Bacteria 2001
561 Ga0207681_10222013 3300025923 Bacteria 1462
562 Ga0207681_10511610 3300025923 Bacteria 984
563 Ga0207694_10277570 3300025924 Bacteria 1376
564 Ga0207694_10328029 3300025924 Bacteria 1264
565 Ga0207694_10519609 3300025924 Bacteria 998
566 Ga0207650_10003084 3300025925 Bacteria 11475
567 Ga0207650_10004678 3300025925 Bacteria 9354
568 Ga0207650_10007756 3300025925 Bacteria 7318
569 Ga0207650_10012522 3300025925 Bacteria 5854
570 Ga0207650_10019765 3300025925 Bacteria 4737
571 Ga0207650_10031990 3300025925 Bacteria 3804
572 Ga0207650_10036416 3300025925 Bacteria 3580
573 Ga0207650_10045310 3300025925 Bacteria 3236
574 Ga0207650_10057952 3300025925 Bacteria 2882
575 Ga0207650_10094404 3300025925 Bacteria 2291
576 Ga0207650_10450989 3300025925 Bacteria 1070
577 Ga0207650_10550446 3300025925 Bacteria 967
578 Ga0207659_10005942 3300025926 Bacteria 7448
579 Ga0207659_10016534 3300025926 Bacteria 4803
580 Ga0207659_10024036 3300025926 Bacteria 4076
581 Ga0207659_10027681 3300025926 Bacteria 3842
582 Ga0207659_10062877 3300025926 Bacteria 2681
583 Ga0207659_10092013 3300025926 Bacteria 2267
584 Ga0207659_10255625 3300025926 Bacteria 1423
585 Ga0207659_10557973 3300025926 Bacteria 974
586 Ga0207700_10000084 3300025928 Bacteria 58386
587 Ga0207700_10002711 3300025928 Bacteria 10209
588 Ga0207700_10008158 3300025928 Bacteria 6468
589 Ga0207664_10001330 3300025929 Bacteria 16288
590 Ga0207664_10076261 3300025929 Bacteria 2713
591 Ga0207644_10010936 3300025931 Bacteria 5996
592 Ga0207644_10019180 3300025931 Bacteria 4637
593 Ga0207644_10025898 3300025931 Bacteria 4036
594 Ga0207644_10141927 3300025931 Bacteria 1850
595 Ga0207690_10000461 3300025932 Bacteria 26139
596 Ga0207690_10030150 3300025932 Bacteria 3457
597 Ga0207690_10114046 3300025932 Bacteria 1951
598 Ga0207690_10591812 3300025932 Bacteria 905
599 Ga0207706_10000014 3300025933 Bacteria 177082
600 Ga0207706_10003500 3300025933 Bacteria 14990
601 Ga0207706_10004135 3300025933 Bacteria 13683
602 Ga0207706_10007454 3300025933 Bacteria 10119
603 Ga0207706_10068549 3300025933 Bacteria 3121
604 Ga0207706_10358564 3300025933 Bacteria 1267
605 Ga0207709_10017317 3300025935 Bacteria 4020
606 Ga0207709_10190176 3300025935 Bacteria 1457
607 Ga0207670_10089839 3300025936 Bacteria 2169
608 Ga0207670_10384997 3300025936 Bacteria 1118
609 Ga0207669_10018360 3300025937 Bacteria 3614
610 Ga0207669_10023528 3300025937 Bacteria 3293
611 Ga0207669_10028655 3300025937 Bacteria 3067
612 Ga0207669_10043965 3300025937 Bacteria 2620
613 Ga0207704_10040558 3300025938 Bacteria 2722
614 Ga0207704_10128961 3300025938 Bacteria 1747
615 Ga0207665_10022565 3300025939 Bacteria 4141
616 Ga0207665_10024165 3300025939 Bacteria 4006
617 Ga0207665_10050727 3300025939 Bacteria 2791
618 Ga0207691_10000243 3300025940 Bacteria 53649
619 Ga0207691_10000488 3300025940 Bacteria 39341
620 Ga0207691_10000999 3300025940 Bacteria 28088
621 Ga0207691_10004761 3300025940 Bacteria 13124
622 Ga0207691_10008651 3300025940 Bacteria 9767
623 Ga0207691_10026704 3300025940 Bacteria 5417
624 Ga0207691_10036107 3300025940 Bacteria 4580
625 Ga0207691_10082927 3300025940 Bacteria 2879
626 Ga0207691_10084355 3300025940 Bacteria 2852
627 Ga0207691_10100420 3300025940 Bacteria 2583
628 Ga0207691_10202759 3300025940 Bacteria 1726
629 Ga0207711_10003675 3300025941 Bacteria 13250
630 Ga0207711_10006583 3300025941 Bacteria 9783
631 Ga0207711_10015861 3300025941 Bacteria 6250
632 Ga0207711_10162506 3300025941 Bacteria 2023
633 Ga0207711_10231454 3300025941 Bacteria 1692
634 Ga0207711_10267141 3300025941 Bacteria 1573
635 Ga0207711_10364257 3300025941 Bacteria 1340
636 Ga0207689_10000066 3300025942 Bacteria 84063
637 Ga0207689_10002822 3300025942 Bacteria 16042
638 Ga0207689_10011021 3300025942 Bacteria 7769
639 Ga0207689_10104281 3300025942 Bacteria 2330
640 Ga0207689_10234290 3300025942 Bacteria 1517
641 Ga0207689_10287106 3300025942 Bacteria 1363
642 Ga0207661_10170759 3300025944 Bacteria 1893
643 Ga0207679_10007025 3300025945 Bacteria 7136
644 Ga0207679_10016970 3300025945 Bacteria 4843
645 Ga0207679_10019385 3300025945 Bacteria 4568
646 Ga0207679_10047362 3300025945 Bacteria 3123
647 Ga0207679_10058944 3300025945 Bacteria 2847
648 Ga0207679_10146953 3300025945 Bacteria 1913
649 Ga0207679_10149368 3300025945 Bacteria 1900
650 Ga0207679_10295983 3300025945 Bacteria 1393
651 Ga0207667_10001516 3300025949 Bacteria 29182
652 Ga0207667_10004276 3300025949 Bacteria 17516
653 Ga0207667_10133835 3300025949 Bacteria 2553
654 Ga0207667_10492828 3300025949 Bacteria 1243
655 Ga0207667_10702577 3300025949 Bacteria 1013
656 Ga0207651_10002560 3300025960 Bacteria 8691
657 Ga0207651_10014470 3300025960 Bacteria 4558
658 Ga0207651_10050332 3300025960 Bacteria 2828
659 Ga0207651_10095405 3300025960 Bacteria 2190
660 Ga0207651_10099865 3300025960 Bacteria 2150
661 Ga0207712_10264735 3300025961 Bacteria 1396
662 Ga0207668_10003885 3300025972 Bacteria 8805
663 Ga0207668_10005128 3300025972 Bacteria 7706
664 Ga0207668_10028489 3300025972 Bacteria 3652
665 Ga0207668_10040243 3300025972 Bacteria 3152
666 Ga0207668_10123010 3300025972 Bacteria 1968
667 Ga0207668_10177701 3300025972 Bacteria 1676
668 Ga0207668_10422234 3300025972 Bacteria 1132
669 Ga0207640_10035273 3300025981 Bacteria 3129
670 Ga0207640_10102928 3300025981 Bacteria 2006
671 Ga0207640_10110004 3300025981 Bacteria 1951
672 Ga0207640_10161768 3300025981 Bacteria 1657
673 Ga0207640_10194037 3300025981 Bacteria 1533
674 Ga0207658_10002734 3300025986 Bacteria 12742
675 Ga0207658_10031204 3300025986 Bacteria 3782
676 Ga0207658_10044942 3300025986 Bacteria 3217
677 Ga0207658_10088286 3300025986 Bacteria 2397
678 Ga0207658_10111361 3300025986 Bacteria 2165
679 Ga0207658_10129024 3300025986 Bacteria 2029
680 Ga0207658_10229652 3300025986 Bacteria 1566
681 Ga0207658_10403883 3300025986 Bacteria 1201
682 Ga0207658_10606902 3300025986 Bacteria 983
683 Ga0207677_10000509 3300026023 Bacteria 25064
684 Ga0207677_10010048 3300026023 Bacteria 5342
685 Ga0207677_10269476 3300026023 Bacteria 1392
686 Ga0207677_10303435 3300026023 Bacteria 1320
687 Ga0207677_10340878 3300026023 Bacteria 1252
688 Ga0207677_10401211 3300026023 Bacteria 1163
689 Ga0207703_10002220 3300026035 Bacteria 17031
690 Ga0207703_10007367 3300026035 Bacteria 8743
691 Ga0207703_10041493 3300026035 Bacteria 3687
692 Ga0207703_10114228 3300026035 Bacteria 2309
693 Ga0207703_10146979 3300026035 Bacteria 2051
694 Ga0207703_10357076 3300026035 Bacteria 1347
695 Ga0207703_10382253 3300026035 Bacteria 1303
696 Ga0207703_10424048 3300026035 Unclassified 1238
697 Ga0207703_10743375 3300026035 Bacteria 934
698 Ga0207639_10006616 3300026041 Bacteria 7882
699 Ga0207639_10042662 3300026041 Bacteria 3401
700 Ga0207639_10078990 3300026041 Bacteria 2599
701 Ga0207639_10088963 3300026041 Bacteria 2466
702 Ga0207639_10167299 3300026041 Bacteria 1859
703 Ga0207678_10002320 3300026067 Bacteria 17245
704 Ga0207678_10003040 3300026067 Bacteria 15175
705 Ga0207678_10010401 3300026067 Bacteria 8166
706 Ga0207678_10159463 3300026067 Bacteria 1927
707 Ga0207678_10296964 3300026067 Bacteria 1388
708 Ga0207708_10000789 3300026075 Bacteria 23888
709 Ga0207708_10013596 3300026075 Bacteria 6082
710 Ga0207708_10216442 3300026075 Bacteria 1533
711 Ga0207708_10216938 3300026075 Bacteria 1531
712 Ga0207702_10006446 3300026078 Bacteria 10118
713 Ga0207702_10007617 3300026078 Bacteria 9216
714 Ga0207702_10054685 3300026078 Bacteria 3383
715 Ga0207702_10077073 3300026078 Bacteria 2882
716 Ga0207702_10095911 3300026078 Bacteria 2607
717 Ga0207702_10162999 3300026078 Bacteria 2037
718 Ga0207702_10191476 3300026078 Bacteria 1890
719 Ga0207702_10260659 3300026078 Bacteria 1632
720 Ga0207641_10001273 3300026088 Bacteria 25089
721 Ga0207641_10055724 3300026088 Bacteria 3357
722 Ga0207641_10064921 3300026088 Bacteria 3121
723 Ga0207641_10081947 3300026088 Bacteria 2802
724 Ga0207641_10146479 3300026088 Bacteria 2135
725 Ga0207641_10148418 3300026088 Bacteria 2122
726 Ga0207641_10266722 3300026088 Bacteria 1605
727 Ga0207648_10000324 3300026089 Bacteria 52466
728 Ga0207648_10004321 3300026089 Bacteria 14629
729 Ga0207648_10007292 3300026089 Bacteria 10899
730 Ga0207648_10028539 3300026089 Bacteria 4946
731 Ga0207648_10037581 3300026089 Bacteria 4266
732 Ga0207648_10075672 3300026089 Bacteria 2934
733 Ga0207648_10102339 3300026089 Bacteria 2511
734 Ga0207648_10236451 3300026089 Bacteria 1626
735 Ga0207648_10251926 3300026089 Bacteria 1574
736 Ga0207648_10260239 3300026089 Bacteria 1548
737 Ga0207648_10422947 3300026089 Bacteria 1210
738 Ga0207648_10786708 3300026089 Bacteria 885
739 Ga0207676_10001121 3300026095 Bacteria 20306
740 Ga0207676_10016929 3300026095 Bacteria 5279
741 Ga0207676_10040004 3300026095 Bacteria 3590
742 Ga0207676_10069163 3300026095 Bacteria 2826
743 Ga0207676_10076314 3300026095 Bacteria 2707
744 Ga0207676_10098876 3300026095 Bacteria 2413
745 Ga0207676_10169818 3300026095 Bacteria 1899
746 Ga0207676_10249897 3300026095 Bacteria 1596
747 Ga0207676_10252263 3300026095 Bacteria 1589
748 Ga0207676_10366551 3300026095 Bacteria 1337
749 Ga0207676_10583057 3300026095 Bacteria 1072
750 Ga0207676_10592949 3300026095 Bacteria 1063
751 Ga0207674_10000052 3300026116 Bacteria 115252
752 Ga0207674_10003215 3300026116 Bacteria 20119
753 Ga0207674_10024058 3300026116 Bacteria 6514
754 Ga0207674_10833134 3300026116 Bacteria 890
755 Ga0207675_100005143 3300026118 Bacteria 12595
756 Ga0207675_100023263 3300026118 Bacteria 5763
757 Ga0207675_100025891 3300026118 Bacteria 5458
758 Ga0207675_100069867 3300026118 Bacteria 3282
759 Ga0207675_100089474 3300026118 Bacteria 2893
760 Ga0207675_100120329 3300026118 Bacteria 2484
761 Ga0207675_100176921 3300026118 Bacteria 2042
762 Ga0207683_10000109 3300026121 Bacteria 66727
763 Ga0207683_10000308 3300026121 Bacteria 44216
764 Ga0207683_10000448 3300026121 Bacteria 38154
765 Ga0207683_10014491 3300026121 Bacteria 6713
766 Ga0207683_10017509 3300026121 Bacteria 6108
767 Ga0207683_10052382 3300026121 Bacteria 3576
768 Ga0207683_10065953 3300026121 Bacteria 3192
769 Ga0207683_10118857 3300026121 Bacteria 2371
770 Ga0207683_10260185 3300026121 Bacteria 1584
771 Ga0207683_10281467 3300026121 Bacteria 1520
772 Ga0207683_10384386 3300026121 Bacteria 1290
773 Ga0207698_10012326 3300026142 Bacteria 5591
774 Ga0207698_10027547 3300026142 Bacteria 4036
775 Ga0207698_10119642 3300026142 Bacteria 2226
776 Ga0207698_10166923 3300026142 Bacteria 1933
777 Ga0207698_10230311 3300026142 Bacteria 1681
778 Ga0207698_10254739 3300026142 Bacteria 1608
779 Ga0207698_10542072 3300026142 Bacteria 1139
780 Ga0209967_1003926 3300027364 Bacteria 1963
781 Ga0209996_1009615 3300027395 Bacteria 1276
782 Ga0209995_1004680 3300027471 Bacteria 2195
783 Ga0209995_1007358 3300027471 Bacteria 1775
784 Ga0209971_1007375 3300027682 Bacteria 2609
785 Ga0209971_1033627 3300027682 Bacteria 1232
786 Ga0209998_10012548 3300027717 Bacteria 1760
787 Ga0209974_10081434 3300027876 Bacteria 1115
788 Ga0207428_10289644 3300027907 Bacteria 1214
789 Ga0268266_10006219 3300028379 Bacteria 10966
790 Ga0268266_10034794 3300028379 Bacteria 4285
791 Ga0268266_10063084 3300028379 Bacteria 3199
792 Ga0268266_10082586 3300028379 Bacteria 2803
793 Ga0268266_10095303 3300028379 Bacteria 2614
794 Ga0268266_10120278 3300028379 Bacteria 2336
795 Ga0268266_10180135 3300028379 Bacteria 1923
796 Ga0268266_10189694 3300028379 Bacteria 1876
797 Ga0268265_10061720 3300028380 Bacteria 2877
798 Ga0268265_10088938 3300028380 Bacteria 2462
799 Ga0268265_10187464 3300028380 Bacteria 1783
800 Ga0268265_10250419 3300028380 Bacteria 1569
801 Ga0268265_10261357 3300028380 Bacteria 1539
802 Ga0268264_10003053 3300028381 Bacteria 14505
803 Ga0268264_10011874 3300028381 Bacteria 7175
804 Ga0268264_10016863 3300028381 Bacteria 5979
805 Ga0268264_10040223 3300028381 Bacteria 3863
806 Ga0268264_10110484 3300028381 Bacteria 2407
807 Ga0268264_10367583 3300028381 Bacteria 1374
808 Ga0268264_10612146 3300028381 Bacteria 1074
809 Ga0265330_10001397 3300031235 Bacteria 14121
810 Ga0265332_10002014 3300031238 Bacteria 10662
811 Ga0265328_10004196 3300031239 Bacteria 6278
812 Ga0265325_10007694 3300031241 Bacteria 6429
813 Ga0265329_10001268 3300031242 Bacteria 12331
814 Ga0265339_10010535 3300031249 Bacteria 5739
815 Ga0265331_10000571 3300031250 Bacteria 33044
816 Ga0265327_10012687 3300031251 Bacteria 5664
817 Ga0307408_100013018 3300031548 Bacteria 5516
818 Ga0307408_100024299 3300031548 Bacteria 4136
819 Ga0307408_100075280 3300031548 Bacteria 2508
820 Ga0316575_10044862 3300031665 Bacteria 1754
821 Ga0265342_10009557 3300031712 Bacteria 6816
822 Ga0307405_10029581 3300031731 Bacteria 3203
823 Ga0307413_10019256 3300031824 Bacteria 3602
824 Ga0307413_10101746 3300031824 Bacteria 1900
825 Ga0307413_10118932 3300031824 Bacteria 1785
826 Ga0307410_10051735 3300031852 Bacteria 2770
827 Ga0307406_10011440 3300031901 Bacteria 5037
828 Ga0307406_10127824 3300031901 Bacteria 1778
829 Ga0307407_10079432 3300031903 Bacteria 1979
830 Ga0307407_10197414 3300031903 Bacteria 1346
831 Ga0307412_10012352 3300031911 Bacteria 4975
832 Ga0307412_10025898 3300031911 Bacteria 3639
833 Ga0307412_10030282 3300031911 Bacteria 3406
834 Ga0307409_100010606 3300031995 Bacteria 5742
835 Ga0307409_100034813 3300031995 Bacteria 3684
836 Ga0307409_100143631 3300031995 Bacteria 2060
837 Ga0307416_100011079 3300032002 Bacteria 5993
838 Ga0307416_100044964 3300032002 Bacteria 3472
839 Ga0307416_100301042 3300032002 Bacteria 1594
840 Ga0307416_100770557 3300032002 Bacteria 1056
841 Ga0307414_10022232 3300032004 Bacteria 3996
842 Ga0307414_10397975 3300032004 Bacteria 1195
843 Ga0307411_10010633 3300032005 Bacteria 4917
844 Ga0307411_10012990 3300032005 Bacteria 4574
845 Ga0307411_10034751 3300032005 Bacteria 3140
846 Ga0307411_10059616 3300032005 Bacteria 2531
847 Ga0307415_100002355 3300032126 Bacteria 9398
848 Ga0307415_100044261 3300032126 Bacteria 2975
849 Ga0373926_0123227 3300035083 Bacteria 978
850 Ga0373934_0007738 3300035086 Bacteria 3994
851 Ga0373934_0066283 3300035086 Bacteria 1442
852 Ga0373944_0008903 3300035089 Bacteria 2714
853 Ga0373923_0093502 3300035111 Bacteria 1318
854 Ga0373953_0018437 3300035117 Bacteria 2583
855 Ga0373956_0018822 3300035119 Bacteria 2926
856 Ga0373957_0038473 3300035120 Bacteria 1791
857 Ga0373943_0021205 3300035170 Bacteria 2998
858 Ga0373943_0034999 3300035170 Bacteria 2398
859 Ga0373946_0057991 3300035171 Bacteria 1639
860 Ga0373955_0043583 3300035172 Bacteria 2414
861 Ga0373962_0071153 3300035242 Bacteria 1040
862 Ga0316574_0001281 3300035398 Bacteria 11739
863 Ga0373924_0007020 3300035410 Bacteria 4054
864 Ga0373931_0379053 3300035691 Bacteria 891
865 Ga0373935_0010797 3300035692 Bacteria 5487
866 Ga0373935_0028283 3300035692 Bacteria 3465
867 Ga0373927_0018269 3300035695 Bacteria 4609
868 Ga0373927_0082309 3300035695 Bacteria 2086
869 Ga0373927_0084882 3300035695 Bacteria 2054
870 Ga0373933_0026233 3300035724 Bacteria 3345
871 Ga0373947_0089921 3300035725 Bacteria 1913
872 Ga0373937_0007010 3300036401 Bacteria 9727
873 Ga0373937_0051347 3300036401 Bacteria 3779
874 Ga0373937_0085960 3300036401 Bacteria 2910
875 Ga0373937_0138616 3300036401 Bacteria 2275
876 Ga0373937_0299680 3300036401 Bacteria 1519
877 Ga0373937_0457156 3300036401 Bacteria 1213
878 Ga0373925_0045702 3300037068 Bacteria 3253
879 Ga0373925_0071771 3300037068 Bacteria 2619
880 Ga0373925_0314604 3300037068 Bacteria 1266
881 Ga0395900_0269502 3300037418 Bacteria 1698
882 Ga0395905_0047248 3300037471 Bacteria 4035
883 Ga0395901_0073870 3300038443 Bacteria 3557
884 Ga0395901_0901079 3300038443 Bacteria 866
885 Ga0436365_0614334 3300039437 Bacteria 3305
886 Ga0439461_0001830 3300041410 Bacteria 3346
887 Ga0439441_000116 3300042001 Bacteria 6525
888 Ga0450896_008703 3300042133 Bacteria 1410
889 Ga0439446_0060604 3300042156 Bacteria 1143
890 Ga0439435_0008479 3300042436 Bacteria 2383
891 Ga0439435_0014960 3300042436 Bacteria 1924
892 Ga0439460_0007421 3300042461 Bacteria 2742
893 Ga0451577_0209475 3300042876 Bacteria 1761
894 Ga0451577_0244960 3300042876 Bacteria 1622
895 Ga0466969_0016926 3300044656 Bacteria 3810
896 Ga0453683_0173079 3300044673 Bacteria 1368
897 Ga0466965_0009563 3300044683 Bacteria 4507
898 Ga0466966_0018973 3300044684 Bacteria 4532
899 Ga0466961_0087899 3300044693 Bacteria 1963
900 Ga0466971_0028406 3300044719 Bacteria 2502
901 Ga0466959_0244136 3300045049 Bacteria 1239
902 Ga0451576_0051484 3300045051 Bacteria 4317
903 Ga0451576_0162159 3300045051 Bacteria 2334
904 Ga0451576_0422338 3300045051 Bacteria 1399
905 Ga0451576_0485017 3300045051 Bacteria 1298
906 Ga0466958_0048829 3300045836 Bacteria 2559
907 Ga0466967_0001049 3300045976 Bacteria 15200
908 Ga0495592_0000711 3300046454 Bacteria 23301
909 Ga0495603_0023863 3300046455 Bacteria 3700
910 Ga0495629_0074680 3300046459 Bacteria 2367
911 Ga0495629_0188846 3300046459 Bacteria 1426
912 Ga0495580_0071206 3300046472 Bacteria 2429
913 Ga0495662_0011906 3300046476 Bacteria 4251
914 Ga0495628_0001663 3300046516 Bacteria 20314
915 Ga0495630_0404662 3300046517 Bacteria 1046
916 Ga0495642_0251434 3300046528 Bacteria 773
917 Ga0495652_0004318 3300046529 Bacteria 13622
918 Ga0495665_0014048 3300046531 Bacteria 4324
919 Ga0495640_0313258 3300046533 Bacteria 973
920 Ga0495645_0001291 3300046543 Bacteria 17090
921 Ga0495645_0125988 3300046543 Bacteria 1799
922 Ga0495645_0174887 3300046543 Bacteria 1475
923 Ga0495667_0021442 3300046559 Bacteria 4360
924 Ga0495634_0077998 3300046642 Bacteria 2171
925 Ga0495635_0076517 3300046663 Bacteria 2293
926 Ga0495659_0016833 3300046664 Bacteria 2416
927 Ga0495588_0038495 3300046674 Bacteria 2433
928 Ga0495599_0001351 3300046678 Bacteria 14001
929 Ga0495647_0003600 3300046681 Bacteria 4968
930 Ga0495658_0052988 3300046683 Bacteria 2302
931 Ga0495600_0039369 3300046809 Bacteria 3078
932 Ga0495581_0000428 3300047315 Bacteria 21379
933 Ga0495680_0024970 3300047322 Bacteria 4949
934 Ga0495684_0077021 3300047471 Bacteria 2532
935 Ga0495684_0326176 3300047471 Bacteria 1096
936 Ga0495614_0011142 3300048089 Bacteria 3957
937 Ga0496100_0305132 3300048903 Bacteria 1192
938 Ga0496101_0052367 3300048904 Bacteria 2943
939 Ga0496101_0131533 3300048904 Bacteria 1900
940 Ga0496102_0047644 3300048905 Bacteria 3896
941 Ga0496102_0109864 3300048905 Bacteria 2570
942 Ga0496104_0008934 3300048907 Bacteria 8906
943 Ga0496104_0273506 3300048907 Bacteria 1602
944 Ga0496105_0020136 3300048908 Bacteria 5387
945 Ga0496105_0205335 3300048908 Bacteria 1607
946 Ga0496106_0009881 3300048909 Bacteria 7043
947 Ga0496106_0288770 3300048909 Bacteria 1315
948 Ga0496106_0379166 3300048909 Bacteria 1136
949 Ga0496107_0005246 3300048910 Bacteria 8844
950 Ga0496107_0113805 3300048910 Bacteria 1990
951 Ga0496108_0007673 3300048911 Bacteria 8736
952 Ga0496108_0258668 3300048911 Bacteria 1515
953 Ga0496108_0776128 3300048911 Bacteria 828
954 Ga0496109_0004576 3300048912 Bacteria 11543
955 Ga0496109_0051045 3300048912 Bacteria 3767
956 Ga0496109_0165458 3300048912 Bacteria 2073
957 Ga0496109_0281233 3300048912 Bacteria 1568
958 Ga0496110_0009595 3300048913 Bacteria 7833
959 Ga0496110_0098431 3300048913 Bacteria 2621
960 Ga0496110_0413349 3300048913 Bacteria 1230
961 Ga0496110_0615931 3300048913 Bacteria 984
962 Ga0496112_0070721 3300048915 Bacteria 3448
963 Ga0496112_0316424 3300048915 Bacteria 1505
964 Ga0496114_0121527 3300048917 Bacteria 2246
965 Ga0501034_0053868 3300049571 Bacteria 4050
966 Ga0501037_0095336 3300049573 Bacteria 2151
967 Ga0501038_0056483 3300049574 Bacteria 3371
968 Ga0501039_0048882 3300049575 Bacteria 3270
969 Ga0501040_0015144 3300049576 Bacteria 5095
970 Ga0501041_0012873 3300049577 Bacteria 4956
971 Ga0501041_0034122 3300049577 Bacteria 3081
972 Ga0501042_0039822 3300049578 Bacteria 3341
973 Ga0501042_0083239 3300049578 Bacteria 2294
974 Ga0501042_0093899 3300049578 Bacteria 2155
975 Ga0501046_0254081 3300049580 Bacteria 1293
976 Ga0501047_0141911 3300049581 Bacteria 2280
977 Ga0501048_0408809 3300049582 Bacteria 970
978 Ga0501068_0160653 3300049584 Bacteria 1416
979 Ga0501068_0209068 3300049584 Bacteria 1239
980 Ga0501069_0300568 3300049585 Bacteria 941
981 Ga0501069_0377594 3300049585 Bacteria 837
982 Ga0501071_0011960 3300049587 Bacteria 5863
983 Ga0501071_0097100 3300049587 Bacteria 2169
984 Ga0501072_0005486 3300049588 Bacteria 9656
985 Ga0501072_0043870 3300049588 Bacteria 3516
986 Ga0501073_0079883 3300049589 Bacteria 2276
987 Ga0501073_0100219 3300049589 Bacteria 2011
988 Ga0501073_0124510 3300049589 Bacteria 1787
989 Ga0501074_0051011 3300049590 Bacteria 2986
990 Ga0501074_0100336 3300049590 Bacteria 2072
991 Ga0501075_0022495 3300049591 Bacteria 4605
992 Ga0501075_0022605 3300049591 Bacteria 4595
993 Ga0501076_0017570 3300049592 Bacteria 5438
994 Ga0501076_0019108 3300049592 Bacteria 5231
995 Ga0501076_0061214 3300049592 Bacteria 2996
996 Ga0501077_0086648 3300049593 Bacteria 1985
997 Ga0501216_038488 3300049660 Bacteria 907
998 Ga0501079_0231182 3300049741 Bacteria 1444
999 Ga0501080_0017072 3300049742 Bacteria 6704
1000 Ga0501080_0057569 3300049742 Bacteria 3619
1001 Ga0501081_0043996 3300049743 Bacteria 3064
1002 Ga0501283_009322 3300049779 Bacteria 1429
1003 Ga0501045_0017955 3300049824 Bacteria 5024
1004 Ga0501045_0024324 3300049824 Bacteria 4348
1005 Ga0501045_0085799 3300049824 Bacteria 2324
1006 Ga0501045_0254582 3300049824 Bacteria 1307
1007 nmdc:mga0k408_4139_c1 3300050493 Bacteria 7703
1008 nmdc:mga05p37_12648_c1 3300050507 Bacteria 10081
1009 nmdc:mga09592_16924_c1 3300050508 Bacteria 5967
1010 nmdc:mga09592_72973_c1 3300050508 Bacteria 2916
1011 nmdc:mga0qj67_236455_c1 3300050509 Bacteria 1482
1012 nmdc:mga06r32_271528_c1 3300050510 Bacteria 1683
1013 nmdc:mga06r32_77800_c1 3300050510 Bacteria 3223
1014 nmdc:mga08y16_111854_c1 3300050511 Bacteria 2843
1015 nmdc:mga08y16_172275_c1 3300050511 Bacteria 2248
1016 nmdc:mga08y16_222801_c1 3300050511 Bacteria 1952
1017 nmdc:mga08y16_567992_c1 3300050511 Bacteria 1146
1018 nmdc:mga0n895_153747_c1 3300050512 Bacteria 2331
1019 nmdc:mga0n895_240727_c1 3300050512 Bacteria 1836
1020 nmdc:mga0n895_287847_c1 3300050512 Bacteria 1666
1021 nmdc:mga0n895_582121_c1 3300050512 Bacteria 1123
1022 nmdc:mga0n895_763351_c1 3300050512 Bacteria 959
1023 nmdc:mga0n895_83941_c1 3300050512 Bacteria 3178
1024 nmdc:mga0rr50_439911_c1 3300050513 Bacteria 1104
1025 nmdc:mga0rr50_454081_c1 3300050513 Bacteria 1086
1026 nmdc:mga08x19_103372_c1 3300050514 Bacteria 1892
1027 nmdc:mga08x19_107230_c1 3300050514 Bacteria 1859
1028 nmdc:mga08x19_426545_c1 3300050514 Bacteria 932
1029 nmdc:mga0a205_113116_c1 3300050515 Bacteria 2613
1030 nmdc:mga0a205_18359_c1 3300050515 Bacteria 6574
1031 nmdc:mga0a205_495975_c1 3300050515 Bacteria 1078
1032 Ga0495601_0005658 3300053077 Bacteria 7289
1033 Ga0495601_0017412 3300053077 Bacteria 4362
1034 Ga0495619_0019782 3300053085 Bacteria 4283
1035 Ga0495619_0189201 3300053085 Bacteria 1425
1036 Ga0501084_0079863 3300054114 Bacteria 2742
1037 Ga0590071_023203 3300059421 Bacteria 1466
1038 Ga0501082_0031776 3300060353 Bacteria 4553
1039 Ga0501082_0173491 3300060353 Bacteria 1875
1040 Ga0466962_0000421 3300061719 Bacteria 18318
1041 Ga0530510_0006768 3300061734 Bacteria 7987

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0408809 Ga0501048_0408809_10_603 196
2 3300050512 nmdc:mga0n895_763351_c1 nmdc:mga0n895_763351_c1_126_842 198
3 3300035695 Ga0373927_0082309 Ga0373927_0082309_526_1314 225
4 3300009551 Ga0105238_10499899 Ga0105238_104998992 230
5 3300046454 Ga0495592_0000711 Ga0495592_0000711_14903_15682 235
6 3300046516 Ga0495628_0001663 Ga0495628_0001663_11156_11935 235
7 3300046529 Ga0495652_0004318 Ga0495652_0004318_6240_7019 235
8 3300046543 Ga0495645_0001291 Ga0495645_0001291_11023_11802 235
9 3300046678 Ga0495599_0001351 Ga0495599_0001351_9349_10128 235
10 3300053077 Ga0495601_0005658 Ga0495601_0005658_4591_5370 235
11 3300005549 Ga0070704_100014002 Ga0070704_1000140022 238
12 3300049779 Ga0501283_009322 Ga0501283_009322_110_829 238
13 3300046528 Ga0495642_0251434 Ga0495642_0251434_26_745 239
14 3300049577 Ga0501041_0034122 Ga0501041_0034122_739_1461 239
15 3300049578 Ga0501042_0093899 Ga0501042_0093899_1229_1951 239
16 3300049587 Ga0501071_0097100 Ga0501071_0097100_343_1065 239
17 3300049824 Ga0501045_0254582 Ga0501045_0254582_118_840 239
18 3300009147 Ga0114129_11024070 Ga0114129_110240701 240
19 3300027682 Ga0209971_1007375 Ga0209971_10073754 240
20 3300027717 Ga0209998_10012548 Ga0209998_100125482 240
21 3300042001 Ga0439441_000116 Ga0439441_000116_104_889 240
22 3300045976 Ga0466967_0001049 Ga0466967_0001049_14157_14906 240
23 3300006844 Ga0075428_100107723 Ga0075428_1001077233 241
24 3300014325 Ga0163163_10100389 Ga0163163_101003894 241
25 3300005347 Ga0070668_100334024 Ga0070668_1003340242 242
26 3300005355 Ga0070671_100002054 Ga0070671_1000020544 242
27 3300009098 Ga0105245_10716880 Ga0105245_107168802 242
28 3300025931 Ga0207644_10019180 Ga0207644_100191803 243
29 3300026089 Ga0207648_10422947 Ga0207648_104229471 243
30 3300031548 Ga0307408_100075280 Ga0307408_1000752802 243
31 3300031911 Ga0307412_10030282 Ga0307412_100302824 243
32 3300032004 Ga0307414_10397975 Ga0307414_103979751 243
33 3300046543 Ga0495645_0125988 Ga0495645_0125988_443_1231 243
34 3300053077 Ga0495601_0017412 Ga0495601_0017412_3501_4289 243
35 3300005618 Ga0068864_100302402 Ga0068864_1003024023 247
36 3300005841 Ga0068863_100101671 Ga0068863_1001016713 247
37 3300025925 Ga0207650_10450989 Ga0207650_104509892 247
38 3300026095 Ga0207676_10249897 Ga0207676_102498972 247
39 3300006844 Ga0075428_100010320 Ga0075428_1000103204 248
40 3300006846 Ga0075430_100213379 Ga0075430_1002133792 248
41 3300006880 Ga0075429_100034410 Ga0075429_1000344102 248
42 3300009147 Ga0114129_10056041 Ga0114129_100560413 248
43 3300025924 Ga0207694_10519609 Ga0207694_105196092 248
44 3300027471 Ga0209995_1007358 Ga0209995_10073581 248
45 3300032005 Ga0307411_10034751 Ga0307411_100347514 248
46 3300042436 Ga0439435_0008479 Ga0439435_0008479_1616_2365 248
47 3300042461 Ga0439460_0007421 Ga0439460_0007421_1793_2542 248
48 3300049660 Ga0501216_038488 Ga0501216_038488_54_803 248
49 3300050508 nmdc:mga09592_72973_c1 nmdc:mga09592_72973_c1_532_1281 248
50 3300005354 Ga0070675_100004965 Ga0070675_1000049659 249
51 3300006844 Ga0075428_100084684 Ga0075428_1000846843 249
52 3300006847 Ga0075431_100019537 Ga0075431_1000195375 249
53 3300006880 Ga0075429_100000175 Ga0075429_1000001757 249
54 3300009147 Ga0114129_10046258 Ga0114129_100462583 249
55 3300025901 Ga0207688_10171422 Ga0207688_101714222 249
56 3300025925 Ga0207650_10031990 Ga0207650_100319902 249
57 3300025926 Ga0207659_10062877 Ga0207659_100628772 249
58 3300025940 Ga0207691_10084355 Ga0207691_100843553 249
59 3300026089 Ga0207648_10251926 Ga0207648_102519262 249
60 3300026121 Ga0207683_10384386 Ga0207683_103843862 249
61 3300027395 Ga0209996_1009615 Ga0209996_10096152 249
62 3300027682 Ga0209971_1033627 Ga0209971_10336272 249
63 3300028379 Ga0268266_10063084 Ga0268266_100630843 249
64 3300035117 Ga0373953_0018437 Ga0373953_0018437_1169_1954 249
65 3300035120 Ga0373957_0038473 Ga0373957_0038473_228_1013 249
66 3300035242 Ga0373962_0071153 Ga0373962_0071153_38_787 249
67 3300036401 Ga0373937_0007010 Ga0373937_0007010_1777_2562 249
68 3300044673 Ga0453683_0173079 Ga0453683_0173079_42_791 249
69 3300050507 nmdc:mga05p37_12648_c1 nmdc:mga05p37_12648_c1_8541_9290 249
70 3300050508 nmdc:mga09592_16924_c1 nmdc:mga09592_16924_c1_4063_4812 249
71 3300050510 nmdc:mga06r32_77800_c1 nmdc:mga06r32_77800_c1_1054_1803 249
72 3300050511 nmdc:mga08y16_222801_c1 nmdc:mga08y16_222801_c1_737_1531 249
73 3300059421 Ga0590071_023203 Ga0590071_023203_667_1419 249
74 3300005334 Ga0068869_100002553 Ga0068869_10000255310 250
75 3300005335 Ga0070666_10096294 Ga0070666_100962941 250
76 3300005338 Ga0068868_100029854 Ga0068868_1000298545 250
77 3300005338 Ga0068868_100057869 Ga0068868_1000578694 250
78 3300005344 Ga0070661_100090424 Ga0070661_1000904243 250
79 3300005345 Ga0070692_10016897 Ga0070692_100168973 250
80 3300005347 Ga0070668_100322569 Ga0070668_1003225691 250
81 3300005353 Ga0070669_100162155 Ga0070669_1001621552 250
82 3300005354 Ga0070675_100309694 Ga0070675_1003096941 250
83 3300005367 Ga0070667_100002979 Ga0070667_1000029797 250
84 3300005406 Ga0070703_10011705 Ga0070703_100117052 250
85 3300005436 Ga0070713_100001967 Ga0070713_1000019673 250
86 3300005441 Ga0070700_100144855 Ga0070700_1001448553 250
87 3300005444 Ga0070694_100023264 Ga0070694_1000232642 250
88 3300005444 Ga0070694_100097376 Ga0070694_1000973762 250
89 3300005445 Ga0070708_100034792 Ga0070708_1000347925 250
90 3300005457 Ga0070662_100060315 Ga0070662_1000603153 250
91 3300005457 Ga0070662_100264419 Ga0070662_1002644192 250
92 3300005459 Ga0068867_100002252 Ga0068867_10000225215 250
93 3300005467 Ga0070706_100056378 Ga0070706_1000563782 250
94 3300005518 Ga0070699_100002810 Ga0070699_1000028105 250
95 3300005530 Ga0070679_100188946 Ga0070679_1001889461 250
96 3300005535 Ga0070684_100106172 Ga0070684_1001061722 250
97 3300005536 Ga0070697_100533234 Ga0070697_1005332341 250
98 3300005539 Ga0068853_100330484 Ga0068853_1003304842 250
99 3300005545 Ga0070695_100011248 Ga0070695_1000112483 250
100 3300005546 Ga0070696_100066883 Ga0070696_1000668832 250
101 3300005547 Ga0070693_100127465 Ga0070693_1001274652 250
102 3300005549 Ga0070704_100026382 Ga0070704_1000263822 250
103 3300005563 Ga0068855_100402743 Ga0068855_1004027432 250
104 3300005577 Ga0068857_100030274 Ga0068857_1000302742 250
105 3300005578 Ga0068854_100373897 Ga0068854_1003738972 250
106 3300005616 Ga0068852_100090719 Ga0068852_1000907194 250
107 3300005617 Ga0068859_100002682 Ga0068859_10000268214 250
108 3300005618 Ga0068864_100003419 Ga0068864_10000341910 250
109 3300005719 Ga0068861_100000930 Ga0068861_1000009307 250
110 3300005834 Ga0068851_10008843 Ga0068851_100088433 250
111 3300005840 Ga0068870_10011298 Ga0068870_100112985 250
112 3300005841 Ga0068863_100002938 Ga0068863_10000293814 250
113 3300005842 Ga0068858_100008579 Ga0068858_1000085795 250
114 3300005843 Ga0068860_100018869 Ga0068860_1000188692 250
115 3300006881 Ga0068865_100394832 Ga0068865_1003948321 250
116 3300006914 Ga0075436_100022726 Ga0075436_1000227262 250
117 3300006931 Ga0097620_100002682 Ga0097620_10000268214 250
118 3300009098 Ga0105245_10030966 Ga0105245_100309665 250
119 3300009098 Ga0105245_10108538 Ga0105245_101085381 250
120 3300009148 Ga0105243_10307794 Ga0105243_103077942 250
121 3300009177 Ga0105248_10011976 Ga0105248_100119762 250
122 3300009545 Ga0105237_10042280 Ga0105237_100422805 250
123 3300010375 Ga0105239_10458469 Ga0105239_104584692 250
124 3300011119 Ga0105246_10119689 Ga0105246_101196892 250
125 3300013104 Ga0157370_10039006 Ga0157370_100390063 250
126 3300013105 Ga0157369_10151720 Ga0157369_101517203 250
127 3300013297 Ga0157378_10123850 Ga0157378_101238502 250
128 3300013307 Ga0157372_10750287 Ga0157372_107502871 250
129 3300014326 Ga0157380_10083960 Ga0157380_100839602 250
130 3300025898 Ga0207692_10132069 Ga0207692_101320692 250
131 3300025903 Ga0207680_10322419 Ga0207680_103224192 250
132 3300025907 Ga0207645_10041702 Ga0207645_100417023 250
133 3300025908 Ga0207643_10015525 Ga0207643_100155255 250
134 3300025910 Ga0207684_10553508 Ga0207684_105535082 250
135 3300025911 Ga0207654_10028623 Ga0207654_100286235 250
136 3300025914 Ga0207671_10311892 Ga0207671_103118922 250
137 3300025915 Ga0207693_10226978 Ga0207693_102269782 250
138 3300025919 Ga0207657_10018126 Ga0207657_100181264 250
139 3300025920 Ga0207649_10151367 Ga0207649_101513672 250
140 3300025925 Ga0207650_10550446 Ga0207650_105504461 250
141 3300025928 Ga0207700_10002711 Ga0207700_100027113 250
142 3300025932 Ga0207690_10114046 Ga0207690_101140462 250
143 3300025933 Ga0207706_10068549 Ga0207706_100685493 250
144 3300025935 Ga0207709_10190176 Ga0207709_101901762 250
145 3300025939 Ga0207665_10022565 Ga0207665_100225655 250
146 3300025941 Ga0207711_10267141 Ga0207711_102671412 250
147 3300025942 Ga0207689_10000066 Ga0207689_1000006615 250
148 3300025942 Ga0207689_10234290 Ga0207689_102342902 250
149 3300025944 Ga0207661_10170759 Ga0207661_101707592 250
150 3300025949 Ga0207667_10492828 Ga0207667_104928281 250
151 3300025972 Ga0207668_10422234 Ga0207668_104222342 250
152 3300025981 Ga0207640_10161768 Ga0207640_101617683 250
153 3300025986 Ga0207658_10403883 Ga0207658_104038832 250
154 3300026023 Ga0207677_10269476 Ga0207677_102694762 250
155 3300026023 Ga0207677_10303435 Ga0207677_103034352 250
156 3300026035 Ga0207703_10007367 Ga0207703_100073679 250
157 3300026075 Ga0207708_10216938 Ga0207708_102169381 250
158 3300026078 Ga0207702_10095911 Ga0207702_100959113 250
159 3300026089 Ga0207648_10007292 Ga0207648_100072927 250
160 3300026089 Ga0207648_10075672 Ga0207648_100756723 250
161 3300026095 Ga0207676_10001121 Ga0207676_1000112115 250
162 3300026116 Ga0207674_10003215 Ga0207674_100032155 250
163 3300026118 Ga0207675_100005143 Ga0207675_1000051437 250
164 3300026142 Ga0207698_10166923 Ga0207698_101669232 250
165 3300028380 Ga0268265_10261357 Ga0268265_102613572 250
166 3300028381 Ga0268264_10003053 Ga0268264_100030533 250
167 3300048905 Ga0496102_0109864 Ga0496102_0109864_424_1224 250
168 3300048910 Ga0496107_0113805 Ga0496107_0113805_465_1349 250
169 3300048912 Ga0496109_0281233 Ga0496109_0281233_367_1167 250
170 3300050514 nmdc:mga08x19_426545_c1 nmdc:mga08x19_426545_c1_16_894 250
171 3300005440 Ga0070705_100360792 Ga0070705_1003607921 251
172 3300005445 Ga0070708_100102774 Ga0070708_1001027743 251
173 3300005467 Ga0070706_100040808 Ga0070706_1000408083 251
174 3300005536 Ga0070697_100007116 Ga0070697_1000071166 251
175 3300005546 Ga0070696_100358700 Ga0070696_1003587002 251
176 3300005549 Ga0070704_100078596 Ga0070704_1000785962 251
177 3300025910 Ga0207684_10061016 Ga0207684_100610162 251
178 3300049589 Ga0501073_0100219 Ga0501073_0100219_181_963 251
179 3300049742 Ga0501080_0057569 Ga0501080_0057569_1645_2427 251
180 3300013297 Ga0157378_10672319 Ga0157378_106723191 252
181 3300031852 Ga0307410_10051735 Ga0307410_100517352 252
182 3300031995 Ga0307409_100034813 Ga0307409_1000348134 252
183 3300032002 Ga0307416_100770557 Ga0307416_1007705572 252
184 3300035695 Ga0373927_0018269 Ga0373927_0018269_1923_2711 252
185 3300005618 Ga0068864_100401908 Ga0068864_1004019082 253
186 3300005842 Ga0068858_100601281 Ga0068858_1006012812 253
187 3300006852 Ga0075433_10139232 Ga0075433_101392323 253
188 3300026035 Ga0207703_10424048 Ga0207703_104240482 253
189 3300035692 Ga0373935_0028283 Ga0373935_0028283_1389_2177 253
190 3300050511 nmdc:mga08y16_567992_c1 nmdc:mga08y16_567992_c1_29_811 253
191 3300005290 Ga0065712_10026653 Ga0065712_100266531 254
192 3300005328 Ga0070676_10340738 Ga0070676_103407382 254
193 3300005330 Ga0070690_100139830 Ga0070690_1001398301 254
194 3300005331 Ga0070670_100287364 Ga0070670_1002873642 254
195 3300005335 Ga0070666_10029575 Ga0070666_100295753 254
196 3300005340 Ga0070689_100123480 Ga0070689_1001234803 254
197 3300005354 Ga0070675_100751310 Ga0070675_1007513101 254
198 3300005364 Ga0070673_100001547 Ga0070673_1000015472 254
199 3300005365 Ga0070688_100057364 Ga0070688_1000573641 254
200 3300005367 Ga0070667_100181683 Ga0070667_1001816832 254
201 3300005436 Ga0070713_100016486 Ga0070713_1000164862 254
202 3300005440 Ga0070705_100085793 Ga0070705_1000857932 254
203 3300005456 Ga0070678_100004102 Ga0070678_1000041027 254
204 3300005466 Ga0070685_10001891 Ga0070685_100018914 254
205 3300005543 Ga0070672_100084812 Ga0070672_1000848121 254
206 3300005544 Ga0070686_100016443 Ga0070686_1000164432 254
207 3300005546 Ga0070696_100056927 Ga0070696_1000569273 254
208 3300005547 Ga0070693_100006875 Ga0070693_1000068754 254
209 3300005548 Ga0070665_100005936 Ga0070665_1000059363 254
210 3300005564 Ga0070664_100152650 Ga0070664_1001526502 254
211 3300005578 Ga0068854_100141712 Ga0068854_1001417122 254
212 3300005614 Ga0068856_100044836 Ga0068856_1000448363 254
213 3300005615 Ga0070702_100094957 Ga0070702_1000949572 254
214 3300005617 Ga0068859_100091024 Ga0068859_1000910245 254
215 3300005834 Ga0068851_10079555 Ga0068851_100795552 254
216 3300005841 Ga0068863_100140224 Ga0068863_1001402242 254
217 3300006173 Ga0070716_100034262 Ga0070716_1000342623 254
218 3300006175 Ga0070712_100058044 Ga0070712_1000580443 254
219 3300006237 Ga0097621_100015241 Ga0097621_1000152416 254
220 3300006358 Ga0068871_100158004 Ga0068871_1001580042 254
221 3300006871 Ga0075434_100292901 Ga0075434_1002929011 254
222 3300006881 Ga0068865_100214888 Ga0068865_1002148882 254
223 3300006931 Ga0097620_100091021 Ga0097620_1000910215 254
224 3300009098 Ga0105245_10021563 Ga0105245_100215637 254
225 3300009101 Ga0105247_10018828 Ga0105247_100188283 254
226 3300009176 Ga0105242_10009513 Ga0105242_100095135 254
227 3300009176 Ga0105242_10044321 Ga0105242_100443215 254
228 3300009177 Ga0105248_10165601 Ga0105248_101656012 254
229 3300009553 Ga0105249_10309895 Ga0105249_103098952 254
230 3300011119 Ga0105246_10328817 Ga0105246_103288172 254
231 3300013297 Ga0157378_10012711 Ga0157378_100127117 254
232 3300013297 Ga0157378_10129837 Ga0157378_101298373 254
233 3300013306 Ga0163162_10008387 Ga0163162_100083878 254
234 3300013306 Ga0163162_10217241 Ga0163162_102172412 254
235 3300013308 Ga0157375_10019692 Ga0157375_100196926 254
236 3300014325 Ga0163163_10018845 Ga0163163_100188453 254
237 3300014968 Ga0157379_10023178 Ga0157379_100231785 254
238 3300017792 Ga0163161_10548064 Ga0163161_105480641 254
239 3300025321 Ga0207656_10040771 Ga0207656_100407712 254
240 3300025898 Ga0207692_10005904 Ga0207692_100059042 254
241 3300025899 Ga0207642_10031819 Ga0207642_100318193 254
242 3300025900 Ga0207710_10089917 Ga0207710_100899173 254
243 3300025907 Ga0207645_10158198 Ga0207645_101581982 254
244 3300025915 Ga0207693_10000070 Ga0207693_1000007076 254
245 3300025924 Ga0207694_10277570 Ga0207694_102775702 254
246 3300025925 Ga0207650_10045310 Ga0207650_100453103 254
247 3300025926 Ga0207659_10557973 Ga0207659_105579732 254
248 3300025928 Ga0207700_10008158 Ga0207700_100081587 254
249 3300025933 Ga0207706_10003500 Ga0207706_1000350018 254
250 3300025939 Ga0207665_10024165 Ga0207665_100241655 254
251 3300025940 Ga0207691_10100420 Ga0207691_101004201 254
252 3300025941 Ga0207711_10003675 Ga0207711_100036755 254
253 3300025945 Ga0207679_10295983 Ga0207679_102959832 254
254 3300025981 Ga0207640_10102928 Ga0207640_101029282 254
255 3300026023 Ga0207677_10000509 Ga0207677_1000050917 254
256 3300026035 Ga0207703_10041493 Ga0207703_100414932 254
257 3300026067 Ga0207678_10159463 Ga0207678_101594632 254
258 3300026088 Ga0207641_10081947 Ga0207641_100819473 254
259 3300026095 Ga0207676_10069163 Ga0207676_100691633 254
260 3300026118 Ga0207675_100120329 Ga0207675_1001203292 254
261 3300026121 Ga0207683_10000448 Ga0207683_1000044825 254
262 3300028379 Ga0268266_10034794 Ga0268266_100347944 254
263 3300035083 Ga0373926_0123227 Ga0373926_0123227_79_867 254
264 3300035086 Ga0373934_0007738 Ga0373934_0007738_1264_2052 254
265 3300035089 Ga0373944_0008903 Ga0373944_0008903_429_1217 254
266 3300035111 Ga0373923_0093502 Ga0373923_0093502_179_967 254
267 3300035695 Ga0373927_0084882 Ga0373927_0084882_479_1267 254
268 3300036401 Ga0373937_0051347 Ga0373937_0051347_1288_2076 254
269 3300037068 Ga0373925_0045702 Ga0373925_0045702_830_1618 254
270 3300046664 Ga0495659_0016833 Ga0495659_0016833_667_1455 254
271 3300047471 Ga0495684_0326176 Ga0495684_0326176_194_982 254
272 3300048904 Ga0496101_0052367 Ga0496101_0052367_2080_2868 254
273 3300048907 Ga0496104_0008934 Ga0496104_0008934_4660_5448 254
274 3300048908 Ga0496105_0020136 Ga0496105_0020136_283_1071 254
275 3300048909 Ga0496106_0288770 Ga0496106_0288770_384_1172 254
276 3300048911 Ga0496108_0776128 Ga0496108_0776128_29_817 254
277 3300048912 Ga0496109_0165458 Ga0496109_0165458_324_1112 254
278 3300048913 Ga0496110_0615931 Ga0496110_0615931_59_847 254
279 3300048915 Ga0496112_0316424 Ga0496112_0316424_545_1333 254
280 3300050512 nmdc:mga0n895_582121_c1 nmdc:mga0n895_582121_c1_77_955 254
281 3300005328 Ga0070676_10000545 Ga0070676_100005459 255
282 3300005330 Ga0070690_100016791 Ga0070690_1000167915 255
283 3300005333 Ga0070677_10119846 Ga0070677_101198462 255
284 3300005335 Ga0070666_10002371 Ga0070666_100023716 255
285 3300005338 Ga0068868_100232934 Ga0068868_1002329342 255
286 3300005347 Ga0070668_100000206 Ga0070668_10000020636 255
287 3300005353 Ga0070669_100031588 Ga0070669_1000315884 255
288 3300005354 Ga0070675_100001498 Ga0070675_1000014987 255
289 3300005355 Ga0070671_100015348 Ga0070671_1000153485 255
290 3300005364 Ga0070673_100140304 Ga0070673_1001403042 255
291 3300005365 Ga0070688_100025653 Ga0070688_1000256532 255
292 3300005367 Ga0070667_100001933 Ga0070667_10000193320 255
293 3300005455 Ga0070663_100266308 Ga0070663_1002663082 255
294 3300005456 Ga0070678_100000259 Ga0070678_10000025910 255
295 3300005459 Ga0068867_100001543 Ga0068867_1000015437 255
296 3300005466 Ga0070685_10057686 Ga0070685_100576862 255
297 3300005543 Ga0070672_100000960 Ga0070672_1000009607 255
298 3300005548 Ga0070665_100002580 Ga0070665_10000258019 255
299 3300005617 Ga0068859_100001177 Ga0068859_10000117710 255
300 3300005618 Ga0068864_100002535 Ga0068864_1000025357 255
301 3300005842 Ga0068858_100025315 Ga0068858_1000253153 255
302 3300005843 Ga0068860_100001191 Ga0068860_1000011913 255
303 3300005844 Ga0068862_100047830 Ga0068862_1000478304 255
304 3300006237 Ga0097621_100000696 Ga0097621_10000069614 255
305 3300006358 Ga0068871_100000472 Ga0068871_10000047210 255
306 3300006881 Ga0068865_100073431 Ga0068865_1000734313 255
307 3300006931 Ga0097620_100001177 Ga0097620_10000117717 255
308 3300009177 Ga0105248_10001670 Ga0105248_100016707 255
309 3300013296 Ga0157374_10002207 Ga0157374_1000220711 255
310 3300013306 Ga0163162_10000619 Ga0163162_1000061929 255
311 3300013308 Ga0157375_10003009 Ga0157375_100030097 255
312 3300014325 Ga0163163_10186639 Ga0163163_101866392 255
313 3300014968 Ga0157379_10001443 Ga0157379_1000144312 255
314 3300014969 Ga0157376_10050661 Ga0157376_100506612 255
315 3300026095 Ga0207676_10252263 Ga0207676_102522632 255
316 3300031824 Ga0307413_10019256 Ga0307413_100192564 256
317 3300035170 Ga0373943_0034999 Ga0373943_0034999_1040_1828 256
318 3300042133 Ga0450896_008703 Ga0450896_008703_546_1334 256
319 3300025315 Ga0207697_10008287 Ga0207697_100082875 257
320 3300025893 Ga0207682_10151509 Ga0207682_101515092 257
321 3300025903 Ga0207680_10001163 Ga0207680_100011637 257
322 3300025907 Ga0207645_10000095 Ga0207645_1000009552 257
323 3300025923 Ga0207681_10005063 Ga0207681_100050634 257
324 3300025926 Ga0207659_10016534 Ga0207659_100165344 257
325 3300025931 Ga0207644_10025898 Ga0207644_100258985 257
326 3300025938 Ga0207704_10040558 Ga0207704_100405583 257
327 3300025940 Ga0207691_10000488 Ga0207691_1000048819 257
328 3300025941 Ga0207711_10006583 Ga0207711_100065835 257
329 3300025960 Ga0207651_10002560 Ga0207651_100025606 257
330 3300025972 Ga0207668_10003885 Ga0207668_100038855 257
331 3300025986 Ga0207658_10002734 Ga0207658_100027347 257
332 3300026023 Ga0207677_10010048 Ga0207677_100100482 257
333 3300026035 Ga0207703_10002220 Ga0207703_100022208 257
334 3300026067 Ga0207678_10296964 Ga0207678_102969642 257
335 3300026088 Ga0207641_10001273 Ga0207641_100012737 257
336 3300026089 Ga0207648_10000324 Ga0207648_1000032445 257
337 3300026121 Ga0207683_10000109 Ga0207683_1000010939 257
338 3300028379 Ga0268266_10006219 Ga0268266_100062197 257
339 3300028380 Ga0268265_10061720 Ga0268265_100617202 257
340 3300028381 Ga0268264_10040223 Ga0268264_100402234 257
341 3300031903 Ga0307407_10197414 Ga0307407_101974142 257
342 3300032005 Ga0307411_10059616 Ga0307411_100596162 257
343 3300048912 Ga0496109_0051045 Ga0496109_0051045_1635_2435 257
344 3300048913 Ga0496110_0098431 Ga0496110_0098431_273_1073 257
345 3300048917 Ga0496114_0121527 Ga0496114_0121527_435_1235 257
346 3300049573 Ga0501037_0095336 Ga0501037_0095336_1166_1948 257
347 3300049574 Ga0501038_0056483 Ga0501038_0056483_1134_1916 257
348 3300049575 Ga0501039_0048882 Ga0501039_0048882_1960_2742 257
349 3300049576 Ga0501040_0015144 Ga0501040_0015144_1571_2353 257
350 3300049577 Ga0501041_0012873 Ga0501041_0012873_833_1615 257
351 3300049578 Ga0501042_0039822 Ga0501042_0039822_1669_2451 257
352 3300049578 Ga0501042_0083239 Ga0501042_0083239_965_1747 257
353 3300049580 Ga0501046_0254081 Ga0501046_0254081_223_1005 257
354 3300049584 Ga0501068_0160653 Ga0501068_0160653_415_1197 257
355 3300049587 Ga0501071_0011960 Ga0501071_0011960_1857_2639 257
356 3300049588 Ga0501072_0005486 Ga0501072_0005486_821_1603 257
357 3300049588 Ga0501072_0043870 Ga0501072_0043870_2530_3312 257
358 3300049589 Ga0501073_0124510 Ga0501073_0124510_950_1732 257
359 3300049590 Ga0501074_0100336 Ga0501074_0100336_760_1542 257
360 3300049591 Ga0501075_0022495 Ga0501075_0022495_3189_3971 257
361 3300049591 Ga0501075_0022605 Ga0501075_0022605_1277_2059 257
362 3300049592 Ga0501076_0017570 Ga0501076_0017570_1566_2348 257
363 3300049592 Ga0501076_0019108 Ga0501076_0019108_2937_3719 257
364 3300049593 Ga0501077_0086648 Ga0501077_0086648_155_937 257
365 3300049741 Ga0501079_0231182 Ga0501079_0231182_30_812 257
366 3300049742 Ga0501080_0017072 Ga0501080_0017072_3272_4054 257
367 3300049743 Ga0501081_0043996 Ga0501081_0043996_914_1696 257
368 3300049824 Ga0501045_0017955 Ga0501045_0017955_1623_2405 257
369 3300049824 Ga0501045_0024324 Ga0501045_0024324_2767_3549 257
370 3300054114 Ga0501084_0079863 Ga0501084_0079863_17_799 257
371 3300060353 Ga0501082_0031776 Ga0501082_0031776_2290_3072 257
372 3300061734 Ga0530510_0006768 Ga0530510_0006768_3020_3802 257
373 3300005466 Ga0070685_10324771 Ga0070685_103247711 258
374 3300035410 Ga0373924_0007020 Ga0373924_0007020_2876_3661 258
375 3300045836 Ga0466958_0048829 Ga0466958_0048829_631_1416 258
376 3300050493 nmdc:mga0k408_4139_c1 nmdc:mga0k408_4139_c1_1643_2425 258
377 3300005336 Ga0070680_100049152 Ga0070680_1000491524 260
378 3300005367 Ga0070667_100049464 Ga0070667_1000494644 260
379 3300005435 Ga0070714_100127254 Ga0070714_1001272544 260
380 3300005436 Ga0070713_100254758 Ga0070713_1002547582 260
381 3300005458 Ga0070681_10004606 Ga0070681_100046067 260
382 3300005530 Ga0070679_100031838 Ga0070679_1000318386 260
383 3300005539 Ga0068853_100075502 Ga0068853_1000755024 260
384 3300005563 Ga0068855_100026941 Ga0068855_1000269419 260
385 3300005614 Ga0068856_100023886 Ga0068856_1000238862 260
386 3300005617 Ga0068859_100209166 Ga0068859_1002091663 260
387 3300006931 Ga0097620_100209170 Ga0097620_1002091703 260
388 3300009093 Ga0105240_10045447 Ga0105240_100454475 260
389 3300013104 Ga0157370_10134194 Ga0157370_101341942 260
390 3300013105 Ga0157369_10236246 Ga0157369_102362461 260
391 3300013307 Ga0157372_10045381 Ga0157372_100453816 260
392 3300025912 Ga0207707_10004319 Ga0207707_100043194 260
393 3300025917 Ga0207660_10138111 Ga0207660_101381112 260
394 3300025920 Ga0207649_10029299 Ga0207649_100292994 260
395 3300025921 Ga0207652_10077355 Ga0207652_100773554 260
396 3300025924 Ga0207694_10328029 Ga0207694_103280292 260
397 3300025929 Ga0207664_10076261 Ga0207664_100762614 260
398 3300025945 Ga0207679_10047362 Ga0207679_100473622 260
399 3300025949 Ga0207667_10133835 Ga0207667_101338352 260
400 3300025981 Ga0207640_10194037 Ga0207640_101940372 260
401 3300026041 Ga0207639_10167299 Ga0207639_101672992 260
402 3300026078 Ga0207702_10007617 Ga0207702_1000761711 260
403 3300031665 Ga0316575_10044862 Ga0316575_100448623 260
404 3300035398 Ga0316574_0001281 Ga0316574_0001281_8903_9685 260
405 3300042876 Ga0451577_0209475 Ga0451577_0209475_722_1504 260
406 3300045051 Ga0451576_0422338 Ga0451576_0422338_297_1079 260
407 3300005335 Ga0070666_10333214 Ga0070666_103332142 261
408 3300005339 Ga0070660_100013019 Ga0070660_1000130192 261
409 3300005340 Ga0070689_100396085 Ga0070689_1003960852 261
410 3300005343 Ga0070687_100274129 Ga0070687_1002741292 261
411 3300005344 Ga0070661_100011229 Ga0070661_1000112297 261
412 3300005347 Ga0070668_100340424 Ga0070668_1003404241 261
413 3300005354 Ga0070675_100020158 Ga0070675_1000201586 261
414 3300005355 Ga0070671_100393186 Ga0070671_1003931861 261
415 3300005364 Ga0070673_100014398 Ga0070673_1000143982 261
416 3300005366 Ga0070659_100002218 Ga0070659_10000221814 261
417 3300005440 Ga0070705_100176305 Ga0070705_1001763052 261
418 3300005457 Ga0070662_100000582 Ga0070662_10000058214 261
419 3300005458 Ga0070681_10160385 Ga0070681_101603852 261
420 3300005471 Ga0070698_100198187 Ga0070698_1001981873 261
421 3300005530 Ga0070679_100252229 Ga0070679_1002522292 261
422 3300005539 Ga0068853_100018287 Ga0068853_1000182872 261
423 3300005549 Ga0070704_100032975 Ga0070704_1000329752 261
424 3300005563 Ga0068855_100005529 Ga0068855_1000055292 261
425 3300005564 Ga0070664_100002314 Ga0070664_1000023142 261
426 3300005564 Ga0070664_100140654 Ga0070664_1001406542 261
427 3300005578 Ga0068854_100009659 Ga0068854_1000096592 261
428 3300005614 Ga0068856_100000093 Ga0068856_1000000939 261
429 3300005616 Ga0068852_100035485 Ga0068852_1000354852 261
430 3300005617 Ga0068859_100010733 Ga0068859_1000107338 261
431 3300005842 Ga0068858_100771939 Ga0068858_1007719392 261
432 3300006847 Ga0075431_100024857 Ga0075431_1000248573 261
433 3300006931 Ga0097620_100010733 Ga0097620_1000107338 261
434 3300009094 Ga0111539_10331248 Ga0111539_103312482 261
435 3300009094 Ga0111539_10659496 Ga0111539_106594962 261
436 3300009174 Ga0105241_10415779 Ga0105241_104157792 261
437 3300009176 Ga0105242_10459533 Ga0105242_104595332 261
438 3300009553 Ga0105249_10188497 Ga0105249_101884972 261
439 3300013100 Ga0157373_10001205 Ga0157373_100012057 261
440 3300013102 Ga0157371_10000228 Ga0157371_1000022815 261
441 3300013104 Ga0157370_10020629 Ga0157370_100206294 261
442 3300013105 Ga0157369_10100242 Ga0157369_101002425 261
443 3300013307 Ga0157372_10009636 Ga0157372_100096366 261
444 3300025885 Ga0207653_10045344 Ga0207653_100453442 261
445 3300025912 Ga0207707_10131617 Ga0207707_101316172 261
446 3300025919 Ga0207657_10000645 Ga0207657_1000064519 261
447 3300025920 Ga0207649_10030611 Ga0207649_100306111 261
448 3300025920 Ga0207649_10116236 Ga0207649_101162362 261
449 3300025922 Ga0207646_10119191 Ga0207646_101191912 261
450 3300025926 Ga0207659_10027681 Ga0207659_100276812 261
451 3300025931 Ga0207644_10141927 Ga0207644_101419272 261
452 3300025932 Ga0207690_10000461 Ga0207690_1000046124 261
453 3300025933 Ga0207706_10000014 Ga0207706_1000001465 261
454 3300025936 Ga0207670_10384997 Ga0207670_103849971 261
455 3300025940 Ga0207691_10026704 Ga0207691_100267046 261
456 3300025945 Ga0207679_10016970 Ga0207679_100169706 261
457 3300025945 Ga0207679_10149368 Ga0207679_101493682 261
458 3300025949 Ga0207667_10004276 Ga0207667_1000427614 261
459 3300025981 Ga0207640_10110004 Ga0207640_101100042 261
460 3300025986 Ga0207658_10606902 Ga0207658_106069021 261
461 3300026035 Ga0207703_10743375 Ga0207703_107433751 261
462 3300026041 Ga0207639_10042662 Ga0207639_100426622 261
463 3300026078 Ga0207702_10006446 Ga0207702_100064466 261
464 3300026121 Ga0207683_10260185 Ga0207683_102601852 261
465 3300026142 Ga0207698_10027547 Ga0207698_100275474 261
466 3300027364 Ga0209967_1003926 Ga0209967_10039263 261
467 3300027471 Ga0209995_1004680 Ga0209995_10046803 261
468 3300027876 Ga0209974_10081434 Ga0209974_100814342 261
469 3300027907 Ga0207428_10289644 Ga0207428_102896442 261
470 3300028380 Ga0268265_10250419 Ga0268265_102504192 261
471 3300031548 Ga0307408_100024299 Ga0307408_1000242992 261
472 3300031731 Ga0307405_10029581 Ga0307405_100295814 261
473 3300031824 Ga0307413_10101746 Ga0307413_101017462 261
474 3300031901 Ga0307406_10011440 Ga0307406_100114405 261
475 3300031903 Ga0307407_10079432 Ga0307407_100794322 261
476 3300031911 Ga0307412_10025898 Ga0307412_100258985 261
477 3300031995 Ga0307409_100143631 Ga0307409_1001436312 261
478 3300032002 Ga0307416_100044964 Ga0307416_1000449642 261
479 3300032002 Ga0307416_100301042 Ga0307416_1003010422 261
480 3300032005 Ga0307411_10012990 Ga0307411_100129907 261
481 3300032126 Ga0307415_100044261 Ga0307415_1000442613 261
482 3300038443 Ga0395901_0073870 Ga0395901_0073870_1933_2721 261
483 3300041410 Ga0439461_0001830 Ga0439461_0001830_874_1659 261
484 3300042156 Ga0439446_0060604 Ga0439446_0060604_321_1106 261
485 3300044656 Ga0466969_0016926 Ga0466969_0016926_2585_3370 261
486 3300044683 Ga0466965_0009563 Ga0466965_0009563_2086_2871 261
487 3300044684 Ga0466966_0018973 Ga0466966_0018973_2645_3430 261
488 3300044693 Ga0466961_0087899 Ga0466961_0087899_228_1013 261
489 3300044719 Ga0466971_0028406 Ga0466971_0028406_126_911 261
490 3300045049 Ga0466959_0244136 Ga0466959_0244136_139_924 261
491 3300045051 Ga0451576_0051484 Ga0451576_0051484_371_1156 261
492 3300048905 Ga0496102_0047644 Ga0496102_0047644_2315_3100 261
493 3300048909 Ga0496106_0009881 Ga0496106_0009881_1930_2715 261
494 3300048910 Ga0496107_0005246 Ga0496107_0005246_7267_8052 261
495 3300049585 Ga0501069_0377594 Ga0501069_0377594_32_823 261
496 3300050510 nmdc:mga06r32_271528_c1 nmdc:mga06r32_271528_c1_882_1667 261
497 3300050511 nmdc:mga08y16_172275_c1 nmdc:mga08y16_172275_c1_525_1310 261
498 3300050515 nmdc:mga0a205_113116_c1 nmdc:mga0a205_113116_c1_1329_2114 261
499 3300061719 Ga0466962_0000421 Ga0466962_0000421_14581_15366 261
500 3300001976 JGI24752J21851_1006625 JGI24752J21851_10066252 262
501 3300002244 JGI24742J22300_10017488 JGI24742J22300_100174881 262
502 3300002459 JGI24751J29686_10009515 JGI24751J29686_100095153 262
503 3300005327 Ga0070658_10006851 Ga0070658_100068518 262
504 3300005328 Ga0070676_10018052 Ga0070676_100180525 262
505 3300005329 Ga0070683_100027006 Ga0070683_1000270066 262
506 3300005329 Ga0070683_100102802 Ga0070683_1001028023 262
507 3300005330 Ga0070690_100135392 Ga0070690_1001353922 262
508 3300005331 Ga0070670_100009503 Ga0070670_1000095036 262
509 3300005331 Ga0070670_100032729 Ga0070670_1000327293 262
510 3300005331 Ga0070670_100036494 Ga0070670_1000364943 262
511 3300005333 Ga0070677_10000343 Ga0070677_1000034310 262
512 3300005333 Ga0070677_10037091 Ga0070677_100370912 262
513 3300005333 Ga0070677_10097736 Ga0070677_100977362 262
514 3300005334 Ga0068869_100009240 Ga0068869_1000092404 262
515 3300005334 Ga0068869_100043670 Ga0068869_1000436703 262
516 3300005334 Ga0068869_100132350 Ga0068869_1001323502 262
517 3300005334 Ga0068869_100229283 Ga0068869_1002292832 262
518 3300005335 Ga0070666_10007974 Ga0070666_100079743 262
519 3300005335 Ga0070666_10042572 Ga0070666_100425723 262
520 3300005335 Ga0070666_10181936 Ga0070666_101819362 262
521 3300005336 Ga0070680_100100690 Ga0070680_1001006904 262
522 3300005336 Ga0070680_100253535 Ga0070680_1002535352 262
523 3300005337 Ga0070682_100032822 Ga0070682_1000328226 262
524 3300005339 Ga0070660_100028623 Ga0070660_1000286232 262
525 3300005339 Ga0070660_100252435 Ga0070660_1002524352 262
526 3300005340 Ga0070689_100031936 Ga0070689_1000319365 262
527 3300005340 Ga0070689_100500294 Ga0070689_1005002941 262
528 3300005343 Ga0070687_100444479 Ga0070687_1004444791 262
529 3300005344 Ga0070661_100003520 Ga0070661_1000035202 262
530 3300005344 Ga0070661_100016045 Ga0070661_1000160457 262
531 3300005344 Ga0070661_100016963 Ga0070661_1000169632 262
532 3300005344 Ga0070661_100103983 Ga0070661_1001039833 262
533 3300005347 Ga0070668_100002549 Ga0070668_1000025499 262
534 3300005347 Ga0070668_100006137 Ga0070668_1000061373 262
535 3300005347 Ga0070668_100007175 Ga0070668_1000071754 262
536 3300005347 Ga0070668_100062215 Ga0070668_1000622153 262
537 3300005347 Ga0070668_100266306 Ga0070668_1002663062 262
538 3300005353 Ga0070669_100018043 Ga0070669_1000180435 262
539 3300005353 Ga0070669_100053736 Ga0070669_1000537363 262
540 3300005353 Ga0070669_100141733 Ga0070669_1001417332 262
541 3300005353 Ga0070669_100158042 Ga0070669_1001580422 262
542 3300005353 Ga0070669_100415760 Ga0070669_1004157601 262
543 3300005354 Ga0070675_100004730 Ga0070675_1000047309 262
544 3300005354 Ga0070675_100210522 Ga0070675_1002105222 262
545 3300005355 Ga0070671_100052938 Ga0070671_1000529383 262
546 3300005355 Ga0070671_100109036 Ga0070671_1001090363 262
547 3300005355 Ga0070671_100133619 Ga0070671_1001336192 262
548 3300005355 Ga0070671_100190605 Ga0070671_1001906052 262
549 3300005355 Ga0070671_100263014 Ga0070671_1002630141 262
550 3300005356 Ga0070674_100017565 Ga0070674_1000175656 262
551 3300005356 Ga0070674_100144914 Ga0070674_1001449141 262
552 3300005356 Ga0070674_100167731 Ga0070674_1001677313 262
553 3300005356 Ga0070674_100274136 Ga0070674_1002741362 262
554 3300005356 Ga0070674_100326499 Ga0070674_1003264992 262
555 3300005364 Ga0070673_100001140 Ga0070673_10000114012 262
556 3300005364 Ga0070673_100011534 Ga0070673_1000115347 262
557 3300005364 Ga0070673_100031620 Ga0070673_1000316201 262
558 3300005365 Ga0070688_100049809 Ga0070688_1000498092 262
559 3300005365 Ga0070688_100299197 Ga0070688_1002991972 262
560 3300005366 Ga0070659_100024728 Ga0070659_1000247284 262
561 3300005366 Ga0070659_100104784 Ga0070659_1001047842 262
562 3300005366 Ga0070659_100456049 Ga0070659_1004560492 262
563 3300005367 Ga0070667_100068013 Ga0070667_1000680132 262
564 3300005367 Ga0070667_100110048 Ga0070667_1001100482 262
565 3300005367 Ga0070667_100180102 Ga0070667_1001801021 262
566 3300005367 Ga0070667_100363890 Ga0070667_1003638902 262
567 3300005434 Ga0070709_10005119 Ga0070709_100051197 262
568 3300005434 Ga0070709_10052832 Ga0070709_100528323 262
569 3300005436 Ga0070713_100000031 Ga0070713_10000003156 262
570 3300005436 Ga0070713_100167194 Ga0070713_1001671942 262
571 3300005438 Ga0070701_10005021 Ga0070701_100050216 262
572 3300005438 Ga0070701_10023917 Ga0070701_100239173 262
573 3300005439 Ga0070711_100027155 Ga0070711_1000271552 262
574 3300005439 Ga0070711_100256135 Ga0070711_1002561352 262
575 3300005441 Ga0070700_100050457 Ga0070700_1000504572 262
576 3300005445 Ga0070708_100018090 Ga0070708_1000180903 262
577 3300005455 Ga0070663_100001186 Ga0070663_1000011869 262
578 3300005455 Ga0070663_100008129 Ga0070663_1000081296 262
579 3300005455 Ga0070663_100040592 Ga0070663_1000405924 262
580 3300005456 Ga0070678_100223702 Ga0070678_1002237022 262
581 3300005456 Ga0070678_100526582 Ga0070678_1005265821 262
582 3300005458 Ga0070681_10020531 Ga0070681_100205318 262
583 3300005458 Ga0070681_10104122 Ga0070681_101041223 262
584 3300005458 Ga0070681_10200210 Ga0070681_102002103 262
585 3300005459 Ga0068867_100001753 Ga0068867_1000017539 262
586 3300005459 Ga0068867_100050245 Ga0068867_1000502454 262
587 3300005459 Ga0068867_100052859 Ga0068867_1000528593 262
588 3300005459 Ga0068867_100077168 Ga0068867_1000771682 262
589 3300005459 Ga0068867_100107300 Ga0068867_1001073003 262
590 3300005459 Ga0068867_100143122 Ga0068867_1001431222 262
591 3300005459 Ga0068867_100161458 Ga0068867_1001614582 262
592 3300005459 Ga0068867_100275790 Ga0068867_1002757902 262
593 3300005466 Ga0070685_10113051 Ga0070685_101130511 262
594 3300005467 Ga0070706_100293177 Ga0070706_1002931772 262
595 3300005518 Ga0070699_100008896 Ga0070699_1000088968 262
596 3300005530 Ga0070679_100079385 Ga0070679_1000793853 262
597 3300005530 Ga0070679_100082903 Ga0070679_1000829032 262
598 3300005535 Ga0070684_100040176 Ga0070684_1000401765 262
599 3300005539 Ga0068853_100025596 Ga0068853_1000255964 262
600 3300005539 Ga0068853_100086660 Ga0068853_1000866602 262
601 3300005539 Ga0068853_100105741 Ga0068853_1001057412 262
602 3300005539 Ga0068853_100382442 Ga0068853_1003824421 262
603 3300005539 Ga0068853_100448093 Ga0068853_1004480932 262
604 3300005543 Ga0070672_100022218 Ga0070672_1000222185 262
605 3300005543 Ga0070672_100023349 Ga0070672_1000233492 262
606 3300005543 Ga0070672_100030863 Ga0070672_1000308634 262
607 3300005543 Ga0070672_100264392 Ga0070672_1002643922 262
608 3300005543 Ga0070672_100424987 Ga0070672_1004249871 262
609 3300005546 Ga0070696_100017107 Ga0070696_1000171073 262
610 3300005547 Ga0070693_100017583 Ga0070693_1000175832 262
611 3300005547 Ga0070693_100400105 Ga0070693_1004001051 262
612 3300005548 Ga0070665_100008185 Ga0070665_1000081856 262
613 3300005548 Ga0070665_100035193 Ga0070665_1000351933 262
614 3300005548 Ga0070665_100072122 Ga0070665_1000721225 262
615 3300005548 Ga0070665_100246051 Ga0070665_1002460512 262
616 3300005548 Ga0070665_100310401 Ga0070665_1003104012 262
617 3300005549 Ga0070704_100144198 Ga0070704_1001441982 262
618 3300005563 Ga0068855_100059007 Ga0068855_1000590073 262
619 3300005563 Ga0068855_100078768 Ga0068855_1000787685 262
620 3300005563 Ga0068855_100294394 Ga0068855_1002943942 262
621 3300005563 Ga0068855_100451937 Ga0068855_1004519371 262
622 3300005563 Ga0068855_100471248 Ga0068855_1004712482 262
623 3300005564 Ga0070664_100006795 Ga0070664_1000067958 262
624 3300005564 Ga0070664_100051277 Ga0070664_1000512771 262
625 3300005564 Ga0070664_100071856 Ga0070664_1000718563 262
626 3300005564 Ga0070664_100203952 Ga0070664_1002039522 262
627 3300005564 Ga0070664_100373670 Ga0070664_1003736702 262
628 3300005564 Ga0070664_100471277 Ga0070664_1004712772 262
629 3300005577 Ga0068857_100040036 Ga0068857_1000400364 262
630 3300005578 Ga0068854_100062585 Ga0068854_1000625854 262
631 3300005578 Ga0068854_100084378 Ga0068854_1000843782 262
632 3300005578 Ga0068854_100230556 Ga0068854_1002305562 262
633 3300005614 Ga0068856_100014926 Ga0068856_1000149268 262
634 3300005614 Ga0068856_100015908 Ga0068856_1000159084 262
635 3300005614 Ga0068856_100192724 Ga0068856_1001927243 262
636 3300005614 Ga0068856_100256471 Ga0068856_1002564713 262
637 3300005614 Ga0068856_100742572 Ga0068856_1007425721 262
638 3300005615 Ga0070702_100086916 Ga0070702_1000869163 262
639 3300005616 Ga0068852_100007757 Ga0068852_1000077576 262
640 3300005616 Ga0068852_100070955 Ga0068852_1000709552 262
641 3300005616 Ga0068852_100071009 Ga0068852_1000710093 262
642 3300005616 Ga0068852_100592848 Ga0068852_1005928481 262
643 3300005617 Ga0068859_100032436 Ga0068859_1000324362 262
644 3300005617 Ga0068859_100090057 Ga0068859_1000900572 262
645 3300005617 Ga0068859_100592423 Ga0068859_1005924232 262
646 3300005618 Ga0068864_100003579 Ga0068864_1000035799 262
647 3300005618 Ga0068864_100018393 Ga0068864_1000183934 262
648 3300005618 Ga0068864_100080019 Ga0068864_1000800192 262
649 3300005618 Ga0068864_100082429 Ga0068864_1000824292 262
650 3300005718 Ga0068866_10002777 Ga0068866_100027773 262
651 3300005719 Ga0068861_100190133 Ga0068861_1001901332 262
652 3300005834 Ga0068851_10001833 Ga0068851_100018336 262
653 3300005834 Ga0068851_10003969 Ga0068851_100039697 262
654 3300005834 Ga0068851_10012795 Ga0068851_100127956 262
655 3300005840 Ga0068870_10004563 Ga0068870_100045637 262
656 3300005840 Ga0068870_10037219 Ga0068870_100372192 262
657 3300005841 Ga0068863_100046106 Ga0068863_1000461065 262
658 3300005841 Ga0068863_100059141 Ga0068863_1000591412 262
659 3300005841 Ga0068863_100093802 Ga0068863_1000938024 262
660 3300005841 Ga0068863_100124228 Ga0068863_1001242282 262
661 3300005841 Ga0068863_100141986 Ga0068863_1001419862 262
662 3300005842 Ga0068858_100039701 Ga0068858_1000397013 262
663 3300005842 Ga0068858_100054531 Ga0068858_1000545314 262
664 3300005842 Ga0068858_100144291 Ga0068858_1001442912 262
665 3300005842 Ga0068858_100207244 Ga0068858_1002072443 262
666 3300005842 Ga0068858_100211598 Ga0068858_1002115982 262
667 3300005843 Ga0068860_100013607 Ga0068860_1000136073 262
668 3300005843 Ga0068860_100019078 Ga0068860_1000190786 262
669 3300005843 Ga0068860_100037773 Ga0068860_1000377735 262
670 3300005843 Ga0068860_100056604 Ga0068860_1000566045 262
671 3300005843 Ga0068860_100255261 Ga0068860_1002552612 262
672 3300005843 Ga0068860_100391047 Ga0068860_1003910472 262
673 3300005844 Ga0068862_100063344 Ga0068862_1000633442 262
674 3300006175 Ga0070712_100044645 Ga0070712_1000446453 262
675 3300006237 Ga0097621_100003701 Ga0097621_1000037016 262
676 3300006237 Ga0097621_100008390 Ga0097621_1000083906 262
677 3300006237 Ga0097621_100026548 Ga0097621_1000265482 262
678 3300006237 Ga0097621_100054192 Ga0097621_1000541923 262
679 3300006237 Ga0097621_100104271 Ga0097621_1001042713 262
680 3300006237 Ga0097621_100127721 Ga0097621_1001277212 262
681 3300006237 Ga0097621_100313231 Ga0097621_1003132312 262
682 3300006237 Ga0097621_100403263 Ga0097621_1004032632 262
683 3300006358 Ga0068871_100124841 Ga0068871_1001248412 262
684 3300006358 Ga0068871_100254953 Ga0068871_1002549532 262
685 3300006358 Ga0068871_100354285 Ga0068871_1003542852 262
686 3300006844 Ga0075428_100117321 Ga0075428_1001173212 262
687 3300006852 Ga0075433_10014465 Ga0075433_100144655 262
688 3300006871 Ga0075434_100010242 Ga0075434_10001024211 262
689 3300006871 Ga0075434_100119033 Ga0075434_1001190333 262
690 3300006871 Ga0075434_100152502 Ga0075434_1001525021 262
691 3300006881 Ga0068865_100036414 Ga0068865_1000364142 262
692 3300006881 Ga0068865_100133683 Ga0068865_1001336832 262
693 3300006881 Ga0068865_100353811 Ga0068865_1003538112 262
694 3300006914 Ga0075436_100175164 Ga0075436_1001751642 262
695 3300006931 Ga0097620_100032436 Ga0097620_1000324362 262
696 3300006931 Ga0097620_100090057 Ga0097620_1000900572 262
697 3300006931 Ga0097620_100592423 Ga0097620_1005924232 262
698 3300007076 Ga0075435_100000996 Ga0075435_10000099610 262
699 3300007076 Ga0075435_100206571 Ga0075435_1002065712 262
700 3300009093 Ga0105240_10052230 Ga0105240_100522306 262
701 3300009094 Ga0111539_10142481 Ga0111539_101424811 262
702 3300009098 Ga0105245_10358242 Ga0105245_103582421 262
703 3300009098 Ga0105245_10368171 Ga0105245_103681712 262
704 3300009148 Ga0105243_10236361 Ga0105243_102363611 262
705 3300009174 Ga0105241_10004906 Ga0105241_100049068 262
706 3300009174 Ga0105241_10138001 Ga0105241_101380012 262
707 3300009174 Ga0105241_10372640 Ga0105241_103726402 262
708 3300009176 Ga0105242_10034566 Ga0105242_100345664 262
709 3300009176 Ga0105242_10072045 Ga0105242_100720453 262
710 3300009176 Ga0105242_10819496 Ga0105242_108194961 262
711 3300009177 Ga0105248_10013498 Ga0105248_100134988 262
712 3300009177 Ga0105248_10025672 Ga0105248_100256726 262
713 3300009177 Ga0105248_10048753 Ga0105248_100487533 262
714 3300009177 Ga0105248_10202940 Ga0105248_102029403 262
715 3300009177 Ga0105248_10395398 Ga0105248_103953982 262
716 3300009545 Ga0105237_10131252 Ga0105237_101312522 262
717 3300009545 Ga0105237_10293452 Ga0105237_102934523 262
718 3300009551 Ga0105238_10062479 Ga0105238_100624792 262
719 3300009553 Ga0105249_10004775 Ga0105249_100047759 262
720 3300009553 Ga0105249_10124073 Ga0105249_101240733 262
721 3300010375 Ga0105239_10733907 Ga0105239_107339072 262
722 3300013100 Ga0157373_10002005 Ga0157373_100020057 262
723 3300013100 Ga0157373_10049919 Ga0157373_100499193 262
724 3300013102 Ga0157371_10045890 Ga0157371_100458902 262
725 3300013102 Ga0157371_10123177 Ga0157371_101231772 262
726 3300013102 Ga0157371_10291975 Ga0157371_102919751 262
727 3300013104 Ga0157370_10011607 Ga0157370_100116074 262
728 3300013104 Ga0157370_10036807 Ga0157370_100368073 262
729 3300013104 Ga0157370_10048439 Ga0157370_100484391 262
730 3300013104 Ga0157370_10107088 Ga0157370_101070882 262
731 3300013104 Ga0157370_10330831 Ga0157370_103308312 262
732 3300013105 Ga0157369_10004565 Ga0157369_1000456512 262
733 3300013105 Ga0157369_10127131 Ga0157369_101271312 262
734 3300013296 Ga0157374_10010560 Ga0157374_100105609 262
735 3300013296 Ga0157374_10456941 Ga0157374_104569412 262
736 3300013297 Ga0157378_10009398 Ga0157378_100093982 262
737 3300013297 Ga0157378_10936551 Ga0157378_109365511 262
738 3300013306 Ga0163162_10013531 Ga0163162_100135318 262
739 3300013306 Ga0163162_10086076 Ga0163162_100860762 262
740 3300013306 Ga0163162_10216232 Ga0163162_102162322 262
741 3300013307 Ga0157372_10037205 Ga0157372_100372052 262
742 3300013307 Ga0157372_10214336 Ga0157372_102143363 262
743 3300013307 Ga0157372_10254938 Ga0157372_102549383 262
744 3300013308 Ga0157375_10119523 Ga0157375_101195233 262
745 3300013308 Ga0157375_10146613 Ga0157375_101466132 262
746 3300013308 Ga0157375_10738056 Ga0157375_107380562 262
747 3300013308 Ga0157375_10850331 Ga0157375_108503312 262
748 3300013308 Ga0157375_11064402 Ga0157375_110644021 262
749 3300014325 Ga0163163_10003372 Ga0163163_100033729 262
750 3300014325 Ga0163163_10089598 Ga0163163_100895982 262
751 3300014325 Ga0163163_10116793 Ga0163163_101167932 262
752 3300014326 Ga0157380_10022406 Ga0157380_100224063 262
753 3300014326 Ga0157380_10054788 Ga0157380_100547882 262
754 3300014326 Ga0157380_10279086 Ga0157380_102790862 262
755 3300014497 Ga0182008_10071251 Ga0182008_100712512 262
756 3300014968 Ga0157379_10022156 Ga0157379_100221566 262
757 3300014968 Ga0157379_10466201 Ga0157379_104662012 262
758 3300014968 Ga0157379_10525751 Ga0157379_105257512 262
759 3300014969 Ga0157376_10035683 Ga0157376_100356834 262
760 3300014969 Ga0157376_10065570 Ga0157376_100655703 262
761 3300014969 Ga0157376_10118977 Ga0157376_101189772 262
762 3300014969 Ga0157376_10395243 Ga0157376_103952432 262
763 3300017792 Ga0163161_10009380 Ga0163161_100093805 262
764 3300017792 Ga0163161_10019666 Ga0163161_100196663 262
765 3300017792 Ga0163161_10021646 Ga0163161_100216464 262
766 3300017792 Ga0163161_10090394 Ga0163161_100903943 262
767 3300025290 Ga0207673_1000490 Ga0207673_10004904 262
768 3300025315 Ga0207697_10000152 Ga0207697_1000015231 262
769 3300025321 Ga0207656_10011875 Ga0207656_100118753 262
770 3300025321 Ga0207656_10018233 Ga0207656_100182332 262
771 3300025893 Ga0207682_10000198 Ga0207682_1000019824 262
772 3300025893 Ga0207682_10000277 Ga0207682_100002775 262
773 3300025893 Ga0207682_10010491 Ga0207682_100104913 262
774 3300025893 Ga0207682_10087131 Ga0207682_100871312 262
775 3300025901 Ga0207688_10049854 Ga0207688_100498542 262
776 3300025903 Ga0207680_10004517 Ga0207680_100045175 262
777 3300025903 Ga0207680_10115652 Ga0207680_101156522 262
778 3300025903 Ga0207680_10298566 Ga0207680_102985662 262
779 3300025907 Ga0207645_10000676 Ga0207645_1000067624 262
780 3300025907 Ga0207645_10002695 Ga0207645_1000269511 262
781 3300025907 Ga0207645_10009493 Ga0207645_100094932 262
782 3300025907 Ga0207645_10063263 Ga0207645_100632632 262
783 3300025907 Ga0207645_10094687 Ga0207645_100946872 262
784 3300025908 Ga0207643_10000311 Ga0207643_1000031120 262
785 3300025908 Ga0207643_10019620 Ga0207643_100196202 262
786 3300025908 Ga0207643_10043085 Ga0207643_100430852 262
787 3300025910 Ga0207684_10128792 Ga0207684_101287924 262
788 3300025912 Ga0207707_10002449 Ga0207707_100024497 262
789 3300025912 Ga0207707_10314313 Ga0207707_103143131 262
790 3300025913 Ga0207695_10014284 Ga0207695_100142846 262
791 3300025914 Ga0207671_10095653 Ga0207671_100956533 262
792 3300025915 Ga0207693_10126993 Ga0207693_101269933 262
793 3300025916 Ga0207663_10134118 Ga0207663_101341183 262
794 3300025916 Ga0207663_10240988 Ga0207663_102409883 262
795 3300025917 Ga0207660_10182054 Ga0207660_101820542 262
796 3300025917 Ga0207660_10435334 Ga0207660_104353342 262
797 3300025918 Ga0207662_10016821 Ga0207662_100168216 262
798 3300025919 Ga0207657_10000045 Ga0207657_1000004549 262
799 3300025920 Ga0207649_10009634 Ga0207649_100096347 262
800 3300025921 Ga0207652_10005836 Ga0207652_100058363 262
801 3300025921 Ga0207652_10015307 Ga0207652_100153072 262
802 3300025921 Ga0207652_10042383 Ga0207652_100423835 262
803 3300025921 Ga0207652_10094074 Ga0207652_100940741 262
804 3300025922 Ga0207646_10006400 Ga0207646_100064008 262
805 3300025923 Ga0207681_10005688 Ga0207681_100056882 262
806 3300025923 Ga0207681_10110212 Ga0207681_101102123 262
807 3300025923 Ga0207681_10222013 Ga0207681_102220132 262
808 3300025923 Ga0207681_10511610 Ga0207681_105116101 262
809 3300025925 Ga0207650_10003084 Ga0207650_100030847 262
810 3300025925 Ga0207650_10004678 Ga0207650_100046786 262
811 3300025925 Ga0207650_10007756 Ga0207650_100077566 262
812 3300025925 Ga0207650_10012522 Ga0207650_100125225 262
813 3300025925 Ga0207650_10019765 Ga0207650_100197654 262
814 3300025925 Ga0207650_10036416 Ga0207650_100364164 262
815 3300025925 Ga0207650_10057952 Ga0207650_100579524 262
816 3300025925 Ga0207650_10094404 Ga0207650_100944042 262
817 3300025926 Ga0207659_10005942 Ga0207659_100059422 262
818 3300025926 Ga0207659_10024036 Ga0207659_100240362 262
819 3300025926 Ga0207659_10092013 Ga0207659_100920132 262
820 3300025926 Ga0207659_10255625 Ga0207659_102556252 262
821 3300025928 Ga0207700_10000084 Ga0207700_100000844 262
822 3300025929 Ga0207664_10001330 Ga0207664_100013309 262
823 3300025931 Ga0207644_10010936 Ga0207644_100109366 262
824 3300025932 Ga0207690_10030150 Ga0207690_100301502 262
825 3300025932 Ga0207690_10591812 Ga0207690_105918121 262
826 3300025933 Ga0207706_10004135 Ga0207706_100041356 262
827 3300025933 Ga0207706_10007454 Ga0207706_100074546 262
828 3300025933 Ga0207706_10358564 Ga0207706_103585642 262
829 3300025935 Ga0207709_10017317 Ga0207709_100173174 262
830 3300025936 Ga0207670_10089839 Ga0207670_100898392 262
831 3300025937 Ga0207669_10018360 Ga0207669_100183602 262
832 3300025937 Ga0207669_10023528 Ga0207669_100235283 262
833 3300025937 Ga0207669_10028655 Ga0207669_100286552 262
834 3300025937 Ga0207669_10043965 Ga0207669_100439652 262
835 3300025938 Ga0207704_10128961 Ga0207704_101289612 262
836 3300025939 Ga0207665_10050727 Ga0207665_100507273 262
837 3300025940 Ga0207691_10000243 Ga0207691_1000024324 262
838 3300025940 Ga0207691_10000999 Ga0207691_100009994 262
839 3300025940 Ga0207691_10004761 Ga0207691_100047619 262
840 3300025940 Ga0207691_10008651 Ga0207691_100086519 262
841 3300025940 Ga0207691_10036107 Ga0207691_100361075 262
842 3300025940 Ga0207691_10082927 Ga0207691_100829272 262
843 3300025940 Ga0207691_10202759 Ga0207691_102027592 262
844 3300025941 Ga0207711_10015861 Ga0207711_100158612 262
845 3300025941 Ga0207711_10162506 Ga0207711_101625062 262
846 3300025941 Ga0207711_10231454 Ga0207711_102314542 262
847 3300025941 Ga0207711_10364257 Ga0207711_103642572 262
848 3300025942 Ga0207689_10002822 Ga0207689_100028229 262
849 3300025942 Ga0207689_10011021 Ga0207689_100110216 262
850 3300025942 Ga0207689_10104281 Ga0207689_101042812 262
851 3300025942 Ga0207689_10287106 Ga0207689_102871062 262
852 3300025945 Ga0207679_10007025 Ga0207679_100070256 262
853 3300025945 Ga0207679_10019385 Ga0207679_100193853 262
854 3300025945 Ga0207679_10058944 Ga0207679_100589443 262
855 3300025945 Ga0207679_10146953 Ga0207679_101469532 262
856 3300025949 Ga0207667_10001516 Ga0207667_1000151625 262
857 3300025949 Ga0207667_10702577 Ga0207667_107025772 262
858 3300025960 Ga0207651_10014470 Ga0207651_100144704 262
859 3300025960 Ga0207651_10050332 Ga0207651_100503321 262
860 3300025960 Ga0207651_10095405 Ga0207651_100954052 262
861 3300025960 Ga0207651_10099865 Ga0207651_100998652 262
862 3300025961 Ga0207712_10264735 Ga0207712_102647352 262
863 3300025972 Ga0207668_10005128 Ga0207668_100051282 262
864 3300025972 Ga0207668_10028489 Ga0207668_100284895 262
865 3300025972 Ga0207668_10040243 Ga0207668_100402433 262
866 3300025972 Ga0207668_10123010 Ga0207668_101230102 262
867 3300025972 Ga0207668_10177701 Ga0207668_101777012 262
868 3300025981 Ga0207640_10035273 Ga0207640_100352735 262
869 3300025986 Ga0207658_10031204 Ga0207658_100312042 262
870 3300025986 Ga0207658_10044942 Ga0207658_100449425 262
871 3300025986 Ga0207658_10088286 Ga0207658_100882862 262
872 3300025986 Ga0207658_10111361 Ga0207658_101113613 262
873 3300025986 Ga0207658_10129024 Ga0207658_101290242 262
874 3300025986 Ga0207658_10229652 Ga0207658_102296522 262
875 3300026023 Ga0207677_10340878 Ga0207677_103408782 262
876 3300026023 Ga0207677_10401211 Ga0207677_104012112 262
877 3300026035 Ga0207703_10114228 Ga0207703_101142282 262
878 3300026035 Ga0207703_10146979 Ga0207703_101469792 262
879 3300026035 Ga0207703_10357076 Ga0207703_103570762 262
880 3300026035 Ga0207703_10382253 Ga0207703_103822532 262
881 3300026041 Ga0207639_10006616 Ga0207639_100066166 262
882 3300026041 Ga0207639_10078990 Ga0207639_100789902 262
883 3300026041 Ga0207639_10088963 Ga0207639_100889633 262
884 3300026067 Ga0207678_10002320 Ga0207678_100023202 262
885 3300026067 Ga0207678_10003040 Ga0207678_100030404 262
886 3300026067 Ga0207678_10010401 Ga0207678_100104016 262
887 3300026075 Ga0207708_10000789 Ga0207708_100007896 262
888 3300026075 Ga0207708_10013596 Ga0207708_100135966 262
889 3300026075 Ga0207708_10216442 Ga0207708_102164422 262
890 3300026078 Ga0207702_10054685 Ga0207702_100546854 262
891 3300026078 Ga0207702_10077073 Ga0207702_100770732 262
892 3300026078 Ga0207702_10162999 Ga0207702_101629992 262
893 3300026078 Ga0207702_10191476 Ga0207702_101914763 262
894 3300026078 Ga0207702_10260659 Ga0207702_102606591 262
895 3300026088 Ga0207641_10055724 Ga0207641_100557244 262
896 3300026088 Ga0207641_10064921 Ga0207641_100649214 262
897 3300026088 Ga0207641_10146479 Ga0207641_101464792 262
898 3300026088 Ga0207641_10148418 Ga0207641_101484183 262
899 3300026088 Ga0207641_10266722 Ga0207641_102667222 262
900 3300026089 Ga0207648_10004321 Ga0207648_100043218 262
901 3300026089 Ga0207648_10028539 Ga0207648_100285396 262
902 3300026089 Ga0207648_10037581 Ga0207648_100375813 262
903 3300026089 Ga0207648_10102339 Ga0207648_101023392 262
904 3300026089 Ga0207648_10236451 Ga0207648_102364512 262
905 3300026089 Ga0207648_10260239 Ga0207648_102602392 262
906 3300026089 Ga0207648_10786708 Ga0207648_107867081 262
907 3300026095 Ga0207676_10016929 Ga0207676_100169296 262
908 3300026095 Ga0207676_10040004 Ga0207676_100400045 262
909 3300026095 Ga0207676_10076314 Ga0207676_100763142 262
910 3300026095 Ga0207676_10098876 Ga0207676_100988762 262
911 3300026095 Ga0207676_10169818 Ga0207676_101698182 262
912 3300026095 Ga0207676_10366551 Ga0207676_103665512 262
913 3300026095 Ga0207676_10583057 Ga0207676_105830572 262
914 3300026095 Ga0207676_10592949 Ga0207676_105929492 262
915 3300026116 Ga0207674_10000052 Ga0207674_1000005269 262
916 3300026116 Ga0207674_10024058 Ga0207674_100240586 262
917 3300026116 Ga0207674_10833134 Ga0207674_108331341 262
918 3300026118 Ga0207675_100023263 Ga0207675_1000232632 262
919 3300026118 Ga0207675_100025891 Ga0207675_1000258916 262
920 3300026118 Ga0207675_100069867 Ga0207675_1000698673 262
921 3300026118 Ga0207675_100089474 Ga0207675_1000894742 262
922 3300026118 Ga0207675_100176921 Ga0207675_1001769212 262
923 3300026121 Ga0207683_10000308 Ga0207683_1000030824 262
924 3300026121 Ga0207683_10014491 Ga0207683_100144915 262
925 3300026121 Ga0207683_10017509 Ga0207683_100175093 262
926 3300026121 Ga0207683_10052382 Ga0207683_100523822 262
927 3300026121 Ga0207683_10065953 Ga0207683_100659533 262
928 3300026121 Ga0207683_10118857 Ga0207683_101188572 262
929 3300026121 Ga0207683_10281467 Ga0207683_102814672 262
930 3300026142 Ga0207698_10012326 Ga0207698_100123263 262
931 3300026142 Ga0207698_10119642 Ga0207698_101196423 262
932 3300026142 Ga0207698_10230311 Ga0207698_102303113 262
933 3300026142 Ga0207698_10254739 Ga0207698_102547391 262
934 3300026142 Ga0207698_10542072 Ga0207698_105420722 262
935 3300028379 Ga0268266_10082586 Ga0268266_100825862 262
936 3300028379 Ga0268266_10095303 Ga0268266_100953033 262
937 3300028379 Ga0268266_10120278 Ga0268266_101202782 262
938 3300028379 Ga0268266_10180135 Ga0268266_101801352 262
939 3300028379 Ga0268266_10189694 Ga0268266_101896942 262
940 3300028380 Ga0268265_10088938 Ga0268265_100889382 262
941 3300028380 Ga0268265_10187464 Ga0268265_101874642 262
942 3300028381 Ga0268264_10011874 Ga0268264_100118743 262
943 3300028381 Ga0268264_10016863 Ga0268264_100168635 262
944 3300028381 Ga0268264_10110484 Ga0268264_101104843 262
945 3300028381 Ga0268264_10367583 Ga0268264_103675832 262
946 3300028381 Ga0268264_10612146 Ga0268264_106121461 262
947 3300031235 Ga0265330_10001397 Ga0265330_100013976 262
948 3300031238 Ga0265332_10002014 Ga0265332_100020148 262
949 3300031239 Ga0265328_10004196 Ga0265328_100041966 262
950 3300031241 Ga0265325_10007694 Ga0265325_100076946 262
951 3300031242 Ga0265329_10001268 Ga0265329_100012685 262
952 3300031249 Ga0265339_10010535 Ga0265339_100105355 262
953 3300031250 Ga0265331_10000571 Ga0265331_1000057129 262
954 3300031251 Ga0265327_10012687 Ga0265327_100126874 262
955 3300031548 Ga0307408_100013018 Ga0307408_1000130182 262
956 3300031712 Ga0265342_10009557 Ga0265342_100095576 262
957 3300031824 Ga0307413_10118932 Ga0307413_101189322 262
958 3300031901 Ga0307406_10127824 Ga0307406_101278242 262
959 3300031911 Ga0307412_10012352 Ga0307412_100123522 262
960 3300031995 Ga0307409_100010606 Ga0307409_1000106063 262
961 3300032002 Ga0307416_100011079 Ga0307416_1000110792 262
962 3300032004 Ga0307414_10022232 Ga0307414_100222324 262
963 3300032005 Ga0307411_10010633 Ga0307411_100106335 262
964 3300032126 Ga0307415_100002355 Ga0307415_1000023555 262
965 3300035086 Ga0373934_0066283 Ga0373934_0066283_389_1177 262
966 3300035119 Ga0373956_0018822 Ga0373956_0018822_1192_1980 262
967 3300035170 Ga0373943_0021205 Ga0373943_0021205_608_1396 262
968 3300035171 Ga0373946_0057991 Ga0373946_0057991_326_1114 262
969 3300035172 Ga0373955_0043583 Ga0373955_0043583_1106_1894 262
970 3300035691 Ga0373931_0379053 Ga0373931_0379053_31_819 262
971 3300035692 Ga0373935_0010797 Ga0373935_0010797_3843_4631 262
972 3300035724 Ga0373933_0026233 Ga0373933_0026233_1004_1792 262
973 3300035725 Ga0373947_0089921 Ga0373947_0089921_200_988 262
974 3300036401 Ga0373937_0085960 Ga0373937_0085960_907_1695 262
975 3300036401 Ga0373937_0138616 Ga0373937_0138616_442_1230 262
976 3300036401 Ga0373937_0299680 Ga0373937_0299680_16_807 262
977 3300036401 Ga0373937_0457156 Ga0373937_0457156_49_837 262
978 3300037068 Ga0373925_0071771 Ga0373925_0071771_1770_2558 262
979 3300037068 Ga0373925_0314604 Ga0373925_0314604_59_847 262
980 3300037418 Ga0395900_0269502 Ga0395900_0269502_193_981 262
981 3300037471 Ga0395905_0047248 Ga0395905_0047248_1087_1875 262
982 3300038443 Ga0395901_0901079 Ga0395901_0901079_44_832 262
983 3300039437 Ga0436365_0614334 Ga0436365_0614334_1701_2510 262
984 3300042436 Ga0439435_0014960 Ga0439435_0014960_389_1192 262
985 3300042876 Ga0451577_0244960 Ga0451577_0244960_44_844 262
986 3300045051 Ga0451576_0162159 Ga0451576_0162159_1336_2136 262
987 3300045051 Ga0451576_0485017 Ga0451576_0485017_134_922 262
988 3300046455 Ga0495603_0023863 Ga0495603_0023863_951_1739 262
989 3300046459 Ga0495629_0074680 Ga0495629_0074680_824_1612 262
990 3300046459 Ga0495629_0188846 Ga0495629_0188846_271_1059 262
991 3300046472 Ga0495580_0071206 Ga0495580_0071206_1161_1949 262
992 3300046476 Ga0495662_0011906 Ga0495662_0011906_1767_2555 262
993 3300046517 Ga0495630_0404662 Ga0495630_0404662_143_931 262
994 3300046531 Ga0495665_0014048 Ga0495665_0014048_2459_3247 262
995 3300046533 Ga0495640_0313258 Ga0495640_0313258_139_927 262
996 3300046543 Ga0495645_0174887 Ga0495645_0174887_177_968 262
997 3300046559 Ga0495667_0021442 Ga0495667_0021442_3192_3980 262
998 3300046642 Ga0495634_0077998 Ga0495634_0077998_495_1283 262
999 3300046663 Ga0495635_0076517 Ga0495635_0076517_279_1067 262
1000 3300046674 Ga0495588_0038495 Ga0495588_0038495_1003_1791 262
1001 3300046681 Ga0495647_0003600 Ga0495647_0003600_1061_1849 262
1002 3300046683 Ga0495658_0052988 Ga0495658_0052988_521_1309 262
1003 3300046809 Ga0495600_0039369 Ga0495600_0039369_1226_2014 262
1004 3300047315 Ga0495581_0000428 Ga0495581_0000428_17522_18310 262
1005 3300047322 Ga0495680_0024970 Ga0495680_0024970_1263_2051 262
1006 3300047471 Ga0495684_0077021 Ga0495684_0077021_1226_2014 262
1007 3300048089 Ga0495614_0011142 Ga0495614_0011142_1941_2729 262
1008 3300048903 Ga0496100_0305132 Ga0496100_0305132_203_991 262
1009 3300048904 Ga0496101_0131533 Ga0496101_0131533_314_1102 262
1010 3300048907 Ga0496104_0273506 Ga0496104_0273506_741_1529 262
1011 3300048908 Ga0496105_0205335 Ga0496105_0205335_353_1141 262
1012 3300048909 Ga0496106_0379166 Ga0496106_0379166_141_929 262
1013 3300048911 Ga0496108_0007673 Ga0496108_0007673_5565_6353 262
1014 3300048911 Ga0496108_0258668 Ga0496108_0258668_308_1096 262
1015 3300048912 Ga0496109_0004576 Ga0496109_0004576_10299_11087 262
1016 3300048913 Ga0496110_0009595 Ga0496110_0009595_4228_5016 262
1017 3300048913 Ga0496110_0413349 Ga0496110_0413349_427_1215 262
1018 3300048915 Ga0496112_0070721 Ga0496112_0070721_90_878 262
1019 3300049571 Ga0501034_0053868 Ga0501034_0053868_3001_3795 262
1020 3300049581 Ga0501047_0141911 Ga0501047_0141911_326_1120 262
1021 3300049584 Ga0501068_0209068 Ga0501068_0209068_122_916 262
1022 3300049585 Ga0501069_0300568 Ga0501069_0300568_21_809 262
1023 3300049589 Ga0501073_0079883 Ga0501073_0079883_140_934 262
1024 3300049590 Ga0501074_0051011 Ga0501074_0051011_268_1062 262
1025 3300049592 Ga0501076_0061214 Ga0501076_0061214_1868_2656 262
1026 3300049824 Ga0501045_0085799 Ga0501045_0085799_1339_2127 262
1027 3300050509 nmdc:mga0qj67_236455_c1 nmdc:mga0qj67_236455_c1_173_961 262
1028 3300050511 nmdc:mga08y16_111854_c1 nmdc:mga08y16_111854_c1_514_1302 262
1029 3300050512 nmdc:mga0n895_153747_c1 nmdc:mga0n895_153747_c1_1333_2124 262
1030 3300050512 nmdc:mga0n895_240727_c1 nmdc:mga0n895_240727_c1_911_1711 262
1031 3300050512 nmdc:mga0n895_287847_c1 nmdc:mga0n895_287847_c1_559_1347 262
1032 3300050512 nmdc:mga0n895_83941_c1 nmdc:mga0n895_83941_c1_290_1078 262
1033 3300050513 nmdc:mga0rr50_439911_c1 nmdc:mga0rr50_439911_c1_207_1007 262
1034 3300050513 nmdc:mga0rr50_454081_c1 nmdc:mga0rr50_454081_c1_41_829 262
1035 3300050514 nmdc:mga08x19_103372_c1 nmdc:mga08x19_103372_c1_198_986 262
1036 3300050514 nmdc:mga08x19_107230_c1 nmdc:mga08x19_107230_c1_560_1348 262
1037 3300050515 nmdc:mga0a205_18359_c1 nmdc:mga0a205_18359_c1_2012_2800 262
1038 3300050515 nmdc:mga0a205_495975_c1 nmdc:mga0a205_495975_c1_50_838 262
1039 3300053085 Ga0495619_0019782 Ga0495619_0019782_2587_3375 262
1040 3300053085 Ga0495619_0189201 Ga0495619_0189201_167_955 262
1041 3300060353 Ga0501082_0173491 Ga0501082_0173491_497_1285 262

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

45

249

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lkz-assembly1.cif.gz_A structure of atp-bound human abca4 0.7556 66 257
8i3d-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 0.7248 14 258
7r88-assembly1.cif.gz_B the structure of human abcg5-i529w/abcg8-wt 0.7164 16 257
6hbu-assembly1.cif.gz_A cryo-em structure of the abcg2 e211q mutant bound to atp and magnesium 0.7067 19 256
7p05-assembly1.cif.gz_A cryo-em structure of pdr5 from saccharomyces cerevisiae in inward-facing conformation with adp/atp and rhodamine 6g 0.6872 16 257
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8228 59 255 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8203 59 255 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.82 59 252 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6335 59 255 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6331 59 255 3.40.1710.10
ID Description Score Start End GO Terms
AF-V4Y4G7-F1-model_v4 Transport permease protein 0.9856 6 262 GO:0015772
GO:0043190
GO:0140359
AF-A0A536VL93-F1-model_v4 Transport permease protein 0.982 6 262 GO:0015772
GO:0043190
GO:0140359
AF-A0A2N9LEA2-F1-model_v4 Transport permease protein 0.9817 4 262 GO:0043190
GO:0140359
AF-A0A2M7C2L9-F1-model_v4 Transport permease protein 0.9806 59 262 GO:0043190
GO:0140359
AF-A0A1H7XBK7-F1-model_v4 Transport permease protein 0.9804 6 262 GO:0043190
GO:0140359

Feature Viewer

pLDDT pTM Quality
89.56 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map