F488818

General Info

Members Datasets Scaffolds Average Seq Length
1040 449 938 286

Family's Representative Sequence

Representative Sequence 3300030731|Ga0316177_1152336|Ga0316177_11523365
Length 272
Sequence MSQLLLGLVNGSFYAMLSLGLAVIFGLLNVINFSHGALYMMGAFLAWMGLSYFDINYWVMLVAAPLLVGLFGVIIEKTMLRWLYKLDHLYGLLFTFGVTLVLEGVFRSFYGVSGQAYPVPDVLQGATDLGFMVLPNYRAWVVAASLLVCLGTWFVIEKTKLGSYLRAGTENPKLVEAFGINVPLMVTLTYGFGVALAGFAGVLAAPIINVTPLMGSHLIIVVFAVVVIGGMGSIVIEGLTRVFYPEGSEVVVFVVMXXVLLIRPAGLFGKEK

Samples

Sample ID Description Type Environment
1 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
4 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
5 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
6 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
7 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
8 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
9 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
10 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
11 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
12 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
13 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
14 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
15 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
16 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
17 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
18 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
19 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
20 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
21 2643221556 Massilia sp. Root1485 Isolate Unclassified
22 2643221569 Achromobacter sp. Root565 Isolate Unclassified
23 2643221594 Achromobacter sp. Root170 Isolate Unclassified
24 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
25 2643221621 Achromobacter sp. Root83 Isolate Unclassified
26 2643221638 Duganella sp. Root336D2 Isolate Unclassified
27 2643221664 Massilia sp. Root418 Isolate Unclassified
28 2643221684 Massilia sp. Root133 Isolate Unclassified
29 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
30 2738541280 Massilia sp. GV090 Isolate Unclassified
31 2738541297 Duganella sp. GV083 Isolate Unclassified
32 2738541300 Massilia sp. GV016 Isolate Unclassified
33 2738541337 Pelomonas sp. BT06 Isolate Unclassified
34 2738541357 Duganella sp. GV053 Isolate Unclassified
35 2738543003 Duganella sp. GV066 Isolate Unclassified
36 2738543018 Massilia sp. GV045 Isolate Unclassified
37 2738543026 Duganella sp. GV089 Isolate Unclassified
38 2738543029 Duganella sp. GV039 Isolate Unclassified
39 2738543030 Massilia sp. GV097 Isolate Unclassified
40 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
41 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
42 2818991436 Collimonas arenae 515 Isolate Unclassified
43 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
44 2821131069 Duganella sp. 1224 Isolate Unclassified
45 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
46 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
47 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
48 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
49 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
50 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
51 2842711865 Duganella sp. R-73148 Isolate Unclassified
52 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
53 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
54 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
55 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
56 2857553236 Duganella sp. R-74557 Isolate Unclassified
57 2857558681 Duganella sp. R-74565 Isolate Unclassified
58 2857564685 Duganella sp. R-74599 Isolate Unclassified
59 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
60 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
61 2858950400 Achromobacter sp. K91 Isolate Unclassified
62 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
63 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
64 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
65 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
66 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
67 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
68 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
69 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
70 2885266251 Ralstonia sp. SET104 Isolate Nodule
71 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
72 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
73 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
74 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
75 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
76 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
77 2904424332 Duganella sp. 1411 Isolate Rhizosphere
78 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
79 2919476304 Duganella sp. 3397 Isolate Unclassified
80 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
81 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
82 2928058823 Ralstonia sp. 1138 Isolate Unclassified
83 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
84 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
85 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
86 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
87 2941479691
88 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
89 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
90 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
91 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
92 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
93 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
94 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
95 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
96 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
97 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
98 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
99 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
100 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
101 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
102 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
103 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
104 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
105 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
106 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
107 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
108 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
109 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
110 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
111 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
112 3300003558 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_10_fullP_mix1_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
113 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
114 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
115 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
116 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
117 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
118 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
119 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
120 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
121 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
122 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
123 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
124 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
125 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
126 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
127 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
128 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
129 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
130 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
131 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
132 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
133 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
134 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
135 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
136 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
137 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
138 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
139 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
140 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
141 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
142 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
143 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
144 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
145 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
146 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
147 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
148 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
149 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
150 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
151 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
152 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
153 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
154 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
155 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
156 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
157 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
158 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
159 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
160 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
161 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
162 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
163 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
164 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
165 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
166 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
167 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
168 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
169 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
170 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
171 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
172 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
173 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
176 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
177 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
178 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
179 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
180 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
181 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
182 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
183 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
184 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
185 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
186 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
187 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
188 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
190 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
191 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
193 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
200 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
201 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
203 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
204 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
205 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
208 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
209 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
210 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
211 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
213 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
214 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
215 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
217 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
218 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
219 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
220 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
221 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
222 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
252 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
253 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
256 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
257 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
258 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
259 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
260 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
261 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
262 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
263 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
264 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
265 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
266 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
267 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
268 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
269 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
270 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
271 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
272 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
273 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
274 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
275 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
276 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
277 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
278 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
279 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
280 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
283 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
284 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
285 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
286 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
287 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
288 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
289 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
290 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
291 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
292 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
293 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
294 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
295 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
296 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
297 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
298 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
299 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
300 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
301 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
302 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
303 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
304 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
305 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
306 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
307 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
308 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
309 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
310 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
311 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
312 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
313 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
314 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
315 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
316 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
317 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
318 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
319 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
320 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
321 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
322 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
323 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
324 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
325 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
326 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
327 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
328 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
329 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
330 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
331 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
332 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
333 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
334 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
335 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
336 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
337 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
338 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
341 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
342 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
343 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
344 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
345 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
346 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
347 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
348 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
349 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
350 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
351 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
352 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
353 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
354 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
355 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
356 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
357 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
358 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
359 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
360 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
361 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
362 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
363 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
364 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
365 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
366 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
367 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
368 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
369 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
370 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
371 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
372 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
373 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
374 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
375 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
376 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
377 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
378 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
379 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
380 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
381 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
382 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
383 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
384 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
385 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
386 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
387 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
388 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
389 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
390 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
391 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
392 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
396 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
397 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
398 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
399 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
400 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
401 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
402 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
403 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
404 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
405 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
406 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
407 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
412 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
413 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
418 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
419 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
420 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
421 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
422 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
423 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
427 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
428 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
429 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
430 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
431 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
432 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
433 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
434 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
435 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
436 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
437 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
438 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
439 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
440 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
441 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
442 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
443 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
444 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
445 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
446 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
447 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere
448 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
449 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.71
Metatranscriptomes 0.48
Isolates 9.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.58
Nodule 3.65
Rhizoplane 2.21
Rhizosphere 61.15
Stem 0
Stem Tuber 0
Unclassified 12.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000029 3300001915 Bacteria 34366
2 JGI24740J21852_10000130 3300001979 Bacteria 28590
3 JGI24740J21852_10001393 3300001979 Bacteria 11042
4 JGI24737J22298_10013887 3300001990 Bacteria 2619
5 JGI24735J21928_10000241 3300002067 Bacteria 19210
6 JGI25155J39150_1000035 3300002704 Bacteria 99118
7 JGI25155J39150_1000282 3300002704 Bacteria 18440
8 JGI25156J39149_1000012 3300002705 Bacteria 194393
9 JGI25156J39149_1000488 3300002705 Bacteria 23811
10 JGI25156J39149_1002325 3300002705 Bacteria 6931
11 JGI25156J39149_1011844 3300002705 Bacteria 1952
12 JGI25162J39368_1003537 3300002737 Bacteria 4419
13 JGI25154J39366_1000029 3300002738 Bacteria 194393
14 JGI25154J39366_1000266 3300002738 Bacteria 33099
15 JGI25154J39366_1000285 3300002738 Bacteria 30441
16 JGI25154J39366_1000395 3300002738 Bacteria 23811
17 JGI25154J39366_1000436 3300002738 Bacteria 22196
18 JGI25158J39367_1000408 3300002739 Bacteria 8961
19 JGI25157J39369_1000014 3300002741 Bacteria 194393
20 JGI25157J39369_1000354 3300002741 Bacteria 32205
21 JGI25163J39215_1002546 3300002771 Bacteria 1816
22 JGI25164J39214_1001529 3300002772 Bacteria 5126
23 JGI25152J39213_1000598 3300002773 Bacteria 19394
24 JGI25152J39213_1010430 3300002773 Bacteria 2125
25 JGI25150J39212_1002185 3300002774 Bacteria 5000
26 JGI25159J45721_1003179 3300002987 Bacteria 5896
27 JGI25159J45721_1004593 3300002987 Bacteria 4540
28 JGI25159J45721_1011995 3300002987 Bacteria 2090
29 JGI25151J46595_10008323 3300003187 Bacteria 4996
30 JGI25151J46595_10013604 3300003187 Bacteria 3656
31 JGI25151J46595_10035879 3300003187 Bacteria 1877
32 JGI25165J46597_1000045 3300003214 Bacteria 257539
33 JGI25153J46596_10006424 3300003215 Bacteria 5943
34 JGI25160J50197_1000016 3300003354 Bacteria 247819
35 JGI25160J50197_1018508 3300003354 Bacteria 2168
36 JGI25161J50226_1000871 3300003374 Bacteria 11093
37 JGI25161J50226_1006540 3300003374 Bacteria 2090
38 Ga0006558J51389_1017413 3300003558 Bacteria 2523
39 Ga0006560J51390_1018844 3300003565 Bacteria 2480
40 Ga0006562J51391_1021459 3300003578 Bacteria 6520
41 Ga0055538_1000022 3300003751 Bacteria 257539
42 Ga0055539_1000028 3300003752 Bacteria 257539
43 Ga0055539_1000236 3300003752 Bacteria 37511
44 Ga0055533_1000036 3300003756 Bacteria 257539
45 Ga0055533_1001141 3300003756 Bacteria 7531
46 Ga0055532_1000143 3300003758 Bacteria 69615
47 Ga0055532_1000149 3300003758 Bacteria 66954
48 Ga0055525_1000023 3300003759 Bacteria 359920
49 Ga0055525_1000191 3300003759 Bacteria 75011
50 Ga0055525_1000450 3300003759 Bacteria 23644
51 Ga0055535_1000180 3300003761 Bacteria 66954
52 Ga0055535_1008266 3300003761 Bacteria 1896
53 Ga0055542_1000489 3300003762 Bacteria 36510
54 Ga0055542_1011580 3300003762 Bacteria 1560
55 Ga0055529_1000245 3300003763 Bacteria 66949
56 Ga0055529_1001162 3300003763 Bacteria 10845
57 Ga0055526_1000007 3300003771 Bacteria 321998
58 Ga0055526_1000054 3300003771 Bacteria 113702
59 Ga0055526_1000854 3300003771 Bacteria 22695
60 Ga0055526_1001838 3300003771 Bacteria 14684
61 Ga0055526_1002611 3300003771 Bacteria 12045
62 Ga0055526_1004481 3300003771 Bacteria 8371
63 Ga0055526_1006624 3300003771 Bacteria 6224
64 Ga0055526_1006883 3300003771 Bacteria 6057
65 Ga0055526_1006931 3300003771 Bacteria 6029
66 Ga0055526_1012789 3300003771 Bacteria 3622
67 Ga0055537_1000005 3300003773 Bacteria 160497
68 Ga0055537_1004353 3300003773 Bacteria 4062
69 Ga0055537_1015838 3300003773 Bacteria 1303
70 Ga0055524_1000038 3300003775 Bacteria 162683
71 Ga0055524_1000306 3300003775 Bacteria 46611
72 Ga0055524_1001416 3300003775 Bacteria 13806
73 Ga0055524_1002711 3300003775 Bacteria 8940
74 Ga0055524_1009930 3300003775 Bacteria 3827
75 Ga0055524_1010778 3300003775 Bacteria 3617
76 Ga0055524_1021199 3300003775 Bacteria 2161
77 Ga0055536_1000677 3300003781 Bacteria 22946
78 Ga0055536_1011832 3300003781 Bacteria 3297
79 Ga0055534_1000366 3300003784 Bacteria 28310
80 Ga0055534_1000394 3300003784 Bacteria 27123
81 Ga0055534_1002755 3300003784 Bacteria 5894
82 Ga0055534_1003092 3300003784 Bacteria 5414
83 Ga0055534_1004091 3300003784 Bacteria 4351
84 Ga0055534_1004442 3300003784 Bacteria 4063
85 Ga0055528_1000063 3300003790 Bacteria 85587
86 Ga0055528_1000480 3300003790 Bacteria 31747
87 Ga0055530_10000863 3300003791 Bacteria 24942
88 Ga0055530_10002415 3300003791 Bacteria 12094
89 Ga0055530_10003829 3300003791 Bacteria 8264
90 Ga0055530_10014605 3300003791 Bacteria 2605
91 Ga0055540_1000449 3300003792 Bacteria 32166
92 Ga0055531_10002683 3300003794 Bacteria 11722
93 Ga0055531_10014143 3300003794 Bacteria 3618
94 Ga0055541_1000094 3300003841 Bacteria 75011
95 Ga0055541_1000766 3300003841 Bacteria 8130
96 Ga0055543_1001173 3300004625 Bacteria 11131
97 Ga0065165_1000875 3300005262 Bacteria 38986
98 Ga0065165_1004087 3300005262 Bacteria 9444
99 Ga0065165_1011381 3300005262 Bacteria 3720
100 Ga0065165_1014882 3300005262 Bacteria 2998
101 Ga0065165_1023232 3300005262 Bacteria 2107
102 Ga0065715_10006400 3300005293 Bacteria 3862
103 Ga0070658_10000918 3300005327 Bacteria 25164
104 Ga0070658_10389915 3300005327 Bacteria 1195
105 Ga0070670_100012755 3300005331 Bacteria 7192
106 Ga0070660_100036600 3300005339 Bacteria 3718
107 Ga0070660_100067023 3300005339 Bacteria 2796
108 Ga0070661_100000048 3300005344 Bacteria 91068
109 Ga0070671_100272756 3300005355 Bacteria 1438
110 Ga0070659_100001892 3300005366 Bacteria 14978
111 Ga0070659_100005090 3300005366 Bacteria 9429
112 Ga0070659_100015694 3300005366 Bacteria 5674
113 Ga0070659_100072925 3300005366 Bacteria 2733
114 Ga0070667_100077700 3300005367 Bacteria 2835
115 Ga0070663_100000001 3300005455 Bacteria 318372
116 Ga0070663_100009774 3300005455 Bacteria 5957
117 Ga0070678_100444000 3300005456 Bacteria 1135
118 Ga0070662_100047882 3300005457 Bacteria 3077
119 Ga0070684_100229677 3300005535 Bacteria 1694
120 Ga0068853_100061476 3300005539 Bacteria 3249
121 Ga0070665_100104899 3300005548 Bacteria 2829
122 Ga0070665_100116857 3300005548 Bacteria 2670
123 Ga0068855_100002049 3300005563 Bacteria 24988
124 Ga0068855_100037617 3300005563 Bacteria 5753
125 Ga0068855_100290961 3300005563 Bacteria 1811
126 Ga0070664_100000016 3300005564 Bacteria 128509
127 Ga0070664_100264075 3300005564 Bacteria 1549
128 Ga0068854_100000124 3300005578 Bacteria 53140
129 Ga0068856_100000047 3300005614 Bacteria 108894
130 Ga0068856_100158027 3300005614 Bacteria 2277
131 Ga0068852_100164612 3300005616 Bacteria 2074
132 Ga0068852_100205627 3300005616 Bacteria 1865
133 Ga0070717_10027331 3300006028 Bacteria 4560
134 Ga0075364_10003966 3300006051 Bacteria 8499
135 Ga0075364_10005124 3300006051 Bacteria 7595
136 Ga0075364_10084279 3300006051 Bacteria 2104
137 Ga0075364_10199259 3300006051 Bacteria 1357
138 Ga0075430_100079739 3300006846 Bacteria 2743
139 Ga0075431_100004543 3300006847 Bacteria 13627
140 Ga0068865_100041971 3300006881 Bacteria 3116
141 Ga0079104_1004960 3300006946 Bacteria 5477
142 Ga0099826_10000008 3300006948 Bacteria 380974
143 Ga0099826_10000022 3300006948 Bacteria 159004
144 Ga0105251_10001447 3300009011 Bacteria 20403
145 Ga0105251_10016252 3300009011 Bacteria 4029
146 Ga0105251_10017543 3300009011 Bacteria 3832
147 Ga0105244_10001703 3300009036 Bacteria 17364
148 Ga0105244_10002571 3300009036 Bacteria 13626
149 Ga0105244_10022022 3300009036 Bacteria 3514
150 Ga0105244_10074399 3300009036 Bacteria 1690
151 Ga0105240_10005916 3300009093 Bacteria 18119
152 Ga0105240_10007519 3300009093 Bacteria 15811
153 Ga0105240_10045943 3300009093 Bacteria 5537
154 Ga0105240_10125609 3300009093 Bacteria 3083
155 Ga0105240_10125967 3300009093 Bacteria 3078
156 Ga0105245_10202132 3300009098 Bacteria 1908
157 Ga0105247_10115645 3300009101 Bacteria 1731
158 Ga0114129_10017494 3300009147 Bacteria 10207
159 Ga0105241_10025372 3300009174 Bacteria 4404
160 Ga0105241_10139127 3300009174 Bacteria 1975
161 Ga0105242_10030203 3300009176 Bacteria 4327
162 Ga0105248_10003137 3300009177 Bacteria 18293
163 Ga0105248_10443160 3300009177 Bacteria 1463
164 Ga0105237_10054083 3300009545 Bacteria 4023
165 Ga0105237_10325072 3300009545 Bacteria 1542
166 Ga0105238_10584905 3300009551 Bacteria 1123
167 Ga0105028_100512 3300009993 Bacteria 4167
168 Ga0105239_10176817 3300010375 Bacteria 2387
169 Ga0105239_10560356 3300010375 Bacteria 1302
170 Ga0105239_10620176 3300010375 Bacteria 1234
171 Ga0105246_10081055 3300011119 Bacteria 2312
172 Ga0105246_10348866 3300011119 Bacteria 1212
173 Ga0157373_10001283 3300013100 Bacteria 19190
174 Ga0157371_10000080 3300013102 Bacteria 152121
175 Ga0157370_10000032 3300013104 Bacteria 138963
176 Ga0157370_10003903 3300013104 Bacteria 17377
177 Ga0157369_10004526 3300013105 Bacteria 16359
178 Ga0163162_10004087 3300013306 Bacteria 14005
179 Ga0157372_10001481 3300013307 Bacteria 25501
180 Ga0157375_10113643 3300013308 Bacteria 2809
181 Ga0182008_10058013 3300014497 Bacteria 1912
182 Ga0182006_1002574 3300015261 Bacteria 9828
183 Ga0182006_1021193 3300015261 Bacteria 2713
184 Ga0182007_10001316 3300015262 Bacteria 13425
185 Ga0182007_10034799 3300015262 Bacteria 1699
186 Ga0182005_1000006 3300015265 Bacteria 515188
187 Ga0182005_1011436 3300015265 Bacteria 2529
188 Ga0183362_10003 3300015683 Bacteria 977584
189 Ga0163161_10103463 3300017792 Bacteria 2122
190 Ga0154015_1001453 3300020610 Bacteria 16894
191 Ga0213872_10000022 3300021361 Bacteria 158011
192 Ga0213872_10000108 3300021361 Bacteria 76910
193 Ga0213872_10000642 3300021361 Bacteria 26433
194 Ga0213872_10000745 3300021361 Bacteria 24082
195 Ga0213872_10001440 3300021361 Bacteria 15506
196 Ga0213872_10002016 3300021361 Bacteria 12335
197 Ga0213872_10007168 3300021361 Bacteria 5511
198 Ga0209435_100002 3300025206 Bacteria 794178
199 Ga0209435_100053 3300025206 Bacteria 88737
200 Ga0209435_102376 3300025206 Bacteria 2213
201 Ga0209435_105054 3300025206 Bacteria 1480
202 Ga0209760_101944 3300025207 Bacteria 2021
203 Ga0209436_100219 3300025208 Bacteria 26306
204 Ga0209436_103731 3300025208 Bacteria 3948
205 Ga0209784_100006 3300025224 Bacteria 930704
206 Ga0209784_100036 3300025224 Bacteria 263689
207 Ga0209784_100472 3300025224 Bacteria 16603
208 Ga0209566_100002 3300025225 Bacteria 2614868
209 Ga0209566_100044 3300025225 Bacteria 263689
210 Ga0209566_100303 3300025225 Bacteria 44626
211 Ga0209566_101736 3300025225 Bacteria 5244
212 Ga0209674_100010 3300025226 Bacteria 1038638
213 Ga0209674_100065 3300025226 Bacteria 263689
214 Ga0209674_100176 3300025226 Bacteria 79399
215 Ga0209674_100206 3300025226 Bacteria 59401
216 Ga0209672_101382 3300025228 Bacteria 8992
217 Ga0209147_100018 3300025229 Bacteria 515719
218 Ga0209147_100060 3300025229 Bacteria 249588
219 Ga0209563_100011 3300025230 Bacteria 1187808
220 Ga0209563_100041 3300025230 Bacteria 407467
221 Ga0209563_100063 3300025230 Bacteria 263689
222 Ga0209563_102556 3300025230 Bacteria 4080
223 Ga0207427_100798 3300025231 Bacteria 14323
224 Ga0209437_100082 3300025233 Bacteria 263689
225 Ga0209437_100311 3300025233 Bacteria 65616
226 Ga0209437_106017 3300025233 Bacteria 2038
227 Ga0209258_100028 3300025242 Bacteria 515719
228 Ga0209258_100388 3300025242 Bacteria 56204
229 Ga0207425_1000009 3300025245 Bacteria 593135
230 Ga0207425_1000679 3300025245 Bacteria 18554
231 Ga0207425_1007277 3300025245 Bacteria 2941
232 Ga0209646_1000001 3300025246 Bacteria 3092932
233 Ga0209646_1000042 3300025246 Bacteria 343923
234 Ga0209646_1000043 3300025246 Bacteria 343652
235 Ga0209646_1000101 3300025246 Bacteria 164503
236 Ga0209646_1000164 3300025246 Bacteria 89308
237 Ga0209026_1000040 3300025250 Bacteria 277470
238 Ga0209026_1000167 3300025250 Bacteria 100451
239 Ga0209026_1003296 3300025250 Bacteria 5393
240 Ga0209026_1008097 3300025250 Bacteria 2246
241 Ga0209026_1011247 3300025250 Bacteria 1623
242 Ga0209677_100007 3300025253 Bacteria 1021332
243 Ga0209677_100038 3300025253 Bacteria 263689
244 Ga0209677_100566 3300025253 Bacteria 20483
245 Ga0209677_104182 3300025253 Bacteria 4286
246 Ga0209148_1000199 3300025254 Bacteria 108936
247 Ga0209148_1000348 3300025254 Bacteria 60117
248 Ga0209759_1000001 3300025256 Bacteria 2799452
249 Ga0209759_1000360 3300025256 Bacteria 58460
250 Ga0209759_1000996 3300025256 Bacteria 19393
251 Ga0209759_1005535 3300025256 Bacteria 4399
252 Ga0209129_1000051 3300025258 Bacteria 267104
253 Ga0209129_1001385 3300025258 Bacteria 13560
254 Ga0209233_1000109 3300025261 Bacteria 263689
255 Ga0209565_1000026 3300025263 Bacteria 365910
256 Ga0209565_1000074 3300025263 Bacteria 164237
257 Ga0209565_1000426 3300025263 Bacteria 34052
258 Ga0209565_1000453 3300025263 Bacteria 31642
259 Ga0209565_1001224 3300025263 Bacteria 12108
260 Ga0209565_1001533 3300025263 Bacteria 9951
261 Ga0209565_1005567 3300025263 Bacteria 3641
262 Ga0209565_1005715 3300025263 Bacteria 3585
263 Ga0209455_1000065 3300025272 Bacteria 321272
264 Ga0209455_1001145 3300025272 Bacteria 12804
265 Ga0209455_1001449 3300025272 Bacteria 10673
266 Ga0209673_1000009 3300025273 Bacteria 620735
267 Ga0209673_1000012 3300025273 Bacteria 579480
268 Ga0209673_1000129 3300025273 Bacteria 164238
269 Ga0209673_1005121 3300025273 Bacteria 6714
270 Ga0209673_1007611 3300025273 Bacteria 4951
271 Ga0209673_1031015 3300025273 Bacteria 1671
272 Ga0209130_1000644 3300025284 Bacteria 32528
273 Ga0209130_1001985 3300025284 Bacteria 11245
274 Ga0209130_1007196 3300025284 Bacteria 3480
275 Ga0209675_1000072 3300025291 Bacteria 164237
276 Ga0209675_1000090 3300025291 Bacteria 146665
277 Ga0209675_1000174 3300025291 Bacteria 74594
278 Ga0209675_1000308 3300025291 Bacteria 44127
279 Ga0209675_1000426 3300025291 Bacteria 34022
280 Ga0209675_1001322 3300025291 Bacteria 14705
281 Ga0209675_1010475 3300025291 Bacteria 3162
282 Ga0209675_1011234 3300025291 Bacteria 2984
283 Ga0209675_1022598 3300025291 Bacteria 1648
284 Ga0209676_1000013 3300025292 Bacteria 816080
285 Ga0209676_1001413 3300025292 Bacteria 22998
286 Ga0209676_1006627 3300025292 Bacteria 5659
287 Ga0209025_1001481 3300025294 Bacteria 30488
288 Ga0209025_1002193 3300025294 Bacteria 21617
289 Ga0209025_1005365 3300025294 Bacteria 10492
290 Ga0209025_1016928 3300025294 Bacteria 4251
291 Ga0209025_1017504 3300025294 Bacteria 4130
292 Ga0209025_1018519 3300025294 Bacteria 3937
293 Ga0209564_1000010 3300025295 Bacteria 885399
294 Ga0209564_1000042 3300025295 Bacteria 392805
295 Ga0209564_1000119 3300025295 Bacteria 204926
296 Ga0209564_1000145 3300025295 Bacteria 175251
297 Ga0209564_1000160 3300025295 Bacteria 164214
298 Ga0209564_1000172 3300025295 Bacteria 155715
299 Ga0209564_1001240 3300025295 Bacteria 28664
300 Ga0209564_1001261 3300025295 Bacteria 27868
301 Ga0209564_1001304 3300025295 Bacteria 26859
302 Ga0209564_1001909 3300025295 Bacteria 18634
303 Ga0209564_1004730 3300025295 Bacteria 8150
304 Ga0209564_1005940 3300025295 Bacteria 6762
305 Ga0209564_1006459 3300025295 Bacteria 6315
306 Ga0209564_1007529 3300025295 Bacteria 5608
307 Ga0209564_1008581 3300025295 Bacteria 5017
308 Ga0209758_1000054 3300025297 Bacteria 337655
309 Ga0209758_1040846 3300025297 Bacteria 1744
310 Ga0209050_1000008 3300025298 Bacteria 1144179
311 Ga0209050_1000040 3300025298 Bacteria 408492
312 Ga0209050_1000309 3300025298 Bacteria 99432
313 Ga0209050_1001429 3300025298 Bacteria 25722
314 Ga0209050_1003284 3300025298 Bacteria 12146
315 Ga0209256_1000003 3300025299 Bacteria 1661127
316 Ga0209256_1000125 3300025299 Bacteria 165336
317 Ga0209256_1000307 3300025299 Bacteria 85852
318 Ga0209256_1001148 3300025299 Bacteria 30046
319 Ga0209256_1001617 3300025299 Bacteria 21980
320 Ga0209256_1003455 3300025299 Bacteria 11060
321 Ga0209256_1003493 3300025299 Bacteria 10955
322 Ga0209256_1007694 3300025299 Bacteria 5230
323 Ga0209256_1010465 3300025299 Bacteria 3878
324 Ga0207426_1000007 3300025302 Bacteria 971011
325 Ga0207426_1002593 3300025302 Bacteria 11226
326 Ga0207426_1003042 3300025302 Bacteria 9688
327 Ga0207426_1006546 3300025302 Bacteria 5035
328 Ga0209051_1000005 3300025303 Bacteria 1142353
329 Ga0209051_1004988 3300025303 Bacteria 7922
330 Ga0209051_1037602 3300025303 Bacteria 1772
331 Ga0209257_1000048 3300025304 Bacteria 455536
332 Ga0209257_1000054 3300025304 Bacteria 416957
333 Ga0207655_1000933 3300025728 Bacteria 30311
334 Ga0207655_1001881 3300025728 Bacteria 18046
335 Ga0207713_1005784 3300025735 Bacteria 7654
336 Ga0207710_10118793 3300025900 Bacteria 1261
337 Ga0207647_10001501 3300025904 Bacteria 17934
338 Ga0207705_10001434 3300025909 Bacteria 19002
339 Ga0207705_10002099 3300025909 Bacteria 15494
340 Ga0207705_10479290 3300025909 Bacteria 966
341 Ga0207654_10002736 3300025911 Bacteria 8945
342 Ga0207654_10156419 3300025911 Bacteria 1468
343 Ga0207695_10004867 3300025913 Bacteria 18117
344 Ga0207695_10008068 3300025913 Bacteria 13248
345 Ga0207695_10008879 3300025913 Bacteria 12515
346 Ga0207695_10041090 3300025913 Bacteria 4951
347 Ga0207671_10034942 3300025914 Bacteria 3732
348 Ga0207671_10375082 3300025914 Bacteria 1130
349 Ga0207657_10004477 3300025919 Bacteria 14775
350 Ga0207657_10039164 3300025919 Bacteria 4214
351 Ga0207657_10058162 3300025919 Bacteria 3328
352 Ga0207649_10000200 3300025920 Bacteria 49831
353 Ga0207649_10044597 3300025920 Bacteria 2716
354 Ga0207694_10055129 3300025924 Bacteria 3086
355 Ga0207650_10032348 3300025925 Bacteria 3783
356 Ga0207644_10092145 3300025931 Bacteria 2261
357 Ga0207690_10001438 3300025932 Bacteria 14901
358 Ga0207690_10056174 3300025932 Bacteria 2654
359 Ga0207690_10243000 3300025932 Bacteria 1387
360 Ga0207706_10291803 3300025933 Bacteria 1422
361 Ga0207686_10008391 3300025934 Bacteria 5576
362 Ga0207686_10303852 3300025934 Bacteria 1186
363 Ga0207711_10005592 3300025941 Bacteria 10626
364 Ga0207679_10000012 3300025945 Bacteria 339773
365 Ga0207679_10022486 3300025945 Bacteria 4295
366 Ga0207679_10111550 3300025945 Bacteria 2160
367 Ga0207667_10012454 3300025949 Bacteria 9797
368 Ga0207667_10167032 3300025949 Bacteria 2262
369 Ga0207667_10288533 3300025949 Bacteria 1677
370 Ga0207667_10322236 3300025949 Bacteria 1578
371 Ga0207651_10065985 3300025960 Bacteria 2541
372 Ga0207640_10000047 3300025981 Bacteria 98563
373 Ga0207658_10054737 3300025986 Bacteria 2953
374 Ga0207678_10000028 3300026067 Bacteria 115277
375 Ga0207678_10014291 3300026067 Bacteria 6980
376 Ga0207678_10092758 3300026067 Bacteria 2581
377 Ga0207702_10000255 3300026078 Bacteria 61384
378 Ga0207674_10060104 3300026116 Bacteria 3844
379 Ga0207674_10070925 3300026116 Bacteria 3503
380 Ga0207683_10467315 3300026121 Bacteria 1164
381 Ga0207698_10003628 3300026142 Bacteria 9316
382 Ga0207698_10428526 3300026142 Bacteria 1271
383 Ga0209371_1013726 3300027312 Bacteria 2255
384 Ga0209282_1000005 3300027666 Bacteria 380858
385 Ga0209282_1000841 3300027666 Bacteria 15819
386 Ga0209966_1019186 3300027695 Bacteria 1316
387 Ga0268266_10058376 3300028379 Bacteria 3323
388 Ga0268256_1020211 3300030500 Bacteria 1801
389 Ga0307511_10000025 3300030521 Bacteria 112344
390 Ga0316177_1152336 3300030731 Bacteria 5855
391 Ga0316181_1030474 3300030744 Bacteria 2916
392 Ga0265332_10011873 3300031238 Bacteria 3868
393 Ga0265328_10046110 3300031239 Bacteria 1603
394 Ga0265320_10122938 3300031240 Bacteria 1182
395 Ga0265331_10018875 3300031250 Bacteria 3565
396 Ga0265327_10000266 3300031251 Bacteria 103308
397 Ga0307513_10000057 3300031456 Bacteria 146564
398 Ga0307513_10233994 3300031456 Bacteria 1648
399 Ga0307408_100000227 3300031548 Bacteria 59538
400 Ga0307408_100000830 3300031548 Bacteria 24512
401 Ga0307408_100003641 3300031548 Bacteria 10502
402 Ga0307408_100005010 3300031548 Bacteria 8886
403 Ga0307408_100006847 3300031548 Bacteria 7556
404 Ga0307408_100205999 3300031548 Bacteria 1595
405 Ga0307508_10122120 3300031616 Bacteria 2208
406 Ga0265314_10003180 3300031711 Bacteria 16087
407 Ga0265314_10023252 3300031711 Bacteria 4730
408 Ga0307405_10112975 3300031731 Bacteria 1844
409 Ga0307405_10116142 3300031731 Bacteria 1822
410 Ga0307410_10082671 3300031852 Bacteria 2260
411 Ga0307407_10067008 3300031903 Bacteria 2120
412 Ga0307407_10204251 3300031903 Bacteria 1326
413 Ga0307412_10000313 3300031911 Bacteria 30726
414 Ga0307412_10111984 3300031911 Bacteria 1950
415 Ga0307409_100032337 3300031995 Bacteria 3792
416 Ga0307409_100066972 3300031995 Bacteria 2834
417 Ga0307409_100235766 3300031995 Bacteria 1662
418 Ga0307409_100254176 3300031995 Bacteria 1608
419 Ga0307416_100025772 3300032002 Bacteria 4319
420 Ga0307416_100105482 3300032002 Bacteria 2467
421 Ga0307414_10140684 3300032004 Bacteria 1889
422 Ga0307411_10026064 3300032005 Bacteria 3514
423 Ga0307415_100009334 3300032126 Bacteria 5493
424 Ga0307507_10040352 3300033179 Bacteria 4690
425 Ga0373935_0278999 3300035692 Bacteria 1176
426 Ga0395899_0005285 3300037312 Bacteria 10023
427 Ga0395899_0029825 3300037312 Bacteria 4103
428 Ga0395899_0038326 3300037312 Bacteria 3590
429 Ga0395899_0284330 3300037312 Bacteria 1124
430 Ga0395899_0377942 3300037312 Bacteria 942
431 Ga0395900_0001043 3300037418 Bacteria 35555
432 Ga0395900_0001113 3300037418 Bacteria 34100
433 Ga0395900_0001479 3300037418 Bacteria 28032
434 Ga0395900_0008818 3300037418 Bacteria 10359
435 Ga0395900_0010859 3300037418 Bacteria 9314
436 Ga0395900_0017195 3300037418 Bacteria 7380
437 Ga0395900_0032314 3300037418 Bacteria 5381
438 Ga0395900_0153903 3300037418 Bacteria 2349
439 Ga0395900_0518863 3300037418 Bacteria 1140
440 Ga0395898_0006387 3300037466 Bacteria 12593
441 Ga0395898_0012459 3300037466 Bacteria 8791
442 Ga0395898_0394531 3300037466 Bacteria 1319
443 Ga0395905_0000079 3300037471 Bacteria 160663
444 Ga0395905_0001013 3300037471 Bacteria 35872
445 Ga0395905_0009071 3300037471 Bacteria 9755
446 Ga0395905_0010644 3300037471 Bacteria 8923
447 Ga0395905_0014269 3300037471 Bacteria 7590
448 Ga0395905_0101870 3300037471 Bacteria 2695
449 Ga0395905_0136672 3300037471 Bacteria 2306
450 Ga0395905_0189371 3300037471 Bacteria 1930
451 Ga0395905_0345567 3300037471 Bacteria 1379
452 Ga0395901_0000122 3300038443 Bacteria 100003
453 Ga0395901_0000278 3300038443 Bacteria 63368
454 Ga0395901_0001341 3300038443 Bacteria 25811
455 Ga0395901_0001431 3300038443 Bacteria 24880
456 Ga0395901_0095092 3300038443 Bacteria 3122
457 Ga0395901_0108667 3300038443 Bacteria 2911
458 Ga0395901_0132106 3300038443 Bacteria 2623
459 Ga0395901_0133256 3300038443 Bacteria 2611
460 Ga0395901_0157250 3300038443 Bacteria 2387
461 Ga0395901_0159462 3300038443 Bacteria 2369
462 Ga0395901_0470238 3300038443 Bacteria 1283
463 Ga0436361_0059985 3300039447 Bacteria 7648
464 Ga0436361_0135595 3300039447 Bacteria 4824
465 Ga0436361_0183975 3300039447 Bacteria 24933
466 Ga0436361_0240598 3300039447 Bacteria 30904
467 Ga0436361_0360734 3300039447 Bacteria 7026
468 Ga0436361_0403221 3300039447 Bacteria 8653
469 Ga0436361_0526987 3300039447 Bacteria 13726
470 Ga0436361_0675000 3300039447 Bacteria 73288
471 Ga0436361_1070817 3300039447 Bacteria 30666
472 Ga0436361_1183286 3300039447 Bacteria 15711
473 Ga0439436_0047617 3300041404 Bacteria 1217
474 Ga0439461_0004070 3300041410 Bacteria 2428
475 Ga0450917_000327 3300042120 Bacteria 3545
476 Ga0450888_000542 3300042126 Bacteria 3560
477 Ga0450890_002604 3300042127 Bacteria 2460
478 Ga0450891_000499 3300042129 Bacteria 4106
479 Ga0450892_000826 3300042130 Bacteria 3406
480 Ga0450889_008251 3300042144 Bacteria 1056
481 Ga0439446_0035102 3300042156 Bacteria 1461
482 Ga0450909_007041 3300042185 Bacteria 1624
483 Ga0439434_0085719 3300042435 Bacteria 1003
484 Ga0439460_0034492 3300042461 Bacteria 1459
485 Ga0450893_0000157 3300042532 Bacteria 8548
486 Ga0451577_0010055 3300042876 Bacteria 9065
487 Ga0451577_0018596 3300042876 Bacteria 6399
488 Ga0466972_0000084 3300044658 Bacteria 86336
489 Ga0466972_0165579 3300044658 Bacteria 1038
490 Ga0453683_0008084 3300044673 Bacteria 7078
491 Ga0453683_0062882 3300044673 Bacteria 2321
492 Ga0466965_0044312 3300044683 Bacteria 2198
493 Ga0466961_0000722 3300044693 Bacteria 20781
494 Ga0466964_0000593 3300044706 Bacteria 11449
495 Ga0466964_0011530 3300044706 Bacteria 3340
496 Ga0453684_0000280 3300044712 Bacteria 219955
497 Ga0453684_0025363 3300044712 Bacteria 8611
498 Ga0453684_0030004 3300044712 Bacteria 7698
499 Ga0453684_0073208 3300044712 Bacteria 4321
500 Ga0466970_0050723 3300044765 Bacteria 2214
501 Ga0466957_0000018 3300044842 Bacteria 64818
502 Ga0466957_0031011 3300044842 Bacteria 3193
503 Ga0466960_0067011 3300044901 Bacteria 1777
504 Ga0466959_0001982 3300045049 Bacteria 12897
505 Ga0466959_0191441 3300045049 Bacteria 1427
506 Ga0451576_0003797 3300045051 Bacteria 20361
507 Ga0451576_0103469 3300045051 Bacteria 2962
508 Ga0466958_0213033 3300045836 Bacteria 1231
509 Ga0466967_0060490 3300045976 Bacteria 3356
510 Ga0466967_0073571 3300045976 Bacteria 3066
511 Ga0495617_000027 3300046452 Bacteria 157385
512 Ga0495617_000069 3300046452 Bacteria 87505
513 Ga0495617_000638 3300046452 Bacteria 17598
514 Ga0495617_000710 3300046452 Bacteria 16565
515 Ga0495627_000004 3300046453 Bacteria 640612
516 Ga0495627_004991 3300046453 Bacteria 5444
517 Ga0495590_0000012 3300046457 Bacteria 303377
518 Ga0495590_0000544 3300046457 Bacteria 18083
519 Ga0495590_0003255 3300046457 Bacteria 6640
520 Ga0495591_000616 3300046458 Bacteria 26709
521 Ga0495638_0000047 3300046460 Bacteria 216004
522 Ga0495638_0008241 3300046460 Bacteria 7406
523 Ga0495638_0042965 3300046460 Bacteria 2853
524 Ga0495651_0025836 3300046462 Bacteria 4572
525 Ga0495653_0000082 3300046463 Bacteria 80285
526 Ga0495653_0018694 3300046463 Bacteria 5626
527 Ga0495653_0035460 3300046463 Bacteria 3936
528 Ga0495650_0000077 3300046471 Bacteria 245511
529 Ga0495650_0000265 3300046471 Bacteria 100744
530 Ga0495650_0000899 3300046471 Bacteria 35060
531 Ga0495650_0002013 3300046471 Bacteria 17822
532 Ga0495650_0039394 3300046471 Bacteria 2039
533 Ga0495580_0014623 3300046472 Bacteria 5948
534 Ga0495580_0076996 3300046472 Bacteria 2326
535 Ga0495605_0000018 3300046474 Bacteria 270187
536 Ga0495605_0000135 3300046474 Bacteria 95104
537 Ga0495605_0000399 3300046474 Bacteria 39905
538 Ga0495605_0005897 3300046474 Bacteria 7080
539 Ga0495605_0017791 3300046474 Bacteria 3820
540 Ga0495605_0024741 3300046474 Bacteria 3138
541 Ga0495605_0026091 3300046474 Bacteria 3039
542 Ga0495605_0054565 3300046474 Bacteria 1935
543 Ga0495639_0030029 3300046475 Bacteria 2415
544 Ga0495584_0000004 3300046491 Bacteria 314714
545 Ga0495584_0000760 3300046491 Bacteria 21323
546 Ga0495584_0002070 3300046491 Bacteria 11514
547 Ga0495584_0003737 3300046491 Bacteria 8291
548 Ga0495584_0027888 3300046491 Bacteria 2860
549 Ga0495584_0027962 3300046491 Bacteria 2856
550 Ga0495584_0127670 3300046491 Bacteria 1289
551 Ga0495584_0140704 3300046491 Bacteria 1225
552 Ga0495584_0158877 3300046491 Bacteria 1148
553 Ga0495585_0000050 3300046492 Bacteria 119283
554 Ga0495585_0000053 3300046492 Bacteria 115559
555 Ga0495585_0000420 3300046492 Bacteria 40892
556 Ga0495585_0001162 3300046492 Bacteria 21412
557 Ga0495585_0005092 3300046492 Bacteria 8366
558 Ga0495585_0007426 3300046492 Bacteria 6710
559 Ga0495585_0009418 3300046492 Bacteria 5858
560 Ga0495585_0011548 3300046492 Bacteria 5226
561 Ga0495585_0062264 3300046492 Bacteria 2049
562 Ga0495594_0064901 3300046499 Bacteria 2024
563 Ga0495594_0121025 3300046499 Bacteria 1479
564 Ga0495594_0137427 3300046499 Bacteria 1385
565 Ga0495596_0000381 3300046500 Bacteria 28365
566 Ga0495596_0000675 3300046500 Bacteria 21244
567 Ga0495596_0005207 3300046500 Bacteria 6183
568 Ga0495596_0005873 3300046500 Bacteria 5736
569 Ga0495596_0009233 3300046500 Bacteria 4348
570 Ga0495596_0046416 3300046500 Bacteria 1706
571 Ga0495607_0000638 3300046501 Bacteria 34024
572 Ga0495607_0000757 3300046501 Bacteria 30953
573 Ga0495607_0001821 3300046501 Bacteria 18187
574 Ga0495607_0003245 3300046501 Bacteria 12535
575 Ga0495607_0004753 3300046501 Bacteria 9928
576 Ga0495607_0005155 3300046501 Bacteria 9430
577 Ga0495607_0005235 3300046501 Bacteria 9334
578 Ga0495607_0047120 3300046501 Bacteria 2527
579 Ga0495607_0110497 3300046501 Bacteria 1458
580 Ga0495607_0123309 3300046501 Bacteria 1357
581 Ga0495583_0000092 3300046506 Bacteria 158865
582 Ga0495583_0000223 3300046506 Bacteria 95922
583 Ga0495583_0001001 3300046506 Bacteria 32337
584 Ga0495583_0001420 3300046506 Bacteria 24384
585 Ga0495583_0025064 3300046506 Bacteria 2986
586 Ga0495583_0028439 3300046506 Bacteria 2748
587 Ga0495583_0031281 3300046506 Bacteria 2581
588 Ga0495583_0053784 3300046506 Bacteria 1826
589 Ga0495606_0000101 3300046507 Bacteria 146752
590 Ga0495606_0000423 3300046507 Bacteria 70535
591 Ga0495606_0000623 3300046507 Bacteria 55841
592 Ga0495606_0001015 3300046507 Bacteria 40726
593 Ga0495606_0001399 3300046507 Bacteria 32508
594 Ga0495606_0005147 3300046507 Bacteria 12678
595 Ga0495606_0019832 3300046507 Bacteria 4979
596 Ga0495606_0039551 3300046507 Bacteria 3176
597 Ga0495606_0145803 3300046507 Bacteria 1394
598 Ga0495606_0156365 3300046507 Bacteria 1334
599 Ga0495608_0015265 3300046511 Bacteria 5329
600 Ga0495610_0000293 3300046512 Bacteria 52547
601 Ga0495610_0005084 3300046512 Bacteria 9475
602 Ga0495610_0007541 3300046512 Bacteria 7210
603 Ga0495610_0010594 3300046512 Bacteria 5715
604 Ga0495610_0128712 3300046512 Bacteria 1101
605 Ga0495616_0000313 3300046513 Bacteria 38775
606 Ga0495616_0002756 3300046513 Bacteria 11496
607 Ga0495616_0006096 3300046513 Bacteria 7347
608 Ga0495616_0010003 3300046513 Bacteria 5510
609 Ga0495616_0016517 3300046513 Bacteria 4084
610 Ga0495616_0049914 3300046513 Bacteria 2095
611 Ga0495616_0053037 3300046513 Bacteria 2017
612 Ga0495620_0035220 3300046515 Bacteria 2253
613 Ga0495631_0000402 3300046518 Bacteria 29972
614 Ga0495631_0003723 3300046518 Bacteria 8312
615 Ga0495631_0008869 3300046518 Bacteria 5047
616 Ga0495631_0009137 3300046518 Bacteria 4963
617 Ga0495631_0013222 3300046518 Bacteria 4012
618 Ga0495631_0032632 3300046518 Bacteria 2346
619 Ga0495631_0087396 3300046518 Bacteria 1342
620 Ga0495631_0088238 3300046518 Bacteria 1335
621 Ga0495631_0116364 3300046518 Bacteria 1149
622 Ga0495632_0000012 3300046519 Bacteria 264389
623 Ga0495632_0002651 3300046519 Bacteria 13436
624 Ga0495637_0000515 3300046520 Bacteria 28094
625 Ga0495643_0000234 3300046522 Bacteria 84022
626 Ga0495643_0000388 3300046522 Bacteria 58226
627 Ga0495643_0004796 3300046522 Bacteria 9328
628 Ga0495643_0014097 3300046522 Bacteria 4766
629 Ga0495643_0035804 3300046522 Bacteria 2731
630 Ga0495643_0047866 3300046522 Bacteria 2313
631 Ga0495643_0077599 3300046522 Bacteria 1735
632 Ga0495643_0156699 3300046522 Bacteria 1123
633 Ga0495644_0001228 3300046523 Bacteria 10492
634 Ga0495644_0009233 3300046523 Bacteria 3801
635 Ga0495644_0020851 3300046523 Bacteria 2499
636 Ga0495644_0061183 3300046523 Bacteria 1415
637 Ga0495648_0000019 3300046524 Bacteria 276407
638 Ga0495648_0000451 3300046524 Bacteria 44465
639 Ga0495648_0002819 3300046524 Bacteria 15637
640 Ga0495648_0005435 3300046524 Bacteria 10584
641 Ga0495648_0009552 3300046524 Bacteria 7487
642 Ga0495648_0013593 3300046524 Bacteria 6004
643 Ga0495648_0016047 3300046524 Bacteria 5408
644 Ga0495648_0086316 3300046524 Bacteria 1770
645 Ga0495648_0088829 3300046524 Bacteria 1736
646 Ga0495648_0108826 3300046524 Bacteria 1512
647 Ga0495642_0000587 3300046528 Bacteria 18236
648 Ga0495642_0000876 3300046528 Bacteria 14202
649 Ga0495642_0004550 3300046528 Bacteria 5377
650 Ga0495642_0110525 3300046528 Bacteria 1175
651 Ga0495652_0272077 3300046529 Bacteria 1244
652 Ga0495654_0010404 3300046530 Bacteria 5063
653 Ga0495654_0039095 3300046530 Bacteria 2369
654 Ga0495654_0044473 3300046530 Bacteria 2196
655 Ga0495665_0144137 3300046531 Bacteria 1244
656 Ga0495640_0152202 3300046533 Bacteria 1486
657 Ga0495586_0096581 3300046535 Bacteria 1636
658 Ga0495609_0000117 3300046538 Bacteria 92147
659 Ga0495609_0000127 3300046538 Bacteria 82467
660 Ga0495609_0000741 3300046538 Bacteria 24793
661 Ga0495609_0002223 3300046538 Bacteria 12147
662 Ga0495609_0003071 3300046538 Bacteria 9795
663 Ga0495609_0005683 3300046538 Bacteria 6494
664 Ga0495609_0006898 3300046538 Bacteria 5735
665 Ga0495609_0010218 3300046538 Bacteria 4510
666 Ga0495609_0015624 3300046538 Bacteria 3551
667 Ga0495597_0000075 3300046542 Bacteria 86570
668 Ga0495597_0000500 3300046542 Bacteria 32676
669 Ga0495597_0000907 3300046542 Bacteria 22980
670 Ga0495597_0003375 3300046542 Bacteria 9366
671 Ga0495597_0006675 3300046542 Bacteria 5941
672 Ga0495597_0006853 3300046542 Bacteria 5853
673 Ga0495597_0049893 3300046542 Bacteria 1848
674 Ga0495597_0076420 3300046542 Bacteria 1436
675 Ga0495622_0000019 3300046557 Bacteria 169931
676 Ga0495622_0000037 3300046557 Bacteria 119690
677 Ga0495622_0134543 3300046557 Bacteria 1124
678 Ga0495633_0000221 3300046558 Bacteria 70459
679 Ga0495633_0000489 3300046558 Bacteria 39984
680 Ga0495633_0001433 3300046558 Bacteria 18574
681 Ga0495633_0001978 3300046558 Bacteria 14838
682 Ga0495633_0003291 3300046558 Bacteria 10857
683 Ga0495633_0025023 3300046558 Bacteria 2944
684 Ga0495633_0055814 3300046558 Bacteria 1856
685 Ga0495656_0003997 3300046615 Bacteria 5011
686 Ga0495656_0007689 3300046615 Bacteria 3822
687 Ga0495656_0015490 3300046615 Bacteria 2878
688 Ga0495668_0000066 3300046616 Bacteria 178533
689 Ga0495668_0000961 3300046616 Bacteria 32029
690 Ga0495668_0001087 3300046616 Bacteria 28336
691 Ga0495668_0001652 3300046616 Bacteria 20786
692 Ga0495668_0001745 3300046616 Bacteria 19948
693 Ga0495668_0004422 3300046616 Bacteria 9987
694 Ga0495668_0007818 3300046616 Bacteria 6773
695 Ga0495668_0008616 3300046616 Bacteria 6342
696 Ga0495668_0011433 3300046616 Bacteria 5314
697 Ga0495668_0021799 3300046616 Bacteria 3667
698 Ga0495668_0051750 3300046616 Bacteria 2273
699 Ga0495668_0077451 3300046616 Bacteria 1825
700 Ga0495634_0007542 3300046642 Bacteria 8158
701 Ga0495611_0001122 3300046648 Bacteria 14075
702 Ga0495611_0007040 3300046648 Bacteria 4776
703 Ga0495611_0007522 3300046648 Bacteria 4624
704 Ga0495611_0011965 3300046648 Bacteria 3685
705 Ga0495611_0022112 3300046648 Bacteria 2750
706 Ga0495611_0054352 3300046648 Bacteria 1810
707 Ga0495625_0000432 3300046660 Bacteria 63013
708 Ga0495625_0000938 3300046660 Bacteria 39100
709 Ga0495625_0011535 3300046660 Bacteria 7201
710 Ga0495625_0016238 3300046660 Bacteria 5864
711 Ga0495625_0021285 3300046660 Bacteria 4995
712 Ga0495625_0065868 3300046660 Bacteria 2553
713 Ga0495625_0084579 3300046660 Bacteria 2203
714 Ga0495625_0099513 3300046660 Bacteria 1999
715 Ga0495625_0110297 3300046660 Bacteria 1881
716 Ga0495625_0306798 3300046660 Bacteria 1014
717 Ga0495635_0010906 3300046663 Bacteria 6372
718 Ga0495659_0000205 3300046664 Bacteria 25556
719 Ga0495661_0000454 3300046665 Bacteria 43387
720 Ga0495661_0000650 3300046665 Bacteria 35187
721 Ga0495661_0002015 3300046665 Bacteria 16013
722 Ga0495661_0002859 3300046665 Bacteria 13072
723 Ga0495661_0004602 3300046665 Bacteria 9934
724 Ga0495661_0010773 3300046665 Bacteria 6223
725 Ga0495661_0014006 3300046665 Bacteria 5376
726 Ga0495661_0018043 3300046665 Bacteria 4647
727 Ga0495661_0047710 3300046665 Bacteria 2606
728 Ga0495661_0065158 3300046665 Bacteria 2147
729 Ga0495661_0081379 3300046665 Bacteria 1866
730 Ga0495661_0123428 3300046665 Bacteria 1427
731 Ga0495623_0008095 3300046679 Bacteria 6835
732 Ga0495623_0014303 3300046679 Bacteria 5139
733 Ga0495669_0000073 3300046684 Bacteria 66387
734 Ga0495669_0001172 3300046684 Bacteria 10892
735 Ga0495669_0008984 3300046684 Bacteria 4211
736 Ga0495669_0066813 3300046684 Bacteria 1633
737 Ga0495624_0036931 3300046690 Bacteria 3146
738 Ga0495670_0000278 3300046691 Bacteria 24090
739 Ga0495670_0001254 3300046691 Bacteria 12410
740 Ga0495670_0013325 3300046691 Bacteria 4044
741 Ga0495670_0029724 3300046691 Bacteria 2713
742 Ga0495671_0002807 3300046692 Bacteria 10904
743 Ga0495649_0001335 3300046694 Bacteria 18749
744 Ga0495649_0001759 3300046694 Bacteria 15968
745 Ga0495649_0013347 3300046694 Bacteria 4740
746 Ga0495649_0017366 3300046694 Bacteria 4060
747 Ga0495649_0029064 3300046694 Bacteria 3062
748 Ga0495589_0000096 3300046794 Bacteria 84521
749 Ga0495589_0000351 3300046794 Bacteria 35944
750 Ga0495589_0000626 3300046794 Bacteria 23278
751 Ga0495589_0003608 3300046794 Bacteria 8360
752 Ga0495589_0021106 3300046794 Bacteria 3328
753 Ga0495660_0000497 3300046810 Bacteria 32487
754 Ga0495660_0000526 3300046810 Bacteria 31313
755 Ga0495660_0000661 3300046810 Bacteria 26723
756 Ga0495660_0006271 3300046810 Bacteria 7056
757 Ga0495660_0017629 3300046810 Bacteria 4109
758 Ga0495660_0029629 3300046810 Bacteria 3086
759 Ga0495604_0011700 3300047317 Bacteria 6977
760 Ga0495636_0002069 3300047318 Bacteria 7703
761 Ga0495672_0000614 3300047320 Bacteria 39876
762 Ga0495672_0000864 3300047320 Bacteria 31968
763 Ga0495672_0001197 3300047320 Bacteria 26222
764 Ga0495672_0003094 3300047320 Bacteria 14532
765 Ga0495672_0166365 3300047320 Bacteria 1128
766 Ga0495676_0000221 3300047321 Bacteria 45708
767 Ga0495676_0006856 3300047321 Bacteria 10468
768 Ga0495676_0076479 3300047321 Bacteria 2556
769 Ga0495680_0016271 3300047322 Bacteria 6396
770 Ga0495683_0000470 3300047323 Bacteria 31364
771 Ga0495683_0001121 3300047323 Bacteria 18461
772 Ga0495683_0004480 3300047323 Bacteria 7923
773 Ga0495683_0019319 3300047323 Bacteria 3518
774 Ga0495683_0141389 3300047323 Bacteria 1127
775 Ga0495687_000117 3300047443 Bacteria 122591
776 Ga0495687_000203 3300047443 Bacteria 84774
777 Ga0495687_000772 3300047443 Bacteria 34667
778 Ga0495687_001912 3300047443 Bacteria 17877
779 Ga0495687_008815 3300047443 Bacteria 5720
780 Ga0495687_058616 3300047443 Bacteria 1596
781 Ga0495687_075669 3300047443 Bacteria 1334
782 Ga0495675_0042699 3300047444 Bacteria 2888
783 Ga0495675_0051767 3300047444 Bacteria 2607
784 Ga0495677_0000036 3300047445 Bacteria 81332
785 Ga0495677_0003491 3300047445 Bacteria 6098
786 Ga0495677_0003708 3300047445 Bacteria 5915
787 Ga0495677_0004596 3300047445 Bacteria 5270
788 Ga0495677_0059181 3300047445 Bacteria 1418
789 Ga0495679_012634 3300047446 Bacteria 3203
790 Ga0495679_031419 3300047446 Bacteria 1713
791 Ga0495679_033949 3300047446 Bacteria 1626
792 Ga0495685_005892 3300047447 Bacteria 4005
793 Ga0495685_009733 3300047447 Bacteria 3217
794 Ga0495673_0000008 3300047469 Bacteria 752462
795 Ga0495673_0000012 3300047469 Bacteria 656908
796 Ga0495673_0009993 3300047469 Bacteria 5198
797 Ga0495673_0146141 3300047469 Bacteria 917
798 Ga0495681_0002604 3300047470 Bacteria 12806
799 Ga0495681_0007319 3300047470 Bacteria 7071
800 Ga0495681_0009577 3300047470 Bacteria 5951
801 Ga0495681_0043304 3300047470 Bacteria 2172
802 Ga0495681_0049028 3300047470 Bacteria 1998
803 Ga0495686_0000519 3300047472 Bacteria 55675
804 Ga0495686_0001487 3300047472 Bacteria 25415
805 Ga0495686_0190911 3300047472 Bacteria 1181
806 Ga0495593_0089737 3300047673 Bacteria 1583
807 Ga0495602_0003238 3300048088 Bacteria 16812
808 Ga0495614_0011804 3300048089 Bacteria 3840
809 Ga0495615_0000524 3300048090 Bacteria 5465
810 Ga0495626_0000248 3300048091 Bacteria 62661
811 Ga0495626_0000922 3300048091 Bacteria 25785
812 Ga0495626_0001496 3300048091 Bacteria 18442
813 Ga0495626_0007742 3300048091 Bacteria 5953
814 Ga0495626_0018389 3300048091 Bacteria 3509
815 Ga0495626_0020408 3300048091 Bacteria 3302
816 Ga0495626_0058258 3300048091 Bacteria 1765
817 Ga0495626_0077532 3300048091 Bacteria 1481
818 Ga0496100_0047127 3300048903 Bacteria 2776
819 Ga0496101_0089557 3300048904 Bacteria 2287
820 Ga0496102_0000024 3300048905 Bacteria 227873
821 Ga0496102_0016152 3300048905 Bacteria 6521
822 Ga0496102_0055897 3300048905 Bacteria 3599
823 Ga0496102_0116297 3300048905 Bacteria 2495
824 Ga0496103_0012271 3300048906 Bacteria 5085
825 Ga0496103_0014802 3300048906 Bacteria 4637
826 Ga0496103_0024365 3300048906 Bacteria 3653
827 Ga0496103_0076273 3300048906 Bacteria 2103
828 Ga0496103_0077143 3300048906 Bacteria 2091
829 Ga0496103_0097999 3300048906 Bacteria 1854
830 Ga0496106_0004558 3300048909 Bacteria 10269
831 Ga0496107_0081945 3300048910 Bacteria 2353
832 Ga0496107_0124721 3300048910 Bacteria 1899
833 Ga0496110_0000432 3300048913 Bacteria 28461
834 Ga0496111_0106096 3300048914 Bacteria 2068
835 Ga0496113_0007118 3300048916 Bacteria 7163
836 Ga0496113_0131889 3300048916 Bacteria 1961
837 Ga0496114_0181614 3300048917 Bacteria 1838
838 Ga0496116_0028982 3300048919 Bacteria 3998
839 Ga0496116_0028993 3300048919 Bacteria 3997
840 Ga0496117_0005952 3300048920 Bacteria 12571
841 Ga0496118_0002738 3300048921 Bacteria 23192
842 Ga0496118_0007455 3300048921 Bacteria 11587
843 Ga0496118_0163986 3300048921 Bacteria 1369
844 Ga0496120_0003576 3300048923 Bacteria 13994
845 Ga0496121_0000306 3300048924 Bacteria 102245
846 Ga0496121_0013395 3300048924 Bacteria 8819
847 Ga0496121_0039769 3300048924 Bacteria 4136
848 Ga0496121_0050235 3300048924 Bacteria 3525
849 Ga0496121_0136119 3300048924 Bacteria 1830
850 Ga0496122_0000483 3300048925 Bacteria 82763
851 Ga0496122_0000865 3300048925 Bacteria 57024
852 Ga0496122_0001769 3300048925 Bacteria 33125
853 Ga0496122_0008843 3300048925 Bacteria 10745
854 Ga0496122_0013070 3300048925 Bacteria 8173
855 Ga0496122_0030539 3300048925 Bacteria 4512
856 Ga0496122_0121465 3300048925 Bacteria 1683
857 Ga0496122_0136355 3300048925 Bacteria 1546
858 Ga0496122_0170837 3300048925 Bacteria 1311
859 Ga0496123_0000203 3300048926 Bacteria 121361
860 Ga0496123_0000904 3300048926 Bacteria 46774
861 Ga0496123_0001436 3300048926 Bacteria 33219
862 Ga0496123_0017480 3300048926 Bacteria 5766
863 Ga0496123_0136760 3300048926 Bacteria 1347
864 Ga0496124_0000046 3300048927 Bacteria 287043
865 Ga0496124_0007687 3300048927 Bacteria 11401
866 Ga0496124_0054287 3300048927 Bacteria 3392
867 Ga0496124_0062881 3300048927 Bacteria 3104
868 Ga0496124_0072805 3300048927 Bacteria 2844
869 Ga0496124_0091047 3300048927 Bacteria 2486
870 Ga0496124_0108571 3300048927 Bacteria 2238
871 Ga0496124_0242536 3300048927 Bacteria 1339
872 Ga0496125_0000011 3300048928 Bacteria 655895
873 Ga0496125_0004899 3300048928 Bacteria 15174
874 Ga0496125_0012776 3300048928 Bacteria 8301
875 Ga0496125_0012917 3300048928 Bacteria 8245
876 Ga0496125_0116892 3300048928 Bacteria 1914
877 Ga0496126_0000118 3300048929 Bacteria 184719
878 Ga0496126_0014528 3300048929 Bacteria 7954
879 Ga0496126_0021519 3300048929 Bacteria 6297
880 Ga0495678_000012 3300049459 Bacteria 333905
881 Ga0495678_000130 3300049459 Bacteria 88909
882 Ga0495678_000227 3300049459 Bacteria 64986
883 Ga0495678_002444 3300049459 Bacteria 12588
884 Ga0495678_004271 3300049459 Bacteria 8347
885 Ga0495678_026055 3300049459 Bacteria 2502
886 Ga0495682_0001831 3300049460 Bacteria 10677
887 Ga0495682_0005659 3300049460 Bacteria 5165
888 Ga0495682_0007300 3300049460 Bacteria 4407
889 Ga0501032_0018788 3300049569 Bacteria 4837
890 Ga0501033_0004309 3300049570 Bacteria 11420
891 Ga0501033_0006721 3300049570 Bacteria 8986
892 Ga0501034_0000106 3300049571 Bacteria 153523
893 Ga0501034_0075511 3300049571 Bacteria 3377
894 Ga0501034_0078147 3300049571 Bacteria 3314
895 Ga0501034_0142188 3300049571 Bacteria 2378
896 Ga0501034_0257286 3300049571 Bacteria 1689
897 Ga0501036_0000327 3300049572 Bacteria 33144
898 Ga0501037_0000730 3300049573 Bacteria 24939
899 Ga0501038_0003017 3300049574 Bacteria 15696
900 Ga0501043_0000281 3300049579 Bacteria 45785
901 Ga0501043_0000897 3300049579 Bacteria 26391
902 Ga0501046_0000099 3300049580 Bacteria 92986
903 Ga0501047_0000441 3300049581 Bacteria 46005
904 Ga0501047_0003373 3300049581 Bacteria 15118
905 Ga0501047_0364202 3300049581 Bacteria 1281
906 Ga0501048_0177917 3300049582 Bacteria 1508
907 Ga0501207_008681 3300049654 Bacteria 1473
908 Ga0501214_004043 3300049659 Bacteria 1336
909 Ga0501224_019057 3300049664 Bacteria 1022
910 Ga0501230_000992 3300049667 Bacteria 3223
911 Ga0501238_004388 3300049671 Bacteria 1764
912 Ga0501269_000189 3300049766 Bacteria 18890
913 Ga0501279_002047 3300049775 Bacteria 2668
914 Ga0501035_0000973 3300049822 Bacteria 30267
915 Ga0501035_0004018 3300049822 Bacteria 14031
916 Ga0501035_0109120 3300049822 Bacteria 2426
917 Ga0501044_0000076 3300049823 Bacteria 120755
918 Ga0501044_0011179 3300049823 Bacteria 9735
919 Ga0501044_0079049 3300049823 Bacteria 3333
920 nmdc:mga03683_33735_c1 3300050489 Bacteria 2068
921 nmdc:mga00v17_197438_c1 3300050491 Bacteria 1300
922 nmdc:mga00v17_434_c1 3300050491 Bacteria 23482
923 nmdc:mga00v17_4929_c1 3300050491 Bacteria 6997
924 nmdc:mga0yw44_66496_c1 3300050492 Bacteria 2224
925 nmdc:mga05p37_44326_c1 3300050507 Bacteria 5473
926 nmdc:mga09592_622_c1 3300050508 Bacteria 27059
927 nmdc:mga06r32_31380_c1 3300050510 Bacteria 4990
928 Ga0500646_0020898 3300053090 Bacteria 1741
929 Ga0500594_0018127 3300053118 Bacteria 1730
930 Ga0500655_009643 3300053133 Bacteria 1742
931 Ga0500586_018475 3300053145 Bacteria 2152
932 Ga0500604_0009349 3300053151 Bacteria 2612
933 Ga0500616_0054024 3300053153 Bacteria 2106
934 Ga0500634_0087736 3300053161 Bacteria 1587
935 Ga0500645_008154 3300053730 Bacteria 3598
936 Ga0587076_003986 3300059645 Bacteria 1809
937 Ga0466962_0049412 3300061719 Bacteria 2010
938 Ga0466962_0072008 3300061719 Bacteria 1651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003771 Ga0055526_1006883 Ga0055526_10068831 268
2 3300025295 Ga0209564_1000145 Ga0209564_100014519 268
3 3300003771 Ga0055526_1002611 Ga0055526_10026112 270
4 3300003775 Ga0055524_1009930 Ga0055524_10099303 270
5 3300003791 Ga0055530_10003829 Ga0055530_100038297 270
6 3300005327 Ga0070658_10000918 Ga0070658_1000091819 270
7 3300005339 Ga0070660_100067023 Ga0070660_1000670232 270
8 3300005563 Ga0068855_100002049 Ga0068855_1000020498 270
9 3300006846 Ga0075430_100079739 Ga0075430_1000797393 270
10 3300009093 Ga0105240_10045943 Ga0105240_100459435 270
11 3300013104 Ga0157370_10003903 Ga0157370_100039035 270
12 3300025291 Ga0209675_1022598 Ga0209675_10225982 270
13 3300025295 Ga0209564_1000172 Ga0209564_100017210 270
14 3300025298 Ga0209050_1000309 Ga0209050_100030991 270
15 3300025299 Ga0209256_1003455 Ga0209256_10034553 270
16 3300025909 Ga0207705_10002099 Ga0207705_100020995 270
17 3300025914 Ga0207671_10034942 Ga0207671_100349424 270
18 3300025949 Ga0207667_10012454 Ga0207667_100124547 270
19 3300031548 Ga0307408_100000830 Ga0307408_10000083010 270
20 3300042461 Ga0439460_0034492 Ga0439460_0034492_514_1398 270
21 3300046474 Ga0495605_0054565 Ga0495605_0054565_204_1088 270
22 3300046507 Ga0495606_0001015 Ga0495606_0001015_16637_17521 270
23 3300046513 Ga0495616_0000313 Ga0495616_0000313_12998_13882 270
24 3300046660 Ga0495625_0306798 Ga0495625_0306798_11_868 270
25 3300048091 Ga0495626_0000922 Ga0495626_0000922_11916_12800 270
26 3300048091 Ga0495626_0077532 Ga0495626_0077532_441_1325 270
27 3300049775 Ga0501279_002047 Ga0501279_002047_804_1688 270
28 3300002739 JGI25158J39367_1000408 JGI25158J39367_10004085 271
29 3300002987 JGI25159J45721_1004593 JGI25159J45721_10045933 271
30 3300003374 JGI25161J50226_1000871 JGI25161J50226_100087110 271
31 3300003762 Ga0055542_1011580 Ga0055542_10115802 271
32 3300004625 Ga0055543_1001173 Ga0055543_100117310 271
33 3300005262 Ga0065165_1004087 Ga0065165_10040878 271
34 3300025208 Ga0209436_100219 Ga0209436_10021910 271
35 3300025254 Ga0209148_1000199 Ga0209148_10001996 271
36 3300025284 Ga0209130_1001985 Ga0209130_10019853 271
37 3300031548 Ga0307408_100003641 Ga0307408_1000036412 271
38 3300046558 Ga0495633_0001433 Ga0495633_0001433_2878_3762 271
39 3300047320 Ga0495672_0000864 Ga0495672_0000864_24475_25359 271
40 3300048910 Ga0496107_0124721 Ga0496107_0124721_190_1041 271
41 3300049460 Ga0495682_0001831 Ga0495682_0001831_8528_9412 271
42 3300002773 JGI25152J39213_1010430 JGI25152J39213_10104302 272
43 3300002987 JGI25159J45721_1011995 JGI25159J45721_10119952 272
44 3300003187 JGI25151J46595_10013604 JGI25151J46595_100136042 272
45 3300003354 JGI25160J50197_1018508 JGI25160J50197_10185081 272
46 3300003374 JGI25161J50226_1006540 JGI25161J50226_10065402 272
47 3300003771 Ga0055526_1006624 Ga0055526_10066246 272
48 3300003771 Ga0055526_1012789 Ga0055526_10127892 272
49 3300003773 Ga0055537_1015838 Ga0055537_10158381 272
50 3300003775 Ga0055524_1002711 Ga0055524_10027118 272
51 3300003775 Ga0055524_1010778 Ga0055524_10107782 272
52 3300003784 Ga0055534_1002755 Ga0055534_10027555 272
53 3300003784 Ga0055534_1004091 Ga0055534_10040912 272
54 3300003791 Ga0055530_10014605 Ga0055530_100146052 272
55 3300003794 Ga0055531_10014143 Ga0055531_100141431 272
56 3300006948 Ga0099826_10000022 Ga0099826_10000022154 272
57 3300009011 Ga0105251_10017543 Ga0105251_100175432 272
58 3300025208 Ga0209436_103731 Ga0209436_1037312 272
59 3300025245 Ga0207425_1000679 Ga0207425_100067911 272
60 3300025258 Ga0209129_1001385 Ga0209129_10013859 272
61 3300025263 Ga0209565_1000453 Ga0209565_100045335 272
62 3300025273 Ga0209673_1005121 Ga0209673_10051214 272
63 3300025284 Ga0209130_1007196 Ga0209130_10071962 272
64 3300025291 Ga0209675_1001322 Ga0209675_10013226 272
65 3300025295 Ga0209564_1005940 Ga0209564_10059403 272
66 3300025295 Ga0209564_1008581 Ga0209564_10085814 272
67 3300025298 Ga0209050_1000040 Ga0209050_100004099 272
68 3300025299 Ga0209256_1007694 Ga0209256_10076944 272
69 3300025302 Ga0207426_1002593 Ga0207426_10025936 272
70 3300025304 Ga0209257_1000054 Ga0209257_1000054299 272
71 3300027666 Ga0209282_1000841 Ga0209282_10008413 272
72 3300030731 Ga0316177_1152336 Ga0316177_11523365 272
73 3300044765 Ga0466970_0050723 Ga0466970_0050723_16_870 272
74 3300045049 Ga0466959_0191441 Ga0466959_0191441_12_866 272
75 3300046463 Ga0495653_0000082 Ga0495653_0000082_16093_16977 272
76 3300046474 Ga0495605_0005897 Ga0495605_0005897_5767_6621 272
77 3300046474 Ga0495605_0026091 Ga0495605_0026091_1640_2494 272
78 3300046500 Ga0495596_0000675 Ga0495596_0000675_19816_20670 272
79 3300046501 Ga0495607_0000638 Ga0495607_0000638_24125_24979 272
80 3300046512 Ga0495610_0010594 Ga0495610_0010594_2655_3509 272
81 3300046513 Ga0495616_0053037 Ga0495616_0053037_624_1478 272
82 3300046528 Ga0495642_0110525 Ga0495642_0110525_310_1164 272
83 3300046538 Ga0495609_0000117 Ga0495609_0000117_22250_23104 272
84 3300046665 Ga0495661_0000650 Ga0495661_0000650_24123_24977 272
85 3300046694 Ga0495649_0029064 Ga0495649_0029064_982_1836 272
86 3300046794 Ga0495589_0000096 Ga0495589_0000096_69044_69898 272
87 3300047443 Ga0495687_000203 Ga0495687_000203_14877_15731 272
88 3300047445 Ga0495677_0000036 Ga0495677_0000036_68903_69757 272
89 3300048091 Ga0495626_0007742 Ga0495626_0007742_33_887 272
90 3300048910 Ga0496107_0081945 Ga0496107_0081945_1139_1993 272
91 3300048925 Ga0496122_0013070 Ga0496122_0013070_6668_7522 272
92 3300048926 Ga0496123_0017480 Ga0496123_0017480_4319_5173 272
93 3300048926 Ga0496123_0136760 Ga0496123_0136760_16_870 272
94 3300006948 Ga0099826_10000008 Ga0099826_10000008221 273
95 3300027666 Ga0209282_1000005 Ga0209282_1000005220 273
96 3300046523 Ga0495644_0001228 Ga0495644_0001228_8628_9512 273
97 3300048920 Ga0496117_0005952 Ga0496117_0005952_8851_9738 273
98 3300048921 Ga0496118_0163986 Ga0496118_0163986_86_973 273
99 3300049671 Ga0501238_004388 Ga0501238_004388_853_1737 273
100 3300003773 Ga0055537_1004353 Ga0055537_10043534 274
101 3300003791 Ga0055530_10002415 Ga0055530_100024157 274
102 3300009545 Ga0105237_10054083 Ga0105237_100540833 274
103 3300025263 Ga0209565_1001224 Ga0209565_10012245 274
104 3300025298 Ga0209050_1003284 Ga0209050_10032847 274
105 3300031548 Ga0307408_100005010 Ga0307408_1000050106 274
106 3300041404 Ga0439436_0047617 Ga0439436_0047617_91_975 274
107 3300041410 Ga0439461_0004070 Ga0439461_0004070_1248_2132 274
108 3300042156 Ga0439446_0035102 Ga0439446_0035102_503_1387 274
109 3300042185 Ga0450909_007041 Ga0450909_007041_591_1475 274
110 3300042435 Ga0439434_0085719 Ga0439434_0085719_12_896 274
111 3300045976 Ga0466967_0073571 Ga0466967_0073571_1489_2343 274
112 3300005262 Ga0065165_1014882 Ga0065165_10148823 275
113 3300031911 Ga0307412_10111984 Ga0307412_101119842 275
114 3300046499 Ga0495594_0137427 Ga0495594_0137427_511_1365 275
115 3300049659 Ga0501214_004043 Ga0501214_004043_288_1172 275
116 3300003771 Ga0055526_1000054 Ga0055526_10000548 276
117 3300003775 Ga0055524_1000038 Ga0055524_1000038156 276
118 3300025295 Ga0209564_1000042 Ga0209564_10000428 276
119 3300047469 Ga0495673_0000008 Ga0495673_0000008_377317_378201 276
120 3300001990 JGI24737J22298_10013887 JGI24737J22298_100138872 277
121 3300002067 JGI24735J21928_10000241 JGI24735J21928_100002419 277
122 3300003354 JGI25160J50197_1000016 JGI25160J50197_1000016143 277
123 3300005262 Ga0065165_1000875 Ga0065165_100087530 277
124 3300005355 Ga0070671_100272756 Ga0070671_1002727562 277
125 3300005548 Ga0070665_100104899 Ga0070665_1001048992 277
126 3300005616 Ga0068852_100205627 Ga0068852_1002056272 277
127 3300009011 Ga0105251_10001447 Ga0105251_1000144711 277
128 3300009036 Ga0105244_10001703 Ga0105244_1000170317 277
129 3300009093 Ga0105240_10125967 Ga0105240_101259672 277
130 3300009101 Ga0105247_10115645 Ga0105247_101156452 277
131 3300009174 Ga0105241_10139127 Ga0105241_101391272 277
132 3300009551 Ga0105238_10584905 Ga0105238_105849052 277
133 3300025206 Ga0209435_102376 Ga0209435_1023762 277
134 3300025295 Ga0209564_1001909 Ga0209564_100190914 277
135 3300025302 Ga0207426_1000007 Ga0207426_1000007665 277
136 3300025302 Ga0207426_1006546 Ga0207426_10065463 277
137 3300025728 Ga0207655_1000933 Ga0207655_100093315 277
138 3300025735 Ga0207713_1005784 Ga0207713_10057844 277
139 3300025900 Ga0207710_10118793 Ga0207710_101187931 277
140 3300025904 Ga0207647_10001501 Ga0207647_100015014 277
141 3300025911 Ga0207654_10156419 Ga0207654_101564192 277
142 3300025913 Ga0207695_10041090 Ga0207695_100410905 277
143 3300025931 Ga0207644_10092145 Ga0207644_100921452 277
144 3300028379 Ga0268266_10058376 Ga0268266_100583762 277
145 3300037471 Ga0395905_0000079 Ga0395905_0000079_144041_144925 277
146 3300038443 Ga0395901_0001431 Ga0395901_0001431_9884_10768 277
147 3300046471 Ga0495650_0002013 Ga0495650_0002013_1789_2673 277
148 3300046472 Ga0495580_0014623 Ga0495580_0014623_4101_4985 277
149 3300046472 Ga0495580_0076996 Ga0495580_0076996_1363_2247 277
150 3300046474 Ga0495605_0000018 Ga0495605_0000018_244710_245594 277
151 3300046524 Ga0495648_0108826 Ga0495648_0108826_219_1103 277
152 3300047321 Ga0495676_0076479 Ga0495676_0076479_175_1059 277
153 3300047469 Ga0495673_0009993 Ga0495673_0009993_3665_4549 277
154 3300048905 Ga0496102_0055897 Ga0496102_0055897_1635_2519 277
155 3300048924 Ga0496121_0013395 Ga0496121_0013395_897_1781 277
156 3300048924 Ga0496121_0039769 Ga0496121_0039769_2062_2946 277
157 3300048924 Ga0496121_0050235 Ga0496121_0050235_1191_2075 277
158 3300005367 Ga0070667_100077700 Ga0070667_1000777003 278
159 3300005455 Ga0070663_100009774 Ga0070663_1000097744 278
160 3300005456 Ga0070678_100444000 Ga0070678_1004440001 278
161 3300006028 Ga0070717_10027331 Ga0070717_100273312 278
162 3300009036 Ga0105244_10022022 Ga0105244_100220223 278
163 3300009177 Ga0105248_10003137 Ga0105248_100031373 278
164 3300011119 Ga0105246_10081055 Ga0105246_100810552 278
165 3300013306 Ga0163162_10004087 Ga0163162_1000408712 278
166 3300013308 Ga0157375_10113643 Ga0157375_101136432 278
167 3300025206 Ga0209435_105054 Ga0209435_1050542 278
168 3300025295 Ga0209564_1007529 Ga0209564_10075293 278
169 3300025941 Ga0207711_10005592 Ga0207711_100055923 278
170 3300025960 Ga0207651_10065985 Ga0207651_100659853 278
171 3300025986 Ga0207658_10054737 Ga0207658_100547373 278
172 3300026067 Ga0207678_10014291 Ga0207678_100142916 278
173 3300026121 Ga0207683_10467315 Ga0207683_104673152 278
174 3300031548 Ga0307408_100000227 Ga0307408_1000002275 278
175 3300031548 Ga0307408_100205999 Ga0307408_1002059992 278
176 3300031731 Ga0307405_10112975 Ga0307405_101129752 278
177 3300031731 Ga0307405_10116142 Ga0307405_101161422 278
178 3300031852 Ga0307410_10082671 Ga0307410_100826712 278
179 3300031903 Ga0307407_10067008 Ga0307407_100670082 278
180 3300031903 Ga0307407_10204251 Ga0307407_102042511 278
181 3300031995 Ga0307409_100032337 Ga0307409_1000323374 278
182 3300031995 Ga0307409_100066972 Ga0307409_1000669724 278
183 3300031995 Ga0307409_100235766 Ga0307409_1002357662 278
184 3300031995 Ga0307409_100254176 Ga0307409_1002541762 278
185 3300032002 Ga0307416_100025772 Ga0307416_1000257724 278
186 3300032004 Ga0307414_10140684 Ga0307414_101406841 278
187 3300032005 Ga0307411_10026064 Ga0307411_100260642 278
188 3300032126 Ga0307415_100009334 Ga0307415_1000093344 278
189 3300039447 Ga0436361_0135595 Ga0436361_0135595_360_1244 278
190 3300046452 Ga0495617_000069 Ga0495617_000069_60850_61734 278
191 3300046501 Ga0495607_0110497 Ga0495607_0110497_385_1269 278
192 3300046524 Ga0495648_0009552 Ga0495648_0009552_5299_6183 278
193 3300046660 Ga0495625_0065868 Ga0495625_0065868_43_927 278
194 3300046810 Ga0495660_0006271 Ga0495660_0006271_5161_6045 278
195 3300047469 Ga0495673_0000012 Ga0495673_0000012_230294_231178 278
196 3300048917 Ga0496114_0181614 Ga0496114_0181614_582_1466 278
197 3300048921 Ga0496118_0002738 Ga0496118_0002738_19102_20097 278
198 3300048925 Ga0496122_0136355 Ga0496122_0136355_618_1502 278
199 3300048929 Ga0496126_0000118 Ga0496126_0000118_14790_15785 278
200 3300048929 Ga0496126_0014528 Ga0496126_0014528_4103_4987 278
201 3300002704 JGI25155J39150_1000035 JGI25155J39150_100003548 279
202 3300002705 JGI25156J39149_1000012 JGI25156J39149_100001237 279
203 3300002738 JGI25154J39366_1000029 JGI25154J39366_1000029134 279
204 3300002741 JGI25157J39369_1000014 JGI25157J39369_100001437 279
205 3300002987 JGI25159J45721_1003179 JGI25159J45721_10031794 279
206 3300003187 JGI25151J46595_10008323 JGI25151J46595_100083234 279
207 3300003771 Ga0055526_1000854 Ga0055526_10008545 279
208 3300003771 Ga0055526_1004481 Ga0055526_10044814 279
209 3300003775 Ga0055524_1000306 Ga0055524_100030628 279
210 3300003781 Ga0055536_1011832 Ga0055536_10118322 279
211 3300003784 Ga0055534_1003092 Ga0055534_10030924 279
212 3300003790 Ga0055528_1000480 Ga0055528_100048012 279
213 3300003791 Ga0055530_10000863 Ga0055530_1000086313 279
214 3300003792 Ga0055540_1000449 Ga0055540_100044913 279
215 3300003794 Ga0055531_10002683 Ga0055531_100026835 279
216 3300005262 Ga0065165_1011381 Ga0065165_10113813 279
217 3300006946 Ga0079104_1004960 Ga0079104_10049604 279
218 3300009177 Ga0105248_10443160 Ga0105248_104431602 279
219 3300025206 Ga0209435_100002 Ga0209435_100002439 279
220 3300025245 Ga0207425_1007277 Ga0207425_10072773 279
221 3300025246 Ga0209646_1000001 Ga0209646_10000012582 279
222 3300025250 Ga0209026_1000040 Ga0209026_1000040193 279
223 3300025256 Ga0209759_1000001 Ga0209759_10000012213 279
224 3300025263 Ga0209565_1000026 Ga0209565_1000026222 279
225 3300025273 Ga0209673_1000009 Ga0209673_1000009229 279
226 3300025273 Ga0209673_1000012 Ga0209673_1000012130 279
227 3300025284 Ga0209130_1000644 Ga0209130_100064412 279
228 3300025291 Ga0209675_1000090 Ga0209675_100009043 279
229 3300025291 Ga0209675_1000308 Ga0209675_100030822 279
230 3300025292 Ga0209676_1000013 Ga0209676_100001312 279
231 3300025292 Ga0209676_1006627 Ga0209676_10066275 279
232 3300025294 Ga0209025_1005365 Ga0209025_10053658 279
233 3300025294 Ga0209025_1016928 Ga0209025_10169284 279
234 3300025295 Ga0209564_1000119 Ga0209564_1000119212 279
235 3300025295 Ga0209564_1001304 Ga0209564_100130413 279
236 3300025297 Ga0209758_1040846 Ga0209758_10408462 279
237 3300025298 Ga0209050_1000008 Ga0209050_100000812 279
238 3300025298 Ga0209050_1001429 Ga0209050_100142921 279
239 3300025299 Ga0209256_1000003 Ga0209256_1000003384 279
240 3300025302 Ga0207426_1003042 Ga0207426_10030425 279
241 3300025303 Ga0209051_1000005 Ga0209051_100000512 279
242 3300025303 Ga0209051_1037602 Ga0209051_10376022 279
243 3300025304 Ga0209257_1000048 Ga0209257_100004812 279
244 3300027312 Ga0209371_1013726 Ga0209371_10137262 279
245 3300030500 Ga0268256_1020211 Ga0268256_10202112 279
246 3300031456 Ga0307513_10000057 Ga0307513_1000005787 279
247 3300031911 Ga0307412_10000313 Ga0307412_100003132 279
248 3300032002 Ga0307416_100105482 Ga0307416_1001054821 279
249 3300042144 Ga0450889_008251 Ga0450889_008251_109_996 279
250 3300042876 Ga0451577_0018596 Ga0451577_0018596_3946_4833 279
251 3300044712 Ga0453684_0025363 Ga0453684_0025363_3089_3976 279
252 3300046460 Ga0495638_0042965 Ga0495638_0042965_22_876 279
253 3300046530 Ga0495654_0010404 Ga0495654_0010404_4051_4926 279
254 3300046538 Ga0495609_0000741 Ga0495609_0000741_8969_9853 279
255 3300046810 Ga0495660_0000661 Ga0495660_0000661_22419_23303 279
256 3300047447 Ga0495685_009733 Ga0495685_009733_2338_3192 279
257 3300048919 Ga0496116_0028982 Ga0496116_0028982_434_1318 279
258 3300048919 Ga0496116_0028993 Ga0496116_0028993_404_1291 279
259 3300048921 Ga0496118_0007455 Ga0496118_0007455_2884_3771 279
260 3300048923 Ga0496120_0003576 Ga0496120_0003576_10943_11830 279
261 3300048924 Ga0496121_0000306 Ga0496121_0000306_92892_93779 279
262 3300048925 Ga0496122_0000865 Ga0496122_0000865_29557_30444 279
263 3300048925 Ga0496122_0121465 Ga0496122_0121465_30_917 279
264 3300048926 Ga0496123_0000203 Ga0496123_0000203_22306_23193 279
265 3300048927 Ga0496124_0072805 Ga0496124_0072805_1536_2423 279
266 3300048927 Ga0496124_0108571 Ga0496124_0108571_514_1401 279
267 3300048928 Ga0496125_0000011 Ga0496125_0000011_131657_132544 279
268 3300048928 Ga0496125_0012776 Ga0496125_0012776_3945_4832 279
269 3300048929 Ga0496126_0021519 Ga0496126_0021519_3245_4132 279
270 3300049570 Ga0501033_0006721 Ga0501033_0006721_6265_7149 279
271 3300049571 Ga0501034_0078147 Ga0501034_0078147_580_1464 279
272 3300049581 Ga0501047_0364202 Ga0501047_0364202_70_954 279
273 3300049582 Ga0501048_0177917 Ga0501048_0177917_132_1016 279
274 3300049822 Ga0501035_0004018 Ga0501035_0004018_3650_4534 279
275 3300049823 Ga0501044_0079049 Ga0501044_0079049_1136_2020 279
276 3300053151 Ga0500604_0009349 Ga0500604_0009349_607_1491 279
277 3300053730 Ga0500645_008154 Ga0500645_008154_2456_3340 279
278 iso_pu_bacteria 2904424332 2904428175 279
279 3300002773 JGI25152J39213_1000598 JGI25152J39213_10005987 280
280 3300002774 JGI25150J39212_1002185 JGI25150J39212_10021856 280
281 3300003215 JGI25153J46596_10006424 JGI25153J46596_100064245 280
282 3300003775 Ga0055524_1001416 Ga0055524_10014166 280
283 3300003775 Ga0055524_1021199 Ga0055524_10211991 280
284 3300003784 Ga0055534_1000394 Ga0055534_10003941 280
285 3300005539 Ga0068853_100061476 Ga0068853_1000614762 280
286 3300025245 Ga0207425_1000009 Ga0207425_1000009258 280
287 3300025258 Ga0209129_1000051 Ga0209129_1000051182 280
288 3300025263 Ga0209565_1000426 Ga0209565_100042629 280
289 3300025263 Ga0209565_1001533 Ga0209565_10015335 280
290 3300025273 Ga0209673_1031015 Ga0209673_10310152 280
291 3300025291 Ga0209675_1000426 Ga0209675_10004262 280
292 3300025294 Ga0209025_1017504 Ga0209025_10175045 280
293 3300025295 Ga0209564_1004730 Ga0209564_10047302 280
294 3300025297 Ga0209758_1000054 Ga0209758_1000054259 280
295 3300025299 Ga0209256_1000307 Ga0209256_100030775 280
296 3300025299 Ga0209256_1003493 Ga0209256_10034932 280
297 3300037418 Ga0395900_0008818 Ga0395900_0008818_1804_2691 280
298 3300038443 Ga0395901_0159462 Ga0395901_0159462_821_1708 280
299 3300046453 Ga0495627_000004 Ga0495627_000004_367523_368407 280
300 3300046523 Ga0495644_0009233 Ga0495644_0009233_1082_1966 280
301 3300049571 Ga0501034_0257286 Ga0501034_0257286_356_1243 280
302 iso_pu_bacteria 2738541280 2738738539 280
303 iso_pu_bacteria 2738541300 2738842659 280
304 iso_pu_bacteria 2738543018 2739273406 280
305 iso_pu_bacteria 2738543030 2739342450 280
306 iso_pu_bacteria 2857547612 2857548717 280
307 iso_pu_bacteria 2894023352 2894024578 280
308 iso_pu_bacteria 2900577576 2900578985 280
309 iso_pu_bacteria 2928058823 2928060616 280
310 iso_pu_bacteria 2932416698 2932422028 280
311 3300003187 JGI25151J46595_10035879 JGI25151J46595_100358792 281
312 3300003771 Ga0055526_1006931 Ga0055526_10069316 281
313 3300003781 Ga0055536_1000677 Ga0055536_100067721 281
314 3300003784 Ga0055534_1004442 Ga0055534_10044425 281
315 3300025291 Ga0209675_1000174 Ga0209675_100017432 281
316 3300025292 Ga0209676_1001413 Ga0209676_100141322 281
317 3300025294 Ga0209025_1001481 Ga0209025_10014812 281
318 3300025295 Ga0209564_1001261 Ga0209564_10012612 281
319 3300031548 Ga0307408_100006847 Ga0307408_1000068475 281
320 3300033179 Ga0307507_10040352 Ga0307507_100403522 281
321 3300046538 Ga0495609_0006898 Ga0495609_0006898_2678_3565 281
322 3300049569 Ga0501032_0018788 Ga0501032_0018788_3747_4634 281
323 3300003759 Ga0055525_1000023 Ga0055525_100002355 282
324 3300005262 Ga0065165_1023232 Ga0065165_10232322 282
325 3300005327 Ga0070658_10389915 Ga0070658_103899152 282
326 3300005366 Ga0070659_100015694 Ga0070659_1000156945 282
327 3300005366 Ga0070659_100072925 Ga0070659_1000729252 282
328 3300005457 Ga0070662_100047882 Ga0070662_1000478821 282
329 3300005563 Ga0068855_100037617 Ga0068855_1000376172 282
330 3300005564 Ga0070664_100264075 Ga0070664_1002640752 282
331 3300005614 Ga0068856_100158027 Ga0068856_1001580272 282
332 3300006051 Ga0075364_10005124 Ga0075364_100051242 282
333 3300006051 Ga0075364_10084279 Ga0075364_100842792 282
334 3300006881 Ga0068865_100041971 Ga0068865_1000419712 282
335 3300009036 Ga0105244_10074399 Ga0105244_100743991 282
336 3300009098 Ga0105245_10202132 Ga0105245_102021322 282
337 3300009174 Ga0105241_10025372 Ga0105241_100253725 282
338 3300009176 Ga0105242_10030203 Ga0105242_100302034 282
339 3300010375 Ga0105239_10176817 Ga0105239_101768172 282
340 3300010375 Ga0105239_10560356 Ga0105239_105603562 282
341 3300011119 Ga0105246_10348866 Ga0105246_103488662 282
342 3300015262 Ga0182007_10034799 Ga0182007_100347992 282
343 3300015683 Ga0183362_10003 Ga0183362_10003175 282
344 3300025230 Ga0209563_100011 Ga0209563_100011368 282
345 3300025253 Ga0209677_100566 Ga0209677_1005668 282
346 3300025263 Ga0209565_1005567 Ga0209565_10055673 282
347 3300025273 Ga0209673_1007611 Ga0209673_10076111 282
348 3300025291 Ga0209675_1011234 Ga0209675_10112342 282
349 3300025294 Ga0209025_1002193 Ga0209025_10021934 282
350 3300025295 Ga0209564_1001240 Ga0209564_100124019 282
351 3300025299 Ga0209256_1001617 Ga0209256_100161719 282
352 3300025909 Ga0207705_10001434 Ga0207705_1000143418 282
353 3300025909 Ga0207705_10479290 Ga0207705_104792901 282
354 3300025911 Ga0207654_10002736 Ga0207654_100027369 282
355 3300025919 Ga0207657_10004477 Ga0207657_100044778 282
356 3300025919 Ga0207657_10039164 Ga0207657_100391644 282
357 3300025924 Ga0207694_10055129 Ga0207694_100551294 282
358 3300025932 Ga0207690_10056174 Ga0207690_100561742 282
359 3300025932 Ga0207690_10243000 Ga0207690_102430002 282
360 3300025933 Ga0207706_10291803 Ga0207706_102918031 282
361 3300025934 Ga0207686_10008391 Ga0207686_100083916 282
362 3300025945 Ga0207679_10111550 Ga0207679_101115502 282
363 3300025949 Ga0207667_10288533 Ga0207667_102885332 282
364 3300025949 Ga0207667_10322236 Ga0207667_103222362 282
365 3300026067 Ga0207678_10092758 Ga0207678_100927581 282
366 3300030521 Ga0307511_10000025 Ga0307511_100000252 282
367 3300037312 Ga0395899_0005285 Ga0395899_0005285_8975_9859 282
368 3300037312 Ga0395899_0029825 Ga0395899_0029825_2757_3641 282
369 3300037418 Ga0395900_0001043 Ga0395900_0001043_23330_24214 282
370 3300037418 Ga0395900_0001113 Ga0395900_0001113_9737_10621 282
371 3300037418 Ga0395900_0001479 Ga0395900_0001479_10185_11069 282
372 3300037418 Ga0395900_0017195 Ga0395900_0017195_2485_3369 282
373 3300037466 Ga0395898_0006387 Ga0395898_0006387_7536_8420 282
374 3300037466 Ga0395898_0394531 Ga0395898_0394531_100_984 282
375 3300037471 Ga0395905_0101870 Ga0395905_0101870_964_1848 282
376 3300037471 Ga0395905_0189371 Ga0395905_0189371_204_1088 282
377 3300038443 Ga0395901_0000278 Ga0395901_0000278_48800_49684 282
378 3300038443 Ga0395901_0001341 Ga0395901_0001341_11541_12425 282
379 3300038443 Ga0395901_0095092 Ga0395901_0095092_1341_2225 282
380 3300038443 Ga0395901_0108667 Ga0395901_0108667_731_1615 282
381 3300038443 Ga0395901_0470238 Ga0395901_0470238_132_1016 282
382 3300044658 Ga0466972_0165579 Ga0466972_0165579_101_1018 282
383 3300044683 Ga0466965_0044312 Ga0466965_0044312_269_1153 282
384 3300044706 Ga0466964_0000593 Ga0466964_0000593_6646_7530 282
385 3300044842 Ga0466957_0000018 Ga0466957_0000018_50441_51325 282
386 3300045836 Ga0466958_0213033 Ga0466958_0213033_103_987 282
387 3300046457 Ga0495590_0003255 Ga0495590_0003255_5224_6108 282
388 3300046474 Ga0495605_0000399 Ga0495605_0000399_24679_25563 282
389 3300046501 Ga0495607_0005155 Ga0495607_0005155_943_1827 282
390 3300046501 Ga0495607_0005235 Ga0495607_0005235_7508_8392 282
391 3300046506 Ga0495583_0028439 Ga0495583_0028439_346_1230 282
392 3300046507 Ga0495606_0145803 Ga0495606_0145803_170_1054 282
393 3300046513 Ga0495616_0010003 Ga0495616_0010003_3112_3996 282
394 3300046518 Ga0495631_0000402 Ga0495631_0000402_11516_12400 282
395 3300046522 Ga0495643_0004796 Ga0495643_0004796_6380_7264 282
396 3300046522 Ga0495643_0156699 Ga0495643_0156699_151_1035 282
397 3300046524 Ga0495648_0002819 Ga0495648_0002819_10005_10889 282
398 3300046524 Ga0495648_0086316 Ga0495648_0086316_627_1511 282
399 3300046530 Ga0495654_0044473 Ga0495654_0044473_431_1315 282
400 3300046542 Ga0495597_0006675 Ga0495597_0006675_480_1364 282
401 3300046542 Ga0495597_0076420 Ga0495597_0076420_341_1225 282
402 3300046616 Ga0495668_0001652 Ga0495668_0001652_5166_6050 282
403 3300046660 Ga0495625_0016238 Ga0495625_0016238_580_1464 282
404 3300046660 Ga0495625_0084579 Ga0495625_0084579_185_1069 282
405 3300046665 Ga0495661_0000454 Ga0495661_0000454_10875_11759 282
406 3300046665 Ga0495661_0002015 Ga0495661_0002015_4602_5486 282
407 3300046665 Ga0495661_0123428 Ga0495661_0123428_184_1068 282
408 3300046694 Ga0495649_0017366 Ga0495649_0017366_854_1738 282
409 3300046794 Ga0495589_0000351 Ga0495589_0000351_11434_12318 282
410 3300046794 Ga0495589_0000626 Ga0495589_0000626_4915_5799 282
411 3300046810 Ga0495660_0000497 Ga0495660_0000497_12783_13667 282
412 3300046810 Ga0495660_0029629 Ga0495660_0029629_1489_2373 282
413 3300047320 Ga0495672_0001197 Ga0495672_0001197_9746_10630 282
414 3300047323 Ga0495683_0004480 Ga0495683_0004480_6018_6902 282
415 3300047443 Ga0495687_000117 Ga0495687_000117_78388_79272 282
416 3300047443 Ga0495687_000772 Ga0495687_000772_23074_23958 282
417 3300047443 Ga0495687_001912 Ga0495687_001912_9707_10591 282
418 3300047445 Ga0495677_0003708 Ga0495677_0003708_3983_4867 282
419 3300047446 Ga0495679_012634 Ga0495679_012634_2066_2950 282
420 3300048091 Ga0495626_0000248 Ga0495626_0000248_14508_15392 282
421 3300048091 Ga0495626_0018389 Ga0495626_0018389_2240_3124 282
422 3300048903 Ga0496100_0047127 Ga0496100_0047127_750_1634 282
423 3300048904 Ga0496101_0089557 Ga0496101_0089557_21_905 282
424 3300048906 Ga0496103_0097999 Ga0496103_0097999_86_970 282
425 3300048909 Ga0496106_0004558 Ga0496106_0004558_1851_2735 282
426 3300048913 Ga0496110_0000432 Ga0496110_0000432_9869_10753 282
427 3300048914 Ga0496111_0106096 Ga0496111_0106096_595_1479 282
428 3300048916 Ga0496113_0007118 Ga0496113_0007118_4772_5656 282
429 3300048916 Ga0496113_0131889 Ga0496113_0131889_499_1383 282
430 3300048925 Ga0496122_0000483 Ga0496122_0000483_11966_12850 282
431 3300048925 Ga0496122_0008843 Ga0496122_0008843_4612_5496 282
432 3300048925 Ga0496122_0030539 Ga0496122_0030539_2671_3555 282
433 3300048926 Ga0496123_0000904 Ga0496123_0000904_13885_14769 282
434 3300048927 Ga0496124_0007687 Ga0496124_0007687_4370_5254 282
435 3300048927 Ga0496124_0054287 Ga0496124_0054287_1655_2539 282
436 3300048927 Ga0496124_0091047 Ga0496124_0091047_548_1432 282
437 3300048928 Ga0496125_0004899 Ga0496125_0004899_3776_4660 282
438 3300048928 Ga0496125_0116892 Ga0496125_0116892_366_1250 282
439 3300049459 Ga0495678_000227 Ga0495678_000227_10070_10954 282
440 3300049664 Ga0501224_019057 Ga0501224_019057_45_929 282
441 3300050489 nmdc:mga03683_33735_c1 nmdc:mga03683_33735_c1_729_1616 282
442 3300050491 nmdc:mga00v17_4929_c1 nmdc:mga00v17_4929_c1_367_1254 282
443 3300050492 nmdc:mga0yw44_66496_c1 nmdc:mga0yw44_66496_c1_1309_2196 282
444 3300053090 Ga0500646_0020898 Ga0500646_0020898_73_960 282
445 3300053133 Ga0500655_009643 Ga0500655_009643_193_1080 282
446 3300053153 Ga0500616_0054024 Ga0500616_0054024_575_1462 282
447 3300061719 Ga0466962_0072008 Ga0466962_0072008_157_1041 282
448 3300006051 Ga0075364_10003966 Ga0075364_100039663 283
449 3300006051 Ga0075364_10199259 Ga0075364_101992592 283
450 3300037418 Ga0395900_0518863 Ga0395900_0518863_198_1082 283
451 3300037471 Ga0395905_0001013 Ga0395905_0001013_11521_12372 283
452 3300046471 Ga0495650_0000899 Ga0495650_0000899_11073_11957 283
453 3300046616 Ga0495668_0007818 Ga0495668_0007818_4360_5244 283
454 3300046660 Ga0495625_0011535 Ga0495625_0011535_494_1378 283
455 3300048906 Ga0496103_0024365 Ga0496103_0024365_781_1665 283
456 3300049654 Ga0501207_008681 Ga0501207_008681_485_1369 283
457 3300049667 Ga0501230_000992 Ga0501230_000992_1346_2230 283
458 3300050491 nmdc:mga00v17_197438_c1 nmdc:mga00v17_197438_c1_168_1055 283
459 3300050491 nmdc:mga00v17_434_c1 nmdc:mga00v17_434_c1_13223_14110 283
460 iso_pu_bacteria 2919476304 2919476578 283
461 3300003558 Ga0006558J51389_1017413 Ga0006558J51389_10174133 284
462 3300003565 Ga0006560J51390_1018844 Ga0006560J51390_10188442 284
463 3300003578 Ga0006562J51391_1021459 Ga0006562J51391_10214594 284
464 3300005366 Ga0070659_100001892 Ga0070659_1000018922 284
465 3300005578 Ga0068854_100000124 Ga0068854_1000001243 284
466 3300009011 Ga0105251_10016252 Ga0105251_100162524 284
467 3300009036 Ga0105244_10002571 Ga0105244_1000257112 284
468 3300020610 Ga0154015_1001453 Ga0154015_100145312 284
469 3300025295 Ga0209564_1006459 Ga0209564_10064596 284
470 3300025728 Ga0207655_1001881 Ga0207655_10018813 284
471 3300025932 Ga0207690_10001438 Ga0207690_1000143815 284
472 3300025981 Ga0207640_10000047 Ga0207640_1000004759 284
473 3300030744 Ga0316181_1030474 Ga0316181_10304743 284
474 3300031456 Ga0307513_10233994 Ga0307513_102339942 284
475 3300046452 Ga0495617_000710 Ga0495617_000710_5849_6733 284
476 3300046507 Ga0495606_0000101 Ga0495606_0000101_11012_11896 284
477 3300046507 Ga0495606_0001399 Ga0495606_0001399_24902_25786 284
478 3300046507 Ga0495606_0005147 Ga0495606_0005147_11019_11903 284
479 3300046512 Ga0495610_0000293 Ga0495610_0000293_39789_40673 284
480 3300046512 Ga0495610_0005084 Ga0495610_0005084_3689_4573 284
481 3300046512 Ga0495610_0007541 Ga0495610_0007541_882_1766 284
482 3300046522 Ga0495643_0000234 Ga0495643_0000234_12742_13626 284
483 3300046524 Ga0495648_0013593 Ga0495648_0013593_2614_3498 284
484 3300046524 Ga0495648_0088829 Ga0495648_0088829_308_1192 284
485 3300046538 Ga0495609_0005683 Ga0495609_0005683_5319_6203 284
486 3300046542 Ga0495597_0000500 Ga0495597_0000500_19684_20568 284
487 3300046558 Ga0495633_0000489 Ga0495633_0000489_13450_14334 284
488 3300046558 Ga0495633_0025023 Ga0495633_0025023_659_1543 284
489 3300046616 Ga0495668_0001745 Ga0495668_0001745_8461_9345 284
490 3300046660 Ga0495625_0099513 Ga0495625_0099513_567_1493 284
491 3300046660 Ga0495625_0110297 Ga0495625_0110297_659_1603 284
492 3300046691 Ga0495670_0013325 Ga0495670_0013325_16_870 284
493 3300046694 Ga0495649_0001759 Ga0495649_0001759_8798_9742 284
494 3300047320 Ga0495672_0000614 Ga0495672_0000614_15207_16091 284
495 3300049459 Ga0495678_000130 Ga0495678_000130_76936_77820 284
496 3300053118 Ga0500594_0018127 Ga0500594_0018127_237_1121 284
497 3300053145 Ga0500586_018475 Ga0500586_018475_850_1797 284
498 3300002738 JGI25154J39366_1000436 JGI25154J39366_10004364 285
499 3300003771 Ga0055526_1000007 Ga0055526_1000007291 285
500 3300046471 Ga0495650_0000077 Ga0495650_0000077_14204_15088 285
501 3300046491 Ga0495584_0127670 Ga0495584_0127670_287_1171 285
502 3300046492 Ga0495585_0009418 Ga0495585_0009418_176_1060 285
503 3300046492 Ga0495585_0011548 Ga0495585_0011548_910_1794 285
504 3300046499 Ga0495594_0064901 Ga0495594_0064901_887_1771 285
505 3300046507 Ga0495606_0019832 Ga0495606_0019832_1538_2422 285
506 3300046518 Ga0495631_0088238 Ga0495631_0088238_145_1029 285
507 3300046531 Ga0495665_0144137 Ga0495665_0144137_211_1095 285
508 3300046533 Ga0495640_0152202 Ga0495640_0152202_353_1237 285
509 3300046535 Ga0495586_0096581 Ga0495586_0096581_167_1051 285
510 3300046538 Ga0495609_0003071 Ga0495609_0003071_6265_7149 285
511 3300046542 Ga0495597_0000907 Ga0495597_0000907_6192_7076 285
512 3300046616 Ga0495668_0011433 Ga0495668_0011433_4058_4942 285
513 3300046642 Ga0495634_0007542 Ga0495634_0007542_6353_7237 285
514 3300046648 Ga0495611_0022112 Ga0495611_0022112_569_1453 285
515 3300046665 Ga0495661_0014006 Ga0495661_0014006_1179_2063 285
516 3300046679 Ga0495623_0008095 Ga0495623_0008095_2682_3566 285
517 3300046691 Ga0495670_0001254 Ga0495670_0001254_655_1539 285
518 3300047317 Ga0495604_0011700 Ga0495604_0011700_5522_6406 285
519 3300047444 Ga0495675_0051767 Ga0495675_0051767_657_1541 285
520 3300048088 Ga0495602_0003238 Ga0495602_0003238_9538_10422 285
521 3300048927 Ga0496124_0242536 Ga0496124_0242536_331_1215 285
522 3300049459 Ga0495678_004271 Ga0495678_004271_559_1443 285
523 3300049766 Ga0501269_000189 Ga0501269_000189_1748_2632 285
524 3300005339 Ga0070660_100036600 Ga0070660_1000366002 286
525 3300005366 Ga0070659_100005090 Ga0070659_1000050907 286
526 3300025919 Ga0207657_10058162 Ga0207657_100581622 286
527 3300025920 Ga0207649_10044597 Ga0207649_100445972 286
528 3300031238 Ga0265332_10011873 Ga0265332_100118733 286
529 3300031240 Ga0265320_10122938 Ga0265320_101229382 286
530 3300031711 Ga0265314_10003180 Ga0265314_100031808 286
531 3300046452 Ga0495617_000027 Ga0495617_000027_149020_149904 286
532 3300046457 Ga0495590_0000544 Ga0495590_0000544_9805_10689 286
533 3300046458 Ga0495591_000616 Ga0495591_000616_18491_19375 286
534 3300046463 Ga0495653_0035460 Ga0495653_0035460_269_1153 286
535 3300046474 Ga0495605_0000135 Ga0495605_0000135_7410_8294 286
536 3300046474 Ga0495605_0017791 Ga0495605_0017791_2428_3312 286
537 3300046474 Ga0495605_0024741 Ga0495605_0024741_1984_2868 286
538 3300046491 Ga0495584_0002070 Ga0495584_0002070_6345_7229 286
539 3300046491 Ga0495584_0140704 Ga0495584_0140704_42_926 286
540 3300046491 Ga0495584_0158877 Ga0495584_0158877_84_968 286
541 3300046492 Ga0495585_0000420 Ga0495585_0000420_38810_39694 286
542 3300046492 Ga0495585_0007426 Ga0495585_0007426_3211_4095 286
543 3300046492 Ga0495585_0062264 Ga0495585_0062264_739_1623 286
544 3300046499 Ga0495594_0121025 Ga0495594_0121025_430_1314 286
545 3300046500 Ga0495596_0005207 Ga0495596_0005207_2621_3505 286
546 3300046500 Ga0495596_0005873 Ga0495596_0005873_1972_2856 286
547 3300046500 Ga0495596_0009233 Ga0495596_0009233_901_1785 286
548 3300046500 Ga0495596_0046416 Ga0495596_0046416_279_1163 286
549 3300046501 Ga0495607_0003245 Ga0495607_0003245_3918_4802 286
550 3300046512 Ga0495610_0128712 Ga0495610_0128712_185_1069 286
551 3300046513 Ga0495616_0006096 Ga0495616_0006096_3691_4575 286
552 3300046513 Ga0495616_0016517 Ga0495616_0016517_766_1650 286
553 3300046518 Ga0495631_0003723 Ga0495631_0003723_7204_8088 286
554 3300046518 Ga0495631_0008869 Ga0495631_0008869_304_1188 286
555 3300046518 Ga0495631_0009137 Ga0495631_0009137_3771_4655 286
556 3300046518 Ga0495631_0032632 Ga0495631_0032632_646_1530 286
557 3300046518 Ga0495631_0087396 Ga0495631_0087396_261_1145 286
558 3300046519 Ga0495632_0002651 Ga0495632_0002651_8547_9431 286
559 3300046520 Ga0495637_0000515 Ga0495637_0000515_7575_8459 286
560 3300046522 Ga0495643_0014097 Ga0495643_0014097_2786_3670 286
561 3300046522 Ga0495643_0035804 Ga0495643_0035804_457_1341 286
562 3300046523 Ga0495644_0020851 Ga0495644_0020851_1072_1956 286
563 3300046523 Ga0495644_0061183 Ga0495644_0061183_510_1394 286
564 3300046524 Ga0495648_0005435 Ga0495648_0005435_2844_3728 286
565 3300046524 Ga0495648_0016047 Ga0495648_0016047_379_1263 286
566 3300046528 Ga0495642_0000587 Ga0495642_0000587_7467_8351 286
567 3300046528 Ga0495642_0000876 Ga0495642_0000876_9150_10034 286
568 3300046530 Ga0495654_0039095 Ga0495654_0039095_386_1270 286
569 3300046538 Ga0495609_0002223 Ga0495609_0002223_6186_7070 286
570 3300046542 Ga0495597_0003375 Ga0495597_0003375_5855_6739 286
571 3300046557 Ga0495622_0134543 Ga0495622_0134543_43_927 286
572 3300046558 Ga0495633_0003291 Ga0495633_0003291_2826_3710 286
573 3300046615 Ga0495656_0003997 Ga0495656_0003997_543_1427 286
574 3300046616 Ga0495668_0001087 Ga0495668_0001087_22183_23067 286
575 3300046616 Ga0495668_0004422 Ga0495668_0004422_6316_7200 286
576 3300046616 Ga0495668_0077451 Ga0495668_0077451_920_1804 286
577 3300046648 Ga0495611_0001122 Ga0495611_0001122_6901_7785 286
578 3300046648 Ga0495611_0007522 Ga0495611_0007522_3581_4465 286
579 3300046663 Ga0495635_0010906 Ga0495635_0010906_2918_3802 286
580 3300046665 Ga0495661_0004602 Ga0495661_0004602_1888_2772 286
581 3300046665 Ga0495661_0018043 Ga0495661_0018043_2692_3576 286
582 3300046684 Ga0495669_0000073 Ga0495669_0000073_62303_63187 286
583 3300046684 Ga0495669_0008984 Ga0495669_0008984_3060_3944 286
584 3300046684 Ga0495669_0066813 Ga0495669_0066813_181_1065 286
585 3300046690 Ga0495624_0036931 Ga0495624_0036931_1724_2608 286
586 3300046691 Ga0495670_0029724 Ga0495670_0029724_1256_2140 286
587 3300046692 Ga0495671_0002807 Ga0495671_0002807_2865_3749 286
588 3300046694 Ga0495649_0001335 Ga0495649_0001335_7459_8343 286
589 3300046794 Ga0495589_0003608 Ga0495589_0003608_1580_2464 286
590 3300047320 Ga0495672_0003094 Ga0495672_0003094_7463_8347 286
591 3300047320 Ga0495672_0166365 Ga0495672_0166365_13_897 286
592 3300047321 Ga0495676_0000221 Ga0495676_0000221_41122_42006 286
593 3300047321 Ga0495676_0006856 Ga0495676_0006856_2001_2885 286
594 3300047322 Ga0495680_0016271 Ga0495680_0016271_2917_3801 286
595 3300047323 Ga0495683_0001121 Ga0495683_0001121_10184_11068 286
596 3300047323 Ga0495683_0141389 Ga0495683_0141389_63_947 286
597 3300047444 Ga0495675_0042699 Ga0495675_0042699_970_1854 286
598 3300047445 Ga0495677_0003491 Ga0495677_0003491_2772_3656 286
599 3300047445 Ga0495677_0059181 Ga0495677_0059181_10_894 286
600 3300047446 Ga0495679_033949 Ga0495679_033949_186_1070 286
601 3300047447 Ga0495685_005892 Ga0495685_005892_479_1363 286
602 3300047469 Ga0495673_0146141 Ga0495673_0146141_17_901 286
603 3300047470 Ga0495681_0049028 Ga0495681_0049028_673_1557 286
604 3300047472 Ga0495686_0190911 Ga0495686_0190911_173_1057 286
605 3300047673 Ga0495593_0089737 Ga0495593_0089737_115_999 286
606 3300048089 Ga0495614_0011804 Ga0495614_0011804_154_1038 286
607 3300048091 Ga0495626_0001496 Ga0495626_0001496_13643_14527 286
608 3300048091 Ga0495626_0020408 Ga0495626_0020408_1613_2497 286
609 3300048091 Ga0495626_0058258 Ga0495626_0058258_815_1699 286
610 3300048925 Ga0496122_0170837 Ga0496122_0170837_298_1182 286
611 3300049459 Ga0495678_002444 Ga0495678_002444_7419_8303 286
612 3300049460 Ga0495682_0005659 Ga0495682_0005659_4053_4937 286
613 3300049460 Ga0495682_0007300 Ga0495682_0007300_1519_2403 286
614 3300013100 Ga0157373_10001283 Ga0157373_1000128310 287
615 3300037471 Ga0395905_0136672 Ga0395905_0136672_917_1801 287
616 3300044712 Ga0453684_0073208 Ga0453684_0073208_2129_2992 287
617 3300046460 Ga0495638_0008241 Ga0495638_0008241_5738_6622 287
618 3300046491 Ga0495584_0027888 Ga0495584_0027888_1590_2474 287
619 3300046501 Ga0495607_0004753 Ga0495607_0004753_2098_2982 287
620 3300046506 Ga0495583_0025064 Ga0495583_0025064_1841_2725 287
621 3300046513 Ga0495616_0049914 Ga0495616_0049914_818_1702 287
622 3300046538 Ga0495609_0000127 Ga0495609_0000127_17362_18246 287
623 3300046616 Ga0495668_0051750 Ga0495668_0051750_916_1800 287
624 3300046660 Ga0495625_0021285 Ga0495625_0021285_484_1368 287
625 3300046664 Ga0495659_0000205 Ga0495659_0000205_20054_20938 287
626 3300046665 Ga0495661_0081379 Ga0495661_0081379_420_1304 287
627 3300046694 Ga0495649_0013347 Ga0495649_0013347_923_1807 287
628 3300047318 Ga0495636_0002069 Ga0495636_0002069_5102_5986 287
629 3300047443 Ga0495687_075669 Ga0495687_075669_388_1272 287
630 3300047445 Ga0495677_0004596 Ga0495677_0004596_3471_4355 287
631 3300047446 Ga0495679_031419 Ga0495679_031419_585_1469 287
632 3300047470 Ga0495681_0002604 Ga0495681_0002604_4785_5669 287
633 iso_pu_bacteria 2945945610 2945946798 287
634 3300003763 Ga0055529_1001162 Ga0055529_10011625 288
635 3300021361 Ga0213872_10000108 Ga0213872_1000010812 288
636 3300021361 Ga0213872_10000642 Ga0213872_100006429 288
637 3300021361 Ga0213872_10000745 Ga0213872_100007455 288
638 3300021361 Ga0213872_10007168 Ga0213872_100071683 288
639 3300025272 Ga0209455_1001449 Ga0209455_10014495 288
640 3300031711 Ga0265314_10023252 Ga0265314_100232524 288
641 3300039447 Ga0436361_0059985 Ga0436361_0059985_1316_2203 288
642 3300039447 Ga0436361_0183975 Ga0436361_0183975_11552_12439 288
643 3300039447 Ga0436361_0403221 Ga0436361_0403221_7052_7939 288
644 3300039447 Ga0436361_1183286 Ga0436361_1183286_9397_10284 288
645 3300046452 Ga0495617_000638 Ga0495617_000638_1759_2643 288
646 3300046492 Ga0495585_0000050 Ga0495585_0000050_11910_12794 288
647 3300046513 Ga0495616_0002756 Ga0495616_0002756_5615_6499 288
648 3300046524 Ga0495648_0000451 Ga0495648_0000451_14998_15882 288
649 3300046648 Ga0495611_0054352 Ga0495611_0054352_889_1773 288
650 iso_pu_bacteria 8055301274 8055308068 288
651 3300025934 Ga0207686_10303852 Ga0207686_103038522 289
652 3300039447 Ga0436361_0240598 Ga0436361_0240598_28599_29483 289
653 3300046491 Ga0495584_0027962 Ga0495584_0027962_1210_2094 289
654 3300046501 Ga0495607_0123309 Ga0495607_0123309_138_1022 289
655 3300046507 Ga0495606_0039551 Ga0495606_0039551_728_1699 289
656 3300046522 Ga0495643_0047866 Ga0495643_0047866_180_1151 289
657 3300046538 Ga0495609_0010218 Ga0495609_0010218_1773_2657 289
658 3300046542 Ga0495597_0049893 Ga0495597_0049893_913_1797 289
659 3300046616 Ga0495668_0000066 Ga0495668_0000066_166489_167373 289
660 3300046616 Ga0495668_0021799 Ga0495668_0021799_763_1647 289
661 3300046648 Ga0495611_0007040 Ga0495611_0007040_3092_4063 289
662 3300046794 Ga0495589_0021106 Ga0495589_0021106_1153_2037 289
663 3300047323 Ga0495683_0019319 Ga0495683_0019319_195_1079 289
664 iso_pu_bacteria 2501025502 2501078341 290
665 iso_pu_bacteria 2510065045 2510252819 290
666 iso_pu_bacteria 2510917013 2511090045 290
667 iso_pu_bacteria 2511231003 2511251187 290
668 iso_pu_bacteria 2513237150 2513957048 290
669 iso_pu_bacteria 2513237151 2513959540 290
670 iso_pu_bacteria 2513237166 2514046876 290
671 iso_pu_bacteria 2515154123 2515688311 290
672 iso_pu_bacteria 2515154189 2516018475 290
673 iso_pu_bacteria 2521172590 2521560739 290
674 iso_pu_bacteria 2548876994 2550694693 290
675 iso_pu_bacteria 2596583598 2597029500 290
676 iso_pu_bacteria 2599185178 2599448265 290
677 iso_pu_bacteria 2600255292 2601671446 290
678 iso_pu_bacteria 2643221554 2643790081 290
679 iso_pu_bacteria 2643221556 2643801882 290
680 iso_pu_bacteria 2643221603 2644026094 290
681 iso_pu_bacteria 2643221603 2644028931 290
682 iso_pu_bacteria 2643221603 2644029407 290
683 iso_pu_bacteria 2643221638 2644217103 290
684 iso_pu_bacteria 2643221664 2644359036 290
685 iso_pu_bacteria 2643221684 2644474324 290
686 iso_pu_bacteria 2718217991 2719641920 290
687 iso_pu_bacteria 2738541297 2738826385 290
688 iso_pu_bacteria 2738541357 2739150182 290
689 iso_pu_bacteria 2738543003 2739192101 290
690 iso_pu_bacteria 2738543026 2739318578 290
691 iso_pu_bacteria 2738543029 2739336819 290
692 iso_pu_bacteria 2765235838 2765572014 290
693 iso_pu_bacteria 2818991436 2819545113 290
694 iso_pu_bacteria 2818991445 2819593800 290
695 iso_pu_bacteria 2818991445 2819594517 290
696 iso_pu_bacteria 2821131069 2821134822 290
697 iso_pu_bacteria 2834641062 2834643921 290
698 iso_pu_bacteria 2839094727 2839094955 290
699 iso_pu_bacteria 2842324504 2842329097 290
700 iso_pu_bacteria 2842348783 2842353484 290
701 iso_pu_bacteria 2842454564 2842459007 290
702 iso_pu_bacteria 2842711865 2842716967 290
703 iso_pu_bacteria 2857553236 2857556718 290
704 iso_pu_bacteria 2857558681 2857558939 290
705 iso_pu_bacteria 2857564685 2857567585 290
706 iso_pu_bacteria 2858688981 2858692314 290
707 iso_pu_bacteria 2883087390 2883096101 290
708 iso_pu_bacteria 2884811622 2884814379 290
709 iso_pu_bacteria 2884836552 2884840957 290
710 iso_pu_bacteria 2884852848 2884857447 290
711 iso_pu_bacteria 2885080285 2885082157 290
712 iso_pu_bacteria 2885266251 2885268687 290
713 iso_pu_bacteria 2896154374 2896158387 290
714 iso_pu_bacteria 2919046199 2919051089 290
715 iso_pu_bacteria 2921643360 2921647162 290
716 iso_pu_bacteria 2932410948 2932415959 290
717 iso_pu_bacteria 2932422444 2932424548 290
718 iso_pu_bacteria 8003400568 8003404876 290
719 iso_pu_bacteria 8047673197 8047674476 290
720 iso_pu_bacteria 2508501127 2509141992 291
721 iso_pu_bacteria 2513237165 2514040421 291
722 iso_pu_bacteria 2597489875 2597815961 291
723 iso_pu_bacteria 2599185292 2599903194 291
724 iso_pu_bacteria 2643221569 2643862314 291
725 iso_pu_bacteria 2643221594 2643980660 291
726 iso_pu_bacteria 2643221621 2644122088 291
727 iso_pu_bacteria 2738541337 2739053823 291
728 iso_pu_bacteria 2808606395 2809032023 291
729 iso_pu_bacteria 2841734538 2841734905 291
730 iso_pu_bacteria 2856342000 2856346390 291
731 iso_pu_bacteria 2857537821 2857538502 291
732 iso_pu_bacteria 2857542790 2857546595 291
733 iso_pu_bacteria 2857576091 2857580319 291
734 iso_pu_bacteria 2858950400 2858955774 291
735 iso_pu_bacteria 2871474448 2871476717 291
736 iso_pu_bacteria 2878788777 2878790659 291
737 iso_pu_bacteria 2881927736 2881930262 291
738 iso_pu_bacteria 2885312484 2885315975 291
739 iso_pu_bacteria 2887375801 2887377863 291
740 iso_pu_bacteria 2888343758 2888348926 291
741 iso_pu_bacteria 2924754689 2924759745 291
742 iso_pu_bacteria 2937836603 2937838484 291
743 iso_pu_bacteria 2941479691 2941481898 291
744 iso_pu_bacteria 2958071322 2958074661 291
745 iso_pu_bacteria 2970524798 2970529268 291
746 iso_pu_bacteria 2970540015 2970542256 291
747 iso_pu_bacteria 8004633249 8004634563 291
748 iso_pu_bacteria 8055225921 8055227974 291
749 iso_pu_bacteria 8055617313 8055623228 291
750 iso_pu_bacteria 644736347 644749439 292
751 3300031616 Ga0307508_10122120 Ga0307508_101221202 293
752 3300001915 JGI24741J21665_1000029 JGI24741J21665_10000298 294
753 3300001979 JGI24740J21852_10000130 JGI24740J21852_1000013021 294
754 3300001979 JGI24740J21852_10001393 JGI24740J21852_100013938 294
755 3300002704 JGI25155J39150_1000282 JGI25155J39150_10002822 294
756 3300002705 JGI25156J39149_1000488 JGI25156J39149_100048823 294
757 3300002705 JGI25156J39149_1002325 JGI25156J39149_10023255 294
758 3300002705 JGI25156J39149_1011844 JGI25156J39149_10118442 294
759 3300002737 JGI25162J39368_1003537 JGI25162J39368_10035374 294
760 3300002738 JGI25154J39366_1000266 JGI25154J39366_100026620 294
761 3300002738 JGI25154J39366_1000285 JGI25154J39366_100028520 294
762 3300002738 JGI25154J39366_1000395 JGI25154J39366_100039523 294
763 3300002741 JGI25157J39369_1000354 JGI25157J39369_100035417 294
764 3300002771 JGI25163J39215_1002546 JGI25163J39215_10025461 294
765 3300002772 JGI25164J39214_1001529 JGI25164J39214_10015292 294
766 3300003214 JGI25165J46597_1000045 JGI25165J46597_1000045167 294
767 3300003751 Ga0055538_1000022 Ga0055538_1000022167 294
768 3300003752 Ga0055539_1000028 Ga0055539_1000028167 294
769 3300003752 Ga0055539_1000236 Ga0055539_100023620 294
770 3300003756 Ga0055533_1000036 Ga0055533_1000036167 294
771 3300003756 Ga0055533_1001141 Ga0055533_10011416 294
772 3300003758 Ga0055532_1000143 Ga0055532_100014331 294
773 3300003758 Ga0055532_1000149 Ga0055532_100014947 294
774 3300003759 Ga0055525_1000191 Ga0055525_10001919 294
775 3300003759 Ga0055525_1000450 Ga0055525_100045019 294
776 3300003761 Ga0055535_1000180 Ga0055535_100018024 294
777 3300003761 Ga0055535_1008266 Ga0055535_10082662 294
778 3300003762 Ga0055542_1000489 Ga0055542_100048923 294
779 3300003763 Ga0055529_1000245 Ga0055529_100024524 294
780 3300003771 Ga0055526_1001838 Ga0055526_10018389 294
781 3300003773 Ga0055537_1000005 Ga0055537_100000512 294
782 3300003784 Ga0055534_1000366 Ga0055534_100036611 294
783 3300003790 Ga0055528_1000063 Ga0055528_100006312 294
784 3300003841 Ga0055541_1000094 Ga0055541_10000949 294
785 3300003841 Ga0055541_1000766 Ga0055541_10007667 294
786 3300005293 Ga0065715_10006400 Ga0065715_100064003 294
787 3300005331 Ga0070670_100012755 Ga0070670_1000127552 294
788 3300005344 Ga0070661_100000048 Ga0070661_10000004860 294
789 3300005455 Ga0070663_100000001 Ga0070663_10000000146 294
790 3300005535 Ga0070684_100229677 Ga0070684_1002296772 294
791 3300005548 Ga0070665_100116857 Ga0070665_1001168572 294
792 3300005563 Ga0068855_100290961 Ga0068855_1002909611 294
793 3300005564 Ga0070664_100000016 Ga0070664_10000001649 294
794 3300005614 Ga0068856_100000047 Ga0068856_10000004720 294
795 3300005616 Ga0068852_100164612 Ga0068852_1001646122 294
796 3300006847 Ga0075431_100004543 Ga0075431_1000045435 294
797 3300009093 Ga0105240_10005916 Ga0105240_100059162 294
798 3300009093 Ga0105240_10007519 Ga0105240_100075192 294
799 3300009093 Ga0105240_10125609 Ga0105240_101256092 294
800 3300009147 Ga0114129_10017494 Ga0114129_100174945 294
801 3300009545 Ga0105237_10325072 Ga0105237_103250722 294
802 3300009993 Ga0105028_100512 Ga0105028_1005122 294
803 3300010375 Ga0105239_10620176 Ga0105239_106201762 294
804 3300013102 Ga0157371_10000080 Ga0157371_10000080129 294
805 3300013104 Ga0157370_10000032 Ga0157370_1000003222 294
806 3300013105 Ga0157369_10004526 Ga0157369_1000452618 294
807 3300013307 Ga0157372_10001481 Ga0157372_100014816 294
808 3300014497 Ga0182008_10058013 Ga0182008_100580132 294
809 3300015261 Ga0182006_1002574 Ga0182006_10025748 294
810 3300015261 Ga0182006_1021193 Ga0182006_10211932 294
811 3300015262 Ga0182007_10001316 Ga0182007_1000131614 294
812 3300015265 Ga0182005_1000006 Ga0182005_1000006187 294
813 3300015265 Ga0182005_1011436 Ga0182005_10114362 294
814 3300017792 Ga0163161_10103463 Ga0163161_101034632 294
815 3300021361 Ga0213872_10000022 Ga0213872_1000002296 294
816 3300021361 Ga0213872_10001440 Ga0213872_1000144016 294
817 3300021361 Ga0213872_10002016 Ga0213872_100020168 294
818 3300025206 Ga0209435_100053 Ga0209435_10005359 294
819 3300025207 Ga0209760_101944 Ga0209760_1019442 294
820 3300025224 Ga0209784_100006 Ga0209784_100006258 294
821 3300025224 Ga0209784_100036 Ga0209784_10003671 294
822 3300025224 Ga0209784_100472 Ga0209784_1004725 294
823 3300025225 Ga0209566_100002 Ga0209566_100002258 294
824 3300025225 Ga0209566_100044 Ga0209566_10004471 294
825 3300025225 Ga0209566_100303 Ga0209566_10030324 294
826 3300025225 Ga0209566_101736 Ga0209566_1017362 294
827 3300025226 Ga0209674_100010 Ga0209674_100010879 294
828 3300025226 Ga0209674_100065 Ga0209674_10006571 294
829 3300025226 Ga0209674_100176 Ga0209674_1001764 294
830 3300025226 Ga0209674_100206 Ga0209674_10020626 294
831 3300025228 Ga0209672_101382 Ga0209672_1013825 294
832 3300025229 Ga0209147_100018 Ga0209147_100018248 294
833 3300025229 Ga0209147_100060 Ga0209147_10006027 294
834 3300025230 Ga0209563_100041 Ga0209563_100041214 294
835 3300025230 Ga0209563_100063 Ga0209563_10006371 294
836 3300025230 Ga0209563_102556 Ga0209563_1025566 294
837 3300025231 Ga0207427_100798 Ga0207427_1007986 294
838 3300025233 Ga0209437_100082 Ga0209437_10008271 294
839 3300025233 Ga0209437_100311 Ga0209437_10031116 294
840 3300025233 Ga0209437_106017 Ga0209437_1060172 294
841 3300025242 Ga0209258_100028 Ga0209258_100028248 294
842 3300025242 Ga0209258_100388 Ga0209258_10038822 294
843 3300025246 Ga0209646_1000042 Ga0209646_1000042219 294
844 3300025246 Ga0209646_1000043 Ga0209646_1000043262 294
845 3300025246 Ga0209646_1000101 Ga0209646_100010117 294
846 3300025246 Ga0209646_1000164 Ga0209646_100016417 294
847 3300025250 Ga0209026_1000167 Ga0209026_100016717 294
848 3300025250 Ga0209026_1003296 Ga0209026_10032962 294
849 3300025250 Ga0209026_1008097 Ga0209026_10080972 294
850 3300025250 Ga0209026_1011247 Ga0209026_10112471 294
851 3300025253 Ga0209677_100007 Ga0209677_100007258 294
852 3300025253 Ga0209677_100038 Ga0209677_10003871 294
853 3300025253 Ga0209677_104182 Ga0209677_1041824 294
854 3300025254 Ga0209148_1000348 Ga0209148_100034827 294
855 3300025256 Ga0209759_1000360 Ga0209759_100036018 294
856 3300025256 Ga0209759_1000996 Ga0209759_10009962 294
857 3300025256 Ga0209759_1005535 Ga0209759_10055354 294
858 3300025261 Ga0209233_1000109 Ga0209233_100010971 294
859 3300025263 Ga0209565_1000074 Ga0209565_1000074144 294
860 3300025263 Ga0209565_1005715 Ga0209565_10057152 294
861 3300025272 Ga0209455_1000065 Ga0209455_1000065248 294
862 3300025272 Ga0209455_1001145 Ga0209455_10011452 294
863 3300025273 Ga0209673_1000129 Ga0209673_100012917 294
864 3300025291 Ga0209675_1000072 Ga0209675_100007217 294
865 3300025291 Ga0209675_1010475 Ga0209675_10104752 294
866 3300025294 Ga0209025_1018519 Ga0209025_10185193 294
867 3300025295 Ga0209564_1000010 Ga0209564_1000010383 294
868 3300025295 Ga0209564_1000160 Ga0209564_100016016 294
869 3300025299 Ga0209256_1000125 Ga0209256_100012517 294
870 3300025299 Ga0209256_1001148 Ga0209256_100114813 294
871 3300025299 Ga0209256_1010465 Ga0209256_10104653 294
872 3300025303 Ga0209051_1004988 Ga0209051_10049882 294
873 3300025913 Ga0207695_10004867 Ga0207695_100048672 294
874 3300025913 Ga0207695_10008068 Ga0207695_100080682 294
875 3300025913 Ga0207695_10008879 Ga0207695_1000887911 294
876 3300025914 Ga0207671_10375082 Ga0207671_103750821 294
877 3300025920 Ga0207649_10000200 Ga0207649_100002005 294
878 3300025925 Ga0207650_10032348 Ga0207650_100323484 294
879 3300025945 Ga0207679_10000012 Ga0207679_10000012255 294
880 3300025945 Ga0207679_10022486 Ga0207679_100224864 294
881 3300025949 Ga0207667_10167032 Ga0207667_101670322 294
882 3300026067 Ga0207678_10000028 Ga0207678_1000002846 294
883 3300026078 Ga0207702_10000255 Ga0207702_1000025546 294
884 3300026116 Ga0207674_10060104 Ga0207674_100601042 294
885 3300026116 Ga0207674_10070925 Ga0207674_100709253 294
886 3300026142 Ga0207698_10003628 Ga0207698_100036285 294
887 3300026142 Ga0207698_10428526 Ga0207698_104285261 294
888 3300027695 Ga0209966_1019186 Ga0209966_10191861 294
889 3300031239 Ga0265328_10046110 Ga0265328_100461102 294
890 3300031250 Ga0265331_10018875 Ga0265331_100188753 294
891 3300031251 Ga0265327_10000266 Ga0265327_1000026632 294
892 3300035692 Ga0373935_0278999 Ga0373935_0278999_56_943 294
893 3300037312 Ga0395899_0038326 Ga0395899_0038326_1182_2066 294
894 3300037312 Ga0395899_0284330 Ga0395899_0284330_122_1006 294
895 3300037312 Ga0395899_0377942 Ga0395899_0377942_34_918 294
896 3300037418 Ga0395900_0010859 Ga0395900_0010859_7377_8261 294
897 3300037418 Ga0395900_0032314 Ga0395900_0032314_2769_3653 294
898 3300037418 Ga0395900_0153903 Ga0395900_0153903_389_1273 294
899 3300037466 Ga0395898_0012459 Ga0395898_0012459_4785_5669 294
900 3300037471 Ga0395905_0009071 Ga0395905_0009071_3975_4859 294
901 3300037471 Ga0395905_0010644 Ga0395905_0010644_7617_8501 294
902 3300037471 Ga0395905_0014269 Ga0395905_0014269_6207_7091 294
903 3300037471 Ga0395905_0345567 Ga0395905_0345567_429_1313 294
904 3300038443 Ga0395901_0000122 Ga0395901_0000122_7637_8521 294
905 3300038443 Ga0395901_0132106 Ga0395901_0132106_540_1424 294
906 3300038443 Ga0395901_0133256 Ga0395901_0133256_434_1318 294
907 3300038443 Ga0395901_0157250 Ga0395901_0157250_436_1320 294
908 3300039447 Ga0436361_0360734 Ga0436361_0360734_213_1100 294
909 3300039447 Ga0436361_0526987 Ga0436361_0526987_1088_1972 294
910 3300039447 Ga0436361_0675000 Ga0436361_0675000_51151_52038 294
911 3300039447 Ga0436361_1070817 Ga0436361_1070817_14391_15278 294
912 3300042120 Ga0450917_000327 Ga0450917_000327_330_1232 294
913 3300042126 Ga0450888_000542 Ga0450888_000542_1607_2509 294
914 3300042127 Ga0450890_002604 Ga0450890_002604_562_1464 294
915 3300042129 Ga0450891_000499 Ga0450891_000499_823_1725 294
916 3300042130 Ga0450892_000826 Ga0450892_000826_1949_2851 294
917 3300042532 Ga0450893_0000157 Ga0450893_0000157_7108_8010 294
918 3300042876 Ga0451577_0010055 Ga0451577_0010055_504_1391 294
919 3300044658 Ga0466972_0000084 Ga0466972_0000084_80180_81064 294
920 3300044673 Ga0453683_0008084 Ga0453683_0008084_238_1125 294
921 3300044673 Ga0453683_0062882 Ga0453683_0062882_704_1591 294
922 3300044693 Ga0466961_0000722 Ga0466961_0000722_791_1675 294
923 3300044706 Ga0466964_0011530 Ga0466964_0011530_761_1645 294
924 3300044712 Ga0453684_0000280 Ga0453684_0000280_32719_33606 294
925 3300044712 Ga0453684_0030004 Ga0453684_0030004_319_1206 294
926 3300044842 Ga0466957_0031011 Ga0466957_0031011_1934_2818 294
927 3300044901 Ga0466960_0067011 Ga0466960_0067011_590_1474 294
928 3300045049 Ga0466959_0001982 Ga0466959_0001982_1510_2394 294
929 3300045051 Ga0451576_0003797 Ga0451576_0003797_12588_13475 294
930 3300045051 Ga0451576_0103469 Ga0451576_0103469_1702_2589 294
931 3300045976 Ga0466967_0060490 Ga0466967_0060490_410_1294 294
932 3300046453 Ga0495627_004991 Ga0495627_004991_3782_4666 294
933 3300046457 Ga0495590_0000012 Ga0495590_0000012_115984_116868 294
934 3300046460 Ga0495638_0000047 Ga0495638_0000047_202898_203782 294
935 3300046462 Ga0495651_0025836 Ga0495651_0025836_1533_2417 294
936 3300046463 Ga0495653_0018694 Ga0495653_0018694_420_1304 294
937 3300046471 Ga0495650_0000265 Ga0495650_0000265_40479_41369 294
938 3300046471 Ga0495650_0039394 Ga0495650_0039394_728_1612 294
939 3300046475 Ga0495639_0030029 Ga0495639_0030029_1195_2079 294
940 3300046491 Ga0495584_0000004 Ga0495584_0000004_202115_202999 294
941 3300046491 Ga0495584_0000760 Ga0495584_0000760_5053_5937 294
942 3300046491 Ga0495584_0003737 Ga0495584_0003737_7208_8092 294
943 3300046492 Ga0495585_0000053 Ga0495585_0000053_14988_15872 294
944 3300046492 Ga0495585_0001162 Ga0495585_0001162_15436_16320 294
945 3300046492 Ga0495585_0005092 Ga0495585_0005092_37_921 294
946 3300046500 Ga0495596_0000381 Ga0495596_0000381_22319_23203 294
947 3300046501 Ga0495607_0000757 Ga0495607_0000757_4004_4891 294
948 3300046501 Ga0495607_0001821 Ga0495607_0001821_5769_6653 294
949 3300046501 Ga0495607_0047120 Ga0495607_0047120_1454_2338 294
950 3300046506 Ga0495583_0000092 Ga0495583_0000092_9840_10724 294
951 3300046506 Ga0495583_0000223 Ga0495583_0000223_53015_53905 294
952 3300046506 Ga0495583_0001001 Ga0495583_0001001_10393_11364 294
953 3300046506 Ga0495583_0001420 Ga0495583_0001420_12607_13491 294
954 3300046506 Ga0495583_0031281 Ga0495583_0031281_876_1847 294
955 3300046506 Ga0495583_0053784 Ga0495583_0053784_611_1585 294
956 3300046507 Ga0495606_0000423 Ga0495606_0000423_53884_54774 294
957 3300046507 Ga0495606_0000623 Ga0495606_0000623_45133_46017 294
958 3300046507 Ga0495606_0156365 Ga0495606_0156365_389_1273 294
959 3300046511 Ga0495608_0015265 Ga0495608_0015265_1767_2651 294
960 3300046515 Ga0495620_0035220 Ga0495620_0035220_908_1792 294
961 3300046518 Ga0495631_0013222 Ga0495631_0013222_1673_2644 294
962 3300046518 Ga0495631_0116364 Ga0495631_0116364_187_1071 294
963 3300046519 Ga0495632_0000012 Ga0495632_0000012_248619_249503 294
964 3300046522 Ga0495643_0000388 Ga0495643_0000388_12842_13726 294
965 3300046522 Ga0495643_0077599 Ga0495643_0077599_785_1669 294
966 3300046524 Ga0495648_0000019 Ga0495648_0000019_261058_261942 294
967 3300046528 Ga0495642_0004550 Ga0495642_0004550_710_1594 294
968 3300046529 Ga0495652_0272077 Ga0495652_0272077_260_1144 294
969 3300046538 Ga0495609_0015624 Ga0495609_0015624_2188_3072 294
970 3300046542 Ga0495597_0000075 Ga0495597_0000075_6502_7386 294
971 3300046542 Ga0495597_0006853 Ga0495597_0006853_1006_1890 294
972 3300046557 Ga0495622_0000019 Ga0495622_0000019_15948_16838 294
973 3300046557 Ga0495622_0000037 Ga0495622_0000037_15112_15996 294
974 3300046558 Ga0495633_0000221 Ga0495633_0000221_53099_53983 294
975 3300046558 Ga0495633_0001978 Ga0495633_0001978_11139_12023 294
976 3300046558 Ga0495633_0055814 Ga0495633_0055814_894_1778 294
977 3300046615 Ga0495656_0007689 Ga0495656_0007689_540_1424 294
978 3300046615 Ga0495656_0015490 Ga0495656_0015490_1772_2656 294
979 3300046616 Ga0495668_0000961 Ga0495668_0000961_12180_13064 294
980 3300046616 Ga0495668_0008616 Ga0495668_0008616_4564_5448 294
981 3300046648 Ga0495611_0011965 Ga0495611_0011965_1653_2537 294
982 3300046660 Ga0495625_0000432 Ga0495625_0000432_53200_54084 294
983 3300046660 Ga0495625_0000938 Ga0495625_0000938_610_1494 294
984 3300046665 Ga0495661_0002859 Ga0495661_0002859_2110_2994 294
985 3300046665 Ga0495661_0010773 Ga0495661_0010773_2747_3631 294
986 3300046665 Ga0495661_0047710 Ga0495661_0047710_79_963 294
987 3300046665 Ga0495661_0065158 Ga0495661_0065158_711_1595 294
988 3300046679 Ga0495623_0014303 Ga0495623_0014303_1640_2524 294
989 3300046684 Ga0495669_0001172 Ga0495669_0001172_4836_5720 294
990 3300046691 Ga0495670_0000278 Ga0495670_0000278_10202_11086 294
991 3300046810 Ga0495660_0000526 Ga0495660_0000526_26151_27035 294
992 3300046810 Ga0495660_0017629 Ga0495660_0017629_2518_3402 294
993 3300047323 Ga0495683_0000470 Ga0495683_0000470_15526_16410 294
994 3300047443 Ga0495687_008815 Ga0495687_008815_2157_3041 294
995 3300047443 Ga0495687_058616 Ga0495687_058616_613_1497 294
996 3300047470 Ga0495681_0007319 Ga0495681_0007319_4882_5766 294
997 3300047470 Ga0495681_0009577 Ga0495681_0009577_493_1377 294
998 3300047470 Ga0495681_0043304 Ga0495681_0043304_589_1473 294
999 3300047472 Ga0495686_0000519 Ga0495686_0000519_12385_13335 294
1000 3300047472 Ga0495686_0001487 Ga0495686_0001487_7225_8109 294
1001 3300048090 Ga0495615_0000524 Ga0495615_0000524_1045_1929 294
1002 3300048905 Ga0496102_0000024 Ga0496102_0000024_22965_23978 294
1003 3300048905 Ga0496102_0016152 Ga0496102_0016152_353_1324 294
1004 3300048905 Ga0496102_0116297 Ga0496102_0116297_310_1194 294
1005 3300048906 Ga0496103_0012271 Ga0496103_0012271_865_1749 294
1006 3300048906 Ga0496103_0014802 Ga0496103_0014802_2400_3284 294
1007 3300048906 Ga0496103_0076273 Ga0496103_0076273_353_1324 294
1008 3300048906 Ga0496103_0077143 Ga0496103_0077143_1028_2041 294
1009 3300048924 Ga0496121_0136119 Ga0496121_0136119_615_1499 294
1010 3300048925 Ga0496122_0001769 Ga0496122_0001769_15021_15905 294
1011 3300048926 Ga0496123_0001436 Ga0496123_0001436_15115_15999 294
1012 3300048927 Ga0496124_0000046 Ga0496124_0000046_199927_200814 294
1013 3300048927 Ga0496124_0062881 Ga0496124_0062881_1143_2027 294
1014 3300048928 Ga0496125_0012917 Ga0496125_0012917_921_1805 294
1015 3300049459 Ga0495678_000012 Ga0495678_000012_210636_211520 294
1016 3300049459 Ga0495678_026055 Ga0495678_026055_972_1856 294
1017 3300049570 Ga0501033_0004309 Ga0501033_0004309_8667_9554 294
1018 3300049571 Ga0501034_0000106 Ga0501034_0000106_48064_48951 294
1019 3300049571 Ga0501034_0075511 Ga0501034_0075511_772_1659 294
1020 3300049571 Ga0501034_0142188 Ga0501034_0142188_181_1068 294
1021 3300049572 Ga0501036_0000327 Ga0501036_0000327_5807_6694 294
1022 3300049573 Ga0501037_0000730 Ga0501037_0000730_8827_9714 294
1023 3300049574 Ga0501038_0003017 Ga0501038_0003017_67_954 294
1024 3300049579 Ga0501043_0000281 Ga0501043_0000281_31727_32611 294
1025 3300049579 Ga0501043_0000897 Ga0501043_0000897_14913_15800 294
1026 3300049580 Ga0501046_0000099 Ga0501046_0000099_76121_77005 294
1027 3300049581 Ga0501047_0000441 Ga0501047_0000441_12015_12899 294
1028 3300049581 Ga0501047_0003373 Ga0501047_0003373_12578_13465 294
1029 3300049822 Ga0501035_0000973 Ga0501035_0000973_27188_28075 294
1030 3300049822 Ga0501035_0109120 Ga0501035_0109120_1434_2318 294
1031 3300049823 Ga0501044_0000076 Ga0501044_0000076_22933_23820 294
1032 3300049823 Ga0501044_0011179 Ga0501044_0011179_6634_7521 294
1033 3300050507 nmdc:mga05p37_44326_c1 nmdc:mga05p37_44326_c1_4374_5261 294
1034 3300050508 nmdc:mga09592_622_c1 nmdc:mga09592_622_c1_13873_14760 294
1035 3300050510 nmdc:mga06r32_31380_c1 nmdc:mga06r32_31380_c1_58_945 294
1036 3300053161 Ga0500634_0087736 Ga0500634_0087736_159_1043 294
1037 3300059645 Ga0587076_003986 Ga0587076_003986_471_1355 294
1038 3300061719 Ga0466962_0049412 Ga0466962_0049412_612_1496 294
1039 iso_pu_bacteria 2513237083 2513561339 294
1040 iso_pu_bacteria 8003955200 8003958760 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

3

256

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5645 12 285
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5584 9 288
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5512 9 288
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.5373 6 285
4dbl-assembly2.cif.gz_F crystal structure of e159q mutant of btucdf 0.535 8 283
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.906 15 282 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8605 15 282 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8303 17 288 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.819 17 288 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.81 15 281 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A436D355-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9695 11 266 GO:0005886
GO:0006865
GO:0022857
AF-A0A560ASX5-F1-model_v4 Branched-chain amino acid transport system permease protein 0.9668 1 225 GO:0005886
GO:0006865
GO:0022857
AF-A0A5C4JE01-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9653 9 286 GO:0005886
GO:0006865
GO:0022857
AF-A0A231V0U8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.965 1 294 GO:0005886
GO:0006865
GO:0022857
AF-A0A535WP33-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9623 17 286 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
84.51 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map